4NHBA

Crystal structure of a trap periplasmic solute binding protein from desulfovibrio desulfuricans (ddes_1525), target efi-510107, with bound sn-glycerol-3-phosphate
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
303
structure length
294
Chain Sequence
TVIKMAGMKPEGEPETIGMHLFGKYLKELSNGKYEVQVFPNSQLGKEDAYIAATRKGIIQMCATGTQTSALHPAMAMLETPMLFDNLDHARRAMEGKTFDLINEGFTEKSGLRTLNAFPLGFRHFYSKKPMRMRVPNIPLYTNFAKECGISGQPMPFAEVPGALDQGVIDGGDSPLADIVSLKMYEITPEISLSGHILVIHSLYINDKFFKSLPEQDQKWIEEAAKRSADDVWAMVADGDEKAKATILANKGNIHEPSKELHEHLVNAGKRSWKLFYDTVPNAQAILDSADSYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Desulfovibrio desulfuricans subsp. desulfuricans
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter-DctP subunit
total genus 114
structure length 294
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4nhbA00
4P9KA 4PAFA 2XWVA 4PGPA 2XWIA 4PAIA 2XWOA 2ZZWA 2VPOA 4O7MA 4X04A 2WYKA 4P1EA 4PBQA 4PDHA 4OVRA 5CM6A 4N15A 4X8RA 4MMPA 4PETA 2HZKA 4MNPA 3U65A 2CEXA 4NGUA 4MNCA 4MEVA 4NQ8A 4NN3A 4N17A 4NHBA 2XXKA 4DI3D 4NF0A 4XFEA 2V4CA 3FXBA 4N91A 4NX1A 4UABA 4NG7A 4PF8A 5I5PA 2CEYA 4N6DA 5LTCA 4XEQA 4YICA 4P1LA 4OVPA 2XWKA 4PE3A 2ZZXA 5IM2A 4LN5A 4PF6A 4PCDA 4O94A 5IGAA 2HPGA 4N8YA 4N6KA 5IZZA 2HZLA 2ZZVA 4P3LA 4PC9A 4MAGA 4PBHA 4PFIA 4OVQA 4O8MA 3GYYA 4MCOA 4PAKA 4MIJA 4PFBA 3B50A 4OVTA 4MX6A 4XF5A 4P56A 2WX9A 4PGNA 4P8BA 4PDDA 4N8GA 2XA5A 2PFZA 4MHFA 4N4UA 4P47A 2VPNA 4NAPA 4MNIA 4OANA 2PFYA 4DI4B 4YZZA 2WYPA 4OA4A 5I7IA 4PFRA 4OVSA
chains in the Genus database with same CATH superfamily
3H6WA 5AA2A 4JSOA 1FSAA 4LZ8A 1VFEA 4PDHA 1ZTYA 1PBPA 1LBBA 4OWDA 3RNNA 1S50A 4IO7A 4GL8A 1B4HA 1N0TA 4X1DA 5T3JA 4I62A 4G68C 1B5JA 3C36A 1IXIA 4F1YA 2GQ1A 2ZYKA 5JK4A 1POTA 5AA3A 2XXYA 4H67A 4G68B 4ZE8A 4C0RA 3MPLA 4C1UA 4HTGA 4Q0CA 2PX1A 2UVIA 4N6DA 2XX9A 1BLFA 3G3JA 3WAFA 4XEQA 4AS4A 4MLQA 4U23A 3LSFB 4PF6A 4QFOA 4PCDA 3KEIA 4GX6A 5IGAA 3PPNA 5B7DA 4RXLA 2QMWA 2VP1A 2H5YA 5JTYB 3M8UA 4OETA 1IXGA 4PFIA 1P1NA 4O8MA 1NNPA 4U4XA 1B7UA 1BKAA 1B3FA 1YAEA 2DVZA 2F3DA 2G93A 4MX6A 3HN0A 4TOZA 1IITA 1Y1ZA 2HXWA 2RCBA 4F3PA 4OENA 1SW2A 2F3BA 1NNFA 1B3LA 2WEFA 1MH3A 5A5XB 1AIVA 4DCXA 1SI1A 3OSRA 4QFLA 1N3WA 3FGSA 1M5EA 1VDWA 2VOZA 3O29A 4NEDA 2BJIA 3H06B 3TZAA 1B0LA 1MY4A 5K2XA 1MPDA 3FATA 1JVYA 4GWXA 3IOUA 3PPPA 4LVQA 1XHYA 2XX7A 2OLBA 4GWUA 4QF9A 4ZEBA 3FJMA 2F6PA 3TFLA 4GF8A 1JETA 4BDOA 1SVXB 3FXBA 2RINA 1IXCA 3O6IA 1LBCA 5I59B 5H8QB 1CE2A 2FVZA 2H4IA 3M3LA 1NV4A 3TODA 4GWSA 4KQPA 1IMAA 4FBPA 1LAFE 1QGXA 3T9VA 3Q25A 1LGBC 1US4A 5EQ8A 1DCUA 1GV8A 1FPIA 3LSLA 3H4ZA 4PFUA 1CNQA 1QVSA 1NH8A 4GWYA 2F35A 4TLLB 1PB9A 3TCHA 2HAUA 2XD3A 4I40A 4GWWA 1FPFA 1AH5A 3FVGA 5ET5A 2B3BA 2P3VA 3HV1A 1HSLA 3ILUB 3KSJA 4PDDA 3BFUA 4KCDA 3CFZA 3LR1A 4JB7A 3RN8A 4DXUA 4ELOA 4ONYA 1NV6A 2R6GE 4DI4B 2XXVA 3A29A 4NF6B 3SZPA 4ELRA 1BTJA 2QS4A 4PGPA 3BIHA 4XKNA 4IO4A 4FEBA 2Q89A 2VPOA 1ZIUA 1FBCA 2BJJX 4G61A 3R6UA 2HQ0A 4JWXA 3KZGA 3CFLA 4NGUA 2XXKA 4DI3D 2FA7A 2XXWA 3M3FA 2DWHA 4I9DA 3M3KA 3VVEA 4F31B 2E0SA 5I57B 2QMXA 4R2BA 2VT5A 1MQGA 2CZKA 4F22A 3RQTA 1MY1A 3Q29A 3GXAA 1NL5A 1SYIA 1Y3PA 2DE2A 3FJ7A 2XWKA 3FV1A 3D1RA 4BDLA 1FQBA 4XKQA 4F2QA 1SDXA 2XXQA 3HHFA 1RDYA 1URDA 3K2DA 5H8NB 1WDNA 3TAJA 3K6WA 2AL4A 5ELVA 3MAMA 4H5FA 5EQ9A 2X7PA 1ANFA 1RYOA 4H8JA 4HW8A 5LDZA 1ZU0A 3OEKA 3RPLB 1MY3A 1PB7A 4MH5A 3TTNA 1FQEA 3T22A 3UGWA 4P47A 3VXCA 1B40A 5DVJA 1JP4A 3FVOA 3KBZA 3AXFA 3OOAA 2ZNUA 1HSEA 3TQWA 4OA4A 5ET7A 1XT8A 4GIZA 1Y1MA 4RJZA 1UTBB 3ONMA 1B6HA 3PMWA 3LC8A 4OTEA 1B32A 2F78A 5DT6A 1A40A 5J1DA 1URSA 1VE4A 4R9FA 3VLWA 3VFJA 3U65A 1EYIA 2PMSA 4F3GA 1PEBA 4LZ5A 4NN3A 3FASA 3IO6A 1M5DA 1HSJA 2H25A 4GOTA 4H5GA 1MPBA 1I6QA 4ELQA 3I3VA 2DOJA 3TQLA 3QIMA 3FJGA 4MF3A 3EHSA 3O6HA 2B65A 5I5PA 1JEUA 1EU8A 4IGTA 4DXBA 2F97A 2Q8MA 1MY0A 1JW1A 1NV2A 4H65A 1MQDA 3TYHA 3MW0A 2XXUA 4G8NA 1T0KA 4N8YA 2Q9TA 3SEVA 2NUVA 4LATA 1II5A 2VHAA 1K9YA 3SERA 4U1OA 4JXIA 2Y7IA 1N3XA 4H0WA 2X7QA 1B9JA 1MXWA 4OVTA 2Q2CA 3IJOB 3UK4A 1IMCA 3MZBA 1NUYA 4YKPA 2OZZA 4FATA 4MHFA 3G3HA 3D4CA 4XTCQ 5DEXB 2F7CA 4BDMA 1UTHB 3ILTB 3OD7A 3CG1A 2XHDA 4IO3A 3FXQA 4JDFA 1US5A 1USYH 3B6QA 3R7XA 1D9VA 4FEDA 3MP1A 1B51A 1FPEA 1LAGE 4O7MA 2I4CA 5CBRA 5H8QA 5HPQA 5CM6A 4KYEA 1LB8A 1JEVA 3N26A 3K6XA 4N17A 2V3QA 1H43A 1MH4A 1NUWA 3MPKA 1B3GA 4XFEA 4JVIA 3MBPA 2Y5KA 4OEVA 4NG7A 4MFIA 2DYXA 2DWIA 1ZBMA 1OLCA 5LOMA 1Y4TA 5ET8A 4IGRA 3EPEA 4BLAA 4IY5A 2V25A 3RYDA 4WEDA 5I3SA 3RTFB 4MJOA 1M5FA 3RT8A 2UXAA 3JV9A 2DQVA 1B3HA 4U1ZA 1YTVA 4JVDA 3PMVA 4GX4A 2DDKA 3E3KA 3PUWE 4NE4A 5H8FB 3OSQA 1Z7ME 3GYYA 3D4GA 2GRVA 4YMAA 1LCFA 3B50A 2Z22A 2Y7WA 4DIGA 3B6TA 3H03A 2DWJA 2DXRA 3CI8A 3IR1A 3OEMA 1FW0A 1UQWA 4OVJA 4XKRA 2Q2AA 3RPLA 3UA8A 4QFPA 3O6GA 1LAXA 3KSXA 4YB5A 2HCAA 2ZZWA 4LUBA 4R6KA 3HFUA 2Y7KA 1P1WA 3C34A 1FQCA 4GBVA 1FQFA 1D9YA 4KFQA 3BFTA 1Z7NE 5HM4B 5ESYA 2FYIA 2V93A 4GQOA 4RA1A 5CMKA 5I2KB 2HAVA 4N91A 5CMCA 3R26A 4EUOA 1B4ZA 3GBBA 1Y3NA 1FTAA 4O3CA 3Q26A 3PU5A 3MUQA 1H3DA 5LTCA 1N7XA 3HHGA 1S9TA 2WBBA 4AQ4A 2VGQA 2ZYMA 5DYHA 4JWOA 1Q1KA 4MBPA 5CI5A 2OJTA 4N6PA 2L5VA 4ZE9A 2HPGA 5CBSA 1A8EA 5TP9B 3MVWA 5A5LA 2VD3A 3B8BA 1R9QA 2NXOA 1I6AA 3KJTA 1UTHA 2UVHA 4LQ5A 5ICQA 1DOTA 3OXNA 3ZKKA 4F19A 2I58A 3H3GA 4MIJA 5FBPA 3U1OA 4BDQA 4PP0A 4M4GA 3ZSFA 3E79A 5KZTA 4P8BA 3TCFA 5H8HB 4EQ7A 3WAEA 1XVXA 2F6GA 2WBDA 1AWBA 3KN7A 1CB6A 1B58A 1NI9A 4GXSB 3SDFA 2O6AA 1LLSA 3U92A 4Q5TA 5BWJA 2I3WA 4XXUA 2RKMA 4H45A 1ZJLA 5H8SA 3A3CA 4Q8RA 2P2AA 4X04A 3Q28A 1RKMA 3CSGA 5F24A 2XXXA 4NF4A 4X8RA 1SPIA 3W9WA 2DWAA 2Q8JA 1D4NA 3RLFE 3OELA 3DLNA 5H8HA 2E1SA 3OO7A 4NF0A 2V4CA 2ZXTA 3IB1A 3I5OA 4GFRA 3KJ7A 2LAOA 5EHSA 2QVVA 2Y84A 4YICA 2OBGA 4OVPA 4ZEFA 5M2VA 2FNCA 1NV0A 5CC2A 5KDTB 2XXPA 2I48A 2I3VA 3P7IA 4P0GA 3PD8A 5CMBA 1NNTA 4FIMA 5J16A 3A09A 5IZZA 3DELB 5DTBA 2D5WA 2Y7PA 3TPAA 2NOOA 3CFXA 1B7HA 3NOHA 3GZGA 3OMBA 3IOTA 3KBRA 1OMPA 4RPOA 4PFBA 2A5TB 1GGGA 3KC1A 2WX9A 3IAZA 1WODA 4EQ9A 2ONSA 2ZMBA 3PUYE 4NF8A 1MDP1 4OANA 4M1VA 3USDA 3T9UA 1I6BA 1I69A 3E9XA 4F29A 2UYFA 4PAFA 1GVCA 3QUJA 1IMDA 2Z23A 1QKBA 2DVCA 4IB2A 1G0IA 4N15A 1B3EA 3MJNA 2HZKA 1WVJA 1IUDA 3DP4A 4ZEIA 2QVRA 3KC0A 4XKPA 4MEVA 2V84A 4RY1A 4FECA 4GWZA 4LP2B 3PMXA 4DLDA 4I8CA 3JZJA 1FRPA 1JQFA 4HE0A 1B5IA 3TTLA 1ZMGA 1RDZA 5KCJB 1SW4A 2HXRA 1DTZA 2Z8DA 1FTKA 2GHBA 2RF1A 4N13A 3DP8A 3U93A 4F39A 1AMFA 1DBZA 3PUZE 1FBHA 4THIA 4R72A 1P1UA 5AA4B 3Q27A 4L17A 3O2AA 3UN6A 4YKIA 3LUYA 1NMUA 2I6EA 2B3FA 2QJEA 1DPEA 3S9MC 2OK2A 2IEEA 5IKBA 2GHAA 2QSXA 1IZ1A 4PAKA 3PPOA 2RC7A 3KGCA 4KYSA 4DCYA 1IMEA 4Q30B 1TT1A 1Y3QA 2XA5A 2THIA 4KYDA 1B52A 3C4MA 3PUXE 1DMBA 2OWZA 3KFMA 4OFOA 3O97A 3LV0A 1B1HA 2ZYNA 4GVOA 2UVJA 2P1SA 3IJXB 2DSFA 4PBQA 4P1EA 4R74A 4QSEA 2MKZA 1NFTA 3FXRA 5CMMA 4XIGQ 1POY1 1YZ0A 4MMPA 5CRYA 4FJPA 2XD2A 3FD3A 1MG1A 4BDRA 4H8IA 4QBAA 2PVUA 1QULA 3S9NC 5EYGA 1NV7A 3TEPA 4QSDA 1PDAA 5TPAB 5IZ1A 2O84X 5ET6A 4NF6A 1RDXA 1KA1A 2HFBA 3QXMA 2CEYA 1R1NA 1XC1A 4ESWA 4WXJA 3RUMA 4G4PA 1VFDA 2ZZXA 1OIBA 3QMFA 3VE1B 5I56A 4JWYA 4NTLA 4ISUA 5AE4A 3IO4A 5L8DA 2QL3A 1H45A 4GLIA 1M5BA 2VD2A 3KOTA 4ZECA 2PCRA 4DXCA 3HO7A 3K02A 1TXFA 5B70A 4UACA 3FBPA 2PFZA 3N94A 4H1XA 4ZZAA 2G29A 2PFYA 1Y9UA 4GD5A 2AIXA 3TTKA 5H8NA 1A55A 3E78A 3ISPA 3C9HA 4PAIA 3VVDA 2H9BA 1FPGA 3O66A 2XXTA 1FBGA 1EYJA 4PE5B 5JEIA 3A3UA 1LFGA 1MXZA 2V3UA 4C1TA 4H6DA 4MNPA 1KA0A 4K3FA 2DP8A 5EQAA 1LSTA 4E0XA 2PT1A 1JVXA 2PT2A 1SI0A 1YPNA 2F7AA 5I58A 3OO9A 3BIGA 3L6HA 1VSOA 1IMBA 4POXA 1XOCA 2I4BA 2QS2A 3K4UA 5L9OA 4ECFA 1IXHA 4KXPA 4PE3A 5I59A 4IO2A 5I2KA 1B46A 2I0CA 3TELA 4OEUA 4YKKA 3CSBA 2PYYA 3S9LC 1IQ7A 5EHMA 4P3LA 3OENA 1JNFA 3HPIA 5AA2B 2XX8A 4OVQA 5I58B 1SW1A 3VLVA 3OO8A 3C31A 4YB6A 2FIEA 4XF5A 3CVGA 5IZ3B 1UIUA 2NVUB 1FJ9A 2FHYA 4R2FA 1FPDA 2YJPA 4R6YA 3MP6A 5DW8A 3FIRA 3FVKA 2WYPA 4FORA 5I7IA 3RPWA 1LFIA 1MQHA 3DM0A 4HE1A 3PPRA 3EHUA 1FBEA 1ELJA 3F11A 1LB9A 2XWOA 1O64A 4AB6A 3IB0A 5FHOA 1GR2A 2QS1A 2REJA 5L9MA 1ATGA 2XXIA 1VR5A 2B4LA 4GRKA 4OXVA 4QSCA 3PV0E 3CG3A 5AA4A 3CHGA 4PFWA 4QFNA 3T0JA 1NUXA 3S9EA 4PF8A 2QVUA 2QS3A 3IK6B 4EXKA 4GX3A 3QAXA 4OFLA 2FBPA 2O68A 4U21A 4IO5A 3FVNA 1PBQA 1SBPA 2AYSA 3GBAA 4BDNA 3I6VA 4QRZA 3KOSA 3U72A 2GH9A 3PTYA 3G7WA 4F1UA 4MAGA 3SEYA 4NWCA 2UVGA 3IB2A 4YKJA 4MCOA 1A7LA 1LBXA 2Y7RA 1J1NA 4G8MA 1R9LA 1FTMA 1XVYA 4GWOA 4ND9A 3E13X 4Z7EA 2ZNSA 1XI6A 4N8GA 4N4UA 3H6UA 5JTYA 3V5AA 1L5TA 1B2HA 4KPTA 3U8QA 5K2YA 4EF2A 1PC3A 4PFRA 4OVSA 3BKIB 1OLAA 1B1XA 2XWVA 3THIA 2O69A 3IFCA 4F18A 1FCKA 3UORA 4OERA 3SEUA 3FZVA 3MZ9A 1O63A 2R9JA 2CEXA 4RK9A 2ANJA 3FXUA 4NHBA 3T93B 1GTKA 2ALUA 4LQ2A 1QJMA 1YXIA 4FAJA 1QUJA 4DDDA 1FPLA 1OQGA 1EZPA 1OQHA 2P0SA 3RT6B 5BUUA 4NMYA 5F1QA 1QUKA 1LAHE 2F5XA 4ESXA 3N5LA 1NV1A 4DE8A 4O94A 5ITOA 2OCUA 5I57A 2O7UA 3PPQA 2Q88A 3W9VA 3N6TA 4GBWA 4R6HA 5EYHA 3ZKLA 5IAIA 1P1OA 2QRYA 4IO6A 3O28A 4LONB 3C33A 4PQJA 1DSNA 1UTBA 2V3TA 5I2NB 2B4MA 1A54A 1DTGA 1FBPA 1BIYA 4P56A 3EQ1A 3IFAA 4ZEDA 4U22A 2GFEA 1MXXA 5EYFA 2O1LA 5TPAA 1MM6A 5DVIA 4EF1A 3W15C 4MLVA 4P9KA 5TP9A 1EZOA 3MP8A 2Q74A 4AB5A 4NF5B 4OESA 4H46A 3DP6A 3MVZA 2KLFA 3MZ1A 4R75A 1AL3A 3K6VA 3K6UA 3QK6A 1INPA 3LSXA 1NUZA 3TTMA 1FBFA 2H98A 1FTJA 2PBWA 2NWJA 1G0HA 1N76A 4LZ7A 4LA9A 5F7VA 1EH3A 4E0WA 1PB8A 1SW5A 2Z8EA 2F36A 2OX3A 4RK2A 3VLUA 5L9SA 3C32A 3TKDA 4DZ1A 4NF5A 3V89B 3UP9A 4ELPA 5ISUA 4YAHX 3BBRA 2YPNA 3CIJA 3E4RA 4G8HA 3QYTA 5FTIA 1Q9DA 2F7BA 4KHZE 4N81A 3O9PA 2CZIA 3S2VA 1KWHA 1D9QA 2A5SA 2DE4A 1BK4A 1D3KA 3ZS6A 4QFKA 4I3EA 1B5HA 3S4UA 4OMBA 3H6VA 4IR8A 5FTHA 5I56B 1Y4CA 3RTWB 4P0IA 3VDFA 3IORA 3T1BA 3TMGA 4X9TA 2HEUA 1IMFA 3ROJA 3LUZA 4WKMA 1F9BA 1UIVA 2O7IA 3EN3A 3LSWA 3TUSA 3K1NA 2CZHA 1K9ZA 4JVCA 2H99A 3ECRA 2R71A 3V83A 1B05A 1XS5A 2XWIA 5FHNA 1MXYA 1R6ZA 3K00A 3OO6A 1FPBA 2W7YA 3SEXA 1RYXA 4YU0A 2JJKA 4R9GA 4MNCA 4EXLA 3FUZA 1H76A 2OWTA 1YYZA 3K1MA 3MQ9A 2P3NA 1MQJA 1FPJA 2WKYA 4UABA 1FPKA 4U2RA 1EYKA 3UIFA 2ZNTA 4YB7A 1MRPA 4NF4B 2CMOA 1FTOA 4G2ZA 2KQZA 1URGA 3EKIA 5EQ7A 1S7YA 1LEVA 4RPNA 4G77A 3K01A 4R73A 3VXBA 4O3BA 4AS5A 1FJ6A 1M5CA 1USYE 1BP5A 1TWYA 1A8FA 3B6WA 4WEPA 2F34A 1Q35A 2ESNA 2DS9A 3G3FA 3IX1A 2HZLA 1ZLQA 3PGFA 3H6TA 2X26A 4O3AA 1MXUA 1B0HA 1O7TA 3TTRA 1OVBA 3SKPA 3IOVA 4N07A 4O7IA 2O1MA 2REGA 5FHMA 1N04A 4PGNA 4JSDA 2I49A 1LFHA 1IIWA 2I0BA 4NAPA 4Z0IA 4NWDA 1SYHA 2CZLA 2UYEA 4GL0A 3V8XB 3MVXA 4F3SA 3HCQA 2KR0A 1A99A 1NV3A 4KCCA 4X1BA 2R8TA 1NKXA 3G3GA 2A5TA 1QKAA 2O51A 3G3KA 1NH7A 3IL1B 3EHTA 5ITPA 4OVRA 3RGYA 2ONRA 4OZ9A 4IY6A 1MQIA 4ZS9A 3FV2A 1H44A 2RC9A 4F3BA 2RC8A 1YCJA 4QHQA 3SETA 3VV5A 3MWBA 5HBCA 1Y20A 3HSTA 3IOWA 1N84A 4X48A 4HCYA 5KDTA 3MSTA 1FQAA 4QXDA 4OFJA 3C35A 3PUVE 2XXRA 2D3IA 4RYAA 4POWA 4G68A 4P1LA 5TU0A 1FBDA 1NNKA 2D21A 5I84A 1AOVA 1LBYA 1MPCA 5IM2A 1LBWA 1LCTA 5I2NA 3MC2A 2ZYOA 1MXVA 3QUFA 5ICTA 1P99A 1P1QA 4HE2A 3T66A 2ZZVA 4NF8B 4YMBA 4PC9A 1DPPA 5DVFA 4KI0E 1FQDA 1DK4A 3KN3A 3N6UA 3KN8A 4KR5A 4UA8A 3JYRA 3RY3A 3T9XB 4KD5A 2F8DA 5A5XA 5AA1A 2OWSA 3CR9A 2QFLA 4I1DA 3MVYA 5H8FA 4RNSA 5AA2D 4YZZA 3K0VA 3TDJA 1MY2A 1SD3A 1MDQA 4I3YA 1TFDA 4F2OA 3G3IA 2AL5A 2WYKA 1MM7A 3VVFA 3L6GA 1NV5A 2ABHA 2XXHA 2DXYA 2Z8FA 4PETA 2FIXA 3LBSA 3KG2A 4ZEKA 1KZ8A 4NQ8A 3B7DA 3PD9A 2ONKE 4HS7A 4NX1A 1QUIA 3U94A 4HXVA 3ODBA 3SESA 1IEJA 5IZ3A 4OHNA 4OQOA 5KCJA 2YLNA 4OYVA 4EQBA 4F1VA 4LN5A 1TFAA 3EF7A 2QPQA 1SQYA 4PFYA 1B7ZA 4PFTA 1LBZA 3QSLA 4TLMB 3T9HB 3CRBA 4N6KA 1MS7A 3TCGA 1FTLA 3SEWA 2DE3A 4EDPA 4PBHA 4P11A 4HCWA 1ZKBA 2Y5LA 1LBVA 1JW4A 4ZDMA 2HHMA 5DEXA 2RCAA 4TQUQ 4GXAA 4U4SA 3K1PA 4FE8A 4JBZA 2M8CA 3H7MA 1EZ9A 2IA4A 4PTKA 3GLBA 4ZZEA 2VPNA 4MNIA 1N7WA 1OVTA 1JW5A 3T96B 3MYUA 1QW0A
chains in the Genus database with same CATH topology
3SZPA 4H45A 4P9KA 4NAPA 4PAFA 2XWVA 2R8TA 4HE1A 4I3YA 3E78A 1FBEA 3IFCA 4PGPA 3ISPA 1IMDA 4F18A 2XWIA 3BIHA 1VDWA 2Q74A 4PAIA 2XWOA 1FPGA 2ZZWA 2BJIA 1FPEA 2VPOA 3HFUA 4O7MA 4X04A 2WYKA 4P1EA 1FSAA 4PBQA 1FBGA 1EYJA 4H46A 1FBCA 2MKZA 4PDHA 1G0IA 4OVRA 4G61A 5CM6A 5J1DA 5F24A 1NV5A 4GWXA 4GBVA 4N15A 1YZ0A 4X8RA 4MMPA 1SPIA 1FPBA 3W9WA 2HZKA 4MNPA 4PETA 1KA0A 3U65A 1EYIA 2FIXA 1INPA 2CEXA 2JJKA 5ESYA 1NUZA 5EQAA 2QVRA 3KC0A 4MNCA 4NGUA 4QBAA 4MEVA 1KZ8A 4NQ8A 4NN3A 5T3JA 1FBFA 4GWUA 4GWZA 4N17A 4NHBA 2B4LA 2XXKA 4DI3D 2V3QA 1YYZA 1NUWA 5EYGA 1FRPA 1NV7A 4NF0A 3CHGA 2P3NA 4XFEA 2GQ1A 2V4CA 1G0HA 3FXBA 4HCYA 4HE0A 4JVIA 4N91A 1FPJA 4NX1A 5JK4A 4UABA 1YXIA 2Y5KA 1RDZA 3MSTA 1FPKA 4NG7A 5ET6A 5IZ1A 3T0JA 1RDXA 1KA1A 1EYKA 1NUXA 4QXDA 2VT5A 1FPLA 2HXRA 4PF8A 2QVUA 3BIGA 1FTAA 2CZKA 2FVZA 4AS4A 2QVVA 5I5PA 2OX3A 4HXVA 1IMBA 2CEYA 5ET8A 1NV4A 4N6DA 5J16A 5LTCA 2KQZA 5IZ3A 4XEQA 4GX3A 2WBBA 4YICA 2DE2A 1DBZA 2FBPA 3EKIA 5EQ7A 4F1VA 4GWSA 4KXPA 4P1LA 2XWKA 4OVPA 1FBDA 1IMAA 1LEVA 3D1RA 1FBHA 2F5XA 1LBYA 4FBPA 2ZZXA 4PE3A 5IM2A 4LN5A 2Q8MA 1LBWA 3RYDA 1QGXA 1NV2A 5I3SA 4PF6A 2QPQA 1NV0A 5LDZA 1NV1A 4MJOA 4AS5A 1FJ6A 1RDYA 2L5VA 4PCDA 4O94A 1LBZA 1Q9DA 3QMFA 4GX6A 5IGAA 2HPGA 4JVDA 4N81A 4HE2A 5A5LA 4N8YA 2Q9TA 5EQ8A 1DCUA 3PTYA 1FPIA 2CZIA 2DDKA 4GX4A 4N6KA 3B8BA 4PFBA 2HZLA 2ZZVA 3W9VA 5IZZA 2DE3A 4P3LA 4GBWA 1CNQA 4PC9A 5EYHA 1D9QA 4MAGA 4PBHA 4F1UA 4HCWA 2DE4A 1BK4A 4GWYA 4OVQA 4PFIA 4O8MA 1K9YA 2Y5LA 4I3EA 1LBVA 3NOHA 3GYYA 4MCOA 5EQ9A 1LBXA 4PAKA 4IR8A 4F19A 4MIJA 5FBPA 1DK4A 2HHMA 2DVZA 2B4MA 4I40A 2PCRA 3B50A 4GWWA 1FPFA 2F3DA 2FIEA 4O7IA 4MX6A 3KC1A 4OVTA 4XF5A 1FBPA 5IZ3B 3E79A 4P56A 1IMEA 2WX9A 4P8BA 4PGNA 1FJ9A 5ET5A 2P3VA 3IFAA 1IMCA 3FBPA 4PDDA 3RPLB 3T1BA 1XI6A 1NUYA 2FHYA 2XA5A 4N8GA 1IMFA 4X9TA 2PFZA 4MHFA 4N4UA 4P47A 2WBDA 2QFLA 4PTKA 1AWBA 3ROJA 1FPDA 1JP4A 2VPNA 2F3BA 3KBZA 3LUZA 4MNIA 1NV6A 2PFYA 1NI9A 2OWZA 4M1VA 2WEFA 4OANA 4DI4B 5DW8A 3A29A 4YZZA 2KR0A 2WYPA 1NV3A 3MYUA 2CZHA 4OA4A 1K9ZA 3RPLA 4JVCA 5I7IA 4PFRA 5ET7A 3LV0A 4OVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9K A;  4PAF A;  2XWV A;  4PGP A;  2XWI A;  4PAI A;  2XWO A;  2ZZW A;  2VPO A;  4O7M A;  4X04 A;  2WYK A;  4P1E A;  4PBQ A;  4PDH A;  4OVR A;  5CM6 A;  4N15 A;  4X8R A;  4MMP A;  4PET A;  2HZK A;  4MNP A;  3U65 A;  2CEX A;  4NGU A;  4MNC A;  4MEV A;  4NQ8 A;  4NN3 A;  4N17 A;  4NHB A;  2XXK A;  4DI3 D;  4NF0 A;  4XFE A;  2V4C A;  3FXB A;  4N91 A;  4NX1 A;  4UAB A;  4NG7 A;  4PF8 A;  5I5P A;  2CEY A;  4N6D A;  5LTC A;  4XEQ A;  4YIC A;  4P1L A;  4OVP A;  2XWK A;  4PE3 A;  2ZZX A;  5IM2 A;  4LN5 A;  4PF6 A;  4PCD A;  4O94 A;  5IGA A;  2HPG A;  4N8Y A;  4N6K A;  5IZZ A;  2HZL A;  2ZZV A;  4P3L A;  4PC9 A;  4MAG A;  4PBH A;  4PFI A;  4OVQ A;  4O8M A;  3GYY A;  4MCO A;  4PAK A;  4MIJ A;  4PFB A;  3B50 A;  4OVT A;  4MX6 A;  4XF5 A;  4P56 A;  2WX9 A;  4PGN A;  4P8B A;  4PDD A;  4N8G A;  2XA5 A;  2PFZ A;  4MHF A;  4N4U A;  4P47 A;  2VPN A;  4NAP A;  4MNI A;  4OAN A;  2PFY A;  4DI4 B;  4YZZ A;  2WYP A;  4OA4 A;  5I7I A;  4PFR A;  4OVS A; 
#chains in the Genus database with same CATH topology
 3H6W A;  5AA2 A;  4JSO A;  1FSA A;  4LZ8 A;  1VFE A;  4PDH A;  1ZTY A;  1PBP A;  1LBB A;  4OWD A;  3RNN A;  1S50 A;  4IO7 A;  4GL8 A;  1B4H A;  1N0T A;  4X1D A;  5T3J A;  4I62 A;  4G68 C;  1B5J A;  3C36 A;  1IXI A;  4F1Y A;  2GQ1 A;  2ZYK A;  5JK4 A;  1POT A;  5AA3 A;  2XXY A;  4H67 A;  4G68 B;  4ZE8 A;  4C0R A;  3MPL A;  4C1U A;  4HTG A;  4Q0C A;  2PX1 A;  2UVI A;  4N6D A;  2XX9 A;  1BLF A;  3G3J A;  3WAF A;  4XEQ A;  4AS4 A;  4MLQ A;  4U23 A;  3LSF B;  4PF6 A;  4QFO A;  4PCD A;  3KEI A;  4GX6 A;  5IGA A;  3PPN A;  5B7D A;  4RXL A;  2QMW A;  2VP1 A;  2H5Y A;  5JTY B;  3M8U A;  4OET A;  1IXG A;  4PFI A;  1P1N A;  4O8M A;  1NNP A;  4U4X A;  1B7U A;  1BKA A;  1B3F A;  1YAE A;  2DVZ A;  2F3D A;  2G93 A;  4MX6 A;  3HN0 A;  4TOZ A;  1IIT A;  1Y1Z A;  2HXW A;  2RCB A;  4F3P A;  4OEN A;  1SW2 A;  2F3B A;  1NNF A;  1B3L A;  2WEF A;  1MH3 A;  5A5X B;  1AIV A;  4DCX A;  1SI1 A;  3OSR A;  4QFL A;  1N3W A;  3FGS A;  1M5E A;  1VDW A;  2VOZ A;  3O29 A;  4NED A;  2BJI A;  3H06 B;  3TZA A;  1B0L A;  1MY4 A;  5K2X A;  1MPD A;  3FAT A;  1JVY A;  4GWX A;  3IOU A;  3PPP A;  4LVQ A;  1XHY A;  2XX7 A;  2OLB A;  4GWU A;  4QF9 A;  4ZEB A;  3FJM A;  2F6P A;  3TFL A;  4GF8 A;  1JET A;  4BDO A;  1SVX B;  3FXB A;  2RIN A;  1IXC A;  3O6I A;  1LBC A;  5I59 B;  5H8Q B;  1CE2 A;  2FVZ A;  2H4I A;  3M3L A;  1NV4 A;  3TOD A;  4GWS A;  4KQP A;  1IMA A;  4FBP A;  1LAF E;  1QGX A;  3T9V A;  3Q25 A;  1LGB C;  1US4 A;  5EQ8 A;  1DCU A;  1GV8 A;  1FPI A;  3LSL A;  3H4Z A;  4PFU A;  1CNQ A;  1QVS A;  1NH8 A;  4GWY A;  2F35 A;  4TLL B;  1PB9 A;  3TCH A;  2HAU A;  2XD3 A;  4I40 A;  4GWW A;  1FPF A;  1AH5 A;  3FVG A;  5ET5 A;  2B3B A;  2P3V A;  3HV1 A;  1HSL A;  3ILU B;  3KSJ A;  4PDD A;  3BFU A;  4KCD A;  3CFZ A;  3LR1 A;  4JB7 A;  3RN8 A;  4DXU A;  4ELO A;  4ONY A;  1NV6 A;  2R6G E;  4DI4 B;  2XXV A;  3A29 A;  4NF6 B;  3SZP A;  4ELR A;  1BTJ A;  2QS4 A;  4PGP A;  3BIH A;  4XKN A;  4IO4 A;  4FEB A;  2Q89 A;  2VPO A;  1ZIU A;  1FBC A;  2BJJ X;  4G61 A;  3R6U A;  2HQ0 A;  4JWX A;  3KZG A;  3CFL A;  4NGU A;  2XXK A;  4DI3 D;  2FA7 A;  2XXW A;  3M3F A;  2DWH A;  4I9D A;  3M3K A;  3VVE A;  4F31 B;  2E0S A;  5I57 B;  2QMX A;  4R2B A;  2VT5 A;  1MQG A;  2CZK A;  4F22 A;  3RQT A;  1MY1 A;  3Q29 A;  3GXA A;  1NL5 A;  1SYI A;  1Y3P A;  2DE2 A;  3FJ7 A;  2XWK A;  3FV1 A;  3D1R A;  4BDL A;  1FQB A;  4XKQ A;  4F2Q A;  1SDX A;  2XXQ A;  3HHF A;  1RDY A;  1URD A;  3K2D A;  5H8N B;  1WDN A;  3TAJ A;  3K6W A;  2AL4 A;  5ELV A;  3MAM A;  4H5F A;  5EQ9 A;  2X7P A;  1ANF A;  1RYO A;  4H8J A;  4HW8 A;  5LDZ A;  1ZU0 A;  3OEK A;  3RPL B;  1MY3 A;  1PB7 A;  4MH5 A;  3TTN A;  1FQE A;  3T22 A;  3UGW A;  4P47 A;  3VXC A;  1B40 A;  5DVJ A;  1JP4 A;  3FVO A;  3KBZ A;  3AXF A;  3OOA A;  2ZNU A;  1HSE A;  3TQW A;  4OA4 A;  5ET7 A;  1XT8 A;  4GIZ A;  1Y1M A;  4RJZ A;  1UTB B;  3ONM A;  1B6H A;  3PMW A;  3LC8 A;  4OTE A;  1B32 A;  2F78 A;  5DT6 A;  1A40 A;  5J1D A;  1URS A;  1VE4 A;  4R9F A;  3VLW A;  3VFJ A;  3U65 A;  1EYI A;  2PMS A;  4F3G A;  1PEB A;  4LZ5 A;  4NN3 A;  3FAS A;  3IO6 A;  1M5D A;  1HSJ A;  2H25 A;  4GOT A;  4H5G A;  1MPB A;  1I6Q A;  4ELQ A;  3I3V A;  2DOJ A;  3TQL A;  3QIM A;  3FJG A;  4MF3 A;  3EHS A;  3O6H A;  2B65 A;  5I5P A;  1JEU A;  1EU8 A;  4IGT A;  4DXB A;  2F97 A;  2Q8M A;  1MY0 A;  1JW1 A;  1NV2 A;  4H65 A;  1MQD A;  3TYH A;  3MW0 A;  2XXU A;  4G8N A;  1T0K A;  4N8Y A;  2Q9T A;  3SEV A;  2NUV A;  4LAT A;  1II5 A;  2VHA A;  1K9Y A;  3SER A;  4U1O A;  4JXI A;  2Y7I A;  1N3X A;  4H0W A;  2X7Q A;  1B9J A;  1MXW A;  4OVT A;  2Q2C A;  3IJO B;  3UK4 A;  1IMC A;  3MZB A;  1NUY A;  4YKP A;  2OZZ A;  4FAT A;  4MHF A;  3G3H A;  3D4C A;  4XTC Q;  5DEX B;  2F7C A;  4BDM A;  1UTH B;  3ILT B;  3OD7 A;  3CG1 A;  2XHD A;  4IO3 A;  3FXQ A;  4JDF A;  1US5 A;  1USY H;  3B6Q A;  3R7X A;  1D9V A;  4FED A;  3MP1 A;  1B51 A;  1FPE A;  1LAG E;  4O7M A;  2I4C A;  5CBR A;  5H8Q A;  5HPQ A;  5CM6 A;  4KYE A;  1LB8 A;  1JEV A;  3N26 A;  3K6X A;  4N17 A;  2V3Q A;  1H43 A;  1MH4 A;  1NUW A;  3MPK A;  1B3G A;  4XFE A;  4JVI A;  3MBP A;  2Y5K A;  4OEV A;  4NG7 A;  4MFI A;  2DYX A;  2DWI A;  1ZBM A;  1OLC A;  5LOM A;  1Y4T A;  5ET8 A;  4IGR A;  3EPE A;  4BLA A;  4IY5 A;  2V25 A;  3RYD A;  4WED A;  5I3S A;  3RTF B;  4MJO A;  1M5F A;  3RT8 A;  2UXA A;  3JV9 A;  2DQV A;  1B3H A;  4U1Z A;  1YTV A;  4JVD A;  3PMV A;  4GX4 A;  2DDK A;  3E3K A;  3PUW E;  4NE4 A;  5H8F B;  3OSQ A;  1Z7M E;  3GYY A;  3D4G A;  2GRV A;  4YMA A;  1LCF A;  3B50 A;  2Z22 A;  2Y7W A;  4DIG A;  3B6T A;  3H03 A;  2DWJ A;  2DXR A;  3CI8 A;  3IR1 A;  3OEM A;  1FW0 A;  1UQW A;  4OVJ A;  4XKR A;  2Q2A A;  3RPL A;  3UA8 A;  4QFP A;  3O6G A;  1LAX A;  3KSX A;  4YB5 A;  2HCA A;  2ZZW A;  4LUB A;  4R6K A;  3HFU A;  2Y7K A;  1P1W A;  3C34 A;  1FQC A;  4GBV A;  1FQF A;  1D9Y A;  4KFQ A;  3BFT A;  1Z7N E;  5HM4 B;  5ESY A;  2FYI A;  2V93 A;  4GQO A;  4RA1 A;  5CMK A;  5I2K B;  2HAV A;  4N91 A;  5CMC A;  3R26 A;  4EUO A;  1B4Z A;  3GBB A;  1Y3N A;  1FTA A;  4O3C A;  3Q26 A;  3PU5 A;  3MUQ A;  1H3D A;  5LTC A;  1N7X A;  3HHG A;  1S9T A;  2WBB A;  4AQ4 A;  2VGQ A;  2ZYM A;  5DYH A;  4JWO A;  1Q1K A;  4MBP A;  5CI5 A;  2OJT A;  4N6P A;  2L5V A;  4ZE9 A;  2HPG A;  5CBS A;  1A8E A;  5TP9 B;  3MVW A;  5A5L A;  2VD3 A;  3B8B A;  1R9Q A;  2NXO A;  1I6A A;  3KJT A;  1UTH A;  2UVH A;  4LQ5 A;  5ICQ A;  1DOT A;  3OXN A;  3ZKK A;  4F19 A;  2I58 A;  3H3G A;  4MIJ A;  5FBP A;  3U1O A;  4BDQ A;  4PP0 A;  4M4G A;  3ZSF A;  3E79 A;  5KZT A;  4P8B A;  3TCF A;  5H8H B;  4EQ7 A;  3WAE A;  1XVX A;  2F6G A;  2WBD A;  1AWB A;  3KN7 A;  1CB6 A;  1B58 A;  1NI9 A;  4GXS B;  3SDF A;  2O6A A;  1LLS A;  3U92 A;  4Q5T A;  5BWJ A;  2I3W A;  4XXU A;  2RKM A;  4H45 A;  1ZJL A;  5H8S A;  3A3C A;  4Q8R A;  2P2A A;  4X04 A;  3Q28 A;  1RKM A;  3CSG A;  5F24 A;  2XXX A;  4NF4 A;  4X8R A;  1SPI A;  3W9W A;  2DWA A;  2Q8J A;  1D4N A;  3RLF E;  3OEL A;  3DLN A;  5H8H A;  2E1S A;  3OO7 A;  4NF0 A;  2V4C A;  2ZXT A;  3IB1 A;  3I5O A;  4GFR A;  3KJ7 A;  2LAO A;  5EHS A;  2QVV A;  2Y84 A;  4YIC A;  2OBG A;  4OVP A;  4ZEF A;  5M2V A;  2FNC A;  1NV0 A;  5CC2 A;  5KDT B;  2XXP A;  2I48 A;  2I3V A;  3P7I A;  4P0G A;  3PD8 A;  5CMB A;  1NNT A;  4FIM A;  5J16 A;  3A09 A;  5IZZ A;  3DEL B;  5DTB A;  2D5W A;  2Y7P A;  3TPA A;  2NOO A;  3CFX A;  1B7H A;  3NOH A;  3GZG A;  3OMB A;  3IOT A;  3KBR A;  1OMP A;  4RPO A;  4PFB A;  2A5T B;  1GGG A;  3KC1 A;  2WX9 A;  3IAZ A;  1WOD A;  4EQ9 A;  2ONS A;  2ZMB A;  3PUY E;  4NF8 A;  1MDP 1;  4OAN A;  4M1V A;  3USD A;  3T9U A;  1I6B A;  1I69 A;  3E9X A;  4F29 A;  2UYF A;  4PAF A;  1GVC A;  3QUJ A;  1IMD A;  2Z23 A;  1QKB A;  2DVC A;  4IB2 A;  1G0I A;  4N15 A;  1B3E A;  3MJN A;  2HZK A;  1WVJ A;  1IUD A;  3DP4 A;  4ZEI A;  2QVR A;  3KC0 A;  4XKP A;  4MEV A;  2V84 A;  4RY1 A;  4FEC A;  4GWZ A;  4LP2 B;  3PMX A;  4DLD A;  4I8C A;  3JZJ A;  1FRP A;  1JQF A;  4HE0 A;  1B5I A;  3TTL A;  1ZMG A;  1RDZ A;  5KCJ B;  1SW4 A;  2HXR A;  1DTZ A;  2Z8D A;  1FTK A;  2GHB A;  2RF1 A;  4N13 A;  3DP8 A;  3U93 A;  4F39 A;  1AMF A;  1DBZ A;  3PUZ E;  1FBH A;  4THI A;  4R72 A;  1P1U A;  5AA4 B;  3Q27 A;  4L17 A;  3O2A A;  3UN6 A;  4YKI A;  3LUY A;  1NMU A;  2I6E A;  2B3F A;  2QJE A;  1DPE A;  3S9M C;  2OK2 A;  2IEE A;  5IKB A;  2GHA A;  2QSX A;  1IZ1 A;  4PAK A;  3PPO A;  2RC7 A;  3KGC A;  4KYS A;  4DCY A;  1IME A;  4Q30 B;  1TT1 A;  1Y3Q A;  2XA5 A;  2THI A;  4KYD A;  1B52 A;  3C4M A;  3PUX E;  1DMB A;  2OWZ A;  3KFM A;  4OFO A;  3O97 A;  3LV0 A;  1B1H A;  2ZYN A;  4GVO A;  2UVJ A;  2P1S A;  3IJX B;  2DSF A;  4PBQ A;  4P1E A;  4R74 A;  4QSE A;  2MKZ A;  1NFT A;  3FXR A;  5CMM A;  4XIG Q;  1POY 1;  1YZ0 A;  4MMP A;  5CRY A;  4FJP A;  2XD2 A;  3FD3 A;  1MG1 A;  4BDR A;  4H8I A;  4QBA A;  2PVU A;  1QUL A;  3S9N C;  5EYG A;  1NV7 A;  3TEP A;  4QSD A;  1PDA A;  5TPA B;  5IZ1 A;  2O84 X;  5ET6 A;  4NF6 A;  1RDX A;  1KA1 A;  2HFB A;  3QXM A;  2CEY A;  1R1N A;  1XC1 A;  4ESW A;  4WXJ A;  3RUM A;  4G4P A;  1VFD A;  2ZZX A;  1OIB A;  3QMF A;  3VE1 B;  5I56 A;  4JWY A;  4NTL A;  4ISU A;  5AE4 A;  3IO4 A;  5L8D A;  2QL3 A;  1H45 A;  4GLI A;  1M5B A;  2VD2 A;  3KOT A;  4ZEC A;  2PCR A;  4DXC A;  3HO7 A;  3K02 A;  1TXF A;  5B70 A;  4UAC A;  3FBP A;  2PFZ A;  3N94 A;  4H1X A;  4ZZA A;  2G29 A;  2PFY A;  1Y9U A;  4GD5 A;  2AIX A;  3TTK A;  5H8N A;  1A55 A;  3E78 A;  3ISP A;  3C9H A;  4PAI A;  3VVD A;  2H9B A;  1FPG A;  3O66 A;  2XXT A;  1FBG A;  1EYJ A;  4PE5 B;  5JEI A;  3A3U A;  1LFG A;  1MXZ A;  2V3U A;  4C1T A;  4H6D A;  4MNP A;  1KA0 A;  4K3F A;  2DP8 A;  5EQA A;  1LST A;  4E0X A;  2PT1 A;  1JVX A;  2PT2 A;  1SI0 A;  1YPN A;  2F7A A;  5I58 A;  3OO9 A;  3BIG A;  3L6H A;  1VSO A;  1IMB A;  4POX A;  1XOC A;  2I4B A;  2QS2 A;  3K4U A;  5L9O A;  4ECF A;  1IXH A;  4KXP A;  4PE3 A;  5I59 A;  4IO2 A;  5I2K A;  1B46 A;  2I0C A;  3TEL A;  4OEU A;  4YKK A;  3CSB A;  2PYY A;  3S9L C;  1IQ7 A;  5EHM A;  4P3L A;  3OEN A;  1JNF A;  3HPI A;  5AA2 B;  2XX8 A;  4OVQ A;  5I58 B;  1SW1 A;  3VLV A;  3OO8 A;  3C31 A;  4YB6 A;  2FIE A;  4XF5 A;  3CVG A;  5IZ3 B;  1UIU A;  2NVU B;  1FJ9 A;  2FHY A;  4R2F A;  1FPD A;  2YJP A;  4R6Y A;  3MP6 A;  5DW8 A;  3FIR A;  3FVK A;  2WYP A;  4FOR A;  5I7I A;  3RPW A;  1LFI A;  1MQH A;  3DM0 A;  4HE1 A;  3PPR A;  3EHU A;  1FBE A;  1ELJ A;  3F11 A;  1LB9 A;  2XWO A;  1O64 A;  4AB6 A;  3IB0 A;  5FHO A;  1GR2 A;  2QS1 A;  2REJ A;  5L9M A;  1ATG A;  2XXI A;  1VR5 A;  2B4L A;  4GRK A;  4OXV A;  4QSC A;  3PV0 E;  3CG3 A;  5AA4 A;  3CHG A;  4PFW A;  4QFN A;  3T0J A;  1NUX A;  3S9E A;  4PF8 A;  2QVU A;  2QS3 A;  3IK6 B;  4EXK A;  4GX3 A;  3QAX A;  4OFL A;  2FBP A;  2O68 A;  4U21 A;  4IO5 A;  3FVN A;  1PBQ A;  1SBP A;  2AYS A;  3GBA A;  4BDN A;  3I6V A;  4QRZ A;  3KOS A;  3U72 A;  2GH9 A;  3PTY A;  3G7W A;  4F1U A;  4MAG A;  3SEY A;  4NWC A;  2UVG A;  3IB2 A;  4YKJ A;  4MCO A;  1A7L A;  1LBX A;  2Y7R A;  1J1N A;  4G8M A;  1R9L A;  1FTM A;  1XVY A;  4GWO A;  4ND9 A;  3E13 X;  4Z7E A;  2ZNS A;  1XI6 A;  4N8G A;  4N4U A;  3H6U A;  5JTY A;  3V5A A;  1L5T A;  1B2H A;  4KPT A;  3U8Q A;  5K2Y A;  4EF2 A;  1PC3 A;  4PFR A;  4OVS A;  3BKI B;  1OLA A;  1B1X A;  2XWV A;  3THI A;  2O69 A;  3IFC A;  4F18 A;  1FCK A;  3UOR A;  4OER A;  3SEU A;  3FZV A;  3MZ9 A;  1O63 A;  2R9J A;  2CEX A;  4RK9 A;  2ANJ A;  3FXU A;  4NHB A;  3T93 B;  1GTK A;  2ALU A;  4LQ2 A;  1QJM A;  1YXI A;  4FAJ A;  1QUJ A;  4DDD A;  1FPL A;  1OQG A;  1EZP A;  1OQH A;  2P0S A;  3RT6 B;  5BUU A;  4NMY A;  5F1Q A;  1QUK A;  1LAH E;  2F5X A;  4ESX A;  3N5L A;  1NV1 A;  4DE8 A;  4O94 A;  5ITO A;  2OCU A;  5I57 A;  2O7U A;  3PPQ A;  2Q88 A;  3W9V A;  3N6T A;  4GBW A;  4R6H A;  5EYH A;  3ZKL A;  5IAI A;  1P1O A;  2QRY A;  4IO6 A;  3O28 A;  4LON B;  3C33 A;  4PQJ A;  1DSN A;  1UTB A;  2V3T A;  5I2N B;  2B4M A;  1A54 A;  1DTG A;  1FBP A;  1BIY A;  4P56 A;  3EQ1 A;  3IFA A;  4ZED A;  4U22 A;  2GFE A;  1MXX A;  5EYF A;  2O1L A;  5TPA A;  1MM6 A;  5DVI A;  4EF1 A;  3W15 C;  4MLV A;  4P9K A;  5TP9 A;  1EZO A;  3MP8 A;  2Q74 A;  4AB5 A;  4NF5 B;  4OES A;  4H46 A;  3DP6 A;  3MVZ A;  2KLF A;  3MZ1 A;  4R75 A;  1AL3 A;  3K6V A;  3K6U A;  3QK6 A;  1INP A;  3LSX A;  1NUZ A;  3TTM A;  1FBF A;  2H98 A;  1FTJ A;  2PBW A;  2NWJ A;  1G0H A;  1N76 A;  4LZ7 A;  4LA9 A;  5F7V A;  1EH3 A;  4E0W A;  1PB8 A;  1SW5 A;  2Z8E A;  2F36 A;  2OX3 A;  4RK2 A;  3VLU A;  5L9S A;  3C32 A;  3TKD A;  4DZ1 A;  4NF5 A;  3V89 B;  3UP9 A;  4ELP A;  5ISU A;  4YAH X;  3BBR A;  2YPN A;  3CIJ A;  3E4R A;  4G8H A;  3QYT A;  5FTI A;  1Q9D A;  2F7B A;  4KHZ E;  4N81 A;  3O9P A;  2CZI A;  3S2V A;  1KWH A;  1D9Q A;  2A5S A;  2DE4 A;  1BK4 A;  1D3K A;  3ZS6 A;  4QFK A;  4I3E A;  1B5H A;  3S4U A;  4OMB A;  3H6V A;  4IR8 A;  5FTH A;  5I56 B;  1Y4C A;  3RTW B;  4P0I A;  3VDF A;  3IOR A;  3T1B A;  3TMG A;  4X9T A;  2HEU A;  1IMF A;  3ROJ A;  3LUZ A;  4WKM A;  1F9B A;  1UIV A;  2O7I A;  3EN3 A;  3LSW A;  3TUS A;  3K1N A;  2CZH A;  1K9Z A;  4JVC A;  2H99 A;  3ECR A;  2R71 A;  3V83 A;  1B05 A;  1XS5 A;  2XWI A;  5FHN A;  1MXY A;  1R6Z A;  3K00 A;  3OO6 A;  1FPB A;  2W7Y A;  3SEX A;  1RYX A;  4YU0 A;  2JJK A;  4R9G A;  4MNC A;  4EXL A;  3FUZ A;  1H76 A;  2OWT A;  1YYZ A;  3K1M A;  3MQ9 A;  2P3N A;  1MQJ A;  1FPJ A;  2WKY A;  4UAB A;  1FPK A;  4U2R A;  1EYK A;  3UIF A;  2ZNT A;  4YB7 A;  1MRP A;  4NF4 B;  2CMO A;  1FTO A;  4G2Z A;  2KQZ A;  1URG A;  3EKI A;  5EQ7 A;  1S7Y A;  1LEV A;  4RPN A;  4G77 A;  3K01 A;  4R73 A;  3VXB A;  4O3B A;  4AS5 A;  1FJ6 A;  1M5C A;  1USY E;  1BP5 A;  1TWY A;  1A8F A;  3B6W A;  4WEP A;  2F34 A;  1Q35 A;  2ESN A;  2DS9 A;  3G3F A;  3IX1 A;  2HZL A;  1ZLQ A;  3PGF A;  3H6T A;  2X26 A;  4O3A A;  1MXU A;  1B0H A;  1O7T A;  3TTR A;  1OVB A;  3SKP A;  3IOV A;  4N07 A;  4O7I A;  2O1M A;  2REG A;  5FHM A;  1N04 A;  4PGN A;  4JSD A;  2I49 A;  1LFH A;  1IIW A;  2I0B A;  4NAP A;  4Z0I A;  4NWD A;  1SYH A;  2CZL A;  2UYE A;  4GL0 A;  3V8X B;  3MVX A;  4F3S A;  3HCQ A;  2KR0 A;  1A99 A;  1NV3 A;  4KCC A;  4X1B A;  2R8T A;  1NKX A;  3G3G A;  2A5T A;  1QKA A;  2O51 A;  3G3K A;  1NH7 A;  3IL1 B;  3EHT A;  5ITP A;  4OVR A;  3RGY A;  2ONR A;  4OZ9 A;  4IY6 A;  1MQI A;  4ZS9 A;  3FV2 A;  1H44 A;  2RC9 A;  4F3B A;  2RC8 A;  1YCJ A;  4QHQ A;  3SET A;  3VV5 A;  3MWB A;  5HBC A;  1Y20 A;  3HST A;  3IOW A;  1N84 A;  4X48 A;  4HCY A;  5KDT A;  3MST A;  1FQA A;  4QXD A;  4OFJ A;  3C35 A;  3PUV E;  2XXR A;  2D3I A;  4RYA A;  4POW A;  4G68 A;  4P1L A;  5TU0 A;  1FBD A;  1NNK A;  2D21 A;  5I84 A;  1AOV A;  1LBY A;  1MPC A;  5IM2 A;  1LBW A;  1LCT A;  5I2N A;  3MC2 A;  2ZYO A;  1MXV A;  3QUF A;  5ICT A;  1P99 A;  1P1Q A;  4HE2 A;  3T66 A;  2ZZV A;  4NF8 B;  4YMB A;  4PC9 A;  1DPP A;  5DVF A;  4KI0 E;  1FQD A;  1DK4 A;  3KN3 A;  3N6U A;  3KN8 A;  4KR5 A;  4UA8 A;  3JYR A;  3RY3 A;  3T9X B;  4KD5 A;  2F8D A;  5A5X A;  5AA1 A;  2OWS A;  3CR9 A;  2QFL A;  4I1D A;  3MVY A;  5H8F A;  4RNS A;  5AA2 D;  4YZZ A;  3K0V A;  3TDJ A;  1MY2 A;  1SD3 A;  1MDQ A;  4I3Y A;  1TFD A;  4F2O A;  3G3I A;  2AL5 A;  2WYK A;  1MM7 A;  3VVF A;  3L6G A;  1NV5 A;  2ABH A;  2XXH A;  2DXY A;  2Z8F A;  4PET A;  2FIX A;  3LBS A;  3KG2 A;  4ZEK A;  1KZ8 A;  4NQ8 A;  3B7D A;  3PD9 A;  2ONK E;  4HS7 A;  4NX1 A;  1QUI A;  3U94 A;  4HXV A;  3ODB A;  3SES A;  1IEJ A;  5IZ3 A;  4OHN A;  4OQO A;  5KCJ A;  2YLN A;  4OYV A;  4EQB A;  4F1V A;  4LN5 A;  1TFA A;  3EF7 A;  2QPQ A;  1SQY A;  4PFY A;  1B7Z A;  4PFT A;  1LBZ A;  3QSL A;  4TLM B;  3T9H B;  3CRB A;  4N6K A;  1MS7 A;  3TCG A;  1FTL A;  3SEW A;  2DE3 A;  4EDP A;  4PBH A;  4P11 A;  4HCW A;  1ZKB A;  2Y5L A;  1LBV A;  1JW4 A;  4ZDM A;  2HHM A;  5DEX A;  2RCA A;  4TQU Q;  4GXA A;  4U4S A;  3K1P A;  4FE8 A;  4JBZ A;  2M8C A;  3H7M A;  1EZ9 A;  2IA4 A;  4PTK A;  3GLB A;  4ZZE A;  2VPN A;  4MNI A;  1N7W A;  1OVT A;  1JW5 A;  3T96 B;  3MYU A;  1QW0 A; 
#chains in the Genus database with same CATH homology
 3SZP A;  4H45 A;  4P9K A;  4NAP A;  4PAF A;  2XWV A;  2R8T A;  4HE1 A;  4I3Y A;  3E78 A;  1FBE A;  3IFC A;  4PGP A;  3ISP A;  1IMD A;  4F18 A;  2XWI A;  3BIH A;  1VDW A;  2Q74 A;  4PAI A;  2XWO A;  1FPG A;  2ZZW A;  2BJI A;  1FPE A;  2VPO A;  3HFU A;  4O7M A;  4X04 A;  2WYK A;  4P1E A;  1FSA A;  4PBQ A;  1FBG A;  1EYJ A;  4H46 A;  1FBC A;  2MKZ A;  4PDH A;  1G0I A;  4OVR A;  4G61 A;  5CM6 A;  5J1D A;  5F24 A;  1NV5 A;  4GWX A;  4GBV A;  4N15 A;  1YZ0 A;  4X8R A;  4MMP A;  1SPI A;  1FPB A;  3W9W A;  2HZK A;  4MNP A;  4PET A;  1KA0 A;  3U65 A;  1EYI A;  2FIX A;  1INP A;  2CEX A;  2JJK A;  5ESY A;  1NUZ A;  5EQA A;  2QVR A;  3KC0 A;  4MNC A;  4NGU A;  4QBA A;  4MEV A;  1KZ8 A;  4NQ8 A;  4NN3 A;  5T3J A;  1FBF A;  4GWU A;  4GWZ A;  4N17 A;  4NHB A;  2B4L A;  2XXK A;  4DI3 D;  2V3Q A;  1YYZ A;  1NUW A;  5EYG A;  1FRP A;  1NV7 A;  4NF0 A;  3CHG A;  2P3N A;  4XFE A;  2GQ1 A;  2V4C A;  1G0H A;  3FXB A;  4HCY A;  4HE0 A;  4JVI A;  4N91 A;  1FPJ A;  4NX1 A;  5JK4 A;  4UAB A;  1YXI A;  2Y5K A;  1RDZ A;  3MST A;  1FPK A;  4NG7 A;  5ET6 A;  5IZ1 A;  3T0J A;  1RDX A;  1KA1 A;  1EYK A;  1NUX A;  4QXD A;  2VT5 A;  1FPL A;  2HXR A;  4PF8 A;  2QVU A;  3BIG A;  1FTA A;  2CZK A;  2FVZ A;  4AS4 A;  2QVV A;  5I5P A;  2OX3 A;  4HXV A;  1IMB A;  2CEY A;  5ET8 A;  1NV4 A;  4N6D A;  5J16 A;  5LTC A;  2KQZ A;  5IZ3 A;  4XEQ A;  4GX3 A;  2WBB A;  4YIC A;  2DE2 A;  1DBZ A;  2FBP A;  3EKI A;  5EQ7 A;  4F1V A;  4GWS A;  4KXP A;  4P1L A;  2XWK A;  4OVP A;  1FBD A;  1IMA A;  1LEV A;  3D1R A;  1FBH A;  2F5X A;  1LBY A;  4FBP A;  2ZZX A;  4PE3 A;  5IM2 A;  4LN5 A;  2Q8M A;  1LBW A;  3RYD A;  1QGX A;  1NV2 A;  5I3S A;  4PF6 A;  2QPQ A;  1NV0 A;  5LDZ A;  1NV1 A;  4MJO A;  4AS5 A;  1FJ6 A;  1RDY A;  2L5V A;  4PCD A;  4O94 A;  1LBZ A;  1Q9D A;  3QMF A;  4GX6 A;  5IGA A;  2HPG A;  4JVD A;  4N81 A;  4HE2 A;  5A5L A;  4N8Y A;  2Q9T A;  5EQ8 A;  1DCU A;  3PTY A;  1FPI A;  2CZI A;  2DDK A;  4GX4 A;  4N6K A;  3B8B A;  4PFB A;  2HZL A;  2ZZV A;  3W9V A;  5IZZ A;  2DE3 A;  4P3L A;  4GBW A;  1CNQ A;  4PC9 A;  5EYH A;  1D9Q A;  4MAG A;  4PBH A;  4F1U A;  4HCW A;  2DE4 A;  1BK4 A;  4GWY A;  4OVQ A;  4PFI A;  4O8M A;  1K9Y A;  2Y5L A;  4I3E A;  1LBV A;  3NOH A;  3GYY A;  4MCO A;  5EQ9 A;  1LBX A;  4PAK A;  4IR8 A;  4F19 A;  4MIJ A;  5FBP A;  1DK4 A;  2HHM A;  2DVZ A;  2B4M A;  4I40 A;  2PCR A;  3B50 A;  4GWW A;  1FPF A;  2F3D A;  2FIE A;  4O7I A;  4MX6 A;  3KC1 A;  4OVT A;  4XF5 A;  1FBP A;  5IZ3 B;  3E79 A;  4P56 A;  1IME A;  2WX9 A;  4P8B A;  4PGN A;  1FJ9 A;  5ET5 A;  2P3V A;  3IFA A;  1IMC A;  3FBP A;  4PDD A;  3RPL B;  3T1B A;  1XI6 A;  1NUY A;  2FHY A;  2XA5 A;  4N8G A;  1IMF A;  4X9T A;  2PFZ A;  4MHF A;  4N4U A;  4P47 A;  2WBD A;  2QFL A;  4PTK A;  1AWB A;  3ROJ A;  1FPD A;  1JP4 A;  2VPN A;  2F3B A;  3KBZ A;  3LUZ A;  4MNI A;  1NV6 A;  2PFY A;  1NI9 A;  2OWZ A;  4M1V A;  2WEF A;  4OAN A;  4DI4 B;  5DW8 A;  3A29 A;  4YZZ A;  2KR0 A;  2WYP A;  1NV3 A;  3MYU A;  2CZH A;  4OA4 A;  1K9Z A;  3RPL A;  4JVC A;  5I7I A;  4PFR A;  5ET7 A;  3LV0 A;  4OVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...