4NIMA

Crystal structure of a short chain dehydrogenase from brucella melitensis
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
267
structure length
240
Chain Sequence
GQLKGKIAVITGSTQGLGAATARLFAERGAQGLVICGRSAEKGRAQAAGLEELGAKAVFVQVDLENVEDCRRIVAEADRAFGRLDILVNAAGLTDRGTILDTSPELFDRLFAVNTRAPFFLIQEAIKLFRRDRVEGAIVNVSSMSSMGGQPFIAAYCASKGALDTLTRNVAYSVLRNRIRVNSLNIGWMAFGRLLDPAKVARAIAFLASEESGLMTGAIVNFDQSVWGAYDGSPHPEKPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Versicolorin reductase
publication title Crystal Structure of a Short Chain Dehydrogenase from Brucella melitensis
rcsb
source organism Brucella melitensis
molecule tags Oxidoreductase
total genus 95
structure length 240
sequence length 267
ec nomenclature
pdb deposition date 2013-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nimA00
1NM5A 1M2WA 1E7RA 1PS0A 3PDUA 4WKGA 3U3XA 3JQFC 3O03A 3I4FA 3OH8A 5ICMA 1PWZA 4ALLA 5TT1A 5A06A 3OEYA 5BT9A 2X6TA 1XWFA 5JO9A 4E5PA 2HMWA 4NPCA 3NGLA 4QECA 3W4JA 2R00C 3DZGA 1ULSA 3BMCB 1GEEA 3WB9A 2ZATA 5B4TA 3UFXA 2Z1NA 3PI7A 1P1FA 1VSVA 1YOVB 2BH9A 3BMCA 4WUVA 5H81A 1H5QA 4DMMA 3FTPA 1G1AA 2IYPA 3D0OA 1PGQA 2X7HA 2VNSA 1YOVA 2GZ2A 3RC9A 4CR8A 2UDPA 3DZFA 3IP3A 1K0UA 4FFLA 2BFOA 3TZHA 1I3MA 2YZ7A 3WSVA 4W9NC 4N5LA 3I1JA 3A1NA 2P9CA 4BO0A 1HETA 3WTBA 1HDYA 2G82A 5EINA 4RVHA 1GPJA 1U9JA 3CZMA 4KP7A 3DR3A 1OAAA 4N5NA 4J4TA 2WYVA 2VTDA 2HRZA 3QVSA 4ZHSA 2H9IA 3GH3A 1TT5B 4HWKA 3DC2A 1PR9A 5DP1A 2ET6A 1BMDA 3E5RA 3IP1A 3ZHZA 2BMAA 1TT5A 4G65A 2C5AA 4J1SA 2EJWA 4H3VA 4KQXA 5CDTA 2ZTVA 1NHWA 1PJ2A 4D3FA 2O50A 1EK6A 2YY7A 5CHEA 4JX8A 4J2OA 5CDSA 3NAQA 2FWMX 1HDOA 1LSOA 1A5ZA 3GNQA 1DEHA 3B1JA 3EAGA 4KWHA 5G0SA 3UOGA 4Q39A 4NBRA 4HX5A 1CJCA 4TRRA 5L7YA 3A4VA 4TROA 1BVUA 4OYRA 2DFDA 1UP6A 1UZLA 3ZWBA 2WYWA 5AXDA 1NQTA 2W98A 1XR3A 3DBVO 3VAZA 4M89A 2BKAA 4U6SA 2O3RA 3WFIA 4N7RA 5IZCC 1YB5A 4J6FA 1E3EA 5T5QA 5KKCA 1P77A 2G5CA 3C7CB 1W73A 4LRTB 1KC1A 5HS6A 2ZCVA 3IUSA 4K6FA 2E82A 4R68A 3RKUA 3CE6A 3QSGA 5CEFA 3GNTA 1ZMOA 2RBEA 3GPIA 3ANMA 1KEVA 3KLPX 4QTZA 1E1NA 3FPLA 3S2IA 2CF5A 1GYRA 1X0VA 4YAEA 3WYEA 4RVFA 4YT4A 3OFSA 5C7OO 1VL6A 2E4AA 1HZJA 3FPCA 4Y6PA 2ZB3A 3WXBA 1QYCA 4M1QA 5DBFA 3RU9A 4PLWA 3BYZA 4XR9A 4MIOA 3AW9A 1XELA 2FPIA 2FY8A 4BO1A 1E5LA 1X15A 3BZUA 3DZJA 5KVVA 2HMUA 3QWAA 5JC8A 2CFCA 1HDRA 4NBWA 5JAZA 2YV3A 3QVOA 1C1XA 2OHXA 3BHJA 4O6VA 3AY7A 4CLRB 1HTBA 5L51A 2CDBA 3WBFA 2Y1CA 3AU8A 1EEHA 4YCAA 1GD1O 4JP3A 3ZWCA 1EUZA 3GK3A 2F1KA 1KY5A 4UEOA 4PG6A 4F6LA 4CLRA 3K9QO 3IOYA 3AOEC 3UUWA 1R15A 3AFNA 4Y67A 3DBHB 1GUZA 2D0IA 5I9LA 4YA6A 1KVSA 4UUNA 4YRDA 4PVCA 1MA0A 4BNVA 2DPGA 4OKIA 4K26A 3DBHA 4E5NA 3KHUA 4U0KA 3U49A 1ENZA 4XGNA 1VPDA 4M8SA 2E6UX 3G17A 3H9EO 4JJGA 1PZEA 4WK6A 3OA2A 4Q3AA 4C7JA 3HNPA 2QIOA 5IN5A 4IGFA 2WD7B 4R41A 3VDRA 1T24A 3L6DA 4RQUA 2V6MA 3TN7A 3L9WA 4FFMA 4KDFA 1XEAA 2AG8A 1BXGB 1EBUA 2HRBA 2WD7A 3LF1A 3F47A 2YFHA 4Y9DA 3PIIA 1E3SA 3JYOA 2VHZA 3O38A 3WWZA 3ZI0A 1HE4A 1BXGA 2C2XA 3EZLA 2X9GA 3HDQA 3WIDA 1QYWA 1MG0A 2P68A 3QP9A 3RJ9A 5ILOA 1GU7A 1HL3A 3IKVA 3ZWAA 1U3UA 4X54A 5T8KC 5L40A 1E1KA 1B2LA 1D3AA 1A7AA 3TZ6A 4ZRMA 1LSUA 1IOLA 3DAPA 2VN8A 4J9VA 1Q7GA 1F17A 2Y05A 1O94A 2FPGA 4OO3A 4RL6A 3VKUA 4DL9A 3MWEB 1PJTA 3KBOA 2YUTA 4PRLA 3GVPA 3SJUA 1R16A 4A0SA 1UR5A 3JQEA 2AQ8A 4E2ZA 1I3LA 1DRUA 2Y99A 3EVNA 3QVTA 3VH1A 1U7TA 1IHXA 1XCBA 2QW8A 4CM9D 3D5TA 4I5EA 3RFTA 2IZ1A 1BTOA 1P0FA 5CP8A 4HNGA 1E3JA 1ZEJA 2J6IA 1ZVMA 1B3RA 1ZEMA 2GSDA 4RQTA 3OETA 4B4UA 1C0PA 1J49A 3ZZNA 3NJ4A 4PG8A 3VPXA 3W1VA 2GF2A 1GZ4A 2EIHA 5IDWA 1E92A 1HE2A 2DFVA 4UVDA 4OSOA 1T26A 3UCFA 4E6PA 4XYLA 2O7QA 3DBLB 3Q9UA 3ZV5A 3GC6A 1G6KA 3OJ0A 3ORFA 4M87A 1PSDA 2Q46A 3B6ZA 3FD8A 3FR7A 1ZUD1 3PTZA 3DZBA 3DBLA 5JDCC 1I24A 4LSWA 4BNMA 1B15A 3JD3A 1PS9A 3GUCA 1SZJG 1OFGA 4FOSA 1E7MA 4MIEA 4GLLA 4MOWA 4OAQA 3G0OA 2OBYA 4TZTA 3ZU4A 3FNHA 3PFWO 3L4BC 1R0SA 3BTSA 4R69A 4WJZA 3Q0EA 1PZHA 1ZBQA 4YRAA 4CM6A 2Q50A 1VL8A 4DWVA 4J7XA 5DCUA 3DWFA 4BVAA 2IODA 4D44A 3IL2A 4XRGA 1OC4A 4OOFA 1ONNA 3EW7A 1P9LA 3OSUA 4DPKA 3GVHA 1YQGA 4XKJA 4B79A 3I23A 4XWYA 3FI9A 4MVJD 3LU1A 1U8XX 4YR9A 1PJ3A 1EFKA 2PR2A 4QXMA 2GN9A 2J3HA 4R1SA 5TT0A 4MVJE 3I9MA 4WPGA 3O8QB 3HQ4O 3LC1O 3R1IA 3HJAA 4IBOA 3SLGA 5JFOA 3CXRA 2X0IA 3LLSA 3DZKA 4GPD1 4ILKA 1TB4A 3WDSA 1FDTA 3CTMA 3O8QA 1Y9EA 1Y9AA 5HWSA 2VHWA 4NJOA 4R01A 4CM3A 5A9TA 2VQ3A 4EEXA 2J5KA 2NWQA 2BF7A 1UDCA 5IDQA 3WG9A 2DUUA 3GEMA 3H3FA 3VZRA 1J5PA 1RM0A 4GAEA 5I8WA 4HUJA 4AJIA 1LLQA 1UUFA 4CUJA 3P5SA 1R66A 3RU7A 1MB4A 1ZXBA 4Q3EA 1CIVA 3AFMA 3EHEA 4PLYA 1I01A 1YO6A 3I6IA 3GPDG 4M54A 4YJGB 4JIGA 1O5IA 4L4XA 3DOOA 3RAJA 1WDKA 1PQWA 1M75A 1YE3A 3BTUA 3EUWA 4WLOA 3U9LA 4YJGA 2O48X 2O2SA 5TSDA 4UVIA 1ISJA 3DL2A 1DB3A 4GX5A 3EMKA 1BW9B 1VRWA 3D5QA 1ID1A 1QMGA 2EXXA 4RPHA 3ROQA 4WNIA 3NEPX 1O6ZA 5JAIA 1PU2A 1BW9A 1T4BA 5B37A 4II2A 2WWRA 2IZ0A 3C7AA 1PGPA 1PR3A 1HYHA 5BQFA 4RPGA 4ROSA 2ZKLA 1ZFNA 4FC6A 4WECA 5AYVA 2J3KA 3RROA 2RH8A 5U4QA 3S2FA 3ZHBA 3IS3A 3QA9A 1GPDG 3OF2A 2C7GA 2XPCA 4CQMB 2NM0A 3SVTA 1MV8A 2X0NA 4YXFA 2CVQA 4R1UA 3ICPA 4A27A 3PYLA 4FR5A 3ZW9A 2QX7A 4CQMA 4KMSA 1I36A 1YVEI 1HLDA 4RF5A 3WSWA 5I7EA 4XRRA 1PGOA 1VKOA 3JTMA 5KIAA 2IRWA 4NBTA 4ALNA 4FJ2A 3ZNPA 4KDEA 4WCFB 1H94A 3BMOB 4HXYA 1R12A 3TOXA 2Y0DA 2IXAA 2PY6A 5L95A 4XDZA 4CMBA 3ULKA 4R3NA 4WCFA 3BMOA 4BNGA 1AXEA 2D3TA 5B12A 4ND3A 3JQGA 4XQGA 5KJEA 5G0WA 2ZYAA 4D3DA 2VOJA 5AXBA 2X5OA 2HK9A 3H9GA 5JDIC 3TDKA 4BB6A 2Y1GA 1MFZA 4C4OA 2BGKA 4O59O 1E3LA 4I8XA 3VZQA 3FN4A 3AU9A 3PJEA 1P44A 1E5QA 3GGPA 1P1RA 4UUPA 5BSHA 3U4HA 1QYDA 5TS3A 3H3JA 3KUXA 2I67A 3ONFA 3QLJA 3NGXA 5H82A 1YKFA 1UDAA 1YWGO 2WSBA 1SEVA 1X14A 1XSEA 2P4HX 5K9ZA 2AHRA 1K5HA 4FB5A 2FZEA 3GR6A 4RVDA 2ZJ1A 4CV1A 2C29D 1DFHA 1WXDA 2FHSA 3GG2A 3K5PA 2TMGA 4NFYA 3ZWWA 2GN8A 1X1EA 3OHSX 3DMYA 3B1KA 3PQFA 4JN6B 4ZRNA 4ZJUA 4XEHA 4MVJG 4AJPA 5MDHA 2W4QA 2D1YA 1EE2A 5GZ3A 2VT2A 4QSMA 3I83A 4Q9NA 4YVFA 2Y93A 4GI2A 1ZIDA 2QYSA 2OZPA 2UUOA 2XF8A 5MGBA 1MC5A 4P4NA 5ER9A 4BNUA 4CQLB 4XQ9A 4BO5A 4OQYA 1ZO8A 4INAA 3AY3A 1D1TA 5A1TA 1OOEA 3W8EA 3UN1A 3ZU3A 4BGUA 1LUAA 4CQLA 1IZ9A 3WJAA 3U4DA 2PA3A 3E8XA 1D7OA 1LLDA 3DB2A 4JBHA 4QFCA 2VZ9A 3UH1A 2V6GA 3O4RA 4XYMA 1YJ8A 1EQUA 1GEGA 3KEQA 4DQUA 4RDHA 1JKJA 2CNBA 3INRA 4NQZA 4ZD6A 4CMHA 1LRKA 3S8MA 3ZHYA 3WIEA 2FZWA 5JMPA 3WGOA 4B4VA 3Q2KA 3VH3A 2BFMA 3I52A 4DREA 1UXKA 2CY0A 2BGLA 3ZV3A 2EP5A 2W2KB 3ZN2A 4DPMA 5C7IO 5IF3A 1I8TA 4IMRA 4HADA 3QVXA 2Y1DA 2EKPA 3IC5A 3RVDA 2P5YA 2W2KA 4MPDA 2I99A 1NWCA 1MGOA 5CPFA 4M55A 3U09A 1LXCA 1CEQA 1PJSA 4NDNE 4OH1A 1MXHA 5BNIA 3IDSA 3C3XA 1GTMA 1GY8A 1C1DB 3OEWA 4P22A 3C1AA 1X7GA 3PFFA 2HK7A 2RAFA 5JS6A 3GVCA 1N5DA 1WPQA 3AI2A 3GMSA 1C1DA 4Q3NA 1E7SA 5G4LA 5JAMA 1KIFA 1HZZA 2Z95A 3F4LA 3UVEA 2X8LA 3VTFA 2B35A 1DFGA 5A5FA 4XYEA 1ZJYA 1N7HA 1A27A 3ZCXA 4QQRA 4CL8A 5EIOA 4UAGA 3I4CA 1NVTA 3FR8A 2JL1A 3QRWA 3MJSA 3FNEA 5A05A 4IS3A 1DIGA 1Z6ZA 3UXYA 1EK5A 5A03A 1VE9A 4LK3A 3CPSA 3P19A 4Z9XA 3GVXA 1YXMA 3DBRB 4XDYA 2VYND 2Y0EA 5KOIA 1BHSA 4YB8A 1JKFA 5HM8A 3DZHA 4J43A 5DZSA 3MJ4A 4MP8A 3DBRA 2WTBA 3W8DA 4BV9A 1E77A 1GYQA 3I9NA 4LMRA 1IUKA 4Y6SA 3EY4A 1NQ5A 5ICSA 1FDWA 1DC3A 4YAIA 1DLJA 1JVSA 4BNJA 1YL7A 3JQBC 1X13A 1W8DA 2H1SA 3L6OO 2FMUA 3U4CA 2QRKA 4CPDA 4LCJA 4MVJA 1WMAA 5FFFA 5K6AA 2F00A 5TF4A 4CV0A 4N54A 2OXIA 4FFPA 5LCXA 4A26A 2YHUA 4HKTA 4W99A 4MO2A 3KB6A 4E33A 1ZK4A 3PJDA 4L76A 4BGVA 1I2ZA 1Q7CA 4DBVO 4PN3A 1E6EA 2I3GA 1UZNA 3OQ6A 5H83A 3WOHA 3KO8A 1LNQA 3AY6A 1LDBA 3W4IA 3I9KA 2DTDA 1XIVA 4P38A 5EQFA 4N18A 3Q3CA 4BKPA 4RO0A 3WR5A 5DP2A 3B1FA 3ZNOA 4D42A 4E0BA 1O89A 5JPIA 3V1TC 3B20A 4QO7A 4DC1A 2Z1MA 4PG7A 2GLXA 1HYGA 1KYQA 3EC7A 1U1IA 1U3VA 2B4RO 4E30A 1BDMA 3NTOA 1UAGA 3T4EA 4DPLA 1WZIA 4KWIA 3TF5A 3F46A 3FSRA 4OSPA 3UKOA 4AL4A 4TRJA 3M1AA 1JQBA 2IXBA 4IJUA 2JJYA 3OECA 4YACA 4NNJA 2PTGA 5CDYA 1K3TA 1P31A 3PWSA 2O4CA 4NG5A 3DHNA 3DMTC 1AE1A 4CM8B 1QLHA 3JYLA 5IXSA 4CM1A 4CM8A 1H6AA 1LA2A 2HDHA 1H93A 1E3WB 2UAGA 1TVEA 3UAGA 4IQ0A 1G0OA 5A5EA 4B8ZA 2VCYA 4XIYA 4L0QA 1YQXA 1SC6A 2ZB8A 2GDZA 4ZICA 2H63A 4ZGWA 1ZK1A 2JFHA 1X0XA 4IMPA 3GN2A 3KVOA 1IYZA 2X9VA 3ICCA 3JQ9A 3PYMA 4W82A 2E49A 4RVGA 4WOJA 1ISFA 1EDZA 1Z74A 1MX3A 4YAGA 1PGNA 4IZIA 5I7FA 1YL5A 5JY6A 1M66A 1HWYA 1XU9A 4BO3A 3KEOA 1S6YA 2G1UA 4J1TA 2AEJA 4NU5A 4R51A 4ZVVA 2UYYA 1JKIA 1HDCA 4RVUA 3WYCA 3S2EA 4M49A 1T2DA 4NFSA 1NPDA 3JQAB 4DIOA 4BKOA 1C0KA 2B4TO 3JQAA 4TQGA 3WGTA 1R6DA 2EG9A 5TJHA 4BB5A 3LLVA 3ZWVA 1P1KA 4CM4B 3GZ4A 3GG9A 3WGQA 5DDIP 1CYDA 2PGJA 7MDHA 1RYEA 5DOVA 2CMDA 5G2OA 4CM4A 1O0SA 3OIGA 1BSVA 4XR4A 4AJHA 1Z45A 1DJQA 3JQDA 1VJTA 2EWMA 1E0DA 4I08A 2VUSA 4E2XA 4LVCA 1FDSA 3PHLA 1YBVA 2B4QA 2Q99A 1ML3A 1QSGA 3GNSA 5F1OA 3F5SA 5AVOA 5JCJD 4F6CA 2EP7A 1P0CA 4CV3A 4Z9YA 1GZ3A 5L45A 1DBVO 2HMSA 3LDHA 1LQTA 4PLCA 1JN0A 4AG3A 2GO1A 2X0JA 1F8FA 3FNGA 5B4UA 5CEEA 4YQZA 5EN4A 4CQMD 1OC2A 5GY7A 3OIFA 2EGGA 1B8UA 2V7PA 4E12A 1K6IA 3NUGA 5I9NA 4CMKA 4PZEA 3RUEA 3QHAA 1NPTO 2PLAA 2Y66A 3FBTA 3JSAA 4CMAA 1QYVA 2Q49A 3WJ7A 4L75A 5HA5A 1NXQA 3WTCA 5T64A 5JYDA 4BIIA 4NK5A 1JA9A 1J0XO 5L4SA 3F5QA 1PZGA 1VLLA 2HCTA 1EFLA 1C3VA 1T1SA 3VVCA 1CDOA 2DTXA 1OBFO 3BMQB 4E2YA 1NFFA 4ITUA 1HYEA 1Q2XA 2GUGA 4D3SA 2P4QA 5F5NA 2NU8A 1H9BA 4URFA 4NIMA 4GX0A 2O3UA 4R16A 3TL3A 4DMLA 3VPHA 4HNHA 1U3TA 2DC1A 3ENNA 2H6EA 1JTVA 2B83A 3RUFA 2O23A 3V5NA 1RM3A 2PZMA 4CMEA 2OGUA 4CLHA 1IL0A 1M6HA 4PVDA 1W0CA 4CMJA 1OI7A 3TFOA 1I3KA 3JD0A 2ZIZA 2NLOA 1OMOA 4FPXA 2HJSA 2ZTMA 4OJNA 2X5JO 3K2BA 1GFSA 3AUTA 4U7WA 2QZ9A 1YL6A 4WNCA 4EZBA 3ASUA 3L9XA 3GDFA 3PJFA 3DO5A 4AJ4A 4DLBA 4PGFA 1P1IA 3SBOA 5IAAA 3K92A 3H5RA 3KZVA 3R6DA 1KVUA 2PZJA 3HHPA 2Y68A 3RQSA 4XCVA 5C5IA 1NASA 2OO5A 4FGSA 3MCVA 4GKBA 4PLPA 4UUOA 3PHHA 3NTRA 1LJ8A 2HKIA 4LRSB 2RCYA 2C82A 1A71A 1HF3A 1SEPA 4BNHA 5TLSA 3ZW8A 4BO2A 3BHIA 1MC4A 4YRBA 5JAQA 3RBVA 3WLFA 4JK3A 1DDOA 2VYNA 4HFMA 1B8PA 3K96A 4H15A 1ZNQO 5JLAA 2AXQA 1H6BA 1KBZA 1QYXA 1HT0A 2CDCA 4JXKA 3ITDA 2X9NA 1DSSG 2BRUA 1NFRA 2X4GA 3HADA 4NBUA 3N7UA 2PK3A 3STHA 1PQPA 4TZKA 3ETDA 4R3WA 2ZYDA 2B69A 3QVWA 4GSLA 1BRMA 1Z75A 4YEDA 4J49A 2Z5LA 3MOGA 1E6WA 4QX6A 3PP8A 4BNWA 2FR8A 3K73O 3GEGA 4A5OA 1GR0A 3GT0A 1HSZA 2VZ0A 4LMPA 3FTNA 3LVFO 1H2HA 2FOIA 2I65A 2UUPA 3E48A 5COQA 3D4OA 5TX7A 2Q2QA 4XYBA 3GA0A 4RV9A 2YV1A 1NR7A 3VTZA 4WLFA 4XIJA 4AJ2A 4FJ1A 4Q3BA 4TRMA 4JBGA 1HEUA 1WP4A 3ZWNA 1XQ1A 3MOIA 3NJ8A 3IJRA 4MINA 2RH4A 2FRDA 2GERA 4BNYA 5EPOA 4D0SA 1GCUA 1XU7A 2VHYA 3JYNA 5JSFA 4IDEA 3OA0A 4J16A 1I5RA 1KVRA 3WX0A 4DQVA 5JBIA 4F3YA 2BFAA 1LDEA 4MKRA 1CRWG 1ISHA 3RI3A 4WEQA 4CLOB 1C14A 1ISGA 2X86A 3RUIA 4YT5A 3VVBA 5JXWA 5JCXA 4XGKA 3OJEA 2G0TA 3FNFA 3F4BA 3C24A 3KYBA 3R0IA 4GX2A 4CLOA 1V3VA 1YBAA 5JW6A 3ONDA 4BNTA 1XHLA 4DLAA 5TRTA 4ND1A 3ZU5A 3AUAA 4CR6A 1H6CA 4BO8A 4LSMA 2W2LA 4RDIA 1K6XA 3BTOA 3CKYA 4A73A 1E7QA 4IDCA 3WQQA 4XB2A 4XD2A 5TNXA 4FJ0A 1FXSA 3H2SA 4ZQGA 4OM8A 1HE5A 4PZCA 1WDMA 1B0AA 3PQEA 4B3JA 1F0YA 2GN6A 4KUGA 4FC7A 4XQEA 4E5YA 2PV7A 3QWFA 3MJCA 3LF2A 4MDHA 3KYDB 1I10A 2Y1OA 4AJ1A 5BSGA 3RJ5A 1U28A 3UW3A 5G4KB 5I9MA 2QRJA 1NQAO 3KYDA 4PZDA 4DA9A 2QHXA 4OIMA 1Q7BA 5G4KA 4YTEA 3SC4A 1DOHA 2ZK7A 3JQ7B 3Q11A 3WGHA 2W90A 4NBVA 5EL0A 2WD8A 1BGVA 1Q1NA 3DONA 2DBRA 4NR0A 3JQ7A 4P4LA 4TWRA 1T2FA 3AOGA 1GQQA 1ZK0A 5JMWA 3JQ6A 3PHGA 1RKXA 1T1RA 2AQKA 4IJKA 4WEOA 4OXKA 3UGKA 2HAEA 1NHGA 4QO8A 2OL4A 9LDTA 1FJHA 2WJPA 1AHHA 4J4BA 3K31A 3ZWPA 3D3EA 4LW8A 2HJRA 1ZSVA 2G76A 1HE3A 3WLEA 5BSFA 2A92A 4EJ0A 3H65A 1HDGO 1M67A 3V2GA 4D41A 4MIYA 4LN1A 3S2GA 1SPXA 2GZ1A 3JCZA 1D8AA 1JAYA 3A28A 3ANLA 4ZQHA 1O9BA 4D43A 4ND4A 4O1MA 3WQSB 2EGHA 4BS9A 3GN1A 1H0KA 1KETA 1U4SA 2PD6A 5JCJA 3C7DB 3JQ8B 2BHLA 3H2ZA 1P45A 5U1PA 2GPTA 1BWSA 3WGZA 5ILGA 1A9ZA 3JQ8A 3B70A 1VC2A 1XA0A 1B16A 2Q4BA 4OGWA 1VM6A 1XKQA 3S1LA 3OMLA 4ND5A 4BGIA 2QQ5A 3GOHA 4GX1A 1A9YA 1DPGA 3DTTA 2CDAA 1GQ2A 3CSDA 3D64A 5FYDA 3KTDA 4G5HA 2BELA 3C85A 1J6UA 4IDBA 5L53A 2ZTUA 3FWNA 4DGSA 4ZN6A 1EUDA 1ISIA 3JQAD 4R1TA 2C54A 3E9NA 3NT2A 1A7KA 1E3IA 1CWUA 3ZWXA 1I0ZA 3W6UA 4FIZA 1T2CA 3LZ6A 3TRIA 1HKUA 5DBGA 5IDXA 4KZPA 4HFJA 3WBBA 3AJRA 3DXFA 5J23A 1XLTA 1TXGA 3AM3A 1EUCA 5DN9A 3G1TA 3PDJA 3RC1A 3OQ1A 2X5KO 1E6UA 3PQDA 2XAAA 1UDBA 1KERA 3CINA 1DC6A 2YJZA 4UEKA 3ROKA 4EUFA 5FI5A 5JO0A 2RHCA 1UP4A 4RZIA 2PKQP 1QLJA 3ASVA 2ZJ0A 3ST7A 5IJZA 1C0IA 1NVGA 3A9WA 2QZZA 2Q2VA 4R5MA 4GSKA 3SEFA 3VC7A 1PJCA 2DU8A 2VRCA 2Q4EA 4WLVA 1RPNA 3MJEA 1Q0QA 5A9SB 5CDGA 3FWZA 1EE9A 2EW8A 2WMDA 2NU7A 3CIFA 4A03A 5A9SA 4BV8A 3RSHA 2G17A 3AWDA 1N92A 1ENYA 1O8CA 5B1YA 1LBEA 5T6BA 3DAGA 3GRPA 5ENDA 3OJFA 5BR7A 4NJMB 2CZCA 1EVJA 4B7XA 4E21A 2PZLA 5IZ4A 3K2EA 4IZHA 5I7VA 2Q1WA 1MP0A 3GHHA 1RJWA 4NJMA 4IQGA 2O3TA 1D4FA 3H6KA 4OQZA 1XG5A 3QIVA 5IXYA 1EVYA 1NYTA 3H4VA 3ROPA 1LQUA 5F5LA 2HMVA 1EBFA 3BAZA 4W6ZA 3T7CA 3JQFA 4IJVA 3TZCA 3IJPA 2VZ8A 1RYDA 5TGDA 4K1LA 4IPTA 1PIWA 1IULA 1KEPA 4BQPA 5F1PA 9LDBA 5KVCA 1ZH8A 5ADHA 2NVWA 3E6AA 3GVIA 1E7WA 4Q3CA 4XX0A 2R00A 2I76A 5LC1A 4TRNA 4ALIA 1YDWA 4QFDA 1ZW1A 2NACA 4J91A 3FCOA 4R54A 5L4LA 1V0JA 1QORA 3C8MA 3PHJA 1ORRA 4ALMA 5FWNA 2VWPA 4XJTA 4MVJM 3UICA 2Y1EA 3V8BA 5KJFA 4LGVA 1Z73A 4EYEA 4DVJA 1QG6A 3OBBA 3OM9A 4O63O 3PPIA 4W9NA 1YBMA 4PFJA 2JHFA 2FR0A 1IY8A 1GAEO 4W4TA 4DBZA 4J1NA 3RCBA 1N7GA 2ILTA 4KTTE 4E2WA 4LISA 4IDDA 1ADGA 1XGKA 4EW6A 1NFQA 4GL4A 4CUZA 2RIRA 2NTVA 1L7DA 1W4ZA 3NDIA 4OL9A 4MP3A 4QUKA 1EVIA 1R37A 4GWKA 4DRYA 1HDZA 2R6JA 1ZMTA 1PTJA 3RUHA 4KTVE 2NADA 2CVZA 3EVTA 3RC7A 1LDGA 3X2EA 4CM5A 2D5AA 3NT4A 3CMCO 3QY9A 4MVJF 1EZ4A 2HMTA 2HLPA 2B5WA 3ZH2A 3KM0A 1PJQA 4J0FA 1UXHA 3JQCA 4K28A 5IN4A 4EUHA 1ZSYA 5KNLA 1GDHA 4D45A 3I3OA 1VJ1A 3MZ0A 3UHAA 4YAJA 3ONEA 4Z0PA 4WCDA 3GAFA 4Y98A 4HY3A 1ADCA 1GUFA 1OZAA 4K6CA 1VL0A 4PLHA 5TJ9A 4E5KA 1E7YA 1G0NA 4IS2A 2GRAA 3H5NA 4GLOA 3ADPA 1L1FA 4FFRA 3JYQA 4WGGA 3BHMA 3E9QA 3GEDA 4BL5A 2D4AA 3E18A 3R3SA 4WCFC 4IGEA 5KVQA 3OICA 5EESA 1WLYA 1X1TA 3KSZO 1TT7A 5F1KA 2A4KA 3HN2A 3IQDB 4PG4A 3KETA 1PL7A 4CMGA 5CFZA 2Y0CA 5FI3A 4ALKA 2P9EA 5JYEA 4B4WA 2JCYA 3NKLA 5IZCA 1GADO 4JP2A 4MJLA 1NAIA 2ZYGA 5L4NA 2NVUB 3MEQA 2OUIA 1T4DA 2J5RA 1AUPA 4NU6A 1VI2A 4CM7A 1DLIA 4EEZA 3S55A 3E5MA 3HSKA 3PWKA 3H7AA 2NVUA 2P91A 3PLRA 4S3MA 5JC1A 3G3EA 4RLHA 4DTIA 5B4VA 1T2AA 1GYPA 4II3A 2W8ZA 5DNAA 2JKVA 1HXHA 3E03A 2PGLA 1FMCA 1DIRA 1ZK3A 4WLEA 3U62A 1LEHA 2QYTA 4BO6A 5KWEA 3DAFA 3I9JA 4O0LA 1Z82A 3IKTA 5GZ1A 1U5AA 1MXFA 3WFJA 4PCVA 4GVXA 4TSKA 1AGNA 3HDYA 3MTJA 4JBIA 2B37A 3V1YA 2A35A 3W8FA 3ZHXA 2DPHA 3KLMX 2EJVA 3PIDA 1Q0LA 2DVMA 2O3QA 3D3WB 3E1KA 2JD0A 2WE7A 2BI8A 5IG2A 5AXCA 2O4UX 2NUAA 3D3WA 4F45A 2V65A 4GGPA 4BNLA 1I3NA 2W2LD 5T67A 3HG7A 3AM5A 5BNTA 5EQDA 5TIIA 3H8VA 2Q3EA 4J90A 1IPFA 2PD3A 5KJ1A 1U7HA 2E48A 3WNQA 1VSUA 5JE8A 4E3ZA 1S7CA 3AOEA 4BMSA 1DIHA 4GMGA 4GH5A 3GGGA 1I30A 1UP7A 1E3WA 3WGIA 1GZ6A 4JLWA 3GMDA 3ZU2A 5JY1A 2JD2A 4MKZA 3RBXA 1JAXA 4TKLA 4RJTA 3PGXA 2OP0A 2NQTA 1BDBA 5L7TA 2IDZA 2NU9A 4B7UA 4R9RA 2D5CA 4YJFB 4DYVA 4YQYA 3GY0A 3GLQA 3ROMA 4RCVA 4YJFA 3UF0A 5A02A 1F14A 3AUUA 4L8VA 2Y67A 4ONEA 4ND2A 1NTOA 1R4NB 3RWBA 3ADOA 1Z7BA 2NTJA 5AXAA 2X1HA 4B4OA 5KCZA 2AW5A 3F9IA 3CEAA 1SMKA 2P9GA 4KQWA 1R4NA 3ZGYA 1KC3A 1YB1A 3VHRA 4D0RA 1JLLA 3K6JA 5COAA 3BA1A 1BVRA 1KEUA 2C7VA 2RHRA 5T8KA 1K6JA 3BTVA 2CSUA 4L4RA 4AJOA 2V6FA 4CLXA 3LT2A 3MJTA 3VDQA 1E1LA 4H16A 1HLPA 4I9UA 3GFGA 1B3BA 1F06A 5EJ2A 4AJJA 2NNLD 1PS8A 2AQHA 5DCYA 4UUMA 4EDFA 3MTGA 1M76A 4IDFA 5ITVA 4YWJA 4QEDA 1SBYA 4O5OA 4XJSA 4NHEA 2PH3A 5ENVA 3W4KA 1N2SA 1ZKMA 3ZWMA 1PZFA 4CODB 2CVOA 2HO5A 2DM6A 1ULUA 4BNFA 3DTYA 3K30A 4FN4A 2OBNA 4KOAA 4XGIA 1UJMA 3LYLA 5DULA 3ZWYA 2EEZA 4BNXA 3IIEA 4I1IA 3AUSA 4YJDA 4I9NA 1IB6A 4WLUA 2VUUA 3RFXA 4N5MA 1DHTA 4RPLA 4RORA 2I66A 4S1VA 5L7WA 4JJFA 2VWHA 4H7PA 1NR1A 3RUCA 2EKLA 5F3RA 5JDCA 2DTEA 3DQPA 2J3JA 4IIVA 4L4SA 4OXNA 5A3JA 4EI2A 3DFUA 5K6AC 4RPKA 2GR9A 3C1OA 3OQBA 2C07A 2VRBA 1ZCJA 1QV6A 2DKNA 2OP1A 3L4BA 4FSHA 3H9JA 2PWZA 4XQCA 4OKNA 3PHIA 1P1JA 2AEMA 4ZQFA 3IAHA 3INGA 4G81A 3TNLA 1X7HA 3KV3O 3OJLA 2IYOA 2QG4A 4NZ9A 4FW8A 1SOWA 2GD1O 2EV9A 1BXKA 4UVEA 5C37A 2B36A 3HWRA 4LCEA 1H6DA 1LSSA 2O3SA 3BMQA 3D4NA 5AOVA 3QV1A 1U4OA 1QKIA 1RM5A 3V1UA 4I5DA 5LDGA 1B14A 4CR7A 3NDJA 1QXSA 1SO8A 1NP3A 2GCGA 2VRCD 3ABIA 1IZ0A 2FP4A 1SB8A 5G0VA 1YS4A 2JCVA 3PJGA 1V8BA 3PZBA 4GVLA 3QW2A 1DFIA 3QJ5A 3GFBA 3I9LA 1LRLA 4BKUA 4A2CA 3ON5A 4PLTA 7ADHA 4R5HA 3M2PA 4Z6KA 5ES3A 1K89A 3HE3A 5F21A 1GCOA 3VKVA 4YT2A 4U6QA 4OOEA 4U8GA 1DXYA 2C59A 2IZZA 1C1XB 5FEUA 3QWIA 4XZ3A 1PJBA 1TA4A 2C20A 3W6ZA 1PL8A 2WDZA 3N74A 1Y5MA 3PLNA 3VH4A 1WAMA 3CMMA 2X0RA 4IUYA 5C3MA 3O26A 1P33A 5BNFA 2Q2WA 2PGDA 3KOUA 1D1SA 4AJEA 2Y1FA 5DOZA 2OOSA 1PGJA 4J1QA 2PKRA 5L9AA 4W7IA 1ENOA 1U2DA 4AFNA 4DLLA 4ESOA 4J4HA 5HRUA 4DIBA 4TKMA 2POQX 2YQ5A 3JQ9C 4G2NA 3WWYA 3ZNQA 4XYGA 2XOXA 3C1TA 3LC7O 1NAHA 3N58A 1LI4A 2O7SA 3ENKA 4LVUA 4E32A 4A10A 4CLEA 2EF1A 2H5LA 5CDUA 2JAPA 1KY4A 3M2TA 2D59A 1XQ6A 2TMDA 2VUTA 4P4GA 1SAYA 2CF6A 2GN4A 1LU9A 2PFGA 1WMBA 4U0JA 4B3HA 1XYGA 3LT4A 1K2WA 1V3TA 5A04A 1UXJA 2VYVA 3G79A 3NT5A 1IHYA 1UAYA 4IJWA 2EERA 2OORA 2YDYA 3EZYA 3Q9NA 3TL2A 1YJQA 2E37A 3L77A 3RUDA 1LSJA 4BMVA 2FSSA 3F6YA 4BNKA 3M1LA 3LK7A 3DZIA 2AA3A 3L6EA 4Y6RA 1ONOA 4GWGA 2D8AA 1YB4A 1A4UA 1P3DA 1PJLA 1CQJA 1UXIA 2YYYA 5G0TA 1KOLA 5GMOA 3JV7A 4CLDA 3HUDA 2ZB7A 4BNZA 5ITWA 3DHYA 3WNVA 4J3FA 1QP8A 1SB9A 2FSVA 2JAHA 4Y8VA 4RVSA 3AI1A 2PNFA 4FQ8A 5I8ZA 1Y7TA 3TZQA 1SCUA 1ENPA 5DBIA 3LQFA 1ISMA 4BNIA 3Q6IA 2YW9A 3TQHA 4K9DA 3INTA 5JDIA 2Q45A 4B8WA 1N9GB 3GDGA 1Y8QB 1VKNA 2EHDA 3EK2A 1I2BA 3HB4X 4WASA 1HRDA 5CAEA 1LLCA 1N9GA 1Y8QA 1AN9A 3ZWOA 1Y5RA 2A9FA 4Q3DA 3FHLA 3VZSA 5DCWA 1F12A 4PRKA 3PZRA 3TJRA 2DBZA 2ZQYA 4MVJH 5TQVA 1CF2O 5HS4A 3P2OA 4IDAA 4UEJA 2NTNA 2WEKA 4L9RA 4IQ8A 4IM7A 1T2EA 4BNNA 3VOSA 3PYXA 4HBGA 2JHGA 2WM3A 1PJ4A 1NX6A 3ZV6A 4J7CA 3L0DA 4I5GA 4JCOA 1YRLA 1Y8RB 4CUKA 2ZCUA 4BO9A 3DEYX 3F1KA 3MJVA 3PWZA 4BHTA 4IIUA 1Y8RA 3VPSA 4BOYA 4E4YA 3HDHA 3BIOA 1Y6JA 3JD4A 2C2YA 4DC0A 2GNAA 4YBZA 2ZQZA 3U4IA 2GASA 1Q0HA 2AEFA 4CMEC 3RD5A 4WLNA 3H5AA 4KUHA 4I5FA 1T25A 2I9PA 4IDGA 4RF3A 2BFPA 1PX0A 2AE2A 2WE8A 3GZNB 3NV9A 3PXXA 1UZMA 1V3UA 2HQ1A 2J5QA 2NVBA 2JFGA 5K0ZA 1MLDA 3LSYA 1NNUA 1W6UA 3GZNA 3TFQA 1ADBA 3Q2IA 1HDXA 3PK0A 4YAKA 1FDVA 4ZU3A 3A06A 5A3VA 1LLUA 1R4MB 2Q1UA 1J4AA 2B0JA 1R0KA 4BUCA 2JFFA 2VNAA 5FF9A 1FF9A 2HU2A 5KJCA 5LDHA 2BD0A 3L4SO 2ZB4A 1R4MA 3DFZA 4FCCA 4FGWA 4PLFA 3RASA 4PG5A 5IDYA 4A7PA 8ADHA 2X58A 4FD3A 4YPOA 1TI7A 5KVSA 4AVYA 3D7LA 5KTKA 1WWKA 4JJIA 4BGEA 3IMFA 4MVJP 1LRJA 4B7CA 4GBJA 1LDMA 4JQCA 1QRRA 2AQIA 3T7EA 1R0LA 3M6IA 4UVGA 1DO8A 2DBVO 4L73A 2EKQA 4NMHA 1WNTA 3T4XA 4GMFA 1N8KA 3VPGA 2HK8A 4IXTA 2OFPA 1NQOA 1DJNA 1BXZA 2UV8A 4GKVA 4MP6A 3HN7A 5THQA 1LTHR 4M86A 1PL6A 1HSOA 1N1EA 2YDXA 3D1LA 4CMCA 2EW2A 3TPCA 4FS3A 4OMUA 3PVZA 3E82A 3FF4A 3KXDA 1Y1PA 8LDHA 1FK8A 4EBFA 3WYBA 2PH5A 3I5MA 2JCXA 3WS7A 4DYDA 4XB1A 4PLVA 3SC6A 3DDNA 2LDBA 3QE3A 2VOEA 1V6AA 4RF2A 3VPFA 3G49A 5DT9A 2I5PO 2Q1TA 1Y81A 1ZK2A 4I9HA 1JVBA 1MUUA 1X7DA 3FBGA 3RUAA 1IE3A 2CD9A 1ARZA 2YFQA 3GAZA 3P2YA 2X23A 3SX2A 4AICA 3R3JA 1CETA 3OP4A 4R9SA 1LC3A 4XA8A 2V6BA 3GQVA 5A4DA 1B26A 4UREA 3JQBA 1VJ0A 4MVJI 5KKAA 2HUNA 4AJKA 3JQGB 2WYUA 1EMDA 3I9OA 3RBZA 1DC4A 1H9AA 2DLDA 3IUPA 4UULA 5EERA 4CJXA 1DAOA 1DC5A 2BLLA 4YT8A 1GV1A 1JW9B 1WVGA 1U8FO 1WZEA 4PLZA 1U5CA 4J0EA 3A14A 4E31A 4E5MA 1GQYA 4R4JA 4DUPA 1TLTA 1L7EA 4RGBA 5THKA 3LT0A 1ZZEA 4FDAA 1UH5A 4BMNA 5IFLA 1NBOA 4EITA 1MFPA 3I6QA 4ID9A 3HDJA 4ZA2A 4IINA 1AHIA 4NK4A 3KSDO 2XXBA 3QWBA 1C0LA 1KVTA 4ZQBA 4EJ6A 2B5VA 6LDHA 1JWBB 3JYPA 5EMHA 5CG2A 5AQ1A 1M6WA 1XDWA 3BMNB 3KRTA 3VH2A 3ZV4A 3EGOA 1LX6A 1NPYA 3LC2O 4OXYA 4RPJA 4EUEA 1P1HA 4MKXA 4J7UA 2I3AA 1B7GO 2VTEA 2C5EA 2VT3A 3BMNA 1I33A 4W7HA 2ZTLA 3EDMA 1QR6A 3GHYA 1E1MA 2YQ4A 1JDJA 1SNYA 1SOVA 2DT5A 2GGSA 1DRVA 2GYYA 1U2GA 2YHIB 3PRJA 3PGJA 4Z3DA 1F8GA 3KSUA 3ZNNA 2AG5A 2HSDA 2YHIA 3GRKA 3UCEA 2DQ4A 2YV2A 6ADHA 4Z0TA 4F46A 5COBA 1U3WA 3DMTA 2Q1SA 3KYCB 5ER6A 2IEDA 4FOOA 4ALJA 1LDYA 3COSA 4NH4A 3NYWA 3MWDB 3JD1A 4EGFA 3E9MA 1WDLA 5HBRA 1N1GA 1WW8A 4TMFA 5TC4A 3WGGA 3TOZA 4D46A 1TEHA 3KYCA 4OHUA 1AXGA 3L07A 1FDUA 1KEWA 1NVMB 4R1NA 3P7MA 2IEBA 2VWGA 2CUKA 1CERA 3X2FA 3TZKA 3H9UA 2BGMA 3U5TA 1A72A 4NFHA 4RF4A 4EJMA 1IPEA 4Z0HO 3RKRA 4B3IA 1RWBA 4NI5A 1PWXA 3U0BA 3VZPA 3CZRA 1YQDA 3BXXA 4BO4A 2PD4A 2FN7A 5CPBA 4BKQA 1DHRA 3SXPA 4FFNA 3H9QA 3GUYA 4UVHA 2VHXA 3NRCA 3HB5X 3WICA 3HZZA 3TWOA 4BO7A 1EQ2A 1KS9A 1V35A 2QRLA 4CM9A 4J9UE 4D79A 4YDRA 4IY1A 1LDNA 3GDOA 3GF4A 3O9ZA 3QQPA 1DIBA 5G0UA 1ZXLA 2O2YA 1MG5A 2LDXA 3F1LA 4U5QA 4E13A 5A9RA 3F3SA 4WE3A 4AJNA 4PLGA 1EVZA 4HV4A 1PEDA 2VHVA 3Q1LA 2J8ZA 2JD1A 3OJOA 4KUEA 4DQXA 3EYWA 1YONA 2DBQA 3WQRA 2NV6A 3AM4A 3RC2A 3RFVA 3UCXA 1CQIA 3DOJA 4JROA 1BG6A 4CMIB 5C7LO 1DRWA 1KVQA 4JGBA 3NTQA 2VYVD 2AE1A 4CMIA 4HP8A 2AMFA 3HFSA 4QT0A 3WMXA 4Z3KA 3TSCA 3ITKA 2VWQA 5CG1A 4IXWA 4GQAA 3D4PA 5I7SA 1H2BA 2PZKA 4RZHA 2FPPA 4JNKA 2X22A 4BQRA 4ZQEA 2P5UA 2J3IA 1PQUA 2GZ3A 3GGOA 4FFOA 1P74A 1YGYA 4C7KA 1NWHA 1JU9A 2DAPA 3HFGA 1RM4A 4HFNA 2C0CA 4DIFA 4AJLA 3NDRA 3SJ7A 5T57A 1ONPA 1ZSNA 3SLKA 3RIHA 1A4IA 4YYZA 3QWHA 5U9CA 2BI7A 4RLSA 1V9LA 1GL3A 3K8ZA 1QV7A 1Z7EA 3FRJA 3WMWA 5KJ6A 2IE0A 1YDEA 3CUKA 4J2HA 1DIAA 4TVBA 4D7AA 2NU6A 2XXJA 1GV0A 3ANNA 1ADFA 2OMEA 3PEFA 1GUYA 1LC0A 2O3JA 3JD2A 5HTOA 3G1UA 2I6TA 2DUWA 2D2IA 3V2HA 5BSEA 4FBGA 2SCUA 3ETEA 4BKRA 1DAPA 1O95A 4P8RA 5GZ6A 4YJHB 2NQ8A 4DXHA 3ZDFA 3OIDA 3CH6A 5CEJA 4HFRA 1I32A 4Z9FA 3V2UA 1YH3A 5DF1A 4YJHA 2FR1A 3ETGA 3AI3A 5JNLA 4GGOA 2A94A 3NX4A 4CV2A 4CL3A 2NSDA 1UXGA 1I2CA 1ZJZA 3LT1A 2UVDA 4WOKA 2R2GA 1JWAB 3DHEA 3DOCA 4TVOA 4L74A 1B8VA 4PIVA 2P2SA 3AK4A 1EDOA 2PKQO 3WGYA 5L3ZA
chains in the Genus database with same CATH superfamily
2VF8A 1C2TA 2PWAA 2B7CA 1UIMA 3GIWA 1KZ1A 2NO4A 3O03A 3PDUA 4ZYUA 1W4RA 2QMUA 5JCPA 3I4FA 3OH8A 5F23A 2XMZA 5BT9A 2D54A 3QA3E 5BRNA 5KSZA 5KKNB 4TUYF 3FE2A 4E5PA 1K6EA 1NJGA 2HMWA 2I6FA 3NHBA 4HDKB 3EEBA 5CB4B 5ES4B 1NBHA 1Q5PA 1MO4A 4PR0A 3IR7A 1RXEA 3G7UA 5B4TA 4ENVA 3W8RA 4LJYA 2YJ3A 5A5GA 5FAXA 1H5QA 3CX6A 3I76A 3IR5A 2QLTA 3BOSA 1MZVA 4G8JA 1SD5A 4Q1BA 2WUEA 2GZ2A 2Y1WA 3RC9A 2UDPA 4CVNA 3KFLA 3Q3EA 1H42A 4UTNA 3Q8LA 1WMDA 3DPSA 2C83A 4FFLA 4AP6A 3SJZA 4XFKA 2BFOA 3TZHA 1QRSA 4LUCA 1I3MA 5DYYA 5DGCA 5DHRA 1XDUA 1ZLXA 3HVHA 2A30A 3A1NA 3D7NA 3SF0A 3EGWA 3WTBA 1Z6QA 4KODA 2G82A 3VPBA 3LHDA 1AQ6A 4P84A 3M34A 4FHFA 5IJ9A 5LMNB 3IQWA 2IYYA 1GPJA 1CULC 1NRJB 1U9JA 3K7EA 1TTPB 3C45A 4X60A 3UMSA 2NXEA 1E3TA 3A6DA 2WYVA 4FR2A 5G40A 1SXHA 4ZHSA 4C4XA 4P0TA 2W6ZA 4ZOLF 3AUKA 1NXWA 2VK4A 3AV0B 3DC2A 4HATA 1A4RA 1KGDA 1BMDA 2ET6A 3IP1A 5FA5A 5A4JA 2BMAA 3G9ZA 1DU4A 2GCNA 3KKKA 1TT5A 4G8DA 4P2BA 3P20A 5EJMA 5GONA 3OX2A 4AZVA 5B57C 1IN5A 3HJRA 2BGGA 4G65A 4QVKA 1W19A 2CYAA 3GJ6A 1UBHS 2HEIA 2IYSA 3C8HA 1JTEA 1B0UA 4GHWA 4H3VA 4JDPA 1KOJA 4RD6A 4ENPA 4QQFA 3AEQA 5K8IA 1Z8HA 4WNAA 1PJ2A 1G2PA 3E53A 4D3FA 4EHLA 3C6KA 4J6EA 4K6GA 5FTKA 1Z8NA 3QE9Y 1HX7A 2O50A 2QRNA 3WIOA 1WS6A 2JJ8A 4UHBA 1L7OA 1CDEA 3L8HA 2ONCA 4TTVA 4BFCA 4ZC8A 3K35A 5CHEA 1KZHA 3GLIA 1PO7A 3FTCA 1XZNA 1XXHA 2FWMX 4R40A 4BAZA 2Z4RA 2JLXA 2C58A 3RHZA 1E20A 4X5OA 5K4GA 3B1JA 3ZXIA 3A1EA 4PFKA 1THMA 5JCZA 1CJCA 3QTBA 3F71A 5F52A 5L7YA 3RT9A 4O5AA 4EW1A 2Z56A 4TROA 3KKOA 5CA0A 4L07A 4OYRA 4YRMA 2DFDA 2B4KA 1NT2A 5D3QA 3U1TA 3VISA 4EB6B 1CT9A 3FMOB 5BW6B 2W98A 1OYWA 2OBFA 1ESNA 3CCFA 3DBVO 3UMBA 3ZHRA 1GPYA 1WV1A 3F8TA 3IAS1 4ZCTA 3DCYA 2J33A 5GJVC 3HSYA 3TX2A 3RHTA 1W76A 1M2EA 2BN4A 2H4JA 3C7CB 3EODA 3H86A 1RS0A 1W73A 5K2MA 1KC1A 2ADMA 5AIBA 4YUWA 2ZCVA 5BURA 4LHEA 4KQEA 5JSZB 4RTNA 2E82A 2VI5A 4R68A 5E7QA 4ZEWA 4L8LA 3ANSA 3PNOA 4ZT2A 2AV6A 2IYLD 5DW0A 4KR6A 3S7TA 1ZMOA 4INPA 2HWWA 2W6NA 4QTZA 4QUEA 4DWOA 2JVKA 2M6SA 3BS4A 1KOFA 1OIVA 3IE2A 2B61A 1GYRA 1BFKA 3B9PA 1LWNA 3L7KA 4YAEA 4C0AC 5ALEA 3WYEA 4QKQA 4YT4A 4BLOA 3CUWA 3OFSA 1GKYA 3L06A 4GUAA 1U94A 4LJLA 3THRA 3WLOA 5ESWA 1O95C 2F67A 1GFIA 2E4AA 1HZJA 2BF4A 3FPCA 4OPMA 3TG2A 4M1QA 1UBKS 1G8MA 2FPIB 3O2JA 2PUBA 2HFJA 2I0FA 4URUR 4PLWA 5C8YB 1KZ7B 4MIOA 1FYFA 1L7QA 1ESCA 3IJ5A 4NQRA 4YQEA 4RE5A 1AUVA 1XB2A 2JAQA 1JQLB 1X15A 3DZJA 5CXSA 3IVXA 3X1DA 2HMUA 4CTJA 4EGJA 4NBWA 2SECE 4OHFA 1QK4A 3CO0S 4O4HA 4IICA 5ECYA 1C1XA 4GKJB 1L5FA 5CVCA 3AY7A 3VNSA 5L51A 4UM8B 4Q01A 2Y1CA 1KEZA 1EEHA 3AC0A 3ZKAA 3NCHA 4JP3A 5JH7B 3ZBTA 3KTAB 4MB6A 2QUKA 2G5GX 4UEOA 5EJGA 5JEDA 5F78A 1NVEA 3IOYA 4M9UA 4EUSA 1R15A 1TQHA 3AFNA 4Y67A 5DXAA 3QF4A 1Q22A 3S1AA 1KVSA 2WBLC 4ICIA 2ATIA 3IAAA 2E89A 3HV2A 1MA0A 4UUNA 2DPGA 5CRIA 3QIAA 3DBHA 1X7WA 4UM5A 1ICIA 2R6DA 2F4NA 1J7KA 3KHUA 5FBVB 1SUIA 1VPDA 2QV0A 4K6HA 1LPBB 1N0VC 2E6UX 1RXIA 1DKNA 1FVXA 1D0IA 2JLBA 5FBRB 4C7JA 2QZPA 3HNPA 1KMMA 4KQJA 2QROA 3W8NA 2FE1A 4KR0A 3UA4A 3AVXA 2FSFA 1IXKA 5HMMA 4ZI7B 1QVWA 1Z0ZA 1XEAA 3FRIA 2AG8A 2WD7A 3PIIA 1P39A 2WVHA 1FDRA 3KK0A 1Z22A 1ANKA 2JS7A 5FL7D 5K51A 4E07A 1P75A 2C3UA 5TQ0A 4ZYVA 4RDXA 1HE4A 3HDQA 1PEAA 4EA6A 3WIDA 5FTMA 2QD4A 3VUFA 4AMBA 4PE5B 1RMYA 1XVAA 2YFKA 4ZAVA 5ILOA 1COWD 2BEJA 2EBFX 2HIAA 4IHQA 4OBBA 4X54A 3N2LA 3QVGA 1B2LA 3PDWA 4X41A 1A7AA 3GA7A 3H8JA 5LBIA 2IHKA 3DAPA 1GPNA 4OO3A 4C0LA 3ICVA 4RL6A 3VKUA 4D3ZA 4F2GA 4UW9A 3MWEB 1YI1A 2QW0X 3M49A 4M8NE 4OTZA 3SKXA 1I3CA 2QN7A 4LTDA 3QBJA 4OGKA 1XWIA 3RSZA 3RTAA 3T5DA 2YUTA 1Y3HA 2H1RA 3IUYA 3GVPA 3Q10A 4U39A 1M34E 1KU0A 2FX5A 4NBSA 2BTQA 1TAUA 3LGAA 1MC1A 2YVKA 3FZQA 3HY6A 5JD3A 3RSGA 5MF6A 2IE8A 1U7TA 4I99A 4CM9D 2QW8A 2QSJA 3TBHA 3OLWA 1NUAA 1H9CA 4B46A 4ZZ1A 5AVSA 1ZR2A 1UBGA 2QMYA 1Y8ZA 5PNTA 3RFTA 1V71A 1BTOA 1P0FA 1UK9A 2DHCA 4KDCA 5LA6B 3TD6A 3FPAA 2PL3A 3D6NB 3CLSD 1B3RA 1AS2A 1ZEMA 1LFDB 1M2NA 2B2CA 2R86A 3OCVA 3QUBA 5FI1B 4DMFA 1VIYA 3X43A 2UYQA 4XFJA 1SOUA 4RHCA 3X1WA 3SQXA 4TYYA 1GFZA 1F3LA 2CHGA 2PMCA 3DT9A 3WLRA 5KNBH 1E92A 4UVDA 1S0UA 1I2DA 3O0TA 4TT8A 4AWXA 1T26A 3D81A 2DCMA 4RU1A 1E2HA 3NONA 2O7QA 3T41A 3VYVA 4FCTA 1G6KA 3OJ0A 4JLKA 4OUDB 1X7ZB 4M87A 4H4EA 4B2YA 3LM8A 4QXOA 3FD8A 3IBGA 5EC8A 5IC6A 4DABA 3BVPA 4M1SA 3R3XA 1VE6A 4ZMBA 3ZXUB 1MX9A 5JDCC 1IVSA 1UODA 3RWMB 1XT6A 2ENUA 5CD1A 3LCUA 1RWPA 2UUAB 1UKCA 4XTCS 5AW1A 1SZJG 1OFGA 2AI1A 2ODPA 3K05A 4N0DA 4YFYA 5FPHA 4MW9A 3HN6A 4NCNA 5D3MA 2CLKB 3G0OA 1QH0A 4TZTA 3ZU4A 1VB3A 4RV4A 5KI6A 5HKAA 3TR5A 3V1MA 3GPLA 2G09A 1JS1X 1L6RA 1TKAA 1GGHA 3DO6A 4ACBA 2X9QA 1FE8A 3AKZA 2I03A 1B2RA 1VL8A 1BXRA 1F0NA 2XZDA 1Q3KA 3K3PA 2NSHA 4FSDA 5DCUA 4DWVA 1C9YA 2IODA 1T4MA 2IPAB 3C7TA 1BN6A 1XZIA 2O57A 5D8DA 3G9UA 5K3AA 4GNKA 3PEWA 4KFCA 1CFJA 1OC4A 4ML3A 3G0IA 1L8XA 1I4OA 4IAOA 2ZI3A 3QE2A 1JKMA 5JVDF 2YVUA 1FA9A 4RACA 3KQWA 4XWYA 2Q4TA 2XDQB 3I12A 3LU1A 1AMNA 4R2WA 2WWXA 2PR2A 3L43A 4NZMA 3TRFA 2WHQA 2GN9A 2WIKA 3R75A 3HLKA 3EPHA 5ALTA 3BIXA 4MVJE 4YCJA 3UJ3X 4CYMA 3QFSA 5EKSA 3AHJA 3SR4A 4U02A 3O8QB 1GVHA 3OG9A 3HQ4O 3C5WP 3HJAA 5EJEA 1JHPA 3DLHA 3AVWA 1N2HA 2WNIA 1JFFA 1Y9EA 2J6HA 5B7NA 1SQ0A 3BDVA 4RA6B 5E4YA 2V0GA 4NJOA 4CM3A 1OA0A 1VPEA 2VSXA 3QPBA 4R2KA 1C9MA 4OL0A 4XSHA 3IBSA 3CS3A 2FEOA 1E4EA 3UV6A 3G1WA 3OF3A 3DTVD 3HM2A 1ETUA 1FPQA 1M74A 5IVHA 1QIGA 4R7GA 2DUUA 1XD8A 3GEMA 2FEAA 1YC2A 3BGDA 3H3FA 1GZVA 2ZZNA 4Q82A 1RM0A 2JZOA 3AX6A 1G98A 3FYTA 2P35A 2GLTA 4NMXB 3RB8A 4GAEA 4C78A 3T7DA 1ECCA 1NW4A 3DO8A 5CBPB 1VBNA 4YRTA 3OMXA 2ILVA 4GGMX 4JXZA 1ZHFA 3PKIA 4S1TA 4UMDA 1UUFA 4RADA 4R6XA 1ZMRA 4B3GA 4KJZA 4BJ3A 1U2DC 2LNDA 4QDKA 1EEXB 1CIVA 4Q3EA 3AFMA 4PLYA 2YZKA 1XDZA 4R1OA 2B1QA 1GU0A 2OFWA 4D4GA 3BQNB 3PC6A 3PFBA 1O5IA 1NMEA 5SYAA 1UPCA 3DOOA 1V7PC 3KJHA 1V7ZA 1ZN7A 4BLTA 1WDKA 3EUWA 1CUWA 1M75A 2F43B 2QTWB 3CPEA 5K03A 3NEYA 2JBAA 3M33A 2Q2OA 3W5IA 5TSDA 1N6RA 3KYIB 3P9ZA 3U2QA 4JI6B 4QBGB 1IQ0A 4HOYA 4GXQA 1QJ4A 121PA 1DB3A 3WKBA 4HEHA 1IBCA 3QLVC 5KTTA 3EMKA 4C0QC 4CEIA 2GUWA 1IEQA 4NCBA 4ZXPA 1CFZA 2LR0A 1WY7A 3AHHA 1MVLA 1BHJA 1L3CA 3GA5A 3I6ZA 4WNIA 4Z9AA 2O8CA 5JAIA 1PU2A 4RLQA 1RYMA 3DZDA 4RD3A 4II2A 2WWRA 1KI4A 4IO0A 3IAXA 1RPAA 4X20A 1DAGA 1PGPA 1H3NA 1U2QA 1Y6QA 2GXSA 1PR3A 3OJWA 4Y2RA 5AJYA 3PRKE 4WECA 3V7FA 4FC6A 4FYWA 5EP4A 1G5IA 2J3KA 2RH8A 3QF7A 1KO5A 2VH1A 4J0IA 5EXTA 3IEPA 1XTQA 1D4ZA 4CE6A 1OGIA 2OO3A 4JQZA 2OVBA 4ZOEA 3U7QB 4DTCA 2G9UA 4UPEA 4IZ6A 3D8HA 4LFBB 3ELWA 1K75A 3PQ6A 4OFWA 1MV8A 1VLJA 1AF7A 2X0NA 3BN3A 3GGJA 4YXFA 2MYUA 3LOUA 3ZW9A 1MW8X 4BJHB 4LF5B 3C6XA 4WHMA 1EFPB 3O47A 4DQ0A 1IZYA 4RF5A 2RHTA 3AR5A 3MUEA 4PNHA 1GO2A 4HZUA 3UJDA 3ZDAA 4P5DA 1PGOA 5JD4A 1XP8A 1XZBA 3EOZA 4M1OA 3KXPA 4HTFB 2MSCB 5ESDA 1N36B 4MRSA 1WXIA 3O95A 2HCFA 3BMOB 4HXYA 4U3JB 2BONA 2Y0DA 4Y7DA 3OZIA 5KYYB 4GR9A 2DUNA 2C77A 1KAQA 2WTEA 2GPYA 2IF2A 4OI4A 1H22A 2AN4A 5J2UA 2WW8A 3SPXA 3R7LA 1IN1A 4WCFA 2EQ5A 3HSSA 3I2GA 4O4LB 3U16A 3NVDA 4ND3A 1W1IA 2DYKA 1E8NA 1MNQA 2ZYAA 3DYBA 3IX7A 3PKZA 3KWLA 4Z1MA 1IN7A 1J9ZA 4HDNB 1JF8A 1GRQA 1MFZA 1YZKA 1VJCA 3FDFA 4C4OA 4EGCB 4YP1A 3KXLA 1SXJC 1TJNA 4DXDA 2HU7A 2GFQA 2B8EA 2ACKA 2WZBA 5IAOA 3AJEA 5C1OA 5LLTA 4X66B 5AW4A 5DJ5A 3AU9A 5KU7A 2XSZA 3BA6A 3QHPA 3PJEA 1P44A 2E2WA 2JGJA 3O4HA 3WY9A 5BSHA 2X13A 3TXYA 3U4HA 3VOTA 1R9GA 1I13A 5E4JA 3T61A 1R0BA 3H3JA 3KUXA 3ONFA 5DBEX 2GILA 1YKFA 4TWBA 3C98A 2FUNB 4P4SA 2WSBA 1T91A 2VP2A 5H68A 4C3OB 4YWHA 1X14A 2ZJYA 1SBQA 2AFIE 1RJ9B 1ZVKA 2XRZA 4C0KA 2JLAA 3EYAA 4G85A 2M9MA 1NJ1A 4LJ9A 4EUNA 4AIRA 4NFYA 2P5TB 3E1GA 2CCGA 1R5JA 4Z1OA 5AI0A 2WUWE 5GADl 2GN8A 1KAHA 1Z2NX 1ZN9A 3DMYA 1DEAA 4KZKA 2FWIA 2ID9A 1Y4DE 4WQMA 5BYJA 2EWVA 4JVOA 3OCXA 3ACCA 1NBME 3DEAA 2WSMA 4RVNA 4JLDA 4AJPA 3I28A 3PGMA 2XTJA 2LWIA 2D1YA 1V8FA 2W4QA 2VT2A 3E7DA 3RT1A 4G5OA 2Y93A 1QGZA 3RIXA 3TLEA 2QYSA 4H77A 2ZUSA 4LBYA 1MC5A 1XHEA 2QY9A 4XQ9A 1JEJA 4OQYA 4INAA 1K7YA 4D92A 2Y6UA 5YASA 5A1TA 4MGYR 3W8EA 4CQLA 3FPGA 1CDZA 4GSYA 2PA3A 1JKJB 1PFQA 3A2MA 2PT9A 1BE0A 1D7OA 3LUAA 2RCNA 2VZ9A 4XYMA 4KQHA 1EQUA 3M5CA 2BM1A 1IMOA 3R0JA 2EFGA 4OJQA 3A2LA 5U4XA 4BCCA 4YECA 1TYZA 3H99A 2C9OA 4RY2A 1MR3F 3CRNA 2HGZA 1SVWA 2FZWA 4ZP1A 3WGOA 2LV8A 1XQYA 1NI3A 4B4VA 2O5EA 3VH3A 5HZMA 3WKEA 1S2GA 4FYKA 4OMDA 4DV0B 1SUAA 4US0R 4UCXA 5LZ9A 3I52A 3EUAA 5IX8A 1GOTA 3ZN2A 5CGQB 5REQA 4TQUS 2G7MC 3IA7A 3FMVA 3N39C 4IMRA 2HTFA 4HADA 4KBGA 5HCUA 1OX4B 2P5YA 2W2KA 1Z4KA 2I99A 4HDRA 1MGOA 1FEZA 2BFFB 2RBKA 4M55A 5IUNC 4N3NA 3U4QB 1XKTA 2IS1A 3CLHA 3IDSA 1GTMA 1VKJA 3OEWA 3SNKA 4F2HA 3TPFA 5IEJA 1QS0B 4L85A 4DUGA 2J87A 4JVLA 3Q87B 3U6BA 2HK7A 5IK2A 5JS6A 2GA9A 1MAUA 1RZ3A 4DBLE 3SZLA 3ZZ1A 1JHRA 1E7SA 4UTXA 5G4LA 1X7XA 2H17A 1VIMA 1RXCA 4NICA 5D7BA 2X8LA 2B35A 1DFGA 2IGBA 5A5FA 1Z62A 2H06A 3BKXA 1OHHA 1N7HA 1JG3A 5FB3A 3TXXA 3SLRA 3R7FA 3ZCXA 4PRYA 4ERNA 4XIGS 1QX4A 5EIOA 4AO7A 4HAZA 4LAFA 1QUFA 2JL1A 3H2GA 4L0MA 4V1CB 4DWJA 1YDHA 1FSZA 1HQCA 4IS3A 1PVOA 4G23A 1EK5A 2Z8YM 1D09A 5A03A 4HVLA 4Z9XA 4EUKA 4B75A 2CVHA 1CTQA 4L4ZA 4XDYA 3VJRA 1S4QA 3NNSA 5CVTA 2ZE6A 4HEA6 4M6WB 2D1RA 3V8NA 3CVUA 1JKFA 5HM8A 4QEZA 2F64A 2HCJB 2IZ5A 2FWRA 2O1XA 4MP8A 3C1UA 2RDMA 3DBRA 4BV9A 4XDGA 2UYCA 2BJWA 2P2YA 1MHPA 3JATB 3W05A 2REOA 4DLWA 3RAEC 3HBNA 1QX3A 4FBMA 3EFBA 5FR1A 2Q5EA 2XMQA 4FXPA 1C2YA 4BECA 3G9XA 4Q34A 1IUOA 2AZDA 1G2IA 4BNJA 5BPHA 4D8YA 1V96A 1Z35A 5FT9A 4TMXA 2H1SA 4ZODA 3O74A 3U44A 3ENVA 2FMUA 4BVEA 3ERCA 2WFAA 4OHXA 3RODA 3RIYA 1WMAA 1QF9A 1SELA 4WZAE 5FFFA 2WWVD 4XVCA 5K6AA 4CV0A 4X3OA 1CUUA 2RHJA 3AIKA 4BY9E 5ADVA 2WT4A 3G2NA 2LKCA 3K72B 5F7XA 1U3GA 2FN9A 3L0IB 5EGSA 4MO2A 4A2WA 1DAMA 4JP1A 5BUSA 4YUZA 1ZK4A 4AI6A 3MTBA 1MO2A 5DGXA 1I2ZA 2CSXA 4V0MA 1E6EA 2JIMA 4ZTUB 5E6SB 2NP7A 3OQ6A 4E09A 4O3FA 2G3YA 2NV2B 4OFZA 1LNQA 3ZIAD 1VP3A 4OCZA 1LDBA 1DRJA 3R4CA 3WSTA 1ZONA 3UK0A 3SR0A 2GXUA 1C7ZA 1YAHA 1RI1A 3Q3CA 4N18A 1Z88A 2NZ2A 4BKPA 4HH1A 5FUVA 3M6MD 4QUHA 4M0LA 1T8RA 2H65A 5JPIA 3B20A 2NT3A 3E9EA 4MUIA 1KSGA 3JR3A 5HKLA 3PEEA 1E18A 3IQGX 3EC7A 1U1IA 3UXMA 1U3VA 2B4RO 3O8BA 5EP3A 3VV2A 1D9XA 1UAGA 5C3UA 1DCFA 2EFDB 1B0ZA 3HA5A 4G1FA 3UWKA 1WZIA 4KWIA 3PTAA 4YJ2F 2IS6A 4W9MC 3D02A 4OSPA 4HQFA 5FFMA 4AL4A 4OX9Y 4ARSA 1V4NA 2VDMB 3M1AA 1F9EA 1U2GC 1JQBA 2EOAA 2LPMA 3A58B 3KQSA 4UMEA 5B30A 4RA9B 2C2OA 1CW2B 3ZJ5A 3OECA 5KAMA 4HGOA 5LYJF 3TSYA 4NNJA 1WLSA 1ZI6A 3P9SA 5FO1A 2VHUA 1H4TA 2HTEA 3U26A 3UHJA 1S8AA 4ZT6A 3B13B 3DV9A 1EXNA 3DHNA 3DMTC 3GLRA 4HEJA 2PUFA 2IUUA 2DPXA 3VKWA 2YYZA 2Y1LA 4QGSA 4DCUA 1IIRA 3AETA 4TLLB 2CDNA 2HK6A 3QX8A 3JSXA 4WN9B 4OB8A 4CM8A 4FWBA 2DKOA 4DT1A 4LZWA 4ZQIA 2FSPA 2RI0A 2QTVA 1SR8A 2UAGA 1TVEA 1S9HA 3LIPA 3KZOA 4PIPA 1ILWA 3UAGA 2O0KA 4IQ0A 5A5EA 1TJ4A 1NJ8A 3IUEA 2R6FA 4XIYA 4L0QA 1YQXA 1SC6A 3ABOB 1T9CA 4OQDA 5K3OA 2FOXA 4ZICA 3M6UA 1U0RA 1X0XA 3EQ8A 1QHSA 1UPFA 2NYRA 1IYZA 3JQ9A 3JXEA 1L0BA 3KVOA 3QI7A 3MXTA 3RJTA 3D6TB 3H87A 3IDAA 1JQKA 4RUKA 5KVAA 1ISFA 5JADA 1Z74A 5IKEA 1MX3A 3CBGA 4UBKA 3N1UA 1YL5A 4F72A 4JFAA 3HCOA 1HWYA 1RZRA 4HWGA 1KDOA 1QH8B 1RI2A 1RE0A 1T2UA 3NM6B 5IAKA 1C1HA 3GEPA 3KKQA 1EGVB 3UV3A 4R51A 4PYRA 4PZ0A 1HDCA 3WYCA 5IU6A 3GLFB 1OH6A 3S2EA 4W1RA 2ZI6A 2YCBA 1ELOA 1C3JA 4NFSA 4B17A 3Q8MA 4S05A 2HXYA 3LKDA 3PFCA 4F3RA 3MTEA 5DI3A 3JQAA 4UM9B 2CLMB 3FROA 3FCUB 1R6DA 3KSMA 3QG1A 4G26A 4KGZA 4BB5A 1SVLA 4ZI3A 4K2AA 3H0EA 1Z5NA 5B1DA 2CC2A 2C4UA 2P3LA 1V26A 2YIVX 3WGQA 5JALA 1G8PA 1CYDA 2PGJA 5DDIP 4BE7B 4ZFNA 2CMDA 2K7FA 5KOJB 3B1XA 4XWAA 3L7AA 2ZS7A 1BSVA 4XR4A 5KYWB 3IVRA 4AJHA 3C3YA 3TQRA 1DJQA 2CN1A 1SN7A 2PZFA 2VUIB 2EWMA 3G6KA 4UARA 2XD9A 5I7AA 9ATCA 3AXSA 1TA9A 3M4NA 1XNRB 3DBIA 3PHLA 5BQOA 3P4UA 4GG1A 4IV5A 4JLNA 4O2BA 1AC5A 5JCJD 3GJ3A 3ZDXB 1IOZA 1SH7A 3R41A 3OWXA 2X5XA 3S2ZA 4CV3A 4Q4HB 2LZ0A 2J3MA 1B00A 1CZUA 1P4AA 1DBVO 1RKBA 1A5BB 3A1VA 4RM3A 3ZJ4A 3KPYA 4YDSA 1LQTA 5FPKA 2RGNA 4GRAA 2X0JA 4ER0A 1V37A 1NI4A 1AKRA 1WTCA 3VFDA 4JQOA 3SGLA 3WZ2A 3U7HB 1RXWA 4ZV7A 5EN4A 4KVGA 1LV8A 2SKCA 4F91B 3MTDA 4A16A 5LBUA 5GY7A 3OIFA 2CXHA 2EGGA 1KZ9A 1E79A 1KI3A 1V5WA 2V7PA 1X9GA 3E05A 5I9NA 1OWMA 1A9PA 4CMKA 1M6NA 5BNWA 3KAQA 4B3SB 4P32A 4GIBA 3RUEA 2C00A 2B7LA 2PLAA 3W78A 3OVMA 2C7RA 4BMZA 2CNKA 5BN4B 3H04A 3QENA 4D0NA 4AS3A 4P6VF 1KIAA 1NTRA 5FH9A 2AWNA 1JTFA 4EHKA 4QT4A 1RC0A 3DUFA 2VHJA 2GBGA 4NE2A 2YYSA 4FFVA 4ZZ3A 5DM70 3OTHA 3HFJA 2EQBA 3VPCA 3MTIA 4BIIA 4CTOA 1D0VA 3ASZA 2VJQA 1VSQA 5E8JA 5I48A 1PZGA 5IH3A 3MGAA 4Z1MD 1MJFA 1ZRSA 5IT5A 3KB8A 1EFLA 1T1SA 1GLVA 1HTTA 3A3KA 3UQZA 1JFRA 3RYFB 3VVCA 4JQSA 4E2YA 1N77A 2PT7A 4ITUA 2BR4A 4D3SA 1RI4A 1PT8A 5F5NA 2GHQA 1U1CA 3GT3A 4EY6A 2FFJA 2JGDA 5DSTA 2EW1A 3HGMA 3VPHA 1YE8A 1Z5VA 2J85A 1AKVA 2D2FA 2DC1A 3M5PA 4JLSA 1G16A 4E5VA 1OFUA 2O23A 5EEGA 3V5NA 4WX2B 1ZAKA 1IJBA 4ERXA 3EG9A 3NIBA 1ODKA 2OGUA 1INLA 1IL0A 2CJFA 2J48A 4PVDA 1N0UA 1W0CA 1CJTC 3OY7A 2WTMA 3M6XA 3PNQA 3BREA 3KJEA 1OI7A 3LS2A 1V45E 3Q7PA 4GP6A 2MMCA 3N8NA 4MV5A 1R6BX 2HJ9A 3TFOA 1IAVA 1I3KA 1R9JA 1M2FA 3O84A 3PXCX 2ZIZA 4KDRA 4J0HA 1N2GA 4RETA 1NM5C 1OMOA 3OZVA 1SQSA 4QODA 2OCKA 3GFQA 4FPXA 3V55A 4DEVA 3BF7A 3EGCA 2RGDA 3MT8A 3K2BA 1GFSA 1ZNWA 3IHLA 1N2CB 4NMLA 2OBXA 2RJNA 5A7GA 2MCFA 2VJMB 4AKHA 3GDFA 1QKJA 2WJVA 3A7DA 3DOFA 3M4XA 4UUBA 2WUGA 4PGFA 3DMRA 5EP2A 1YJBA 2DG2A 4D8TA 1RLJA 4MDFA 4F4IA 1XCOA 2FAXA 4DDKA 1W34A 3IFSA 4HJXA 2Y68A 1KY2A 4FSXA 3RYIB 3U7FB 3SXUA 2EIXA 3CM0A 2BBWA 4PYQA 5FWDA 3D6FA 1YOBA 1MORA 1T3GA 3LECA 3Q3HA 4LRSB 5KHOC 5IJ0A 1ETHA 2C82A 3BJMA 4ID3A 3ZW8A 1JDBB 1MC4A 3RYHB 3UM9A 4YRBA 1YS9A 2XA2A 3NBKA 5JAQA 1TCAA 3GI1A 3KWFA 3RBVA 4BJ6A 1X2EA 3ZE7A 3KUKA 1ZJ5A 2GRJA 2HGSA 3HR7A 3SK0A 1UKVY 2D5BA 4JR1A 4JXKA 1NZFA 1GGMA 1HT0A 1YASA 4MW2A 3WJ1A 3I45A 1ZS9A 4ZO6A 1NFRA 1REQA 2QP9X 3GROA 2QBYB 1QHHB 2VPZA 4REOA 3A7EA 2F3UA 4UMFA 3KQUA 3RVMA 4S35A 4Z4IA 1S01A 1VMKA 2XYGA 3Q72A 2RKWA 3C6ZA 3FVWA 4YEDA 3KQHA 4YPFA 4RJIA 1Q15A 1XJQA 1BKYA 2ZB2A 4DUGD 3QTLA 1A77A 1TKRA 3HKBA 4L15A 4DNXA 2ZRBA 2HHAA 3GEGA 3Q8WA 2W43A 4YROA 3MWGA 2HV9A 5ALLA 1BS2A 1G21E 1HSZA 4LMPA 3JPWA 3FTNA 3HKEA 2W93A 4OBEA 5I5GA 1OHHD 5I9BA 2UUPA 1OYYA 4OFBA 5COQA 4XWKA 3P0HA 1QPBA 2MINA 4QSHA 2RONA 4N65A 3VTZA 2M6KA 4WLFA 4YDHB 2REQB 4FJ1A 1P1BA 3V3KA 4YCLA 1HEUA 5B2EA 3MGGA 3B53X 4JC5A 1UFRA 2AVNA 1XQ1A 4BRSA 4JWTA 5LU9A 3OMWA 3VI3B 4BC0A 5B36A 1DT5A 1G5QA 1EK1A 5DEIA 4MINA 3WK8A 1YC5A 4KIJA 3BK7A 1TW2A 4R8VA 3K9CA 1FLDA 2BCEA 3L02A 4AG5A 1JLMA 1I5RA 2DT8A 1W49A 4DLZA 2A1TR 2XIQA 1RYFA 4DCCA 1KVRA 1WMEA 4IIGA 5AKEA 2XZTA 4DQVA 3F8SA 2BMEA 1SQGA 1E4OA 4GZLA 3STTA 4D2IA 1LDEA 3AYXB 1GUAA 4TLEA 1YHZA 2MOKA 1RP7A 2PU7A 1ISHA 1BU8A 4WEQA 4UDXX 4CLOB 1M8KA 1K08A 1ISGA 2OHGA 3RUIA 1NJSA 1JQDA 5JXWA 5JCXA 1EWQA 4BLPA 1BE8A 3C24A 3F4BA 1V1RB 3KC2A 2FGKA 1V3VA 1VE1A 3P1JA 4FX5A 2YVAA 5JW6A 1GQFA 1LVUA 4LXUA 1E62A 1HGXA 5KHLB 4PGAA 5DV9A 2BEVA 2QLMA 4YREA 2PGIA 3NAGA 1H6CA 1SKYB 2WILA 1PR6A 5KTMA 2W2LA 2ZWMA 1MAVA 1TKBA 5F3DA 1K6XA 3MM4A 3QYFA 3WNZA 1RACA 4OQQA 4KAJA 3FJ1A 4EHAA 4IDCA 3WQQA 4CRWB 1Z56C 3NWJA 1IZZA 1FXSA 1B1AA 4ZXFA 4BZPA 4OM8A 5KNDA 5B7GA 2Z2JA 4PZCA 2I62A 2RBGA 3DWEX 3U39A 1Q3HA 2BKVA 3KAKA 3MLAA 3RRJA 3NRBA 2GN6A 4KUGA 1V4BA 4XQEA 1EKXA 3FCYA 5CLLA 4E5YA 2FUKA 2QUJA 1ODTC 2YZGA 2ZULA 3BL6A 3LF2A 4N8SA 5ALPA 3KYDB 4D4IA 2PLRA 1I10A 2Y1OA 2ZITA 1BE1A 4HNUA 3RJ5A 5CXQA 3UW3A 1R4AA 5G4KB 3WJ2A 5I9MA 1CP2A 2XGMA 1JH9A 4G0PA 3VPDA 1CB0A 2HPVA 3KKZA 1Q57A 3ITEA 3T7TA 1OVMA 3FPBA 1XI2A 4GDMA 4P33A 1Q0UA 2P69A 2ZK7A 4I46A 4U7HA 4BLSA 4OMCA 3MFYA 3LAWA 3Q11A 4NYJQ 1WCIA 4QJBA 4L3OA 3OM0A 2W90A 3F78A 4V3CA 2VHTA 3ZI7A 1BGVA 4MWZA 2DBRA 3NU1A 1J07A 4P4LA 4ENSA 3TTUA 1NR5A 4GLFA 5E1MA 5G1OA 3VHXB 3PPYA 2GCIA 3FNQA 1GQQA 2QT0A 1Y5NA 3T9EA 4KE8A 4BX0A 3PHGA 2D5LA 5JMWA 2JIRA 3QX3A 5FLXA 4WEOA 4OXKA 4HRXA 3L5KA 1NHGA 2K87A 2LIVA 4H7JA 1DKOA 2OL4A 4QO8A 2IWHA 1FJHA 2O52A 1JJAA 1YSCA 2BMDA 4QYIB 5HBGA 3PGVA 2K7ZA 3D3EA 2WSYB 1GGKA 3DAYA 3E61A 3IAEA 4OJKA 4UAVA 1ZSVA 4BBPA 5FX2A 4NEHB 5JQGA 1U9IA 2R5NA 2WF5A 4FZRA 4MQEB 4EJ0A 2FJUA 4LZOA 1HDGO 1TPZA 4UUQA 2WG2A 1FNNA 2HN9A 2HSZA 3IB6A 4LN1A 4XX1A 3RDPA 3V2GA 4D41A 3IKLA 4MPPA 2H29A 4TLDA 4I2VA 3IEXA 2Z5FA 1L7XA 1VHLA 1JGTA 4BS9A 1T6ZA 1H0KA 2FX3A 2PD6A 3ME5A 5K3CA 1N6HA 1ESDA 2EDCA 2ZDHA 3K32A 4NF2A 1FUIA 2V8OA 3I5XA 3JQ8B 4PHFA 2H2IA 5U1PA 1OQAA 3FCEA 2QGFA 5ILGA 2ZWOA 4OHCA 1DNPA 3HH8A 5LIRA 4EARA 3VNQA 1OF1A 3ORHA 2ZYUX 3BB3A 3V6MA 1VM6A 2XKJE 4EG6A 3M9WA 1NN1A 3S1LA 2X9LA 5M34A 3OMLA 5IULC 1RZRD 3CN7A 3TRJA 4LDQA 3T1OA 3B82A 4GX1A 1Y6GA 1DPGA 3CSDA 5FYDA 1OB2A 1CSEE 5ICGA 2XQVA 1W87A 4AZ3A 3D2LA 1CQPA 4XI9A 4G4JA 2F3RA 2R48A 4P83A 5K05A 4DGSA 5L53A 4ZN6A 1EUDA 3JQAD 3ZDRA 2IELA 1M8GA 3AERA 2XNDA 2WAYA 3C7KA 3IBCA 3KD3A 1ZOIA 3M1YA 5KWJA 1NKSA 2AC2A 3GLFE 1A7KA 4ZYZA 2H3HA 3REGA 1I0ZA 2VJOA 2R7LA 1Y80A 3TW8B 5J58A 1LW6E 5JHHB 2IOFA 1ULTA 1EFVB 2C5LA 3TRIA 2BL4A 5E7MA 5J23A 1L7AA 3WBBA 1TIKA 5J4YA 2MJLA 2J3DA 3E58A 4PQGA 3AM3A 1EUCA 3QEMA 5DISB 4O8ZA 5DN9A 1A50B 1GPUA 5BSTA 3ZUGA 4MAAA 2XAAA 2MIIA 1KERA 4MR9B 2R5WA 4QPZA 3MT9A 1DC6A 4FXOA 1KE1A 2LCQA 3EIWA 4FDMA 4RTPA 1P7WA 1DXHA 3BWBA 1KRHA 2HQBA 1V6CA 4V02A 3W2FA 3KL2A 1V6SA 4RZIA 5FLKA 2PKQP 1QLJA 4WIAA 2G28A 5AW7A 2V7WA 1W85B 2BR3A 5IJZA 2D00A 1C0IA 2D1SA 2GFHA 3LQ2A 1I4DD 1NF2A 2R79A 3A9WA 1CRQA 3GW8A 1J1IA 2DY0A 4P80A 2NO5A 4C22A 2VJPA 4XJVA 2Q2VA 3M7IA 1O97C 1E2MA 1XTJA 3O7WA 1EZ1A 1PJCA 3BXHA 3PQCA 4R5MA 2WD9A 4RTKA 2G1PA 3NVKI 1Q0QA 5A9SB 3PC8A 3W5HA 4P34A 4YLGA 5E4TA 5BRAA 1E79D 5BOSA 2O8FA 5A3SA 1G9TA 3L7YA 4ZI5A 1XL1A 5TMEA 3NYIA 3C15C 3LZDA 4MB0A 1F6WA 2WMDA 2NU7A 3ZLJA 3L0SA 3O4VA 2W4MA 1L4LA 1EDBA 3VPAA 4BV8A 1Z2DA 3B48A 2G72A 2IYWA 3FJYA 3RSHA 1D1PA 1N92A 2GPWA 2KS6A 2ODWA 2ZANA 4X90A 3PICA 1AO0A 1YS7A 3AVOA 1AA9A 5D87A 3KLNA 1Z0JA 2BM0A 4FEGA 1LJLA 2GH1A 3FETA 3L7OA 4KIGA 3DAGA 3GRPA 2EKZA 2RK4A 3DEHA 5EJ7A 3THWA 1XDDA 3P0RA 3BRCA 3K2EA 3R3YA 4JH0A 3H5OA 3SNHA 4Q48A 4NJMA 1FNDA 1FFDA 4AO6A 5IXYA 3HNOA 3BDAA 4ARAA 1EVYA 2FDXA 1CS0B 3H4VA 4PO3X 2Q7OE 3ROPA 3CJRA 1UT8A 4MS4B 1A9QA 5JS7A 3BAZA 3C5VA 4MS3A 4W6ZA 3EIHA 3QKTA 3TZCA 2CLEB 4UZSA 1EA7A 1ZN2A 1E9CA 1JT2A 1KMHA 2J46A 2A9VA 3IPRA 5TGDA 2ZSJA 5CCEA 3I62A 1S2LA 5DK4A 3THXA 1IULA 4IRXA 1KEPA 1V2GA 4BQPA 2FE4A 2QDXA 4UZFA 5F1PA 5SV2A 9LDBA 5KVCA 4PX5A 1DV2A 4W5NA 2E4VA 2Z5VA 1E7WA 3MWLA 4IUDS 5JI3E 2AC4A 5BW8A 4TRNA 3PUZA 1USKA 3YASA 1ZW1A 4E51A 4A8TA 3SVLA 1LQ2A 3MG9A 4DJAA 3AEUA 2V59A 1GUDA 1QG4A 2AIRA 1HYQA 1ORRA 2VWPA 2V74B 4XJTA 1IY1A 4EMTA 4FN5A 1OU0A 4MK4A 1SIWA 2FNAA 3V8BA 5DBOA 5CW1A 1U7DA 1J56A 1MJHA 4BP3A 1VPLA 3MWFA 5FI0B 1QG6A 3NTLA 4QTTB 3H16A 3CZAA 3VSDA 5F51A 4EPXA 7YASA 1YB7A 1RLTA 2V4ZA 4W9NA 3MQ4A 4MKGA 1A8QA 2A7XA 3P4XA 4DBZA 1DT3A 3NP7A 3ZHSA 3DUWA 1N7GA 5CDHA 4IJMA 2BY4A 3KVRA 2PX3A 1N2CE 5H4HA 1ADGA 5JRZA 4KVAA 4PS0A 4GL4A 2HCBA 2BMJA 1Q6ZA 2Q3DA 3MAJA 3KU1A 3VDXA 1E64A 4OL9A 5AIAA 3MBKA 4QUKA 2JPDA 4BMCA 3E3OA 2IHZA 1K06A 2VBIA 5UKDA 3GZTB 2FB9A 4TMWA 1GNPA 1XA3A 2VP9A 2NADA 3RC7A 4DDTA 5K6TA 1LDGA 4CM5A 4ZCLA 3G2KA 2W2TA 3NT4A 4DLRA 2A6PA 2I2FA 4MVJF 1B1CA 3KT8A 4O8CA 4PYLA 2HMTA 2Y3IA 4GE3A 4RHYA 1P29A 2D8MA 2I78A 3C5HA 4H1UA 1Z2AA 5F7ZA 1FYVA 2MWMA 3TIIA 2BKEA 1ZSYA 2X1VA 5A7FA 4DJEC 1U02A 1UM9B 3A2KA 4HDAA 3ONEA 1NBIA 4CEJB 2ZBDA 1UMKA 4JJZA 3M89A 2HA2A 2NXNA 4IH4A 4YMHA 4EYSA 3VAYA 1ADCA 3OT5A 4IYJA 2OOKA 2PKXA 1SKMA 2V55B 4K6CA 3HA3A 3LYAA 3QEJA 4GPIB 4PLHA