4NIMA

Crystal structure of a short chain dehydrogenase from brucella melitensis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
240
Chain Sequence
b'GQLKGKIAVITGSTQGLGAATARLFAERGAQGLVICGRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGLTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDRVEGAIVNVSSMSSMGGQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMAFGRLLDPAKVARAIAFLASEESGLMTGAIVNFDQSVWGAYDGSPHPEKPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Versicolorin reductase
publication title Crystal Structure of a Short Chain Dehydrogenase from Brucella melitensis
rcsb
source organism Brucella melitensis
molecule tags Oxidoreductase
total genus 95
structure length 240
sequence length 267
ec nomenclature
pdb deposition date 2013-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nimA00
1NR7A 2P2SA 4AJKA 3W8FA 4R54A 1ENZA 2O7QA 3GZNA 3KVOA 1HDOA 4XR9A 3GVPA 3L4BC 2X58A 4O0LA 1U5CA 3ZHBA 1LLDA 3GVIA 4NJOA 4J1SA 4UUNA 1ONPA 1F12A 1OZAA 1GY8A 2OOSA 2TMDA 4CM5A 2HDHA 2B83A 4D3SA 4IQ0A 4EITA 1F8FA 4TQGA 3WLEA 4DIFA 5MGBA 3AM5A 5COAA 4BB5A 2E48A 2V7PA 4CQLB 4JJFA 2Q4BA 3RU9A 3UCEA 2VOEA 2IXBA 1YL7A 4R1UA 4GVXA 3QWBA 4YWJA 1DPGA 1WMBA 5EPOA 5FEUA 4I9HA 4MKZA 1ISJA 1W4ZA 4J4BA 1MG5A 2EHDA 2LDXA 3GFGA 1PQWA 2RH4A 2WD7A 3QSGA 4YJGA 1ORRA 3RFVA 3NV9A 3VKUA 2DLDA 4GX2A 3WSWA 2C07A 3FTPA 3U4IA 2Y1FA 3B6ZA 1U3VA 3O38A 4PVCA 2B4TO 4RGBA 1N1GA 5L95A 2PR2A 2EGHA 1GZ3A 2ZQZA 4YAJA 5BQFA 2QIOA 1ULSA 1MFPA 5JE8A 2JCYA 1NFFA 5EINA 2IDZA 3JQ7B 4WCFC 4TROA 2X9GA 2GN6A 5A06A 4R01A 4R1SA 3RC2A 4GKBA 3DFUA 4RF2A 4DIOA 4NJMA 3DBVO 4KUEA 5G0TA 3D3WB 2J6IA 3GY0A 1OC4A 4MJLA 2G1UA 2PNFA 4NI5A 1H94A 5T5QA 4BNFA 4ALJA 1X15A 3DTYA 3EW7A 2GN8A 1PZGA 1IYZA 4XX0A 1I32A 4FCCA 5I9LA 2QZ9A 3AWDA 4CLXA 5IAAA 3GH3A 1EUZA 3WYEA 2EV9A 3ICCA 2PGDA 1VLLA 1PS8A 1Q1NA 2D5CA 3AUSA 3U9LA 4G81A 2Y68A 4CR8A 1U4OA 1HT0A 4J7UA 2B5VA 2DFVA 1BVRA 2EKLA 4OOFA 4OSOA 5BNTA 1WP4A 3MJVA 4N7RA 5IDYA 3VDQA 2OBNA 4KQXA 2J3IA 3OEWA 2BHLA 3ZWVA 3L9WA 2EXXA 5KCZA 2UYYA 3WXBA 4AJEA 1GDHA 2NTVA 4NU5A 3O8QB 1H6BA 1NPDA 3KSDO 4FN4A 4EJ0A 4CM9D 2G76A 1BXGB 1MXFA 3OBBA 3ICPA 3JQGB 2YZ7A 3HDJA 4MVJM 5DOVA 1A72A 1XWFA 3Q11A 3VPSA 1KVUA 4CLRB 2AEFA 3LLSA 3PK0A 2OP1A 4CM8A 3AY7A 4XIYA 1TVEA 3C3XA 3TZQA 1XELA 3IDSA 2W2KB 2NQ8A 4HNGA 1JQBA 3GDOA 4WASA 4IDFA 1MFZA 5JY1A 2I3AA 3P19A 3QVTA 3IC5A 4EUHA 2D59A 4RV9A 2AE1A 3GEGA 3G1TA 4CM7A 3PHIA 4B4UA 4DMMA 1V3UA 3VTZA 3QIVA 4XDYA 2PZLA 1P1IA 2BD0A 4AJJA 2DPHA 4JBGA 3GZNB 4MVJA 1LC0A 4BO2A 1R0SA 4CLOA 3E9MA 4E5MA 4MIEA 3W1VA 4CQMA 3D1LA 5KJ1A 4RL6A 1E7WA 2EF1A 4FPXA 4CR7A 3AM3A 1WDKA 4RF3A 5LCXA 4N5MA 1U5AA 5I7EA 2VT3A 5EJ2A 2I99A 1NWCA 4IDAA 3RBVA 4TWRA 2V6GA 1S6YA 2Q49A 3LT1A 2DKNA 5JW6A 2OGUA 2BFAA 5HS6A 4GQAA 4QO7A 5EL0A 3I83A 1AXGA 3KLMX 2EGGA 2OMEA 4RDHA 3ZWPA 3H9GA 1QG6A 3F5QA 4NHEA 3NTQA 4E5YA 2FR1A 4R3WA 1SPXA 3TNLA 4IGFA 2FZWA 3JQAA 4GSLA 1ZJYA 4P4LA 4D44A 1T2AA 2RBEA 2X4GA 1XU7A 5BSFA 1HZZA 1B2LA 2IEBA 4K9DA 4AJIA 4WLEA 3OM9A 5HRUA 2ZIZA 3N74A 1UAYA 4LGVA 4UVGA 4NBUA 1GUFA 2WD7B 1J6UA 4YJGB 2W2LD 5G2OA 4EUFA 3K8ZA 1PWXA 1KEVA 3ZNPA 3QA9A 4UEJA 1U7HA 3DZHA 3NTOA 4NK4A 3PYMA 4CLHA 1X1TA 3MJ4A 4UREA 5TIIA 5B37A 3DC2A 3R1IA 4GX5A 1LDGA 5BSHA 3UCFA 4C7KA 4L75A 1Q7BA 3LF2A 1LTHR 1V3TA 3NUGA 4OQYA 2O23A 3B1FA 3CTMA 4O59O 1SO8A 2PGLA 1BXZA 1M2WA 4NJMB 2A94A 4NNJA 3U62A 4XB2A 3HFGA 3O03A 4S1VA 2I9PA 3KLPX 5L4LA 3PRJA 3BTVA 3CXRA 4J90A 1K6XA 3HDHA 3D64A 1TI7A 4IY1A 3DOOA 1DC6A 3O4RA 4IDDA 3PFFA 3EVTA 3H5AA 4FW8A 4Z3DA 3OQ1A 2I5PO 1W73A 4DC0A 4Z0TA 2QG4A 3ITKA 3OJLA 1ZFNA 1FDWA 5GZ3A 3GRPA 3VVBA 1LBEA 4BNJA 1WLYA 3PHJA 4XRGA 3AU8A 1G1AA 4HFNA 4B7XA 5CP8A 2B69A 3G0OA 4JBIA 3LC1O 4JROA 4TZKA 5JDCA 2JL1A 3R3SA 2BMAA 1MGOA 1PGPA 5G4LA 3QRWA 2DBZA 1NHGA 2AG5A 4BO6A 4INAA 2YHIA 3T4XA 4DGSA 1Y6JA 1ADGA 5IG2A 3ETEA 4G2NA 4II3A 1FDUA 1ZNQO 3QVXA 3DAPA 3VKVA 3UN1A 2Q1UA 1GTMA 3DTTA 4BS9A 1B14A 1DFGA 1C0LA 5FF9A 1P0FA 4NIMA 5MDHA 3TOZA 4CM8B 8ADHA 4FDAA 3MCVA 5L45A 4M89A 4U8GA 1MC4A 2A35A 4Z3KA 2Q1WA 4XYMA 4R9RA 4NZ9A 4Q3BA 3VH4A 1R37A 1E3SA 1NVMB 1GV1A 2X6TA 1YOVA 1E5LA 4GL4A 3ZHYA 2AEMA 1AUPA 3RCBA 1GD1O 1ZSVA 2OO5A 4C4OA 4XQ9A 1U3WA 4EUEA 2GDZA 2VUUA 1X0XA 1NFRA 5GY7A 4I5GA 4CLOB 4KWHA 1EQ2A 1N92A 4BMNA 2PGJA 4CQMB 3WMXA 3DBHA 4ONEA 3QLJA 4AJLA 5C7LO 2BF7A 2Y0CA 4YJHA 2VYVA 3L6DA 2HK7A 3R3JA 3LT2A 4XYGA 1DAOA 1Y5RA 2I65A 3AJRA 3X2EA 5EQFA 2RHRA 2EW8A 1VKOA 3ZHXA 2Y1GA 3B1KA 2YW9A 2Y67A 5A03A 3K31A 2ZYGA 4MIYA 4E21A 3LLVA 1TLTA 3SX2A 5K6AC 3FBTA 4PLTA 3JQAB 4D43A 4CMEC 3WGIA 3OJEA 4ND5A 3RSHA 4BNKA 3UXYA 2OORA 2FSSA 4I5DA 4F3YA 2HU2A 3OIFA 3PP8A 4Z9FA 1L1FA 3WNVA 5THKA 4PLPA 2X22A 1JA9A 3WQRA 4UUMA 2X5KO 2FN7A 4TVBA 3FNEA 3H9EO 1AN9A 1N5DA 5U1PA 3F3SA 4ZHSA 4PLGA 3EZLA 4GAEA 1W0CA 3IOYA 1FDVA 1VL6A 5TT0A 3AFMA 3DOCA 1Y9EA 4E2ZA 3A06A 4NMHA 2NWQA 3TOXA 1ZO8A 2Y05A 4DXHA 5TSDA 1I24A 4U0KA 1BW9A 2W4QA 4CMKA 1Q0HA 3I9OA 1RM0A 1OMOA 1YE3A 1P1FA 3GAFA 2GZ2A 1X14A 4TRRA 2Q1SA 5DBIA 2A9FA 4ND3A 1UP6A 3GG2A 4GWKA 1HDYA 3ADPA 4WUVA 3IUPA 4CMBA 3KYBA 1I36A 3QVSA 3TZ6A 3LZ6A 3TJRA 3FHLA 5IDQA 5F1PA 2PH3A 4ZQHA 2V6FA 2YV1A 3VVCA 4CODB 1XG5A 5CHEA 3OEYA 4HX5A 3ZW8A 4XQEA 2Q2VA 3EMKA 2Q45A 1NVGA 2B4RO 3PVZA 4P4GA 4DQUA 1Q7CA 1PGOA 3HB5X 3IP3A 2EW2A 3UUWA 2BI7A 1ZXLA 8LDHA 2WJPA 1D8AA 3SXPA 2WDZA 1ISGA 2D1YA 4AG3A 4BNWA 3FRJA 4LSWA 3F4LA 2IYPA 2ZATA 3PI7A 1ZJZA 2VZ8A 3BZUA 4LMPA 4PZDA 4B8WA 3E82A 1CWUA 2B36A 1U3UA 3M2PA 2ZTVA 2WD8A 2A92A 5FYDA 4BMSA 1DJNA 2O50A 5DN9A 1KEPA 3ZW9A 1GZ6A 2YHIB 4GGPA 4A73A 4EBFA 4YRDA 1RYEA 1XA0A 3KHUA 3TFQA 3GA0A 5A9RA 1ARZA 5TQVA 3WIDA 2NU6A 4FD3A 5JO0A 5L51A 1VL0A 3OFSA 3PQDA 3WGZA 2P68A 3JYQA 1QLJA 2FZEA 4HFMA 3WJ7A 3ZU5A 3KO8A 1JW9B 4GX0A 4U0JA 1HLPA 3V5NA 2UUOA 3PDJA 5KOIA 4OXYA 4L4SA 4MP6A 4Y8VA 1DRVA 1BDBA 2GERA 1YOVB 1K3TA 2GD1O 2EKQA 2VHWA 3GMDA 4NBTA 3P5SA 3RROA 1HSOA 3CINA 1Y1PA 3DXFA 4WNCA 1B8UA 1U8FO 4CMAA 4YACA 4J0FA 5DCUA 2AA3A 3DBHB 4YJHB 2C5AA 3B70A 1YDWA 1UXGA 2PY6A 3KEQA 3PHLA 2R00C 3KZVA 3PZRA 3TN7A 4L73A 4LN1A 1P1RA 3H2ZA 1W8DA 2NLOA 3X2FA 1BGVA 3LYLA 1JTVA 5L7YA 2JHFA 4BO9A 5IDXA 1GU7A 4R4JA 2E6UX 3NX4A 3VC7A 4OH1A 1UP4A 2VTDA 5G0WA 1UZMA 3AM4A 1DEHA 3I6IA 4R69A 3AOEA 1UAGA 3ZV5A 5IN5A 1HYGA 3AUAA 1KY5A 2V6BA 4WK6A 1PGJA 4GLOA 3DWFA 3HN7A 3I4CA 1ZEJA 2Y0EA 3BMNA 5T8KA 3C24A 3HG7A 4CQLA 2DTXA 1WVGA 2D4AA 3I9MA 3NT5A 2HKIA 5CDSA 1A7KA 2PD4A 4GH5A 4R1TA 4I1IA 4FSHA 3IIEA 3PJDA 1N8KA 3TL2A 1GPJA 1XKQA 1QYCA 4OKIA 2XXJA 4DA9A 1B15A 4IPTA 3ULKA 1PIWA 4E2XA 4JP3A 4D41A 1P77A 4A10A 1BW9B 2OP0A 3ANLA 1F8GA 3L0DA 4RORA 1FJHA 2DC1A 4E31A 5G4KA 5L3ZA 1XDWA 2ZJ1A 3JQ6A 3JYOA 3WBFA 3S2EA 1A27A 3L9XA 4BGUA 2P9GA 4WOKA 1NPTO 2EJWA 4B4WA 1WW8A 4JJGA 1PJBA 4M1QA 1I30A 2H5LA 3QP9A 2ZJ0A 3L77A 3A9WA 2QRKA 2D8AA 4E32A 1HKUA 1Y7TA 1RJWA 5JAIA 3JD4A 4YPOA 1LSOA 2CDBA 3V1UA 3JQCA 1ZSNA 5C7IO 1GADO 3ZZNA 1PS0A 2EP7A 2EWMA 3GUCA 3K30A 2AQ8A 4A27A 4DLBA 1LNQA 1ZK1A 1NP3A 4BV8A 1PL7A 5LDHA 1D1TA 1J5PA 3KSUA 5BT9A 2J5QA 4FIZA 1K89A 3RAJA 3CSDA 3L07A 4XGIA 1BRMA 3PQFA 3DBLA 1I3KA 4XA8A 1M6WA 4DC1A 1NASA 3GMSA 1P33A 5HA5A 5A9TA 3KBOA 4F6CA 4RVHA 1LRJA 3DBRA 3KSZO 3LK7A 1DDOA 3CKYA 1KEUA 3TZCA 2W98A 3PHHA 5B4UA 5K9ZA 2BFPA 3RC1A 3ROMA 1RWBA 1NHWA 2EKPA 1HYEA 4KTVE 4ZJUA 3AI3A 3EGOA 1CERA 4R5MA 1YBAA 4EZBA 1XR3A 1MP0A 1Z73A 2FPGA 3G79A 3WG9A 3WYCA 4ALIA 1KC3A 3P7MA 3RKUA 1SCUA 1YQXA 4XGKA 4EGFA 3NGXA 2ZK7A 3WBBA 3WWZA 5KWEA 1UXKA 5JMPA 4LVCA 4TRNA 4BKQA 1HDRA 1E6EA 1PJLA 3RASA 1Y81A 3E9NA 3Q6IA 3KEOA 4B4OA 4RLHA 4XD2A 3WFJA 4XYBA 1KBZA 1R15A 1RKXA 4XJSA 4TMFA 1X1EA 4BKUA 1SOWA 4RF4A 5A4DA 4IDEA 5B1YA 1G0OA 4IIUA 1I5RA 1EE2A 4W9NA 3PWZA 2GUGA 4KZPA 3U4CA 4ILKA 2AXQA 4MP8A 5CDUA 3UCXA 2O3UA 2AHRA 3WR5A 2AG8A 4D42A 5BSEA 4YRAA 2YQ5A 3SC4A 1FXSA 3ZV4A 3JQFA 1PSDA 3DOJA 3U0BA 2XAAA 1Z82A 1Q0QA 4AJNA 2Y1CA 4RVSA 4RDIA 5L40A 4OIMA 1EFKA 1HDZA 3FR8A 4NU6A 1HRDA 5FFFA 1DC4A 3WGGA 4FFMA 4MOWA 5CFZA 1WDMA 4FJ0A 1KOLA 4GVLA 1WNTA 5AXBA 4TVOA 4Q3DA 4UULA 5L9AA 2WE8A 1QYXA 4CJXA 1U7TA 5C5IA 5KVCA 4EJMA 2UV8A 2JJYA 1YO6A 3I9JA 1EDOA 3BMNB 1JKIA 1E7RA 3AY6A 3KYCB 1NX6A 1YDEA 4A2CA 4R16A 1NFQA 4HADA 3SLGA 3NKLA 1LUAA 3F5SA 4XQGA 4NG5A 2CSUA 1VJTA 2BFMA 3AU9A 1Z75A 1DRWA 3FI9A 4Q9NA 1LDYA 3TWOA 1JU9A 4AJOA 1KVTA 1K0UA 4ZQBA 4R5HA 2E4AA 3W6ZA 5G0VA 3ASVA 4HFRA 3S2GA 1Y9AA 3GVHA 1PX0A 5LC1A 3F1KA 2DBRA 5G4KB 4HUJA 5B4TA 4P8RA 3RJ5A 5ADHA 1EUCA 4BO4A 3JQBA 2P9CA 4A0SA 3GHHA 1N7HA 3CMMA 3LC2O 1N2SA 3WOHA 5KVSA 4L4RA 2BH9A 2CFCA 1H93A 4M54A 4IS2A 2Q99A 5COBA 3RUDA 3C85A 2Y66A 4F45A 1VJ1A 3KTDA 1R4NA 4I9NA 4GGOA 1L7DA 1ZCJA 2W8ZA 4S3MA 2E82A 5AXDA 3RBXA 4GLLA 5HM8A 5ILGA 4MVJP 4WCFA 2DQ4A 2JFGA 3JYLA 4UEOA 2FRDA 2JCVA 3EK2A 4IINA 2DVMA 3DAGA 4DYDA 4PG5A 1GYQA 3HADA 5L53A 2I76A 3QWFA 2R6JA 1SBYA 4J3FA 4XJTA 5KJ6A 1R0KA 3JCZA 3BHIA 4JLWA 4AJ2A 5F5LA 5ICMA 3EZYA 3DBLB 4PZCA 1E3JA 2C29D 4CM9A 1HXHA 1O94A 3DZBA 4NFHA 5IFLA 3NJ8A 1B8VA 4MVJE 2Q2QA 3RUIA 3DBRB 3CEAA 1NR1A 3T7EA 1IY8A 3PXXA 3U5TA 3I1JA 3VOSA 4FBGA 4YT8A 4IUYA 3Q0EA 4AJ1A 2DUUA 3JQ9A 3ABIA 4N54A 1JN0A 1UP7A 1JVBA 4Y98A 2ZYDA 3ST7A 4YDRA 1O8CA 3H6KA 4O1MA 1ENYA 1QKIA 2YUTA 2GN9A 3UOGA 2PK3A 2ZCVA 1IPEA 1KVSA 4ND4A 5F3RA 1JWAB 2NNLD 5AOVA 4I5EA 3F47A 2HMSA 3K6JA 4FFRA 4KDFA 3ZWMA 1P1HA 2YFQA 3S55A 5A1TA 5A02A 3DMTA 3BMCA 3NDIA 1CRWG 5JS6A 1H2BA 2F00A 4RVGA 2VUSA 3NJ4A 1TT5A 1UDCA 4LISA 4RVFA 5TRTA 5JAMA 1MLDA 1P31A 1U3TA 1KETA 4IDBA 4PLCA 4ZVVA 3JQ8A 3H5RA 3PZBA 4J1TA 5A5FA 3UFXA 4L8VA 4ITUA 3GNTA 2O7SA 3DHEA 5AYVA 1ADFA 3TPCA 4Q3NA 3V2UA 2PV7A 2J3JA 2GSDA 4NH4A 3AFNA 5DNAA 3OETA 1WMAA 5KIAA 3ETDA 4P4NA 3GFBA 3RIHA 1R0LA 1XQ6A 2IZ0A 4BNMA 1HDGO 3G3EA 1V9LA 1YONA 5BSGA 1UXJA 5B4VA 3AK4A 3KXDA 3RFTA 2WTBA 1R12A 1DAPA 3DB2A 4Q3AA 4UVIA 2E37A 3TZKA 2H1SA 1PJ3A 3L4SO 4BUCA 2NV6A 4MPDA 1LX6A 4CMIA 3D4PA 4L74A 3OIDA 4DL9A 2BRUA 1HETA 5JCJD 2QRLA 4HP8A 3HDQA 4PGFA 5A3VA 4D45A 1IZ9A 1E7SA 1VKNA 4O5OA 1EDZA 3ZWBA 4MVJF 2VNSA 2W2LA 2ZB8A 1A7AA 1RM4A 3NDJA 4YVFA 1JAYA 3VZPA 2O2SA 2I66A 7ADHA 5BNIA 2GCGA 3GRKA 1DHRA 1YQGA 4DTIA 1FF9A 1GV0A 1XHLA 2JD0A 5EERA 3RD5A 1I2CA 4JJIA 2VHXA 4A26A 1AHHA 1ZEMA 1P44A 4A03A 1EVIA 1GAEO 3GVXA 5CG1A 1GUZA 1SAYA 3JYNA 4IQ8A 2PTGA 3KOUA 1C1DA 1HE5A 5IXYA 3RUAA 2PD3A 1QSGA 3PQEA 2CD9A 3CH6A 2AQKA 3CPSA 4R3NA 4XWYA 4TKMA 4K26A 1F17A 2OUIA 4JP2A 3PIDA 1RM3A 1ZK3A 5KJCA 2WWRA 3U4DA 1J0XO 3VHRA 2O4UX 4YYZA 5ER9A 6ADHA 3UAGA 3EAGA 3QJ5A 1E5QA 1R4NB 2UUPA 1GFSA 3ROPA 2X1HA 3DZIA 2Y0DA 3BTSA 4BB6A 3C1TA 4WCFB 2FPIA 4NBWA 1DFHA 5A9SA 1M66A 1YRLA 1I3LA 2QQ5A 3I9NA 4M87A 5KNLA 3Q9UA 1R4MA 3JQDA 2XXBA 1T4BA 1BHSA 1J49A 1PR9A 1BMDA 4FOSA 2B35A 4E6PA 4B3HA 2I67A 3KV3O 1G6KA 1C0PA 1MA0A 4J9VA 4KMSA 4Q3EA 4AICA 1M67A 3LU1A 4QSMA 3QVWA 4FB5A 3ZV6A 1LRLA 3E03A 1GYPA 5JDCC 1HEUA 1LSUA 3UF0A 4WKGA 2OHXA 4QEDA 3GQVA 4Y6SA 3QE3A 4OOEA 1BWSA 1E1MA 2X5OA 3PGXA 3DZFA 4GPD1 1LDMA 3U49A 2IODA 1QV6A 3NTRA 5KJEA 2PFGA 4I8XA 4MO2A 3ONEA 4NDNE 1DB3A 1GCUA 2PZMA 3D4NA 1HSZA 1DLJA 1P45A 3BMCB 4Y6RA 1ZKMA 3GEDA 3ZV3A 5L4SA 4IGEA 1TT5B 2BLLA 5IZCA 4PLHA 3JQ8B 4B3JA 3BA1A 2O3QA 3F6YA 4L9RA 4YR9A 3Q3CA 1PZHA 4ND2A 4RCVA 3ZNNA 3WNQA 1A71A 2Z1NA 1PWZA 1QYWA 4XIJA 1SEPA 4DREA 3RI3A 3W4IA 2UVDA 4XQCA 4FGWA 1UDAA 4YJFA 2CVQA 2IZZA 2POQX 2OL4A 2P5UA 2AMFA 4BKPA 4U7WA 4R51A 2QHXA 1EEHA 2NVUB 1CDOA 1E3EA 5TF4A 4FC6A 4DQVA 1T1SA 4CUZA 3VTFA 3ZU3A 4B3IA 4XB1A 2WYUA 3ZN2A 4RPLA 4CMIB 5CEEA 4BGVA 1PGQA 1ZK4A 4DVJA 5I7VA 1CQIA 4CV2A 1QR6A 4CL8A 2GO1A 5ENDA 4MKRA 1I01A 2X0NA 5JYDA 3DQPA 5FI3A 4PLWA 1ISHA 2G17A 3W6UA 4PZEA 2H63A 2H9IA 3VPFA 4YQYA 4YT4A 2IRWA 3INRA 1Q7GA 1YBVA 2HCTA 5ILOA 2B4QA 1R6DA 4HFJA 3PEFA 4URFA 4D7AA 2DBVO 4ZU3A 2Z1MA 1O0SA 3PDUA 4ZRNA 5C3MA 2VZ9A 4E13A 3UVEA 5DCYA 3E6AA 1C1DB 1DSSG 3TFOA 3NDRA 3ADOA 3OHSX 4YTEA 1DJQA 3IP1A 4D46A 3GDGA 4JIGA 5CDGA 3BIOA 3DZGA 3MEQA 1ENOA 1FDSA 1GPDG 4K28A 5DCWA 4BNZA 2GN4A 4BVAA 3KRTA 1BVUA 2VZ0A 3WQSB 5TGDA 4KP7A 3G49A 4XYEA 5U4QA 1CQJA 2CVZA 3L6OO 4BO7A 4ID9A 4BNHA 4L76A 2PZKA 1P1KA 1E6WA 1VM6A 2FWMX 5AXAA 1PGNA 1B8PA 1XU9A 1TT7A 1BDMA 3Q1LA 2HK8A 5JSFA 5A9SB 4N18A 5L4NA 3VPHA 3FN4A 3M2TA 4D0SA 4XEHA 3RUHA 5ITVA 1P1JA 5F21A 1R4MB 4E0BA 4J16A 3FNGA 4ALNA 5DULA 4W7HA 3QHAA 2DTDA 4OQZA 2DM6A 1YVEI 2FHSA 1PQPA 4NFSA 4RPKA 5THQA 2GR9A 3WGHA 4XYLA 5U9CA 3K96A 2O4CA 3PHGA 4BQRA 1NVTA 3OP4A 3FWZA 2VRCD 4ZQEA 4HBGA 2PD6A 4XGNA 4ALMA 3IJPA 4BOYA 3E18A 2HMUA 2LDBA 4J4TA 1BTOA 3AW9A 1X7HA 1NNUA 5CDTA 5JDIA 1ZSYA 4MINA 4PRKA 9LDTA 4AJPA 1FK8A 2ZKLA 1YWGO 2I6TA 4ESOA 4P38A 3C7DB 5DZSA 3ROKA 1Q0LA 3WICA 4IDGA 1J4AA 2VT2A 4AL4A 2H6EA 4XDZA 1KC1A 3MJCA 3ON5A 1ISMA 1XCBA 4O63O 5JC1A 3TF5A 4JX8A 4OGWA 5DOZA 1M75A 1MG0A 3ZNOA 3HE3A 1I0ZA 1SOVA 5T6BA 1GEGA 1SB8A 4A7PA 1E0DA 3WMWA 2HUNA 1KY4A 3STHA 1V0JA 1E1LA 3EYWA 3ZWNA 2HMWA 2CDAA 4YJFB 2QYSA 4RQTA 4DRYA 5JAZA 3BAZA 3ZWAA 3PWKA 3VPGA 2FMUA 1DC5A 3GR6A 2C59A 1WZIA 4L0QA 1GQ2A 4YEDA 2X8LA 4Z0HO 2ZB7A 4IJVA 1QYDA 1YB5A 2X9VA 3VPXA 2EJVA 4DLLA 1HDXA 1JKJA 5JMWA 1I8TA 1PR3A 1T2CA 1UXHA 1P9LA 1IOLA 2QW8A 4PLYA 4RVDA 1UZNA 5BNFA 7MDHA 5GZ1A 3GUYA 1W6UA 4JBHA 3QY9A 1YH3A 2OZPA 4E3ZA 2FPPA 3PFWO 1PJ2A 2C5EA 1HL3A 1SNYA 1ULUA 4QFDA 3AOEC 1YGYA 3DZJA 2X86A 4H15A 5JO9A 5IXSA 1I33A 1GEEA 2FOIA 4M55A 1KVRA 4WCDA 4BMVA 1UH5A 4Q3CA 4PVDA 4PRLA 2BGMA 4RJTA 1LLUA 4I5FA 3KYCA 4LCEA 1E1KA 4CL3A 3H9UA 1YJ8A 5T8KC 4EEXA 5I8WA 3CZRA 3MWDB 4F46A 4KTTE 3LF1A 2HRZA 4OXNA 1ADCA 3C1AA 2Y1DA 3U3XA 4PLFA 4MIOA 2IE0A 3W8DA 4M8SA 4OO3A 3HHPA 2P5YA 1E77A 1YBMA 4RVUA 2J3HA 4FFPA 1OC2A 5H81A 4ZICA 4XRRA 1IB6A 4OXKA 5ES3A 1JKFA 2P4QA 2W90A 5DDIP 4J49A 4PG4A 1KS9A 2JAPA 1F14A 2GPTA 1D3AA 3WLFA 4MVJG 1XIVA 4GKVA 2J5KA 2OXIA 1LDEA 4OAQA 1YB1A 1A5ZA 1C0KA 3EDMA 1I10A 1YB4A 4B4VA 1PJQA 5COQA 4J1NA 4PIVA 1KVQA 2PKQO 4J9UE 5A3JA 2HO5A 4J1QA 2PKRA 4W4TA 4CV3A 4BNUA 5JYEA 4DPKA 3Q2KA 2NM0A 3WYBA 1NYTA 1Z74A 2VYND 5BR7A 1M6HA 2JFHA 3R6DA 5K0ZA 5JNLA 4IJKA 3WDSA 3FF4A 3P2OA 1B26A 2BFOA 4NPCA 3I5MA 1G0NA 4CM6A 1T2DA 9LDBA 1A4IA 4BNNA 3CIFA 4FC7A 4QQRA 2TMGA 3KM0A 4BGIA 4QT0A 2G82A 2JKVA 4KOAA 4PFJA 1PL8A 3ONFA 1WZEA 3PJEA 1DIGA 3K92A 4Y6PA 3ZDFA 4AVYA 5DP1A 3PPIA 3D5QA 3WGYA 1LU9A 3ZWWA 3HFSA 2VQ3A 3U09A 4PCVA 1NXQA 2HRBA 2Y1OA 3JD1A 5IDWA 1M76A 3W4KA 1GQQA 4BNVA 1ZK0A 3MTGA 4MVJH 4QO8A 1FMCA 3ASUA 4R9SA 2J3KA 1QV7A 3U4HA 1I3NA 2D5AA 3G17A 1T25A 3DFZA 2DPGA 4WEQA 4WLNA 5KVQA 4NFYA 2EG9A 2AQIA 1H9BA 2NU8A 3ANMA 4K6FA 1DIBA 5DBGA 3ZWOA 3AUTA 4EJ6A 4BNIA 3DZKA 1GQYA 3GF4A 3SBOA 2C0CA 4UVEA 5JFOA 3PGJA 3JD2A 1A9ZA 3GDFA 1MX3A 2CMDA 4HY3A 1ZIDA 5G0UA 2JAHA 3LSYA 1UZLA 2QYTA 4UAGA 5FWNA 1IULA 2DAPA 3EY4A 4ALKA 1ZMOA 2GF2A 3I52A 5TS3A 3UHAA 4E2YA 1HE2A 4J4HA 4H3VA 1DIAA 1Y5MA 1IL0A 2C2XA 3GAZA 5TLSA 3WTCA 2RHCA 3JD0A 4IJUA 3I9LA 1MXHA 2F1KA 2NVWA 5F5NA 1SMKA 3NEPX 2YYYA 3WFIA 4E5KA 2Q46A 4W82A 1EMDA 2P9EA 4FJ1A 1CYDA 1N1EA 1V35A 3HQ4O 3FTNA 3JQFC 3A1NA 4H16A 5DBFA 1VI2A 3INTA 4B8ZA 5EIOA 2QRJA 4J2HA 4TRMA 1FDTA 1ZZEA 1T1RA 5TJ9A 3RJ9A 5EESA 1K6JA 4LW8A 3AOGA 3GLQA 2PWZA 3HSKA 3VZRA 1UDBA 3D5TA 4HWKA 2BKAA 5CPBA 4IS3A 4DBZA 1C14A 3WIEA 4H7PA 1EVZA 5GMOA 1CIVA 1D7OA 3L4BA 4UEKA 2GLXA 3HUDA 3OJFA 4QUKA 3S2IA 3VDRA 2ZTLA 1E7MA 1H9AA 1ZUD1 2VWPA 1PS9A 3GNSA 4IMPA 3K5PA 4KQWA 4BO5A 2X9NA 3A28A 4N5NA 3S8MA 1QYVA 4YB8A 3C8MA 3BMOA 5CG2A 4FFLA 1PJCA 1Z45A 3H9JA 2HAEA 2VWGA 1IHYA 4CUKA 1B0AA 3JQBC 1WPQA 3OJ0A 5TC4A 1QMGA 3GGGA 2DT5A 3Q2IA 2HJSA 1LRKA 1UUFA 2CY0A 4GI2A 3TQHA 3QVOA 4DUPA 4CMGA 3ZU4A 3VZSA 2YFHA 3PLRA 4D3FA 1NBOA 3ENNA 4RQUA 4E5NA 1Z7BA 3NT2A 1CETA 3C7CB 4IIVA 4IM7A 4RLSA 3GOHA 4WEOA 2NUAA 2QZZA 2HMVA 2O3JA 5HBRA 5HS4A 3DEYX 3IKTA 4UUOA 2GRAA 4KUGA 4YAKA 1DXYA 4Z6KA 4W7IA 4RZHA 3JQEA 3D4OA 3UGKA 1H6AA 5T57A 4UVDA 2VHZA 2DU8A 3W4JA 3W8EA 4CM3A 3SJ7A 3JTMA 4CPDA 3V2GA 5I7SA 2D2IA 3DMYA 4YT2A 4E12A 3ORFA 1VPDA 1EZ4A 3VH3A 2GNAA 3NYWA 5JXWA 5T64A 5IF3A 4MVJI 3CUKA 1XEAA 3MJEA 5J23A 3JD3A 1GR0A 5JCXA 1YKFA 4HXYA 4WE3A 4CUJA 1PZFA 4HKTA 1XQ1A 2IZ1A 4PG7A 1PTJA 3JQ9C 3WB9A 1E3WA 3IQDB 2X0RA 2JD2A 1SC6A 4U6SA 3RC9A 4BV9A 4J2OA 2FSVA 3CE6A 4XCVA 3I3OA 4E2WA 2I3GA 4WOJA 2GYYA 3H65A 2NU9A 4TSKA 1K2WA 1EE9A 4J7XA 1DFIA 3K9QO 4OL9A 4PG8A 4FFNA 2YQ4A 1IPFA 1C3VA 3DMTC 2VHVA 1P0CA 1DOHA 3GGOA 3OIGA 4IZHA 4E4YA 2CF6A 4RF5A 3DONA 3I9KA 2GZ1A 4WPGA 1ENPA 4CM4A 3OJOA 3ZU2A 1ONOA 1V6AA 3RUEA 4XZ3A 3QV1A 5KKCA 3MJSA 1MC5A 3FSRA 4OKNA 3FNFA 4I9UA 2C54A 3FCOA 3V2HA 2G0TA 3DO5A 5JCJA 3WJAA 4YAIA 3M6IA 3WGTA 2NVUA 1T4DA 3OA2A 1LLQA 3FPCA 3A4VA 3ITDA 4DWVA 5IJZA 1PJSA 1Y8QA 2ET6A 2FR0A 4OHUA 1SEVA 4EEZA 2EEZA 1IUKA 2P91A 1DHTA 3D3EA 2PKQP 4U6QA 3PJFA 4WNIA 5F1OA 2ZQYA 3H5NA 4CV1A 4GMFA 3PIIA 1OOEA 3PTZA 5I7FA 2CDCA 2ZTMA 4WLOA 3KUXA 4DBVO 1N9GA 4G5HA 2C2YA 5AXCA 1JLLA 2VHYA 1NQOA 4E30A 4NR0A 3TRIA 4R41A 5LDGA 1NAIA 1VJ0A 1X7DA 3WQQA 3DR3A 4MVJD 3SEFA 2FY8A 1NWHA 3ROQA 3TSCA 4MP3A 1E3LA 3GK3A 3B20A 1V3VA 2NVBA 4CQMD 1E1NA 2RAFA 2NTJA 5A05A 1I2ZA 3BMOB 4W6ZA 4GMGA 1TEHA 3C1OA 3AUUA 4YQZA 4AJHA 3QW2A 3RQSA 1TA4A 4ND1A 2FP4A 1EBFA 4JK3A 1S7CA 1U28A 4BNGA 2ZYAA 3KYDA 2Y99A 3EC7A 1LDNA 2EIHA 1VSVA 4YXFA 3RFXA 3ZWCA 3HJAA 3M1AA 4NBVA 1XGKA 4PG6A 4MKXA 1MUUA 3DHYA 3D0OA 4JGBA 4IZIA 1Y8RA 1H2HA 1T24A 4Y67A 3JQAD 1KERA 1EQUA 1PQUA 4DLAA 2HJRA 3N7UA 3WS7A 3RU7A 4NQZA 4YCAA 4M49A 4B7CA 1OFGA 4R68A 1ZMTA 3ZNQA 3PYLA 3CZMA 4JXKA 4TRJA 4Q39A 2CUKA 3MJTA 1JDJA 3G1UA 4ZA2A 4DIBA 4IXTA 4FJ2A 1P3DA 3RBZA 2GZ3A 1B3RA 3QQPA 1D1SA 1AE1A 5TT1A 2HMTA 4KUHA 2JHGA 2UAGA 1Q2XA 3GZ4A 2DFDA 2YV3A 1T26A 1VSUA 4ZQGA 3MOGA 4ROSA 4IDCA 1ZH8A 3ZH2A 1JWBB 2YV2A 2B0JA 3GPDG 3RUCA 1O89A 2SCUA 4OSPA 1ZVMA 4YBZA 3H9QA 4PLZA 1LXCA 3EVNA 3KB6A 2B37A 1WDLA 3MTJA 3ZGYA 4DPMA 1KEWA 1U9JA 1E3WB 4UUPA 3O26A 1SB9A 4QX6A 3S2FA 2AQHA 3HB4X 4BNTA 3ZCXA 3PWSA 5TX7A 2O3SA 2P4HX 5L7WA 1GYRA 1PJ4A 3WGQA 3H7AA 5JLAA 1U2DA 4C7JA 4E5PA 2RH8A 1KIFA 4EI2A 2AW5A 1V8BA 3HNPA 3FPLA 3ZHZA 3FBGA 3QWAA 1X13A 1H6DA 4B79A 3VZQA 1TXGA 4PN3A 5HWSA 5IZCC 1YQDA 2QX7A 3T7CA 1DC3A 2HSDA 3D7LA 3MOIA 4CM4B 3HN2A 4FGSA 4OM8A 3HDYA 1MV8A 4HNHA 1ID1A 4BIIA 2ZTUA 1LI4A 6LDHA 4BNYA 2RIRA 4TKLA 3BTOA 1Z7EA 2NU7A 2O3RA 3FD8A 4DQXA 3OECA 4B7UA 1ISFA 4GSKA 2WE7A 4DYVA 4K6CA 1EBUA 4YAEA 1Y8QB 3V8BA 3IUSA 1OBFO 2G5CA 5H83A 3JYPA 4JNKA 4YA6A 5G0SA 1EVYA 1O95A 4I08A 5ITWA 3BMQA 4MDHA 3NRCA 5JAQA 2X0JA 3O9ZA 4IJWA 2BGKA 1ZBQA 1SZJG 4O6VA 3FNHA 1OI7A 3S1LA 1CJCA 3F9IA 1N9GB 4J0EA 1NM5A 2ILTA 4CLEA 3BHMA 1I2BA 3WWYA 1GUYA 2GASA 2VWHA 2AE2A 2D3TA 2JCXA 3GVCA 3PLNA 1XYGA 2YDXA 3NT4A 2Q2WA 1E6UA 3WSVA 4J91A 2V65A 1U2GA 4WECA 3LDHA 2XPCA 3FWNA 4J43A 3OH8A 3IS3A 2RCYA 4FQ8A 2VYVD 5K6AA 3RVDA 3PYXA 4CMEA 1WXDA 4AJ4A 3V1TC 1NAHA 4EYEA 5L7TA 5I8ZA 3GPIA 1N7GA 1LJ8A 3GN2A 5EN4A 4GBJA 1GZ4A 3H2SA 3DHNA 3NAQA 3KYDB 3WTBA 5IN4A 5GZ6A 3H4VA 4XKJA 2DBQA 1AHIA 1C1XA 1R66A 3SJUA 3E1KA 4BQPA 5CAEA 1T2FA 4PLVA 1H5QA 2Z5LA 1T2EA 1BSVA 2Q3EA 1A4UA 1Y8RB 4F6LA 5A5EA 2EP5A 3OA0A 1HDCA 1LQUA 2NSDA 2GGSA 4BO1A 3KETA 3LQFA 1X7GA 1JVSA 1QRRA 3RUFA 2EERA 1LSJA 2VUTA 4BO3A 5HTOA 4HV4A 3GC6A 4YJDA 4WJZA 1HWYA 3LC7O 2VRCA 3OQ6A 2HLPA 4ZD6A 1QORA 3M1LA 4GX1A 1JAXA 3RWBA 4A5OA 3SLKA 2CZCA 1B16A 2VWQA 2JD1A 1D4FA 4CMJA 2ZB3A 2Q1TA 3I23A 3QWIA 4DPLA 3GG9A 1GL3A 2WM3A 3EUWA 4CV0A 4BHTA 4LRTB 3OMLA 1TB4A 3SC6A 2J5RA 3H8VA 1XLTA 5TJHA 1VE9A 4BKRA 4J6FA 4BGEA 2PLAA 2JFFA 4BO8A 2J8ZA 5JDIC 4WLFA 4CMCA 4RPJA 4JN6B 4QFCA 4NBRA 4Z0PA 4D0RA 4WLUA 2IEDA 4CLDA 3JSAA 3PJGA 3AY3A 3EHEA 3F46A 2Q4EA 3ZWXA 1I3MA 1QXSA 2XOXA 3GEMA 5F1KA 1EFLA 2VOJA 3WGOA 1HF3A 5C7OO 2WYWA 4P22A 2VCYA 1PU2A 2VN8A 3IL2A 3LT0A 3BYZA 5DF1A 1CEQA 4BNLA 3Q9NA 3R0IA 4ZN6A 2UDPA 1RM5A 1B3BA 1QLHA 3OSUA 2X0IA 1VC2A 4RPHA 5T67A 5TNXA 3H3FA 3DL2A 1H6CA 3DAFA 3INGA 2A4KA 3GHYA 1X0VA 1B7GO 1PEDA 4Z9XA 3IKVA 4ALLA 3CMCO 4D3DA 3K73O 1NQAO 1U4SA 3TDKA 3MZ0A 2E49A 1LC3A 4N5LA 1UR5A 2VTEA 4LVUA 4CMHA 1UJMA 1C0IA 1HTBA 1IE3A 4UVHA 3RC7A 2DUWA 1U8XX 5ICSA 3BMQB 5IZ4A 3V1YA 3ZI0A 1Z6ZA 3K2EA 1HYHA 4J7CA 3ZWYA 4IMRA 2VNAA 3T4EA 3UKOA 1EVJA 1UXIA 2WMDA 1L7EA 4IQGA 4WGGA 1ML3A 1YL5A 4II2A 3OF2A 2R00A 4QTZA 3TL3A 5KJFA 1WAMA 2ZCUA 3JV7A 4YT5A 4CM1A 5I9NA 3RKRA 3UW3A 2HQ1A 5H82A 3TZHA 3IAHA 4E33A 4EW6A 3ANNA 4JCOA 3H3JA 1CF2O 4NK5A 2NACA 2CVOA 3C7AA 1E92A 1HE3A 4W99A 1NQ5A 3OQBA 4G65A 2XF8A 2B5WA 4LRSB 5B12A 3I6QA 5AVOA 1E3IA 3F1LA 4QECA 5CEJA 1LA2A 3GN1A 4QXMA 2ZB4A 4ZRMA 1RPNA 1O5IA 1RYDA 1U1IA 2Z95A 1DBVO 1C1XB 1NQTA 4RPGA 2YDYA 1PL6A 1VL8A 1LDBA 4IBOA 1WWKA 3MWEB 2X5JO 4BKOA 2V6MA 2IXAA 3AI2A 1DIRA 1QP8A 2VYNA 1ZXBA 3IJRA 3K2BA 1LQTA 3VH2A 1ZK2A 3B1JA 5ENVA 4YRBA 3SVTA 3ENKA 4IXWA 4GWGA 1ADBA 4OMUA 4M86A 2O3TA 1AGNA 2YHUA 5CPFA 4L4XA 2PZJA 3N58A 4RO0A 4Y9DA 5KKAA 2O2YA 4OJNA 1PZEA 3E48A 1HE4A 3E8XA 4YAGA 1XSEA 2R2GA 2YJZA 4ZGWA 3BTUA 5AQ1A 1P74A 3JQ7A 3NGLA 4WLVA 5JC8A 1K5HA 3UH1A 3P2YA 1DRUA 1DLIA 5KVVA 2O48X 1BG6A 1HLDA 5ER6A 4LSMA 1ZW1A 3DDNA 1DO8A 2X7HA 4EDFA 4BO0A 3D3WA 4AFNA 3OICA 3GNQA 3F4BA 4DMLA 2HK9A 1BXKA 3E9QA 4FS3A 1EUDA 3BXXA 1HZJA 4XR4A 5I9MA 5A04A 5JY6A 3LT4A 1NTOA 1H0KA 5EQDA 5CDYA 1LSSA 4OYRA 2CNBA 3VAZA 4D79A 2AEJA 1YJQA 2IYOA 1EK6A 1ISIA 2C7GA 2WYVA 2BELA 2FR8A 1MB4A 2C82A 2PA3A 1A9YA 4BL5A 4R1NA 4BNXA 5KTKA 5JPIA 3E5RA 3UICA 2NTNA 4KDEA 1O6ZA 3FR7A 4LMRA 2PH5A 3IMFA 1EK5A 1DIHA 2VRBA 2Y93A 1OAAA 1VRWA 1NPYA 2C20A 4KWIA 2DTEA 1IHXA 1KYQA 1GCOA 1AXEA 3O8QA 3HZZA 1F06A 1LEHA 2WEKA 2Y1EA 4CR6A 5CEFA 1BXGA 5FI5A 1O9BA 4W9NC 1YS4A 2BGLA 4ZQFA 4X54A 3HWRA 3JQGA 5EMHA 3GT0A 4RZIA 1YL6A 2WSBA 5JBIA 3LVFO 4CLRA 1E7YA 2C7VA 2X23A 3L6EA 2NQTA 4FOOA 5DP2A 3QWHA 3E5MA 4JQCA 4LK3A 2YY7A 3VH1A 3WX0A 1R16A 3BHJA 2Q50A 2W2KA 4U5QA 1ONNA 4TZTA 3ONDA 3AI1A 5DT9A 1IZ0A 2OBYA 4FFOA 5C37A 2D0IA 3COSA 2CF5A 2OFPA 4LCJA 4FR5A 1YXMA 3I4FA 4Z9YA 1PJTA 1F0YA 4K1LA 1LLCA 2NADA 3GGPA 1K6IA 3A14A 3ETGA 1E7QA 2BI8A
chains in the Genus database with same CATH superfamily
4U2GA 4M1EA 3CRMA 3H13A 4R54A 1A97A 2J1LA 2MWMA 4QUIA 1EGVB 1RCFA 3FOCA 3KVOA 3LC0A 3PGVA 5ALLA 3LDFA 1SKYE 2Z5VA 3DDCA 3PNOA 1AS2A 1NN0A 4EW2A 5FOVA 3GVPA 3DF7A 4K81B 2Q5OA 1U5CA 4QUHA 3ZHBA 3GVIA 4NE7A 4J1SA 4UUNA 1ONPA 1F12A 3AQ4A 1GY8A 3NNSA 4K9QA 1ESCA 1Q7TA 4GT1A 1P7WA 1GM5A 1SVSA 1GKYA 2XQKA 4ZCIA 1U7ZA 4UAJA 2BHSA 4LBVA 5COAA 2B0CA 5BSWA 2ESRA 5ED0A 3F98A 2Q5FA 3UCEA 5JH7A 1YZ3A 1YL7A 4LMAA 2MCFA 1WW2A 4JLSA 5BVGB 4GVXA 3QWBA 1Z83A 1WMBA 2ZTHA 3IXQA 3OEHD 5EPOA 3H8SA 4DZRA 5LSAA 2UYHA 1TU0A 5E7MA 1C4KA 2O06A 3OCXA 2HSZA 1F1JA 3FDXA 2XNKA 1MG5A 2EHDA 4S24A 4ENTA 1CU1A 3ELYA 3LO8A 5B57C 3J80A 5I9TA 2G08A 1VBMA 3CHYA 4DJFC 2HJGA 1T3GA 3OX3A 3ENZA 4GX2A 4D9HA 2C07A 2Y1FA 4KN8A 4Q9JA 1Y7LA 1ONSA 2BMDA 2H3HA 5B30A 1CJVC 3P9QA 1GZ3A 3TTTA 2JLAA 1ULSA 2O07A 1MFPA 2PS1A 3M34A 1Z9BA 1NFFA 2AUMA 1MPXA 3JQ7B 1I2AA 1QGUB 2GN6A 2H8GA 4NEHB 4KQEA 3CRZA 1AKYA 3OWXA 4YYEA 1EWRA 4BAUA 1L5SA 2GEBA 3WRYA 5KSWB 4AN0A 4YRJA 3DFUA 4TMVA 1ZGCA 4KUEA 2XMQA 5G0TA 3WB0A 3M89A 5CDFA 5JVDB 1DEAA 1S4MA 1YNOA 3WSTA 5LD2B 4MB2A 2CV2A 4KGXA 4ENWA 1IBRA 3FSEA 1H94A 1ISRA 1L3CA 4IDHA 2OK7A 1QZ3A 5AI8A 5ECWA 2PX6A 5T5QA 2P6RA 1EU1A 4DNOA 1HNWB 1LQ2A 3FE2A 4URHA 4ODIA 3DTYA 3RQIA 4HNUA 1TX4B 1KJ9A 1SVKA 1PZGA 1IYZA 3U2QA 3LUAA 1XEXB 3GJ3A 2QZ9A 2VDLB 3AWDA 4YP0A 4UOZA 3DKRA 1Z5OA 2HA7A 2WJGA 3DOEA 5BURA 4X20B 1Q0SA 2PGDA 3LBIA 3T3IA 1Q20A 3ADDA 3JZDA 1ADJA 3HXLA 3AUSA 4PHHA 4YAUA 1MZPA 3AP1A 4PAOA 4R1MA 1XQXA 1OLUA 3D4IA 1RPZA 5H8WA 1UM8A 2IXFA 3PKZA 5HRAA 1FS5A 4PNZA 2RGRA 5K0JA 2H1FA 1P17A 5CFMA 1SH7A 5CIWA 2BHLA 4R40A 2UYYA 2BFBA 4DA6A 1EX7A 1JLRA 4B6OA 1PYDA 1LVGA 1UM9A 2VT6A 1YVDA 1VFNA 2JI7A 4MGIR 4EKDA 5CVEA 1MXFA 3OBBA 4IJMA 1Q3HA 4KXLA 4C0BA 4Q1VA 5EVCA 3ILXA 5AKHA 3DO8A 5DOVA 3RVOA 4UTPA 2BSXA 3ZDRA 3KJXA 3PK0A 3O6VA 4W7SA 3G2KA 2PMWB 3TZQA 1QS0A 4GMXA 3IDSA 2W2KB 4HNGA 1OHHA 1JQBA 1SUIA 5JY1A 1MFZA 3Q2OA 2XUAA 3LNTA 4IHQA 1PAUA 3T1QA 3VGJA 4AQDA 2CLFB 5B6JA 3PL5A 4RV9A 5HUJA 4FWTA 3IKMB 4S1PA 4F4JA 1FSPA 1NN1A 4CM7A 3IT2A 4BP8A 2AFIB 4B4UA 1ZISA 1AD2A 2FPWA 3B2NA 3H2HA 3E3OA 1JA0A 1GN8A 2C3MA 2PZLA 2BRUC 1G60A 1P1IA 3BIFA 1H66A 3H8WA 4KV9A 4HDAA 3GZNB 5CVJA 2CL6X 4MRPA 1TAHA 3WWCA 5THXA 4BO2A 1Y0BA 4CLOA 4Z99A 3CLUD 2OAQ1 4JEHA 3EMDA 5FP0A 4RL6A 5B1IA 5BPHA 5JSZB 1USUA 4FPXA 1UDRA 3I5YA 1WDKA 2PU7A 3NVMB 5LCXA 4L6CA 5PNTA 1KY2A 3PXDA 5EJ2A 3RJZA 2FEAA 3I0ZA 4BX3A 1J5XA 1Y3FE 2CE2X 2GARA 2V6GA 4TWRA 2I6XA 2Q49A 3B6JA 4C08A 3LT1A 4EJFA 2HFKA 2XA2A 4YCCA 4HS4A 1TJPB 2Q3MA 2X2OA 3RIXA 2FEKA 1V4NA 3HZRA 3KLMX 2EAUA 2I87A 3H9GA 5J43A 2VZLA 3Q8LA 2IELA 3KPJA 4HR7A 4E5YA 1U0SY 2IHVA 4V39A 4S1WA 2FZWA 2ORYA 2YZGA 3JQAA 3LI2A 4FEYA 4Q19A 3ZH9B 4OMCA 1Y8CA 1JLHA 2NUTB 3AHJA 4D1YA 1XU7A 1XZKA 3HWX1 3JY6A 4TKVB 4K9DA 1L3IA 1U28C 1TRKA 1W29A 1D6MA 3OM9A 3SEZA 2H1LA 1MJFA 4UVGA 4KOEC 2IPXA 1G18A 4HDRB 1J6UA 4GIBA 3RTEA 4WNAB 5LQRA 2DEUA 4MW4A 4BX2A 1F6WA 4OFBA 1NMSA 3JATB 1U7HA 3DKIA 1KYWA 2HDOA 4UEJA 5FTJA 5LB2A 4J94A 3HH8A 4G36A 4BQEA 1W4CA 4UDYX 5AOAA 1XTRA 2GF9A 1CKEA 1MGPA 4DN6A 2ECOA 1M3SA 4UREA 4IIJF 1Z12A 5B37A 3TLYA 3DFMA 1YB7A 4DMCA 2HV8A 2HMAA 2I4MA 5JHHB 4JR2A 1LTHR 4NMXB 3ZR4B 3TLAA 4IO0A 1NVEA 3DEFA 1IDN1 2O23A 3HYSA 4YMWA 5DGCA 3VO8A 3G0CA 3O4HA 2PU5A 3AHCA 4O59O 2ZBDA 2PGLA 2A0YA 1E69A 4NNJA 3PC3A 4S1VA 4AJ9A 3WY9A 1GSHA 2YZNA 3W3AH 3ZDBA 1BHJA 4O2RA 3L4KA 1MIOB 2B4KA 2ZJ8A 3QI7A 3GLIA 2WWTA 4KH1A 4JP1A 2A6PA 1UAAA 1Y9JA 3D8BA 4IG9A 2M9MA 5A4AA 4XLLA 1SC9A 2AT1A 1DC6A 2HDNB 3IXMA 4QRHA 3WI7A 2GVNA 4JDPA 4U7FA 2IYXA 1TA9A 4RHYA 3OQ1A 2Q3CA 4XX0B 1TGYA 4B3FX 3CW9A 2HR1A 1ECJA 3FWPA 1E1CB 3IVGA 3CWCA 3HJRA 4M36A 1M8JA 4ZDWA 3AXTA 1WLYA 1IY9A 3ZV4A 4DLXA 3E22B 5I4BA 1EXWA 1W35A 5EMKA 4BTLA 1AKQA 4PTLA 1R9MA 3VR2D 4DR1B 1P9WA 3FPKA 4A16A 3UJAA 2JIQA 2QJOA 3LC1O 3W1WA 3B3GA 5C8ZA 3SEAA 2QJTA 5DNUA 5JATA 4DSNA 5FDFA 1CR0A 3P97A 5IPFA 2JL1A 3F7NA 2BKUA 2BMAA 3M33A 3MUOA 5KNCD 1EXNA 3HLYA 4KB5A 1PGPA 2EKBA 4MS1A 3SQMA 3QRWA 5ULLA 4P4UA 1C9YA 2DBZA 4BO6A 4INAA 2RE8A 3DFIA 1FW6A 2IHTA 1D2CA 1G19A 4G2NA 5HFAA 3QVXA 4IMJB 4CFYA 1T34A 3GUHA 1SHLA 2BCEA 3FYUA 1XE3A 5K0EA 1VJGA 3ILSA 1E2LA 3ZK7A 1B14A 3KS9A 1SIBE 1U0OC 1KS2A 1W4BA 1WUHS 3IQZA 3LFHA 3FMIA 3SFZA 3WA6A 4U7GA 5KYYA 5MDHA 3UPTA 4ESVA 4CTJA 2XMCA 2QL9A 1FRNA 3MCVA 3O90A 5AIAA 4M89A 2XB4A 3EIOA 1GRCA 1T2VA 1VPLA 3HYCA 3I2YX 1MC4A 4F1KA 4A2PA 4R9RA 4QPNA 5DM1A 4TXNA 2XYQA 1XTJA 4F4DA 5AHRA 1YT5A 2YY6A 1TFRA 2AD1A 3HR7A 1T36B 1L5QA 5DTEA 3BQNB 1XCPA 3BH7A 4JUBA 1VYTA 1YOVA 4O4JA 4B3GA 4FLMA 3NYRA 4HQRA 2QPLA 1P91A 1GD1O 4HN4B 1ZSVA 3VSAA 4A0GA 1PVVA 4Y30A 4A92A 4C4OA 4Z86A 3K35A 4RKEA 1ZD2P 1VBFA 3T9AA 1RABA 4DCUA 6GPBA 1YAHA 3V7UA 5E2AA 1W30A 4TSRA 4QZVA 1QIDA 3D0QA 4CQMB 4AJLA 2XV1A 3LGAA 4JLKA 2CNDA 2Y0CA 3R6TA 4YJHA 5DN6A 2O54A 3W5VA 4BJ5A 4MUYA 1LZLA 2FEMA 4HQ0A 2JIRA 4I1YA 3TM5A 4DAEA 1Y5RA 4UOQA 4XXHA 3L3BA 4GFDA 3CO0S 3JR7A 2EW8A 3WRYC 4JT4A 4YHBA 1QAMA 4AUKA 2Y1GA 1E1DA 3B1KA 2QYOA 2Q21A 1WUIS 2BTQB 3A2KA 1Z4IA 2WB4A 1HQYE 1S7GA 3EIHA 4YRGA 5AIBA 1O97C 2NV2B 2A0WA 3WLTA 1FCJA 1OLSB 1TLTA 1ZDMA 1VJCA 1H85A 4O1IA 4CCYB 5I45A 3SX2A 1K0FA 1Z3CA 3FZQA 2Q7DA 4PO3X 4CMEC 1IN4A 4OYLA 3OJEA 3VU0A 4L07A 4EHDA 3NP7A 2FSSA 3UOAB 3NHJA 3T7AA 2ODAA 4PCLA 3TBKA 4Z9FA 2PUFA 3L82B 2X22A 4J0QA 4LZOA 3QEKA 2VLBA 3D6FA 1QH9A 1ZLYA 3KL2A 3LPNA 4NECA 4GAEA 3R41A 5DGXA 5TT0A 1K08A 1RC8A 2C84A 1Y9EA 2WJ6A 1QDUA 3DOCA 3LL4A 2H4ZA 4OPMA 4WDQA 2NWQA 2OAEA 5LNK1 3KWJA 4QUEA 3T9DA 4QPDA 1T5TA 4MW2A 2WP0A 1EFTA 1I24A 3GLFA 1PFQA 5D3ZA 1Z0SA 3OU7A 1XPUA 1N0IA 2QR2A 3HDTA 2HMYB 4MV4A 4CV2A 5DRYA 2VCEA 3CR3C 1YE3A 2QORA 1LW6E 1T8RA 1TPZA 2GZ2A 2ZLBA 3IHWA 4TMTA 5D6OA 3AERB 2I2FA 3KR9A 4KN6A 3AVUA 2Q1SA 5DBIA 3D54D 1GTZA 1HDYA 3FYDA 1TL7C 3CH5A 3A6EA 4WUVA 1ZRNA 2VHEA 3I0NA 3QELB 4CMBA 2FMIA 3MW8A 5CLGA 3U4QA 3D1VA 2EBFX 4TV9F 3F6BX 3PQCA 3OUTA 4P58A 5BWNA 3AV3A 1I4LD 1RCTE 4ZEOA 3ZI4A 3EHDA 3RANA 3ZW8A 1FP4A 1L8LA 4MTLA 4CODB 1C4WA 2XGOA 2ZXEA 3FKSD 2DUJA 2Q45A 3TPFA 3C4VA 2REBA 4Q3LA 1NVGA 2B4RO 4P4GA 2QAJA 1EWYA 1JPNA 2GHIA 1TMGE 3AX6A 3Q10A 4NBLA 5FNZA 4X6LA 3TD9A 2OECA 1JHZA 1VCOA 3MYRA 3EVEA 1HMPA 4REQB 2GEDA 4KI0A 2QVBA 2FETA 3HRHA 3FRJA 3HBMA 4KREA 3R44A 3JQRA 2IYPA 1FZQA 4AKEA 3WNZA 4L5JA 3BZUA 4LMPA 4PZDA 1IC6A 1NMQA 1T9KA 2P78A 4M1TA 1C0EA 4EO9A 5J5VA 1L4HA 2ZTVA 3NM4A 4RFSB 3ACBA 4HGRA 4E14A 4R2XA 1KEPA 4KPGA 1GZ6A 2P9YA 3HKCB 2C42A 3S1AB 4F3CA 1ZI9A 1SUFA 2GXQA 4QBGB 2QV7A 2XWSA 4A73A 1O9HA 4MI6A 3NHRA 2W2PA 3D6TB 3KHUA 3ZXIA 1RP7A 2OBMA 2F62A 3A3YA 4CKCA 5BR4A 3VBCA 4MRNA 4AM8A 5CXUA 4EMSA 3OFSA 2P68A 4XWOA 2FHPA 4YCSA 1UJBA 4H7FA 5FBLB 3WJ7A 3ZU5A 5C1PA 4REMA 4JY7A 1HLPA 3PDJA 2EZTA 2PKYX 3AP2A 4R98A 4OXYA 1RYMA 2A9QA 2BVNA 2BEVA 2VNHA 3L92A 4G37A 3T12A 2YFYA 3IKJA 3VR6A 5FL3A 3W5IA 2F9MA 1DRVA 2DP4E 5ENZA 5CTJA 2D62A 3ER6A 1QJCA 1OFUA 3G82C 4C7OA 1QIHA 3RROA 2JFYA 5KDOA 1HSOA 1SN7A 3Q8XB 1I1OA 3HNOA 3EXHC 4XW2A 1H22A 1DBSA 4OHKA 4R9NA 3T3MB 1APBA 2CMHA 3GLGA 2RK3A 4YWHA 3LIPA 4YACA 5J59A 1XCOA 5LKRA 5E6UB 5LXTF 2UYQA 3CRVA 3HPQA 4YMIA 3RK4A 4MQEA 3B70A 3LVRE 1L1RA 4BBJA 3PHLA 6YASA 3KZVA 5CLIA 2J5BA 2JZCA 1P1RA 3X2FA 2BBOA 3V4OA 1KZ7B 2JHFA 3DHWC 5CA1A 2GEUA 4BO9A 4GE3A 4DJTA 3KJEA 2YJ6A 4PYKA 2PGAA 2VTDA 1YSCA 5EQTA 1HPLA 3L0YA 5G0WA 2DWCA 1DEHA 2ZUUA 2Z4RA 3AM4A 3I6IA 4OMDA 3AOEA 4BP3A 5ALVA 2H1CA 1UC5B 4GOKA 3O8LA 4OJQA 5IN5A 4AS2A 1HYGA 4AS1A 3SHOA 4WK6A 1PGJA 2R7LA 3KEGA 1DAMA 1L5HB 1TM4E 2DJ5A 3TVDA 5LL6P 1FJ2A 3T5PA 3IQFA 5F3DA 4M1SA 5T3YA 3A6FA 2JLVA 1M2NA 4DMHA 2CBXA 2PVPA 4P98A 2Z3ZA 3A25A 4CQLA 4DA4A 1WVGA 5ALYA 3I9MA 1L7BA 2F90A 2P2NA 3Q15C 4HVLA 4BXOB 5CDSA 4R1TA 2EC5A 5CNIA 4NS4A 3DLHA 3H9CA 1ZI8A 1DKQA 1NSYA 2EX0A 3LUFA 1QTRA 1NBME 3SE0A 2X9LA 2XEXA 5LLDA 4I66A 3DYBA 5DLYA 3MPUA 3A4TA 5LQMA 2CNWA 3QUSA 2XRZA 1ELOA 3FZYA 3GJ6A 4URVR 3PPWA 2Q9AA 1PIWA 1IWPB 4D41A 5FULA 4ZAZA 4A10A 3JX9A 1BW9B 5AVQA 2CBGA 1R0BA 4F11A 1KHTA 1PW7A 2RGNC 3IAFA 4ZYWA 4JBXA 5FPQA 2YWHA 4JLMA 4E31A 1MEEA 2P79A 5G4KA 3F8SA 3HR8A 3CX3A 5FFNA 2ZJ1A 1FXUA 2R96A 3S2EA 3OKAA 3ZIAA 3JVUA 1HDIA 1R1DA 3L9XA 1CV2A 2LCIA 2QM8A 5HGXA 1ZP6A 1S2NA 4PQRA 3S40A 3M1YA 4M1QA 1I30A 1O3YA 1C9MA 2Y9MB 4L5BA 1M6NA 3TW8B 3I58A 4BBAA 3L7DA 4NJEA 5GIOE 2GXAA 3ANYB 4J8PA 1IOVA 1LSOA 2XB9A 3V8PA 2CDBA 1X6VA 3JQCA 2RHHA 1TQ6A 1IHOA 5ECGC 1GADO 1T6ZA 1PS0A 1Z4MA 2EWMA 2QY6A 5LD2C 1V5EA 2RGXA 2QZ4A 4OV6B 4RD4A 5K0TA 1VCHA 1ZU4A 4RS4A 2WP8J 1QFSA 1USVA 4B81A 1ZK1A 2O59A 4LDAA 4V38A 1GCIA 2JGRA 4XASA 1UPBA 3VR0A 1D9XA 3EBLA 3B1XA 4ZAVA 3K6SB 1K89A 4FHCA 2AR0A 2HQBA 1CHDA 4C5BA 3I8OA 2RI1A 2VJMA 2B30A 2QAGC 1D2EA 1MENA 2Y6UA 3NCTA 1A8HA 1RAHA 3PNKA 3VU8A 1N0UA 1R0WA 1Z47A 2CN1A 1I3KA 3DBLA 4W1SA 1YVRA 3CUTA 1EESA 1NASA 2PYZA 1Z2EA 3GMSA 3UJBA 5JVDF 2NZVG 2RH5A 1U6KA 2XUOA 3KSZO 4LHXA 4PZ0A 3I72A 1OZ0A 1KEUA 1O77A 1K5DA 2GAFA 2W98A 4C04A 4EAQA 2AKAB 4X85A 2BFPA 3FPBA 4I8DA 3DFKA 1HYEA 4R5MA 1BC5A 3EFOB 3TS1A 2SKDA 2FTKE 1CUGA 4F7WA 1MP0A 1Z73A 4I19A 2FPGA 2QLMA 2NU6B 2CFIA 1NG1A 1KC3A 2G83A 1Q11A 1SCUA 3ABOB 3E9YA 3NTUA 4MS3B 4PZZA 1CUYA 3NGXA 5K3CA 3CYFA 5JS2A 4EGFA 4ZZIA 1UXKA 5JMPA 4UHHA 4CDNA 2ASVA 1ODJA 3KAQA 3RASA 1Y6ZA 3E9NA 1X38A 4NMMA 3COPA 4B4OA 3OCUA 3WFJA 4C4TA 4XYBA 1KBZA 4BP1A 5J4HA 3RO7A 2I54A 4F97A 1XP8A 1L1QA 1EFVA 3HP7A 2AUNA 3RFUA 3L6CA 2Z2JA 4N7BA 3THXA 2FRXA 2CHEA 1Y6FA 4FNAA 3K0KA 3H6GA 1ZR2A 3D1JA 1MT0A 1UK8A 4IDEA 1UEXC 1Y4DE 3FZNA 1B0ZA 1NF3A 2C96A 3OLZA 4L5IA 3GMTA 4UPVA 1D5CA 9GPBA 4UCFA 2AXQA 2AXEA 2I7XA 3KJZA 4YK7A 2OPBA 1T9GS 1YRQA 1QOQB 2O3UA 1D2HA 1XP5A 2X4LA 2YNMC 3L1UA 3WDMA 4OLAA 2F48A 2ADOA 2D3WA 1E2JA 4UNNA 3SC4A 2GH1A 2V54A 1HFJA 5DGIA 4E70A 5ARDA 4GOMD 4EGSA 2XAAA 1Q0QA 5FV7A 3S4YA 4OLBA 4FGKA 1IEQA 1K7YA 1YR6A 4EB6B 3PRHA 1HDZA 4YIKA 1N2IA 1Z0FA 3GCWA 1P1CA 5EAIA 5KJ1A 2ZZNA 3IUYA 2XCIA 4FFMA 3DT9A 1XTTA 4MOWA 4X97A 1AF4A 1WIWA 3Q6MA 4IHJB 5DHFA 1KOLA 2HT1A 4UULA 1JHXA 2UZ1A 3GRZA 3FGPA 5L9AA 4NRDA 4Q7EA 1VECA 4HTAA 4LY3A 2TECE 1U65A 5KB3A 5KVCA 3EDYA 1OBHA 3RYIB 4EJMA 4EZEA 3MN1A 3I9JA 1EDOA 1PR6A 4YLGA 4NY1A 5B7PA 3NTLA 3KAJA 3MTQA 1ULHA 3K3PA 4R16A 4P4TA 5G53C 2KSQA 1NFQA 4HADA 1KK3A 1L4KA 4Y9UA 3SLGA 3NKLA 5C31A 4LFAB 4OI0A 2OBBA 4NSNA 3TZLA 3F5SA 4NG5A 1TM2A 3NANA 3RJMA 1VL5A 2JK0A 1DRWA 1CLEA 3T7DA 1UF9A 1NUUA 2VJOA 1E18A 1K0UA 3A3PA 1CR4A 3IA2A 1YZGA 1WCV1 3T5DA 1XJ0A 3PXAA 4ZQBA 5T3UA 1UJ4A 3ASVA 3DZ8A 4BATA 3K9BA 1Y9AA 2EBUA 2V7VA 1BA2A 3RU2A 5LC1A 2AN4A 5LOVA 2A1TR 2GCIA 3C3YA 2QT0A 2BEWA 3N6XA 3A4LA 1EUCA 3WLPA 1J9EA 1FYXA 1HOXA 2CLEB 1THGA 1QO7A 1F2TA 1VIDA 1W4AA 2P9CA 2QM7A 3IPLA 3JQBA 3PGKA 3V48A 3OY7A 5JZVA 1HG0A 2BLNA 3CMMA 3W04A 1QHXA 3ESRA 3N39C 4NEQA 5KVSA 3IHTA 3OLCX 4FFBA 1FLNA 1Q2UA 2CFCA 4MX8A 1M5TA 2I55A 4MHOA 2FYTA 2YIJA 3FMPB 3JQPA 3K1ZA 4NYIR 3HKDA 3NKVA 1GQRA 1TQ8A 2B1IA 2Y66A 3C85A 3CH7A 3FLEA 1JEAA 2WU8A 1ZOSA 2KM1A 4URYR 5SV2A 4U3JB 3NB0A 3TLGB 2B34A 3SQDA 3P5BA 2C8VA 1GPUA 2QDXA 4GLLA 2VAXA 3TIGA 3L40A 1MC1A 2G36A 1ZUNB 3TCXB 4MVJP 2FSHA 2XYPA 3P2KA 5CYGA 1CYEA 5FO0A 4ZV9A 4M9CA 1JLKA 2JCVA 3V3KA 2GAOA 3DAGA 1G8YA 3T35A 3LX4A 2FKNA 4PG5A 3LYAA 4Y0NA 5FO1A 3QWFA 1H5NA 2XD9A 3R7LA 3DDOA 3HYLA 1YF3A 4EHBA 1SM4A 1BOFA 3BKXA 4U6NA 1BKYA 3O7MA 2HWWA 1R0KA 1PTJC 3BZBA 3IIIA 2UYGA 3BHIA 3JCZA 4AJ2A 1U2RA 2GM4A 2BP7B 2ZDGA 1LS1A 4P92A 2JVJA 1O94A 3A36A 2R4TA 2RG7A 4MVJE 3X1DA 4RULA 3DBRB 4GEKA 3CEAA 4XSHA 2OC4A 1FZTA 2QE7A 3A9SA 5CA0B 1IY8A 3PXXA 2FG5A 3U5TA 1CZUA 2VI5A 1UBHS 2PCJA 4GQBA 1VLZA 2BAGA 4KO8A 3VOSA 4AJ1A 2VDWA 3Q0EA 4NBSA 3TTWA 4N7MA 3CVWA 2X8JA 4DLKA 2VXBA 3V80A 1JN0A 4A6XA 4QATA 2W6ZA 4RESA 2Q6LA 2OO7A 2PX2A 3E3MA 4D3ZA 2GN9A 5JQWA 1UPAA 4UUQA 3ZCPA 4K2HA 3KT6A 3SR4A 5F3RA 1B0UA 5IAKA 4JBWA 3VYSB 3WLNA 1Y9DA 3K6JA 3SC3A 4EGAA 4B2YA 4LRXA 3ZWMA 2RGDA 4G4SP 2F9FA 3EXEB 1XTQA 3L5OA 1H2BA 2F00A 3TEJA 2VUSA 1TT5A 1UDCA 4TGLA 1CS4C 2OSVA 2C4UA 4U2CA 5E3IA 4TXJA 1FBNA 2A0UA 3JQ8A 3HB1A 3CLRD 3H5RA 3AIIA 5DBHX 2VPIA 3QYAA 1COWA 3REQA 4Z7JA 2P8JA 1W2HA 4L8VA 4ITUA 3GNTA 2OPHA 3UFXA 5CBPA 5H7XA 4QFBA 4LNAA 4M0UA 3TPCA 5AW4A 1RXIA 3T6KA 3VNUA 2PSDA 2RI6A 1IXKA 3V2UA 1OH6A 1MAAA 1FMJA 2J3JA 2PJUA 2NT3A 4RTSA 4UM5A 1EFAA 2UYOA 4H7HA 1UMCB 4X84A 4L08A 3ROTA 3K5IA 3PU6A 1S8OA 2J32A 3PXGA 1VZ3A 3RIHA 1MORA 3E27A 1YA8A 3UJ8A 5JASA 4BNMA 4XDHA 1MQ8B 3INNA 4OHRA 3SS9X 1YONA 1FDIA 4Z3OA 1UXJA 5KYWB 1E2PA 3TIXB 3EXG2 3IVAA 2JIPA 3HMKA 1QIGA 5GPBA 1J8YF 4UVIA 2E37A 2Q1XA 2V0GA 3L4SO 4BUCA 5B3KA 2NV6A 3AVPA 1KMHB 4MPDA 1LX6A 3G9UA 3D4PA 4L74A 3RSGA 3LX5A 1R3DA 2BRUA 2YOFA 4FOPA 1IZ8A 3H1PA 4IFTA 1JSZA 1A9SA 2QRLA 3L8ZA 1W1IA 4MRAA 4RXMA 5CNJA 1KAEA 4Z9BA 4XUCA 5A3VA 1YV9A 1VKNA 4GHWA 4DCVA 1V8ZA 2VNSA 1U3CA 3NAGA 1RM4A 4J3JA 1LPAB 5H80A 3CFYA 1JAYA 1TECE 3KKKA 2I66A 3MCWA 3TK1A 5BNIA 3H5WA 4JI6B 4DTIA 2AB0A 5HJ7A 5KNBA 5MN6A 1C9NA 3NZEA 5AM1A 5TPWB 3WYCA 5K8IA 4JJIA 2PVSA 5AKZA 3VSBA 1XD2B 1PT9A 5FBQB 5K3SA 4HCJA 1EVIA 1EK0A 2YW2A 2ZU0C 3TZBA 1RE0A 3ZVMA 3PEVA 1BX3A 5KNDD 1GUZA 1SAYA 1DUVG 3JASB 3Q85A 4X1IA 3JYNA 4RZXA 2OYCA 1GAQA 2PTGA 4BB9A 1W8IA 1X7WA 1GRRA 3L84A 3UG6A 4BGDA 4KNYA 2CD9A 2JCGA 1TUEA 1EXMA 4LY6A 4CKEA 4RJ2A 2WF6A 1YE8A 1KZ4A 3LNCA 4HGYA 1P18A 2J0UA 3HEMA 1TW3A 4WK2B 3P0EA 1LKZA 1W6RA 3U4DA 4C43A 3RYCA 2D7DA 1J0XO 3VHRA 3M4NA 5BW4A 4NDZA 4PYNA 1KSGA 2ORED 1W1UA 4KQJA 3EAGA 3V3TA 3QKRA 1E5QA 4JUAA 2UUPA 1DKNA 4KQ1A 4FCWA 2IUUA 2X1HA 2C4WA 4XLTA 3U1VA 5I9IA 4HAUA 1OAOC 5I48A 3DDSA 3HVIA 3LLCA 2WWYA 2CWDA 2VL7A 2FPIA 1YMQA 5H68A 5C2JB 4LDQA 3FFBA 3GGJA 5U4XA 1AKEA 3TNYA 1CVRA 1I3LA 4CKXA 2XZTA 4S1OA 2YIDA 1R4MA 3QUCA 1JU4A 3LXUX 1SU7A 2PUHA 4U9UA 2XXBA 5H4GA 1BHSA 3RLIA 1J49A 4P36A 5C53B 3E5NA 3L8YA 3MHTA 2VYCA 4MR9B 1N0HA 1AZLA 2B35A 2VQ6A 3N05A 5FI1B 2VAVA 3SLRA 1WEHA 4HAVA 3B13B 2AMVA 3H2YA 4GKJB 2I78A 7MHTA 2XBUA 1LNSA 3O31A 2XR1A 4GXTA 4Q3EA 3EVFA 2HHLA 3SD7A 4DR4B 4KHPB 3QVWA 4MR7A 2D7CA 4FB5A 4O29A 1C5KA 1Q0ZA 5JDCC 1HEUA 2QK4A 2PA0A 1M7GA 4M9QA 4ZK2A 1E2HA 2OG1A 2P3LA 3EXFA 2FX3A 1U0NA 3FRHA 4EHHA 5AK0A 4GXNA 1JEQB 1NMXA 3SFVA 2YV4A 4J03A 2DWOA 4U2KA 1MJNA 2G3YA 3U49A 1FVHA 3BL8A 1Z18A 3RSOA 1TCVA 3A1EA 4ZPXA 1TLFA 5FBVB 3OJWA 1SVOA 1UZAA 3PIRA 4K9RA 2R1TA 1E1RD 4F91B 1JIIA 1VJDA 1Z3IX 3N0TA 4MO2A 4TMWA 2PKEA 2Q3LA 4NDNE 5DPMA 2WUEA 1DB3A 4PZUA 2GBLC 3UK0A 2NZWA 4EJSA 1VE6A 4YJ2B 2P9ZA 1SKBA 2VAWA 2AHOA 1DQZA 4R0NA 4G5SA 5L4SA 1O5OA 1XJ5A 2R7AA 4DDVA 4DIKA 1Z5UA 1W76A 5DIFA 2YASA 5JQGA 1NVDA 1R6UA 4QUJA 3I8XA 4Y7CA 2X40A 2BOVA 4XVCA 2BJWA 1AQIA 4YR9A 3V1KA 2IHUA 3ZNNA 4EY4A 1A71A 4F3KA 2EVWX 4BFZA 3HJUA 5K4HA 1PWZA 3CZ9A 3VC1A 521PA 1L6RA 4FQ7A 4M0DA 2UVDA 2R87A 5B64A 1JR3E 4DLZA 2B1QA 3CF2A 4HNRA 3NU1A 1QB8A 4M0PA 4DLSA 4XARA 2OL4A 2Q1YA 4F6RA 5EJ9A 3MQFA 4LK2A 2QHXA 1JHOA 3TDMA 4QOGA 1CDOA 3ZIUA 3EFEA 1E3EA 3ID6C 5TF4A 4B73A 3MK31 4FC6A 2AWOA 2I4RA 4PONA 5C3UA 4TZ0A 3K0CA 4CUZA 1UJCA 2F64A 1XNJA 2ZR8A 1TLLA 1MB9A 2WWHA 3BFXA 1W5EA 1YTLA 2WYUA 1Q84A 2ZXFA 4RGYA 1LTQA 1C7EA 3LDGA 1XMVA 2O8DA 1TO6A 2GBFA 3SVZA 4HWOA 2AH5A 1PGQA 2XMSA 4GXRA 1H4TA 3G9XA 4B84A 2QTCA 3OUUA 4LTMA 1CUHA 3PXBA 3EE6A 3FVWA 4LRYA 4KSBA 4XCQA 1D8TA 5JYDA 4O4HA 4OYHA 3ZX5A 5FLEX 4FDLA 2I34A 4XVUA 1O95D 1LNZA 2EDCA 2PMKA 5CLJA 1GLNA 1RHMA 4A0FA 4IV0A 4YQYA 5CR9A 2KPOA 3SDZA 3SZOA 3QU4A 3ENWA 3VC3A 4HFJA 2OXRA 3E9DA 3PEFA 4C06A 4URFA 4RA9A 3NWOA 2DBVO 4ZU3A 4ZRNA 4EMTA 1DOZA 5C3MA 3BFJA 1CY8A 3UVEA 5JCOC 2PPLA 2X0FA 2V9CA 1DSSG 2HD4A 3WLAA 4JYBA 4Z54A 3NDRA 3L41A 3RS2A 5FA8A 1W4LA 3ZDDA 1WKBA 1P7YA 2PSHA 3ADOA 4UE6A 2AI2A 1THZA 4US0R 4LX8A 4PSVA 3ZCUA 1KP9A 1CY0A 2XT0A 4BFXA 5CDGA 5KYXA 3B89A 4R1OA 1FDSA 3VU9B 4BNZA 1J99A 4BVAA 3BXEA 1QQ7A 1BVUA 2VZ0A 2KMLA 4HRVA 3WQSB 2I3BA 2YZKA 5KTSA 5FA5A 1SWWA 3G49A 3Q7SA 3AHHA 2I9KA 1CQJA 4ZQIA 3OOWA 4BO7A 1ZAYA 4ID9A 2N9UA 3CUEF 2W9XA 4W6QA 4L76A 2P1ZA 2ZVDA 3LPMA 3PA6A 4P7BA 5AXAA 2XKKA 1T1EA 2HSJA 1UWLA 4XVRA 3Q1LA 3QVLA 3BH0A 1XNQB 5JSFA 3TNFA 1F0NA 1AGXA 2O2XA 4LE0A 5E1DA 3ZS8A 1T5SA 3L0ZA 3M2TA 4PX5A 3RUHA 2YWDA 4S12A 5ITVA 2DF8A 5F21A 1I4WA 1KZHA 4E0BA 3ER9A 1I14A 2CLLB 2IX9A 4HZIA 3J81A 3AEZA 3SHFA 4UZEA 3FPFA 3O84A 1YMUA 3EF1A 4HN2A 2A2ZA 4C4YA 1YVEI 2FHSA 1PQPA 4NFSA 3NPMA 2WIBA 5THQA 3WGHA 4D82A 3LECA 3U6KA 1E9EA 2YXPX 1OI2A 1BVYF 4Q7MB 4IF4A 5B6IA 2COUA 3KYIB 1EFPA 3FWZA 2AYXA 2ZZKA 1KYVA 4ZQEA 1PDVA 3BJZA 3PGMA 4ZCPA 4BE7B 3HCWA 3GFQA 2D00A 3H4MA 3QVGB 4LCBA 4XGNA 3IJPA 1SPBS 2X0EA 4ARVA 4BOYA 3EIFA 3E18A 2KE5A 2HMUA 4J4TA 3EMVA 4A9AA 5CIYA 5BOSA 1YA6A 2A5LA 3OOJA 1R8QA 4C2TA 2XADA 3F78A 2B5OA 4MINA 4PRKA 3Q5GA 2O9JA 4KACA 3VOAA 3G0HA 3N2ZB 4UKDA 5HZKA 5BMVB 1ZM2A 3CCCA 2OR3A 3CRRA 1TGVA 1DAEA 3O2SB 3PUHA 3UNXA 5FV4A 2XI4A 1YWGO 4FHFA 4DZTA 4DT1B 3IEMA 3CRNA 3H0CA 1RAFA 2OE2A 1Q0LA 3WICA 3C7KA 1J4AA 2VT2A 4MS4A 4UZSA 4OA5A 2H6EA 1LB1B 2AEEA 4XDZA 4MMYB 1VIAA 1SZPA 1XCBA 4G85A 3IDAA 1RADA 4HDKB 4KYVA 4OGWA 4QBIA 5AI9A 4A2QA 5AVUA 5DOZA 1C3OA 1MG0A 3W7VA 1FNNA 1ZONA 3ZNOA 4EATA 1GSOA 1T5OA 1JKXA 1ZESA 2ZRFA 3UM9A 2VTBB 4LFBB 2RHOA 2X76A 1GEGA 3W3AA 3PHCA 3L8MA 3G0BA 2E5WA 2Z5FA 3UGTA 1EDDA 1LPOA 1RQLA 5HM6A 4LJRA 4MDYA 2Q5CA 2I4IA 3FA2A 3O91A 3PNMA 1W87A 4B9EA 3NM6B 3ND7A 1QFXA 1QFMA 4RQTA 4M0KA 4YJFB 3BAZA 1PLJA 2VDQB 3D0RA 3SHWA 3CF0A 3PC7A 2PX3A 4FKZA 1DC5A 3GR6A 5E4JA 1MPTA 4RJLA 5K5EA 5AW2A 4Z0HO 2X8LA 4MCHA 2F8TA 2ZB7A 3W3ZB 5EIBC 2YVLA 4MB6A 1QZXA 3W9BA 2JIOA 1IZZA 1D9ZA 4DSTA 1HDXA 1L4MA 5BW5A 1JKJA 1XA3A 1PR3A 1PV1A 1YZLA 1T2CA 2QD1A 3MAGA 3AL0C 1OWPA 5ICCA 2QW8A 2YQZA 4FK8A 4TS4A 4W5WA 3F49S 4ADSG 4BMCA 3NM5A 4F85A 1WD5A 10MHA 2O8CA 1GVNB 2VPTA 4JBHA 4LJYA 4P3XA 2OZPA 2A86A 2XMDA 3A37A 4XM0A 2FPPA 2H1WA 2WUFA 3PFWO 3IVRA 1PJ2A 3WLIA 4D4KA 5HRCA 3A4YA 4LV8B 3NG1A 1HL3A 2RHDA 2XJ9A 4QFDA 2P3OA 3GJZA 1KH3A 5JO9A 3IAM1 1GEEA 4LWOA 4LPKA 3NHUA 2XGJA 2YC2C 2BKEA 3ETCA 4ZVRA 1EWTA 1PNRA 1D03A 4M1ZA 4PRLA 5CK4A 2VJDA 4KXNA 3V8RA 1RWNA 3PXCX 4L3WA 4EEXA 3H9UA 1YJ8A 4X61A 5I8WA 3DJYA 3NYIA 5REQB 4EH1A 5B5SA 1R10A 1SFRA 3LF1A 4ESHA 4CETA 2IHZA 5JAOA 2OK8A 1SXJA 3BWCA 5BQOA 3N2GB 1RQNA 4PPQA 2P5TB 3OQJA 4IHJF 4Z49A 2CNKA 1G5PA 1SG6A 4UBMA 3HHPA 1DQPA 2P5YA 3TAUA 4F2DA 1YBMA 2ZJ6A 3DUWA 4QPJC 5TDHA 2J3HA 4BECA 4ZICA 1N2BA 2SECE 1C7JA 3ECCA 4XRRA 5ES3A 5I7WA 2WYIA 2P4QA 3G85A 2EFYA 1O2DA 3T9FA 4MDEA 4HXFB 3L7KA 2XZDA 1Z62A 3CXUA 2GPJA 1PF7E 3L05A 4GP7A 3SF8A 1Q3TA 2WHEA 1CJUC 3IA7A 4PR3A 1R8SA 4F9TA 4V3BA 5F33A 1DAHA 4E11A 2H4FA 1YB4A 4JUDX 4B4VA 1PJQA 4WXHA 1XKLA 3HCRA 1KVQA 4KLNA 4DF3A 2QTRA 3OBIA 3MT9A 1LK7A 1XVVA 4C78A 2R1ZA 2B8TA 2RGNA 1FFDA 1IDOA 1LBTA 1OXTA 4DPKA 1UOOA 2NM0A 1U8ZA 2H1RA 3K1TA 4LBYA 5BR7A 4QJIA 2QUZA 5K0ZA 2I1QA 1CF4A 2G63A 4R9VA 1ZN7A 3SJAA 3I5MA 4CM6A 4V2IA 1Z4PX 1E2DA 4XQ0A 2C9MA 3LCVB 3PUXA 4QOFA 1NVAA 5AK4A 2NSHA 3CIFA 5KOJB 5MGNA 3KM0A 4HF7A 4BGIA 2D7JA 2JKVA 4FT4A 2AFIE 1T4CB 3F6CA 1C7RA 1PNTA 4PFJA 1L5LA 1WZEA 3PJEA 3TMAA 3M3HA 3QBJA 4AVYA 4CEHA 3G13A 1Y98A 4JEIA 3D5QA 5H02A 4IJ6A 2VEDA 4QJ3A 1U7UA 5FNVA 3G2PA 3ZCSA 5FTLA 1ABEA 2PWBA 4Z0NA 5HCNA 1MJHA 5FTNA 4DR5B 1KEZA 1L8QA 4IOKA 1U8EA 1A4RA 2UZAA 4N65A 1NUSA 4QG7A 5DJ5A 2ZUTA 1ZK0A 4MVJH 3AEKA 3TM4A 4QO8A 2O2GA 3ASUA 3L7BA 2DLNA 1I3NA 5AK5A 2QAGA 1T25A 3CNLA 1ES9A 3SXUB 4WEQA 4YRNA 1AY0A 4HTFA 4TTVA 4LC9A 4GR9A 4UPDA 4MGKR 3ANMA 4K6FA 2YYAA 4FILA 1O54A 3GA7A 2A3RA 3ZXYA 4GMKA 3LUGA 3A2LA 4M21A 5AOCA 3DZKA 4PV7A 1TIPA 4BVHA 2C0CA 4Q1FA 4YGXB 5CA0F 5E38A 4L4ZA 4BZWA 2I03A