4NIYA

Crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) complexed to yrh-ecotin (m84y/m85r/a86h ecotin)
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
216
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYESGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGHHPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKKSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-terminal protein modification by substrate-activated reverse proteolysis.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 51
structure length 216
sequence length 223
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4niyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4niyA02
1GBKA 1AVWA 1QBOA 1T4UH 2VGCC 1SOTA 1AFQC 4ABHA 1NFXA 2ZKSA 3QZQA 2GCHG 4IN2A 1TB6H 4ABGA 1ZSJA 1QQUA 1EB1H 4R0IA 3DHKH 2BD8A 1C2KA 2P16A 2PR3A 1A7SA 1QURH 2BY8X 3A8DA 3P70B 1VITH 4ASHA 1SLUB 5JBTA 4ZKRU 5EU8A 1CO7E 1MKWH 1P06A 1NPMA 4FUEA 1GDQA 1WOFA 3Q76A 1O5CB 1FY8E 5FPSA 2ZU2A 5A8ZA 2ESTE 4I8HA 1WAYB 1RJXB 1K1MA 3L3TA 1UMAH 3RUOA 1LVBA 1O3JA 2ANYA 1ESTA 1TNKA 2QXJA 4JZDH 1P2IA 1NY22 1EAXA 1ZPZA 1TLDA 2ZFSA 1GI4A 2D8WA 1UK3A 3NPSA 3KIDU 2ODQA 4MNWA 1O37A 2NU1E 2AERH 1NTPA 1ZGIA 2ZU3A 1Z1JA 1NT1A 3RXEA 1Y3WA 3V3MA 2ZDKA 1UTKA 2J92A 2OXSA 5CE1A 1K1PA 2W7UA 2A4RA 1O2RA 2AYWA 3I78A 1NFUA 1S6FA 2F83A 2FWWA 2H6MA 1ACBE 3LJOA 5LPRA 3BTFE 1S85A 1O3EA 4HTCH 1SFIA 2ZGCA 4NFFA 3A8AA 5GPIB 1W14U 2G4TA 2JH5D 2OP9A 3VB5A 3ITIA 1C5LH 4FU9A 5I25A 2W3KA 4X8TH 3SV9A 1EUFA 4OS1A 1G37A 3VB6A 4IMZA 1INCA 1TPSA 5F8XA 3PYHA 1VCPA 2VH0A 1AZZA 5LGOA 1C2LA 1ARBA 5FX6A 1CT0E 1C5XB 4ISHH 1C2MA 4FUGA 1SVPA 3LGUA 3SJOA 3SU1A 2F9OA 1O33A 3D23A 1GMDG 3SZNA 1P2MA 1DITH 3DFLA 3FAOA 5A8XA 3ZVBA 3K65B 3QK1A 4MPXA 1FAXA 1IQKA 1MTWA 1NS3A 2ZQ1A 3QTOH 1ZRKA 1C2HA 2ZU1A 3STJA 1K1LA 3SJ8A 4D9QA 1RGQA 2OCVB 2BX3A 2ANMH 1KXAA 1QA0A 4J2YB 3A8BA 1A3BH 3TK9A 2BLWA 2PSXA 3A7XA 3BG4C 2XW9A 4MTBA 3BTHE 1VGCB 4CRGA 4ZMAH 1VITG 1CA0C 2BDHA 4X2XA 1GCDA 1TE0A 4OS4A 4R8TB 2V3OH 1J15A 5AFZH 4MVNA 1O36A 5GDSH 1C2FA 3GDUA 2Q6GA 1ELGA 1NU7B 3PWCA 1JMOH 2VB0A 1AGJA 1V2RT 3UNRA 2PKSB 4O97A 1RS0A 4WWYA 3BTEE 2G55A 1BA8B 1AFEH 1JXPA 3NXPA 1PPCE 1D9IA 3ZZBA 1CSOE 1ZPBA 3A86A 3C27B 3KCGH 1HJAC 1C1PA 1A5IA 5EQQA 1K28D 2FDAA 1YCPK 1NRRH 1O2OA 4IW4E 2FO9A 2GTBA 2OQ5A 2QN5T 1EQ9A 3AAVA 5C3NA 1O2TA 1OPHB 5EODA 4WMDA 1XVOA 4XDEA 2BM2A 1SGNE 2JKHA 1QCPA 1C5MD 2ZI2H 5A2MH 3TNTA 2A31A 2XBWA 1C5OH 1SGYE 2XBVA 1Z8GA 3RXSA 1XXFA 1P2NA 2G81E 3V0XA 1ZLRA 5K0HA 3FZDA 2KAIA 1K1JA 2CV3A 1C4Y2 1JIRA 4FXGH 5SGAE 1HAHH 1UTLM 2GGVB 3RXHA 3MO6A 5J4SA 1TPPA 2SNWA 2VIPA 3RXTA 4AX9H 4AN7A 5GIBA 4I32A 2P8OB 4DCDA 1TGNA 1EP5A 3BSQA 3SNCA 4Z6AH 1AKSB 1BITA 1FZZA 2BZAA 4CRCA 3V7TA 3P8OA 4AG2A 4MNVA 4K8YA 1HAGE 1C5YB 3UTUH 3ATWA 1O2VA 3ZV9A 3PLBA 1YPJH 4AZ2B 4MG3A 4DW2U 4WXVA 4X6NA 1ANEA 1EATA 4WJG2 1HDTH 1P2OA 1FXYA 1B0EA 2IJOB 4O03A 2EA3A 2K1QA 5HYOA 2OC1A 2Q6DA 8GCHG 1GHAG 4OGYA 3V13A 1O3AA 2BD5A 3HATH 3SU6A 1OOKB 1F5LA 1KLTA 4AOQA 1BQYA 2J95A 3ZVGA 1UVUH 2CN0H 1V2KT 1DM4B 6CHAB 1PQ8A 2ZDAH 3AW0A 5HXFA 2PUXB 4ZKNU 1SLXB 3SGQE 5JBCS 4GHQA 1F92A 3B9FH 1WV7H 4K69A 2PLXA 1HAVB 4UE7H 1GL1A 1HAPH 2UWOA 3S7KB 1HUTH 1GJCB 3A85A 1GG6C 2PW8H 2JETC 5T6GA 2GX4A 1RIWB 1IOEA 1AY6H 3ZYEA 1SGDE 1O34A 4U2WA 1BHXB 5JDUB 1TOMH 2ODYB 1FV9A 5ESBA 3E3TA 1KTSB 5C1YA 1QGFA 1DVAH 5EGMA 1OP0A 1OYQA 3BTDE 1N8OC 3D62A 5F6MA 3RXBA 1Z6JH 3P8NA 2ZCLP 1O5BB 4A1VA 2A4QA 1C5NH 2FX4A 5G4BA 3SU3A 2ODPA 1HRTH 1VZQH 1MKWK 1UHBA 1BRUP 3QDZB 3RDZA 2WUBA 2IPHA 2FZZA 1FY3A 3VGCC 1GBIA 1H8DH 1P2KA 1G30B 1UTQA 1DWEH 1THSH 1SOZA 3RXJA 1TBQH 2DE8A 1BJUA 2FOMB 1T8MA 1LKBA 2PGBB 1ETTH 3VPKA 1MH0A 3EQ0H 1OWHA 3OY5U 3RMMH 4ISLA 4X1SU 1SGIB 3T28A 1BTPA 2PKAA 4LOYH 4WH6A 5TJXA 4FU7A 1E34B 3M7QA 2C3SA 3E6PH 2XNIA 1IQNA 2FOAA 2VIVA 3F9EA 1LKAA 1Y5UT 4NIYA 3M3SA 2FMJA 3A7ZA 2QC2A 2HGTH 4X8SH 3ZVEA 1W7GH 1V3XA 2BTCE 3LKWA 2R0LA 2A2QH 5BPEA 4GSOA 1LTOA 1YPMH 4X6OA 1FIWA 1HB0B 4Q7YA 1G2MA 3H7OA 1GVKB 1TRMA 1DOJA 3QLPH 1MTSA 1EZSC 4D76A 1QFKH 2ZCKP 1UJ1A 1TRNA 1SFQB 3EE0B 4X8VH 1O3LA 5JB8S 3DA9B 3P95A 3RU4T 3VEQB 2QYIA 3UQVA 1P0SH 2BDBA 1ELEE 1AMHA 1FQ3A 1PPFE 5F8TA 4RN6A 5C1XA 4JYVH 3T29A 2AH4X 5EQSA 4YOGA 3M7UA 3GYLB 3URDA 2ZPRA 2OC8A 2O8TA 2UWLA 4OGXA 3SUFA 3SV6A 2P8OC 4GAWA 5PTPA 2TGAA 3SJ9A 1TQ7B 2PWXA 5AFYH 1ARCA 1AN1E 4X6PA 3ZZ5A 1C5WB 2R2WU 1GJ5H 4ISOA 1X7AC 4IC5A 2H9HA 1ZJKA 1DS2E 1G32B 3BEUA 2P59A 1KXEA 3PLKA 2BDAA 3O8BA 2FTMA 1CA0B 4NIXA 3TU7H 1SGEE 3ZVDA 1TNLA 4QT8C 1K2I1 1P01A 1XUHA 1NN6A 3M5OA 2J2UA 3BF6H 2HNTF 1IQMA 3MFJA 1O3KA 1KLIH 5HM2A 1TX6A 5C67A 2AIPA 3E0NB 3S0NA 1P12E 1EPTA 3MMGA 3OTJE 1NRPH 1O2HA 2GDEH 3OY6U 1D3TB 5L30H 1C1NA 1ZTJA 3KN2A 4BAHB 2F9BH 3L33A 4HGCA 1T8OA 1NROH 1ZZZA 1T8LA 1XUGA 2G4UA 3UFAA 3ZZCA 3PV4A 4DIIH 4Y7BA 3O8DA 1TMTH 1XUFA 4JCNA 1BCUH 4GHTA 1QBVH 2FYRA 2ZDMA 1QL7A 1RFNA 3S69A 1O2LA 4E05H 4YM9A 2FOBA 5E0GA 4K3JA 2ZP0H 3RM0H 1GHBG 2A2XH 2I6SA 2GCTC 2H2ZA 1O2QA 2A7JA 4RSPA 1DT2A 4INLA 1PQ5A 3W94A 3IG6B 1ANBA 1C5ZB 2Z94A 3DD2H 3ATIA 1IHTH 1EAWA 1GMCF 3SGAE 1KY9A 5EXMA 3U8RH 1J8AA 4CBOA 5DPAA 3SV8A 1CBWC 3RXDA 1V2UT 3GY8A 4XE4A 4X0WU 1HAOH 4WMEA 1BIOA 1YBWA 2XWBI 4KELA 1YPKH 3KEEA 2A4GA 3I77A 4YLUA 1V2JT 1K1NA 2CHAB 1GMCG 1MMJN 2B9LA 1N8OB 1EZXC 3Q3YA 2QCYA 4B71A 3ZZAA 4A7IB 1QB1A 1E36B 2HOBA 1TNJA 2VIWA 1F2SE 1BHXF 4KTUA 1YCPH 3F9GA 4CBNA 1TPAE 1SGFG 1Y59T 1GBLA 9ESTA 3A89A 4K5ZA 1AUJA 1XKAC 1PJPA 5DG6A 2FP7B 4O3UA 4FVBA 2XTTB 2V6NA 5EQRA 2A5IA 5DKMA 3RXAA 2ZG0H 1W12U 4CH8B 3G01A 2VGCB 2VINA 2ZCHP 5CHAC 1HCGA 4INKA 1MTNB 2V0BA 1OXGA 2SGQE 1HJ8A 2XYAA 1F0UA 2V35A 3SNDA 2Y6TA 1GHVH 1AUTC 2BXTH 1MTVA 2GCHF 2D26C 1O31A 3BG8A 2AGGX 1WU1A 1S0QA 1W8BH 2C8WB 5DP4A 2R3UA 1GI9B 1O2XA 1XUKA 3TJNA 2BMGB 1JOUB 1BTZA 4UFFH 3ZVFA 2W5EA 1O5EH 3QTVH 1C5QA 3N7OA 1FY5A 1O5GH 3GCHB 3TGJE 3ZZ9A 3M37A 3FANA 5F03A 2A5KA 2NWNA 2BY9X 1AIXH 1PPEE 2VJ1A 1DE7H 3DFJA 1SGCA 1N1LA 1NFYA 4X2VA 3BEFB 2JETB 1SHYA 2Y80A 1UHBB 2BLVA 4ZXXH 1ZHRA 1KDQB 1J14A 3SBKA 1GL0E 3WY8A 3TNSA 1WYKA 2EEKA 1LHFH 3MI4A 4DT7B 1ZTLA 1V2WT 2FLBH 4CRDA 1Y5BT 1MCVA 3CENA 1BTWA 2FLRH 4A1XA 1O3MA 2ZFPH 3CP7A 3ELAH 4F49A 2JH0D 3VB7A 1YPEH 3SI3H 1P3EA 3U98H 3EAJA 3RXFA 4JYTA 3RXOA 2ANKH 1LVOA 2XXLA 4ABAA 3HKJB 3U1IB 3BV9B 3GCHC 4TY6A 1P02A 1GHWH 1BB0B 1OWEA 2NU4E 3EA7A 4AFQA 3UPEA 4UONA 2CF8H 1UTNA 1RTKA 3B8JA 3TJVA 3PO1B 4ZKOU 1QRZA 1L0ZA 1AFQB 3MNCA 2BX4A 2CJIA 1DUEA 1Y3YA 3EGKH 1SLVB 2KAIB 1P09A 1C5TA 2O8WA 2GV7A 5DK1A 1PQ7A 1TGBA 3SORA 3TH3H 2ZFQH 1SR5C 4K60A 2EI8A 3E90B 4BXSA 1O38A 1BZXE 3LDXH 3MWIU 5E2OA 1QHRB 1A5HA 4JMYA 3RXLA 2R9PA 4AFUA 4Y8YA 3KQCA 1E37B 1C2JA 1F0SA 4AB9A 1KXBA 3UNQA 1FPCH 1CHOG 5JBBS 4FUDA 1O39A 1TGCA 3RLWH 1RTFB 2A4OA 4I8JA 2GD4B 4B76A 1A0LA 2BZ6H 4OS5A 4IS5A 3RXMA 1CHOF 3OX7U 1OWDA 2F9PA 3GY5A 3MH4A 2Y7XA 3QGNB 5DP9A 1B5GH 1GBDA 1ZSLA 1O5FH 1IQEA 3ZZ8A 3QUMP 5DO4H 4YT7H 2VVVA 2ZHEH 2M5TA 4NCYA 1DWBH 4ZH8A 1P03A 2AGIX 1P2JA 3U1JB 1DANH 2AIQA 1LPZB 3S7HB 2B7DH 3LJJA 1QY6A 1BMLA 1FNIA 1Z8JB 5LPEA 3MNSA 1BRAA 3UWJH 4K2YA 3FP8E 3TK6A 2BY6X 5J4QA 1HAVA 4KGAA 4UFEH 2TPIZ 4Y71A 4GVUA 4Q7XA 3KNXA 4B2CA 1C2DA 3TH4H 1EAUA 4FU8A 2VU8E 5DP7A 1O30A 2G52A 1AZ8A 1W13U 1SL3A 2WPKS 4YOIA 1PYTD 1QJ7B 3RU4D 3SNBA 3ODFA 1FUJA 8KME2 1BTHH 1YKTA 2G5VA 1TOCB 1W10U 3KQBA 5L2YH 1L1GA 3NWUA 1QQ4A 1VJAU 2WPIS 3F9HA 1SC8U 2PHBA 2FIRH 5DP3A 2THFB 4AG1A 1CBWB 2FODA 4MQAA 1SQOA 1TMBH 1LPKB 2Y81A 3GCTF 2Q6FA 1W7XH 1WTHD 4DOQA 1Z8RA 2ANWA 3ESTA 4LK4A 1O2WA 1OP2A 2XWAA 3SU0A 1GBBA 1VJ9U 1AWFH 1LHGH 1CGHA 1GG6B 1LHEH 1MKXK 1V2PT 1HXFH 1V2TT 4FUIA 1TRYA 4ISNA 2P94A 3RXVA 3PMJA 1HAIH 1NU9A 2STBE 5LPFA 4FUCA 1YPHC 2TGPZ 4OS2A 2BLOA 1S6HA 2ZHWH 4YESB 5JPMH 1Y3UA 5C5OA 3PMHB 1BRCE 2XC5A 1ESAA 2C90B 2PKAB 2CHAC 1D3PB 2BY5X 1XUIA 5DP6A 3LONA 1AQ7A 3A80A 2A0QB 1QNJA 4Y10E 1SGTA 7GCHF 3TGIE 1O35A 2AMQA 4NGAH 4Q2KA 1TA2A 1E35B 4ABJA 2BDGA 2ZPQA 1JBUH 2O8UA 3H5CB 3C1KA 4XSKU 2HLCA 3ZZ4A 1SPJA 1C9TA 1TBRH 4Q80A 1UVPA 1LDTT 1DUAA 1C5PA 1D6WA 3RMOH 2ZFTA 1FONA 2UUJB 1S83A 3QN7A 2XBYA 1LQEA 1MD7A 2RA3A 3PLPA 2VWMA 3KQEA 4ABFA 1D4PB 3UUZA 1A46H 1LVMA 2Y82A 2W7SA 1THPB 2QXGA 4ZKSU 4I8KA 1IQFA 3A83A 5EXLA 1H8IH 1MBMA 2F9UA 1IAUA 3UNSA 1PPBH 1ZHMA 1HXEH 1ELDE 1GVLA 1MZDA 4X8UH 4VGCC 6ESTA 1G2LA 1G3EA 2QY0B 4AGJA 2P3TB 3I29A 1P3CA 1GGDB 3LGYA 1D3DB 3GY6A 2ZGBH 1QJ1B 3MO9A 6GCHG 2ZTZA 1SHHB 2FOCA 2EC9H 2OTVA 2QAAA 2TBSA 1EJNA 7LPRA 2BD9A 1MZAA 4X1QU 1Q31A 3HGPA 3LT3A 2FOHA 5T6FA 5FPYA 3SQHE 1XX9A 1GBTA 2LPRA 1H9IE 2GT7A 1S0RA 1QBNA 1BBRE 3BTTE 3PMBB 4BTIB 5IYTA 1EP6A 4CREA 3NZIA 1RXPA 1H9LB 1WQSA 2BVXH 3K2UA 2RG3A 4FVDA 4B2BA 1WQVH 5A09A 1BMNH 1AB9C 2HPQH 2Z3DA 1GHBF 1GJBB 3IWMA 4U30A 2Y5GA 1ZMLA 2HNTC 1HYLA 1ZMNA 3E16B 3ATLA 2ALVA 2ZQ2A 2VWLA 3UOPA 2G51A 4JYUH 1QTFA 2Z9IA 3ZZ6A 7GCHG 3BG4B 3GY2A 2VIQA 4AYVB 3RU4E 1C1TA 1HV7A 1MTNC 1P9SA 4IC6A 5DP5A 1PYTC 1QR3E 3MU0A 5GWZA 4A5TS 3ATKA 4ABEA 3SW2B 2FI4E 2ZTYA 1GJ8B 3KGPA 1O0DH 3CS7A 3A7WA 3SN8A 1UCYH 3F1SB 1C1VH 3SNEA 4J1YA 3RXRA 2Z3CA 2CF9H 4GPGA 2W26A 5FAHA 4H4FA 4I8LA 1YGCH 5FBEA 1GBFA 4BAQB 4SGAE 2OBQA 2ZHQH 4Y8ZA 2C8XB 2VVCA 2ZHDA 4U32A 1CGJE 2BHGA 1WBGB 1SLWB 4B1TA 5AF9H 2F9NA 3KF2A 3K6YA 1ZPCA 1MCTA 3TPIZ 5B6OA 4Y0ZE 1ZOMA 2VH6A 4D7FA 2DUCA 3KHVA 5EG4A 1U6QA 4E06H 2AFQB 3GDSA 2BD3A 3H7TA 3M35A 1T31A 1L2EA 1ZRBA 1XVMA 2ZU5A 5ESTE 1FI8A 3E8LA 1AE8H 2OINA 2BLQA 1O2YA 3UQOA 1HBTH 1CE5A 1CT4E 4ZXYH 1XUJA 3GCTG 1J9CH 1GI7B 4MDSA 1GJ4H 4D7GA 1C4V2 1SMFE 1THRH 2C4FH 2BQWB 2SGFE 1OP8A 4X6MA 4XOJA 2QF3A 3A7VA 1LPGB 3FVFB 3RMLH 4MLFB 3SI4H 2CXVA 3HKIB 5LH8A 2Q1JA 3D49H 1N6YA 1CQQA 3SHAH 5CMXH 5C2ZA 3ZV8A 3MNXA 2F91A 4H42U 3RM2H 3MU8A 5EW1H 1F7ZA 3SJKA 3OU0A 4VGCB 1ABIH 4LZ1H 1DX5M 2ZA5A 4GUXA 3MO3A 4A6LA 1A61H 3UWIA 3GY7A 5ABWA 3JZ2B 3MHWU 2TRMA 4XBBA 1V2ST 4OS6A 2RDLA 1PPHE 3VB4A 8ESTE 2ZHFH 1SGQE 1K9OE 2C93B 7ESTE 3EA8A 4TWYA 1GDNA 3U8OH 3PB1E 2FOFA 2H9TH 5EXNA 4FUBA 1A4WH 4Y6DA 2D2DA 4O9VA 1MU8B 1ANDA 1FAKH 1UTMA 3BIVH 3PTBA 3ZYDA 1BDAA 2W3IA 3VB3A 4FUJA 1MKXH 3LOXA 1GBMA 4KTCA 2NU0E 5FCKA 3O8RA 1GDUA 2TGDA 1M9UA 3PWBA 4KTSA 1GI0A 3M3TA 2F3CE 3BIUH 4IN1A 3BTGE 4NWLA 3BN9A 3LPRA 3LC3A 2BQ7B 2ASUB 1BBRH 2EI6A 3ATMA 1ELAA 2Z3EA 1V2MT 2A7CA 1JIMA 3A87A 4B2AA 2P95A 1AD8H 1K1IA 3F9FA 3U69H 3ZVCA 1LO6A 2Z9JA 5L2ZH 2AMDA 3SHCH 3FZZA 1TFXA 1O2UA 1BUIA 1O2NA 1XM1A 5ETXA 4WVPE 1O2PA 2GVFA 1K21H 1T4VH 4ABBA 4B75A 1C9PA 1GJ7B 1OWKA 3QWCH 1OWJA 3SUGA 1IHSH 1FIZA 1TA6A 1L4ZA 1UK2A 9LPRA 1A5GH 5CHAB 3LH3A 4A1TA 2GT8A 4MNYA 2ZGHA 4UDWH 1TMUH 3BTKE 3MH7A 1CA8B 1Y8TA 5DJ7A 1F5KU 3QX5H 1C2EA 3PO1C 4RKJB 1ANCA 2WYGA 4E7RG 1KXCA 1VITF 3EDXB 4X1PU 1PPZA 4INHA 1C2IA 1DPOA 1C1MA 2ZGJA 1TALA 4JK5A 3BEIB 1GMHF 2C8YB 1BTXA 1F0RA 1O3NA 1P57B 4YO9A 2STAE 4YT6H 1JRSA 2BD4A 4F4OC 1UTJA 2SGDE 4CHAC 1ESBA 1EPTB 1S82A 5T6DA 1B0FA 3HK6B 8LPRA 3RXIA 3MYWA 1BT7A 1MAXA 2FS9A 1SGPE 1O5AB 1TGTA 1O3GA 4X2WA 2D1JA 4AGKA 2FS8A 4CR5A 2Z6BD 2PTNA 1FMGA 1TONA 4ZROA 1D6RA 1NZQH 1YC0A 2PKSC 4DIHH 1Z7KA 1A1RA 1KIGH 4IBLH 2AMPA 4XBDA 1UVOA 1QB9A 3OSYA 1Z71A 1TPOA 1WCZA 4MPWA 1QIXB 3TJUA 1QA7A 2FPZA 1GHXH 1EZQA 2ZDLA 4NG9H 1HLTH 3M3VA 1ELTA 1ETRH 2G00A 1QJ6B 1TBZH 2OD3B 1GMDF 2BOHB 3EA9A 3UOUA 1OSSA 1AWHB 5JBAS 2TIOA 3TITA 3ZZ3A 4UD9H 1EXFA 1FLEE 5C5NA 2A32A 4NIWA 2GDDA 1CGIE 3SOSA 1OKXA 3K6ZA 1C5VA 2QGRA 2RA0A 7KMEH 1UCYE 4NA7A 4DGJA 3O8CA 3NCLA 3R3GB 1V2QT 4BTTB 3JZ1B 2P93A 3VXFH 4AB8A 2WUCA 5TCCA 2HALA 4DJZB 1HJAB 1KDQA 3ENSB 3A84A 2JH6D 1Z1IA 1MD8A 2HPPH 3AAUA 4Z0KA 5EPYA 4JZFH 2BYAX 2UUKB 1JRTA 5AHGH 2UWPA 2GP9B 3RXGA 4NSVA 1NRNH 2BVSH 1YM0A 3M36A 4IMQA 2FESH 1K22H 3A8CA 1GJ9B 5C20A 1TNHA 5C1UA 3HK3B 1C5RA 2Z7FE 4K8BA 5FX5A 4GCHF 5BRRE 1SQAA 2FX6A 3STIA 2VVUA 3ZZ7A 1L1NA 4YZUA 1QB6A 1N6XA 1FY1A 3SUDA 1D3QB 2A5AA 5T3HA 1C1UH 4O3TA 3MU1A 4GCHG 2AGEX 4NSYA 2OC7A 4WXIA 5F8ZA 1O2IA 2ZWLH 2Y5HA 1E38B 2QF0A 1RIWC 1CVWH 1RD3B 1ORFA 1V2LT 1AHTH 1TX8A 3DT0H 4XBCA 3UY9A 5HM9A 1O3BA 1GI5A 1LCYA 2ZNKH 3KL6A 4HFPB 3QO6A 4MPUA 1DXPA 3VFEA 1H4WA 2XCNA 4HZHA 3MNBA 1P04A 1WTGH 1GI2A 1SGRE 4Y0YE 1JWTA 1G3DA 1SBWA 2A45B 2GCTB 1UO6A 3SV7A 1IQGA 1XKBC 1KXFA 2BY7X 4Y7AA 1HAZB 1CT2E 3P8GA 3T26A 1CU1A 3S9BA 2FYQA 1AVGH 2B0FA 1C5UA 4AORA 4OS7A 4CR9A 1GBCA 6LPRA 3GICB 4GLYA 2PV9B 3MH5A 2AEIH 3T2NA 2QV1A 1AO5A 4NWKA 1NC6A 2BD7A 1Y3XA 1QL8A 2HWLB 2J94A 3RC6A 2SGPE 1H9HE 4I31A 3B23B 3P6ZB 1UVTH 1EX3A 1OS8A 3VXEH 2BDIA 3MH6A 5JB9S 2IN2A 1MUEB 3HGNA 1J16A 2P3UB 2RCEA 4CRBA 1O2MA 2XCFA 2VIDA 4I7YH 2O9QA 3TJOA 1ELBA 3NKKA 3LGIA 2ZDNA 4PROA 4BANB 3E0PB 2Z9LA 4RKOB 2PGQB 4KP0A 2OLGA 1ZYOA 3SU5A 3LGVA 3EYDA 1O2SA 1V6DA 1LMWB 1GCTC 2P3FH 1ZJDA 1NM6A 3Q00A 2GZ7A 1GBJA 1L1JA 4U01A 5GXPA 5E8EH 1ZTKA 1ETSH 3K9XB 3GOVB 3RC5A 4WMFA 1FPHH 3LU9B 2FI3E 3PTNA 1CHGA 1SB1H 4TPIZ 5I46H 2FXRA 1TIOA 1RTLA 2ZZUH 3UR6A 1TGSZ 4DURA 3LIWA 3SV2H 1FDPA 4M7GA 2ZC9H 1HFDA 2WPJS 1C1SA 5JYIA 2G8TA 1OX1A 1HGTH 2ZU4A 3SO3A 5IDKA 1LHCH 3T5FH 3TIUA 5FXLA 1H1BA 1DWCH 4BAKB 1E0FD 3SU4A 1C5SA 2ULLA 3SGBE 1QRXA 4MNXA 1GBHA 1VGCC 3VGCB 2WINI 1LHDH 5E2PA 1DICA 3RXUA 1P05A 3V12A 4BTUB 4CRAA 1DDJA 6CHAC 3TK5A 3ZVAA 1C1RA 3SNAA 3UIRA 1Q2WA 1FY4A 6GCHF 3ZZDA 3CS0A 2C8ZB 5A0AE 1MQ6A 2Y5FA 1HJ9A 1BJVA 1QL9A 1AE5A 4BAMB 1KYNA 3OYPA 3W95A 1VCWA 4JZEH 2QA9E 1DWDH 4YTAA 1WUNH 3M5NA 1S5SA 1F5RA 1O5DH 3MTYA 3NUMA 1KXDA 4B74A 2TGTA 1G9IE 1C1QA 2WV5A 1UTOA 4AYYB 3MOCA 1BRBE 1TNGA 1ZGVA 1ZSKA 2H1UA 5FHTA 5FBIA 1TQ0B 1G3CA 4THNH 3T27A 4HI3A 1DLKB 2G5NA 1V2OT 5A0CA 2WPMS 1HAXB 3KQDA 1UCYK 2FOEA 2HNTE 1EZUC 4CRFA 2QXHA 4X1RU 3DUXH 2H9EH 3BTQE 1EAIA 1SQTA 3NK8A 5HGGA 3RXCA 2OUAA 4DG4A 2BQ6B 1BMMH 1GI1A 3Q77A 5A8YA 3FP7E 1P2QA 4TWWA 1EJMA 1ZHPA 2Y7ZA 4JZIA 3AVZA 1NFWA 1YPGH 4TYDA 2DE9A 2R3YA 3D65E 1Y5AT 3T25A 2ZPSA 1XMNB 4H6SB 3E1XB 1O3OA 1AI8H 5TCAA 2B5TB 1EJAA 4K1TA 1C4U2 2PFEA 1BTYA 2FTLE 3SQEE 5GCHF 2ZEBA 1YPLH 1SI5H 4WH8A 4WY3A 4JZ1A 1Z6EA 1GHZA 4A92A 4AFSA 1EOJA 1Q3XA 4ABDA 1NRQH 3BTME 2VNTA 3QGJA 4I8GA 2WYJA 2ZFRH 4NIVA 4Y79A 1ELVA 5GCHG 2ZDVH 4NA9H 1F0TA 1ID5H 2BD2A 1Y3VA 1W0YH 2J38A 4NZLA 1WSSH 1Z8IB 1GGDC 3RP2A 4AFZA 2J4IA 1HAYB 4K1EA 4UEHH 3T62A 1GCTB 3Q3KA 1GBEA 1GVZA 1GJ6A 1YLCA 4LZ4B 2IOTA 1ELCA 1O3PB 2AS9A 2VIOA 3S9AA 3GCOA 3RXKA 1GWAA 2BVRH 4IGDA 4LXBH 3RLYH 1MTUA 1O32A 1DXWA 1BOQA 2CMYA 1T32A 1DSTA 5L6NH 1FN8A 2J9NA 3M61U 3BTWE 5DP8A 4CH2B 2BB4A 3P92A 2XBXA 3F6UH 1MQ5A 1J17T 3GY3A 4Y11E 2BDCA 3TVJB 3TH2H 4TPYA 1KSNA 3MU4A 3PROA 1C1OA 5EW2H 1PPGE 2O8MA 1GMHG 4E7NA 3URCA 2R0KA 4ZHLU 4KKDA 2NU3E 2FEQH 2Z9GA 4DVAU 1IQLA 1W0ZU 1GPZA 4I33A 3RXQA 2UUYA 3M5LA 3A82A 5H4IB 1HIAA 4ABIA 2Z9KA 3UREA 2OC0A 1GBAA 1GI6A 1FN6A 1DY8A 3U9AH 1RRKA 2FOGA 1UK4A 4BOHA 1VCQA 1G3BA 3S9CA 1A2CH 2PUQH 2ZGXH 3SUEA 1O3FA 1VR1H 1ABJH 1GHAF 4D9RA 3LGWA 3ODDA 3QZRA 2UUFB 1O2ZA 1BBRK 1LVYA 1PFXC 3PM3A 3SJIA 2I6QA 1PQAA 4MPVA 2WPHS 1IQJA 1C1WH 1UTPA 1O3CA 2GKVE 1W11U 1SG8B 1GJAB 3R0FA 1FJSA 3FP6E 1P11E 1AKSA 1A3EH 3GYMA 2XC4A 4UFGH 4B73A 4Q7ZA 1SSXA 1AU8A 1BTUA 3P8FA 2GMTB 4FUHA 4ZHMU 2SGEE 2B8OH 1S84A 1TAWA 1V2VT 3FFGA 2PSYA 2GV6A 2PTCE 5DGJA 4ZAEA 4ESTE 1DLEA 4TY7A 1P10A 1YP9A 1MU6B 1MAYA 5EPNA 1O2JA 1W2KH 5EOKA 3TGKE 3RMNH 3SU2A 4ZUHA 1EOLA 4NZQA 1YCPM 3P17H 1T7CA 3GISB 1NO9H 4ZHAA 1HPGA 1T8NA 2YNAA 1V2NT 1A0HB 1O3HA 1TYNA 4Y76A 2HRVA 1HIAB 1O2GH 3LH1A 1QRWA 5E0HA 3AASA 2FI5E 3HPTB 2YOLA 2SGAA 1HNEE 3M7TA 1YLDA 4BAOB 1DFPA 1YF4A 5AVDA 2GMTC 1GHYH 4SGBE 3TLOA 1EB2A 3LGTA 4ISIH 4Y8XA 1A0JA 2WV4A 1TNIA 1UVSH 2WPLS 1B7XB 1TX7A 2QXIA 4YOJA 4X1NU 1ZR0A 1MBQA 4K1SA 4XFQA 5HMAA 1P9UA 1KLJH 3F68H 3LC5A 1XXDA 1GI8B 2YNBA 2VWNA 3A81A 2OQUA 2GZ8A 2A1DB 2NU2E 4D8NA 2VWOA 4WF8A 4BNRA 1BMAA 1DSUA 1IQIA 2ZFFH 1DY9A 1KTTB 3RC4A 2FM2A 1AB9B 2LNCA 3A7TA 3IITA 1O3DA 1EASA 1YPHE 4BXWA 1LQDB 3Q3XA 1O3IA 3A88A 2SFAA 3PMAB 1YYY1 1TABE 2GZ9A 1TWXB 1OWIA 1EKBB 1G36A 4FUFA 3A7YA 4YLQH 1ZMJA 3GCNA 5E0JA 5A0BA 3GY4A 2ZIQH 2CGAA 3GDVA 2F9VA 1NESE 1K1OA 2XC0A 1GJDB 4NA8A 3RXPA 2EI7A 2SNVA 2R2MB 3U8TH 2A7HA 1C2GA 4CHAB 5K7RA 2V3HH 2H5DA 4UFDH 1EPTC 2QIQA 1GI3A 1W3CA 3L6PA 1S81A 2ALPA 2ZO3H 2ZTXA 2BXUH 2ZECA 1P8VC 2HVXA 5GJ4B 1IQHA 2BDYA 3UR9A 5FCRA 3E91A 1AVXA 2O8LA 1SGFA 4H6TA 3AW1A 4X2YA 3M5MA 1NRSH 1ELFA 2ZF0H 2BOKA 3MU5A 2XRCA 1OYTH 5FPTA 1L4DA 4NFEA 2OBOA 1O2KA 4DY7B 8GCHF 2ILNA 2H5CA 4JK6A 2J34A
chains in the Genus database with same CATH superfamily
1GBKA 1AVWA 1QBOA 1T4UH 2VGCC 1SOTA 1AFQC 4ABHA 1NFXA 2ZKSA 3QZQA 2GCHG 4IN2A 1TB6H 4ABGA 1ZSJA 1QQUA 1EB1H 2M2AA 2CK3D 4R0IA 3DHKH 2BD8A 2HLDD 1C2KA 2P16A 2PR3A 1A7SA 1QURH 2BY8X 3A8DA 3P70B 1EFRD 1VITH 4ASHA 1SLUB 5JBTA 4ZKRU 5EU8A 1CO7E 1MKWH 1P06A 1NPMA 4FUEA 1GDQA 1WOFA 3Q76A 1O5CB 1FY8E 5FPSA 2ZU2A 5A8ZA 2ESTE 4I8HA 1WAYB 1RJXB 1K1MA 3L3TA 1UMAH 3RUOA 1LVBA 1O3JA 2ANYA 1ESTA 1TNKA 2QXJA 4JZDH 1P2IA 1NY22 1EAXA 1YWUA 1TLDA 1ZPZA 1S6LA 2ZFSA 1GI4A 2D8WA 1UK3A 3NPSA 3KIDU 1W0JD 2ODQA 4MNWA 1O37A 5C0UA 2NU1E 2AERH 1NTPA 1ZGIA 2ZU3A 1Z1JA 1NT1A 3RXEA 1Y3WA 3V3MA 2ZDKA 1UTKA 2J92A 2OXSA 5CE1A 1K1PA 1WXRA 2W7UA 2A4RA 1O2RA 2AYWA 3I78A 1NFUA 1S6FA 2F83A 2FWWA 2H6MA 1ACBE 3LJOA 5LPRA 3BTFE 1S85A 1O3EA 4HTCH 1SFIA 2ZGCA 4NFFA 3A8AA 5GPIB 1W14U 2G4TA 3F3BA 2JH5D 2OP9A 3VB5A 4DT4A 3ITIA 1C5LH 4FU9A 5I25A 2W3KA 4X8TH 3SV9A 1EUFA 4OS1A 1G37A 3VB6A 4IMZA 1INCA 1TPSA 5F8XA 3PYHA 1VCPA 2VH0A 1AZZA 5LGOA 1C2LA 1ARBA 5FX6A 1CT0E 1C5XB 4ISHH 1C2MA 4FUGA 1SVPA 3LGUA 3SJOA 3SU1A 2F9OA 1O33A 2KCYA 3D23A 1GMDG 3SZNA 1P2MA 1DITH 3DFLA 3FAOA 5A8XA 3ZVBA 3K65B 3QK1A 4MPXA 1FAXA 1IQKA 1MTWA 1NS3A 2ZQ1A 3QTOH 1ZRKA 1C2HA 2ZU1A 3STJA 1K1LA 1YY3A 3SJ8A 4D9QA 1RGQA 2OCVB 2BX3A 2ANMH 5CDFE 1KXAA 1QA0A 4J2YB 3A8BA 1A3BH 3TK9A 2BLWA 2PSXA 3A7XA 3BG4C 2XW9A 4MTBA 3BTHE 1VGCB 4CRGA 4ZMAH 1VITG 1CA0C 2BDHA 4X2XA 1GCDA 1TE0A 4OS4A 4R8TB 2V3OH 1J15A 5AFZH 2KCPA 4MVNA 1O36A 5GDSH 1C2FA 3GDUA 2KR7A 2Q6GA 1ELGA 1NU7B 3PWCA 1JMOH 2VB0A 1AGJA 1V2RT 3UNRA 2PKSB 4O97A 1RS0A 4WWYA 3BTEE 3GS9A 2G55A 1BA8B 1AFEH 1JXPA 3NXPA 1PPCE 1D9IA 3ZZBA 1CSOE 3DSGA 1ZPBA 3A86A 3C27B 3KCGH 1HJAC 1C1PA 1A5IA 5EQQA 1K28D 2FDAA 1YCPK 1NRRH 1O2OA 1W0KD 4IW4E 2FO9A 2GTBA 3F2HA 2OQ5A 2QN5T 1EQ9A 3AAVA 5C3NA 1O2TA 1OPHB 5EODA 4WMDA 1XVOA 4XDEA 2BM2A 1SGNE 2JKHA 1QCPA 1SQRA 1C5MD 2ZI2H 5A2MH 3TNTA 2A31A 2XBWA 1C5OH 1SGYE 2XBVA 1Z8GA 3RXSA 1XXFA 1P2NA 2G81E 3V0XA 1ZLRA 5K0HA 3FZDA 2KAIA 1K1JA 2CV3A 1C4Y2 1JIRA 4FXGH 5SGAE 3EE7A 1HAHH 1UTLM 2GGVB 3RXHA 3MO6A 5J4SA 1TPPA 2SNWA 2VIPA 3RXTA 4AX9H 4AN7A 5GIBA 4I32A 2P8OB 4DCDA 1TGNA 1EP5A 3BSQA 5KECA 3SNCA 4AC9A 5EJZA 4Z6AH 1AKSB 1BITA 1FZZA 2BZAA 4CRCA 3V7TA 3P8OA 4AG2A 4MNVA 4K8YA 1HAGE 1C5YB 3UTUH 3ATWA 1O2VA 3ZV9A 3PLBA 1YPJH 4AZ2B 4MG3A 4DW2U 4WXVA 4X6NA 1ANEA 1EATA 4WJG2 1HDTH 1P2OA 1FXYA 1B0EA 2IJOB 4O03A 2EA3A 2K1QA 5HYOA 2OC1A 2Q6DA 5B6LA 8GCHG 3PRDA 1GHAG 4OGYA 3V13A 1O3AA 2BD5A 3HATH 3SU6A 1OOKB 1F5LA 5C94A 1KLTA 4AOQA 1BQYA 2J95A 3ZVGA 1UVUH 2CN0H 1V2KT 1DM4B 6CHAB 1PQ8A 2ZDAH 3AW0A 5HXFA 2PUXB 4ZKNU 1SLXB 3SGQE 5JBCS 4GHQA 1F92A 3B9FH 1WV7H 4K69A 2PLXA 1HAVB 4UE7H 1GL1A 4F48B 1HAPH 2UWOA 3S7KB 1HUTH 1GJCB 3A85A 1GG6C 2PW8H 2JETC 2WZQA 5T6GA 2GX4A 1RIWB 1IOEA 1AY6H 3ZYEA 4Q63A 1SGDE 1O34A 4U2WA 1BHXB 5JDUB 1TOMH 2ODYB 1FV9A 5ESBA 3E3TA 1KTSB 5C1YA 1QGFA 1DVAH 5EGMA 1OP0A 1OYQA 3BTDE 1N8OC 3D62A 5F6MA 3RXBA 1Z6JH 3P8NA 2ZCLP 1O5BB 4A1VA 2A4QA 1C5NH 2FX4A 5G4BA 3SU3A 2ODPA 1HRTH 1VZQH 1MKWK 1UHBA 1BRUP 3QDZB 3RDZA 2WUBA 2IPHA 2FZZA 1FY3A 3VGCC 1GBIA 1H8DH 1P2KA 1G30B 1UTQA 1DWEH 1THSH 1SOZA 3RXJA 1TBQH 2DE8A 1BJUA 2FOMB 1T8MA 5GNDA 1LKBA 2PGBB 1ETTH 3VPKA 1MH0A 3EQ0H 1OWHA 3OY5U 3RMMH 4ISLA 4RI0A 4X1SU 1SGIB 3T28A 1BTPA 2PKAA 4LOYH 4WH6A 5TJXA 4FU7A 1E34B 2KCOA 3M7QA 2C3SA 3E6PH 2XNIA 1IQNA 2FOAA 2VIVA 4P02A 3F9EA 1LKAA 3PV5A 1Y5UT 4NIYA 3WWFA 3M3SA 2FMJA 3A7ZA 2QC2A 2HGTH 4X8SH 3ZVEA 1W7GH 1V3XA 2BTCE 3LKWA 2R0LA 2A2QH 5BPEA 4GSOA 1LTOA 1YPMH 4X6OA 1FIWA 1HB0B 4Q7YA 1G2MA 3H7OA 1GVKB 1TRMA 1DOJA 4TT3D 3QLPH 1MTSA 1EZSC 4D76A 1QFKH 2ZCKP 1UJ1A 1TRNA 1SFQB 3EE0B 4X8VH 1O3LA 2EQNA 5JB8S 3DA9B 3P95A 3RU4T 3VEQB 5DSFA 2QYIA 3UQVA 1P0SH 2BDBA 1ELEE 1AMHA 1FQ3A 1PPFE 5F8TA 4RN6A 5C1XA 4JYVH 3T29A 2AH4X 5EQSA 4YOGA 3M7UA 3GYLB 3URDA 2ZPRA 2OC8A 2O8TA 2UWLA 4OGXA 3SUFA 3SV6A 2V7QD 2P8OC 1NBME 4GAWA 5PTPA 2TGAA 3SJ9A 1TQ7B 2PWXA 2L6OA 5AFYH 1ARCA 1AN1E 4X6PA 3ZZ5A 1C5WB 2R2WU 1GJ5H 3VG8A 4ISOA 1X7AC 4IC5A 2H9HA 1ZJKA 3DCLA 1DS2E 1G32B 3BEUA 2P59A 1KXEA 3PLKA 2BDAA 3O8BA 2FTMA 1CA0B 4NIXA 3TU7H 1SGEE 3ZVDA 1TNLA 4QT8C 1K2I1 5KEDA 1P01A 1XUHA 1NN6A 3M5OA 2J2UA 3AK5A 3BF6H 2HNTF 1IQMA 3MFJA 1O3KA 1KLIH 5HM2A 1TX6A 5C67A 2AIPA 3E0NB 3S0NA 1P12E 1EPTA 3MMGA 3OTJE 1NRPH 1O2HA 2GDEH 3OY6U 1D3TB 4XD7D 5L30H 1C1NA 1ZTJA 3KN2A 4BAHB 2F9BH 3L33A 4HGCA 1T8OA 1NROH 1ZZZA 1T8LA 1XUGA 2G4UA 3UFAA 3ZZCA 3PV4A 3WWBA 4DIIH 4Y7BA 3O8DA 1TMTH 1XUFA 4JCNA 1BCUH 4GHTA 1QBVH 2FYRA 2ZDMA 3DSOA 1QL7A 1RFNA 3S69A 1O2LA 4E05H 4YM9A 2FOBA 5E0GA 4K3JA 2ZP0H 3RM0H 1GHBG 2A2XH 2I6SA 2GCTC 2H2ZA 1O2QA 2A7JA 4RSPA 1DT2A 4INLA 1PQ5A 3W94A 3IG6B 1ANBA 1C5ZB 2Z94A 3DD2H 3ATIA 1IHTH 1EAWA 1GMCF 3SGAE 1KY9A 5EXMA 3U8RH 1J8AA 4CBOA 5DPAA 3SV8A 1CBWC 3RXDA 1V2UT 4M9FA 3GY8A 4XE4A 4X0WU 1HAOH 4WMEA 1BIOA 1YBWA 2XWBI 4KELA 1YPKH 3KEEA 2A4GA 4OM9A 3I77A 4YLUA 1V2JT 1K1NA 2CHAB 1GMCG 1MMJN 2B9LA 1N8OB 1EZXC 3Q3YA 2QCYA 4B71A 3ZZAA 4A7IB 1QB1A 1E36B 2HOBA 1TNJA 2VIWA 1F2SE 1BHXF 3OTPA 4KTUA 1YCPH 3F9GA 4CBNA 1TPAE 1SGFG 5FL7D 1Y59T 1GBLA 9ESTA 3A89A 4K5ZA 1AUJA 1XKAC 1PJPA 5DG6A 2FP7B 4O3UA 4FVBA 2XTTB 2V6NA 5EQRA 2A5IA 5DKMA 3RXAA 2ZG0H 1W12U 4CH8B 3G01A 2VGCB 2VINA 2ZCHP 5CHAC 1HCGA 4INKA 1MTNB 2V0BA 1OXGA 2SGQE 1HJ8A 1F0UA 2XYAA 2V35A 3SNDA 2Y6TA 1GHVH 1AUTC 2BXTH 1MTVA 2GCHF 2D26C 1O31A 3BG8A 2AGGX 4XRNA 1WU1A 1S0QA 1W8BH 2C8WB 5DP4A 2R3UA 1GI9B 1O2XA 1XUKA 3TJNA 2BMGB 1JOUB 1BTZA 4UFFH 3ZVFA 2W5EA 1O5EH 3QTVH 1C5QA 3N7OA 1FY5A 1O5GH 3GCHB 3TGJE 3ZZ9A 3M37A 3FANA 2WPDD 5F03A 2A5KA 2NWNA 2BY9X 1AIXH 1PPEE 2VJ1A 1DE7H 3DFJA 1SGCA 1N1LA 1NFYA 4X2VA 3BEFB 2JETB 1SHYA 2Y80A 1UHBB 2BLVA 4ZXXH 1ZHRA 1KDQB 1J14A 3SBKA 1GL0E 3WY8A 3TNSA 1WYKA 2EEKA 3ZIAD 1LHFH 3PRBA 3MI4A 4ASUD 2VBCA 3H09A 4DT7B 1ZTLA 1V2WT 2FLBH 4CRDA 1Y5BT 1MCVA 3CENA 1BTWA 2FLRH 4A1XA 3SYJA 1O3MA 2ZFPH 3CP7A 3ELAH 4F49A 2JH0D 3VB7A 1YPEH 3SI3H 1P3EA 3U98H 3EAJA 3RXFA 4JYTA 3RXOA 2ANKH 1LVOA 2XXLA 4ABAA 3HKJB 3U1IB 3BV9B 3GCHC 4TY6A 1P02A 1GHWH 1BB0B 1OWEA 2NU4E 3EA7A 4AFQA 3UPEA 4UONA 2CF8H 1UTNA 1RTKA 3B8JA 3FKSD 3TJVA 3PO1B 4ZKOU 1QRZA 1L0ZA 1AFQB 3MNCA 2BX4A 2CJIA 1DUEA 2KZ4A 1Y3YA 3EGKH 1SLVB 2KAIB 1P09A 1C5TA 2O8WA 2GV7A 5DK1A 2KX4A 1PQ7A 1TGBA 3SORA 3TH3H 2ZFQH 1SR5C 4K60A 2EI8A 3E90B 4BXSA 1O38A 1BZXE 3LDXH 3MWIU 2LP6A 5E2OA 5DN6D 5HIZA 1QHRB 1A5HA 4JMYA 3RXLA 2R9PA 4AFUA 4Y8YA 3KQCA 1E37B 1C2JA 1F0SA 4AB9A 1KXBA 3UNQA 2EY4C 1FPCH 1CHOG 5JBBS 2F4LA 4FUDA 1O39A 1TGCA 3RLWH 1RTFB 2A4OA 4I8JA 2GD4B 4B76A 1A0LA 2BZ6H 4OS5A 4RT1A 3F2FA 4IS5A 3RXMA 1CHOF 3OX7U 1OWDA 2F9PA 3GY5A 3MH4A 2Y7XA 3QGNB 5DP9A 1B5GH 1GBDA 1ZSLA 1O5FH 1IQEA 3ZZ8A 3QUMP 5DO4H 4YT7H 1BMFD 2VVVA 2ZHEH 2M5TA 4NCYA 1DWBH 5EIYA 4ZH8A 1P03A 2AGIX 1P2JA 3U1JB 1DANH 2AIQA 1LPZB 3S7HB 2B7DH 2V3MA 3LJJA 1QY6A 1BMLA 1FNIA 1Z8JB 5LPEA 3MNSA 1BRAA 3UWJH 4K2YA 3FP8E 3TK6A 2BY6X 5J4QA 1HAVA 4KGAA 4UFEH 3DSPA 2TPIZ 4Y71A 4GVUA 4Q7XA 3KNXA 4B2CA 1C2DA 3TH4H 1EAUA 2PP6A 4FU8A 2VU8E 5DP7A 1O30A 2G52A 1AZ8A 1W13U 1SL3A 2WPKS 4YOIA 1PYTD 1QJ7B 3RU4D 3SNBA 3ODFA 1FUJA 8KME2 1BTHH 1YKTA 2G5VA 1TOCB 1W10U 3KQBA 5L2YH 2WHXA 1L1GA 3NWUA 1QQ4A 1VJAU 2WPIS 3F9HA 1SC8U 2PHBA 2FIRH 5DP3A 2THFB 4AG1A 1CBWB 2FODA 4MQAA 1SQOA 1TMBH 1LPKB 2Y81A 3GCTF 2Q6FA 1W7XH 1WTHD 4DOQA 1Z8RA 2ANWA 3ESTA 4LK4A 1O2WA 1OP2A 2XWAA 3SU0A 4RT0A 1GBBA 1VJ9U 1AWFH 1LHGH 1CGHA 1GG6B 1LHEH 1MKXK 1V2PT 1HXFH 1V2TT 4FUIA 1TRYA 4ISNA 2P94A 3RXVA 3PMJA 1HAIH 1NU9A 2STBE 5LPFA 4FUCA 5HIYA 1YPHC 2TGPZ 4OS2A 2BLOA 1S6HA 2ZHWH 4YESB 5JPMH 1Y3UA 5C5OA 3PMHB 4FETA 1BRCE 2XC5A 1ESAA 2C90B 2PKAB 2CHAC 1D3PB 2BY5X 1XUIA 5DP6A 3LONA 1AQ7A 3A80A 2A0QB 1QNJA 4Y10E 1SGTA 7GCHF 3TGIE 1O35A 3UAIC 2AMQA 4NGAH 4Q2KA 1TA2A 4Q4LA 1E35B 4ABJA 2BDGA 2ZPQA 1JBUH 2O8UA 3H5CB 3C1KA 4XSKU 2HLCA 3ZZ4A 1COWD 1SPJA 1C9TA 1TBRH 4Q80A 1UVPA 1LDTT 1DUAA 1C5PA 1D6WA 3RMOH 2ZFTA 1FONA 2UUJB 1S83A 3QN7A 1LQEA 1MD7A 2RA3A 2XBYA 3PLPA 2VWMA 3KQEA 4ABFA 1D4PB 3UUZA 1A46H 1LVMA 2Y82A 2W7SA 1THPB 2QXGA 2LELA 4ZKSU 4I8KA 1IQFA 3A83A 5EXLA 1H8IH 2YMSC 1MBMA 2F9UA 1IAUA 3UNSA 1PPBH 1ZHMA 1HXEH 1ELDE 1GVLA 1MZDA 4X8UH 4VGCC 6ESTA 1G2LA 1G3EA 2QY0B 5IK2D 4AGJA 2P3TB 3I29A 4B6EA 2F43B 1P3CA 1GGDB 3LGYA 1D3DB 3GY6A 2ZGBH 1QJ1B 3MO9A 6GCHG 2ZTZA 1SHHB 2FOCA 2EC9H 2OTVA 2QAAA 2TBSA 1EJNA 7LPRA 2BD9A 1MZAA 4X1QU 1Q31A 3HGPA 3LT3A 2FOHA 5T6FA 5FPYA 3SQHE 1XX9A 1GBTA 2LPRA 1H9IE 2GT7A 1S0RA 1QBNA 1BBRE 3BTTE 3PMBB 4BTIB 5IYTA 1EP6A 1YLNA 4CREA 3NZIA 1RXPA 1H9LB 1WQSA 2QF5A 2BVXH 3K2UA 2RG3A 4FVDA 4B2BA 1WQVH 5A09A 1BMNH 1AB9C 2KCAA 2HPQH 2Z3DA 1GHBF 1GJBB 3IWMA 4U30A 2Y5GA 1ZMLA 2HNTC 1HYLA 1ZMNA 3E16B 5HKKD 4HG6A 3ATLA 2ALVA 2ZQ2A 2VWLA 3UOPA 2G51A 5T1VA 3OE7D 4JYUH 1QTFA 2Z9IA 3ZZ6A 7GCHG 3BG4B 3GY2A 2VIQA 4AYVB 3RU4E 1C1TA 1HV7A 1MTNC 1P9SA 4IC6A 5DP5A 1PYTC 1QR3E 2J5UA 3MU0A 5GWZA 4A5TS 3ATKA 4ABEA 3SW2B 2FI4E 2ZTYA 2K8IA 1GJ8B 3KGPA 1O0DH 3CS7A 3A7WA 3SN8A 1UCYH 3F1SB 1C1VH 3SNEA 4J1YA 3RXRA 4YXWD 2Z3CA 2CF9H 4GPGA 2W26A 5FAHA 4H4FA 4I8LA 1YGCH 5FBEA 1GBFA 4BAQB 4SGAE 2OBQA 2ZHQH 4Y8ZA 2C8XB 2VVCA 2ZHDA 4U32A 4P00A 1CGJE 2BHGA 1WBGB 1SLWB 4B1TA 5AF9H 2F9NA 3KF2A 2YMSD 3K6YA 1ZPCA 1MCTA 3TPIZ 5B6OA 4Y0ZE 1ZOMA 2VH6A 4D7FA 2DUCA 3KHVA 5EG4A 1U6QA 4E06H 2AFQB 3GDSA 2BD3A 3H7TA 3M35A 1VKYA 1T31A 1L2EA 1ZRBA 1XVMA 2ZU5A 5ESTE 1FI8A 3E8LA 1AE8H 2OINA 2BLQA 1O2YA 3UQOA 1HBTH 1CE5A 3U28C 1CT4E 4ZXYH 1XUJA 3GCTG 1J9CH 1GI7B 4MDSA 1GJ4H 4D7GA 1C4V2 1SMFE 1THRH 2C4FH 2BQWB 2SGFE 1OP8A 4X6MA 4XOJA 2QF3A 3A7VA 1LPGB 3FVFB 3RMLH 4MLFB 3SI4H 2CXVA 3HKIB 3OEED 5LH8A 2Q1JA 1MABB 3D49H 1N6YA 1CQQA 3SHAH 5CMXH 5C2ZA 3ZV8A 3MNXA 2F91A 4H42U 3RM2H 3MU8A 5EW1H 1F7ZA 2QE7D 3SJKA 3OU0A 4VGCB 3SZEA 1ABIH 4LZ1H 1DX5M 2ZA5A 4GUXA 3MO3A 4A6LA 1A61H 3UWIA 3GY7A 5ABWA 3JZ2B 3MHWU 2TRMA 4XBBA 1V2ST 4OS6A 2RDLA 1PPHE 3VB4A 8ESTE 2ZHFH 1SGQE 1K9OE 2C93B 7ESTE 3EA8A 4TWYA 1GDNA 3U8OH 3PB1E 2FOFA 2H9TH 2JDID 5EXNA 4FUBA 1A4WH 4Y6DA 2D2DA 4O9VA 1MU8B 1ANDA 1FAKH 1UTMA 3BIVH 3PTBA 3ZYDA 3OFND 3NRLA 1BDAA 2W3IA 3VB3A 4FUJA 1MKXH 3LOXA 1GBMA 4KTCA 2NU0E 5FCKA 3O8RA 1GDUA 2TGDA 1M9UA 3PWBA 4KTSA 1GI0A 3M3TA 2F3CE 3BIUH 4IN1A 3BTGE 4NWLA 3BN9A 3LPRA 3LC3A 2BQ7B 2ASUB 1BBRH 2EI6A 3ATMA 1ELAA 2Z3EA 1V2MT 2A7CA 5EJ1A 1JIMA 3A87A 4B2AA 2P95A 1AD8H 1K1IA 3F0OA 3F9FA 3U69H 3ZVCA 1LO6A 2Z9JA 5L2ZH 2AMDA 3SHCH 3FZZA 1TFXA 1O2UA 1BUIA 1O2NA 1XM1A 5ETXA 4WVPE 1O2PA 2GVFA 1K21H 1T4VH 4ABBA 4B75A 1C9PA 1GJ7B 1OWKA 3QWCH 2IPQX 1OWJA 3SUGA 1IHSH 1FIZA 1TA6A 1L4ZA 1UK2A 9LPRA 1A5GH 5CHAB 3LH3A 4A1TA 2GT8A 4MNYA 2ZGHA 4UDWH 1TMUH 3BTKE 3MH7A 1CA8B 1Y8TA 5DJ7A 1F5KU 3QX5H 1C2EA 3PO1C 4RKJB 1ANCA 2WYGA 4E7RG 1KXCA 1VITF 3EDXB 4X1PU 1PPZA 1QZ8A 4INHA 1C2IA 1DPOA 1C1MA 2ZGJA 1TALA 4JK5A 3BEIB 1GMHF 2C8YB 1BTXA 1F0RA 2YMSB 1O3NA 1P57B 4YO9A 2STAE 4YT6H 1JRSA 2BD4A 4B6FA 4F4OC 1UTJA 1H8HD 2SGDE 4CHAC 1ESBA 1EPTB 1S82A 5T6DA 1B0FA 2J98A 3HK6B 8LPRA 3RXIA 3MYWA 1BT7A 1MAXA 2FS9A 1SGPE 1O5AB 1TGTA 1O3GA 4X2WA 2D1JA 4AGKA 2FS8A 4CR5A 2Z6BD 2PTNA 1FMGA 1TONA 4ZROA 1D6RA 1NZQH 1YC0A 2PKSC 4DIHH 1Z7KA 1A1RA 2JIZD 1KIGH 4IBLH 2AMPA 4XBDA 1UVOA 1QB9A 3OSYA 2W6JD 3W1EA 2KM0A 1Z71A 1TPOA 1WCZA 4MPWA 1QIXB 2JJ2D 1QA7A 2FPZA 1GHXH 1EZQA 2ZDLA 4NG9H 3TJUA 1HLTH 3M3VA 1ELTA 1ETRH 2G00A 1QJ6B 1TBZH 2OD3B 1GMDF 2BOHB 3EA9A 3UOUA 1OSSA 1AWHB 5JBAS 2TIOA 3TITA 3ZZ3A 4UD9H 1EXFA 1FLEE 5C5NA 2A32A 4NIWA 2GDDA 1CGIE 3SOSA 1OKXA 3K6ZA 1C5VA 2QGRA 2RA0A 7KMEH 1UCYE 2WV9A 4NA7A 4DGJA 3O8CA 3NCLA 3R3GB 1V2QT 4BTTB 3JZ1B 2P93A 3VXFH 4AB8A 2WUCA 3N7EA 2HALA 5TCCA 4DJZB 1HJAB 1KDQA 3ENSB 3A84A 2JH6D 1Z1IA 1MD8A 2HPPH 3AAUA 4Z0KA 4TSFD 5EPYA 4JZFH 2BYAX 2UUKB 1JRTA 5AHGH 2UWPA 2GP9B 3RXGA 4NSVA 1NRNH 1E79D 2BVSH 1YM0A 3M36A 4IMQA 2FESH 1K22H 2K0QA 3A8CA 1GJ9B 5C20A 1TNHA 5C1UA 3HK3B 1C5RA 2Z7FE 4K8BA 5FX5A 4GCHF 5BRRE 1SQAA 2FX6A 3STIA 2VVUA 3ZZ7A 1L1NA 4YZUA 1QB6A 1N6XA 1FY1A 3SUDA 5C0TA 1D3QB 2A5AA 5T3HA 3FN8A 1C1UH 4O3TA 3MU1A 4GCHG 2AGEX 4NSYA 2OC7A 4WXIA 5F8ZA 1O2IA 3FO8D 2ZWLH 2Y5HA 1E38B 1WDIA 2QF0A 1RIWC 1CVWH 1RD3B 1ORFA 1V2LT 1AHTH 1TX8A 3DT0H 4XBCA 3UY9A 5HM9A 1O3BA 1GI5A 1LCYA 2ZNKH 3KL6A 4HFPB 3QO6A 4MPUA 1DXPA 3VFEA 1H4WA 2XCNA 4HZHA 4ACAA 3MNBA 1P04A 1WTGH 1GI2A 1SGRE 4Y0YE 1JWTA 1G3DA 1SBWA 2A45B 2GCTB 1UO6A 2XOKD 3SV7A 1IQGA 1SKYE 1XKBC 1KXFA 2BY7X 4Y7AA 1HAZB 1CT2E 1K0HA 3P8GA 3T26A 1CU1A 3S9BA 2L74A 5C17A 2FYQA 4I86A 2XNDD 2QF4A 1AVGH 2B0FA 1C5UA 4AORA 4OS7A 4CR9A 1GBCA 6LPRA 3GICB 4GLYA 2PV9B 3MH5A 2AEIH 3T2NA 2QV1A 1AO5A 4NWKA 3KYFA 1NC6A 2BD7A 1Y3XA 1QL8A 2HWLB 2J94A 3RC6A 2SGPE 1H9HE 4I31A 3B23B 3P6ZB 1UVTH 1EX3A 1OS8A 3VXEH 2BDIA 3MH6A 5JB9S 2IN2A 1MUEB 3HGNA 1J16A 2P3UB 2RCEA 4CRBA 1O2MA 2J98B 2XCFA 2VIDA 4I7YH 2O9QA 4Z1MD 3TJOA 1ELBA 3NKKA 3LGIA 2ZDNA 4PROA 4BANB 3E0PB 1E1RD 2Z9LA 4RKOB 2IJD1 2PGQB 4KP0A 2OLGA 1ZYOA 3SU5A 3LGVA 3EYDA 1O2SA 1V6DA 1LMWB 1GCTC 2P3FH 1ZJDA 1NM6A 3Q00A 2GZ7A 1GBJA 1L1JA 4U01A 5GXPA 5E8EH 1ZTKA 1ETSH 3K9XB 3GOVB 3RC5A 4WMFA 1FPHH 3LU9B 2FI3E 3PTNA 1CHGA 1SB1H 4TPIZ 5I46H 2FXRA 1TIOA 1RTLA 2ZZUH 3UR6A 1TGSZ 4DURA 3LIWA 3SV2H 1FDPA 4M7GA 2ZC9H 1UW7A 1HFDA 2WPJS 1C1SA 5JYIA 2GJGA 2G8TA 1OX1A 1HGTH 2ZU4A 3SO3A 5IDKA 1LHCH 3T5FH 3TIUA 5FXLA 1H1BA 1DWCH 4BAKB 3PV2A 1E0FD 3SU4A 1C5SA 2RDEA 2ULLA 3SGBE 3MQKC 1QRXA 2JJ1D 4MNXA 1GBHA 1VGCC 3VGCB 4F55A 2WINI 1LHDH 5E2PA 1DICA 3RXUA 1P05A 3V12A 4BTUB 4CRAA 1DDJA 6CHAC 3TK5A 3ZVAA 1C1RA 3SNAA 3UIRA 1Q2WA 1FY4A 6GCHF 3ZZDA 3CS0A 2C8ZB 5A0AE 1MQ6A 2Y5FA 1HJ9A 1BJVA 1QL9A 1AE5A 4BAMB 1KYNA 3OYPA 3W95A 1VCWA 4JZEH 2QA9E 1DWDH 4YTAA 1WUNH 3M5NA 1S5SA 1F5RA 1O5DH 3MTYA 3NUMA 1KXDA 4B74A 2TGTA 1G9IE 1C1QA 2WV5A 1UTOA 4AYYB 3MOCA 1BRBE 1TNGA 1ZGVA 1ZSKA 2H1UA 5FHTA 5FBIA 1TQ0B 3F2GA 1G3CA 4THNH 3T27A 4HI3A 1DLKB 2G5NA 1V2OT 5A0CA 2WPMS 1HAXB 3KQDA 1UCYK 2FOEA 2HNTE 1EZUC 4CRFA 2QXHA 4X1RU 3DUXH 2H9EH 3BTQE 1EAIA 1SQTA 3NK8A 5HGGA 3RXCA 2OUAA 4DG4A 2BQ6B 1BMMH 1E1QD 1GI1A 3Q77A 2HVYB 5A8YA 3FP7E 1P2QA 4TWWA 1EJMA 1ZHPA 2Y7ZA 4JZIA 3AVZA 1NFWA 1YPGH 4TYDA 2DE9A 2R3YA 3D65E 1Y5AT 3T25A 2ZPSA 1XMNB 4H6SB 3E1XB 1O3OA 1AI8H 5TCAA 2B5TB 1EJAA 4K1TA 1C4U2 2PFEA 1BTYA 1KMHB 3F0PA 2FTLE 3SQEE 5GCHF 2ZEBA 1YPLH 1SI5H 5EJLA 4WH8A 4WY3A 4JZ1A 1Z6EA 1GHZA 4A92A 4AFSA 1EOJA 1Q3XA 4ABDA 1NRQH 1H8ED 3BTME 2VNTA 3QGJA 4I8GA 2AHME 2WYJA 2ZFRH 4NIVA 4Y79A 3OAAD 1ELVA 5GCHG 2ZDVH 4NA9H 1F0TA 1ID5H 2BD2A 1Y3VA 1W0YH 2J38A 4NZLA 1WSSH 1Z8IB 1GGDC 3RP2A 4AFZA 2J4IA 1HAYB 4K1EA 4UEHH 3T62A 1GCTB 3Q3KA 1GBEA 1GVZA 1FX0B 1GJ6A 1YLCA 3KYGA 4LZ4B 2IOTA 1ELCA 1O3PB 2AS9A 2VIOA 3S9AA 3GCOA 3RXKA 1GWAA 2BVRH 4IGDA 4LXBH 3RLYH 1MTUA 1O32A 1DXWA 1BOQA 2CMYA 1T32A 1DSTA 5L6NH 1FN8A 2J9NA 3M61U 3BTWE 5DP8A 4CH2B 2BB4A 3P92A 2XBXA 3F6UH 1MQ5A 1J17T 3GY3A 4Y11E 2BDCA 3TVJB 3TH2H 4TPYA 1KSNA 3MU4A 3PROA 1C1OA 3UB0A 5EW2H 1PPGE 2O8MA 4ACBA 1GMHG 4E7NA 3URCA 2R0KA 4ZHLU 4KKDA 2NU3E 2FEQH 2Z9GA 4DVAU 1IQLA 1W0ZU 1GPZA 4I33A 3RXQA 2UUYA 3M5LA 3A82A 5H4IB 1HIAA 4ABIA 2Z9KA 3UREA 2OC0A 1GBAA 1GI6A 1FN6A 1DY8A 3U9AH 1RRKA 2FOGA 1UK4A 2W6ID 1VCQA 4BOHA 1G3BA 3S9CA 1A2CH 2PUQH 2ZGXH 3SUEA 1O3FA 1VR1H 1ABJH 1GHAF 4D9RA 3LGWA 3ODDA 3QZRA 2UUFB 1O2ZA 1BBRK 1LVYA 1PFXC 3PM3A 3SJIA 2I6QA 1PQAA 4MPVA 2WPHS 1IQJA 1C1WH 1UTPA 1O3CA 2GKVE 1W11U 1SG8B 1GJAB 3R0FA 1FJSA 3FP6E 1P11E 1AKSA 1A3EH 3GYMA 2XC4A 4UFGH 2WSSD 4B73A 4Q7ZA 3OEHD 1SSXA 1AU8A 1BTUA 3P8FA 2GMTB 4FUHA 4ZHMU 2SGEE 2B8OH 1S84A 1NBMD 1TAWA 1V2VT 3FFGA 2PSYA 2GV6A 2PTCE 5DGJA 4ZAEA 4ESTE 1DLEA 4TY7A 1P10A 1YP9A 3N7DA 1MU6B 1MAYA 5EPNA 1O2JA 1W2KH 2J97A 5EOKA 3TGKE 3RMNH 3SU2A 4ZUHA 1EOLA 4NZQA 1YCPM 3P17H 1T7CA 3GISB 1NO9H 4ZHAA 1HPGA 1T8NA 2YNAA 1V2NT 1A0HB 1O3HA 5F53A 1TYNA 4Y76A 2HRVA 1HIAB 1O2GH 3LH1A 1QRWA 5E0HA 3AASA 2FI5E 3HPTB 2YOLA 2SGAA 1HNEE 3FOAA 1YLDA 3M7TA 4BAOB 1DFPA 1YF4A 5AVDA 2GMTC 1GHYH 4SGBE 3TLOA 1EB2A 3LGTA 4ISIH 4Y8XA 1A0JA 2WV4A 3CNRA 1TNIA 1UVSH 2WPLS 1B7XB 1TX7A 2QXIA 4YOJA 4X1NU 1ZR0A 1MBQA 4K1SA 4XFQA 5HMAA 1P9UA 1KLJH 2KFWA 3F68H 3LC5A 1XXDA 1GI8B 2YNBA 2VWNA 3A81A 4FOUC 2OQUA 2GZ8A 2A1DB 2OK5A 2NU2E 4D8NA 2VWOA 5KGOA 4WF8A 4BNRA 1BMAA 1DSUA 1IQIA 2ZFFH 1DY9A 1KTTB 3RC4A 2FM2A 1AB9B 2LNCA 3A7TA 3IITA 1O3DA 1EASA 1YPHE 4BXWA 1LQDB 3Q3XA 1O3IA 3A88A 2SFAA 3PMAB 1YYY1 1TABE 2GZ9A 1TWXB 1OWIA 3WW7A 1EKBB 1G36A 4FUFA 3A7YA 4YLQH 1ZMJA 3GCNA 5E0JA 5A0BA 3GY4A 2ZIQH 2CGAA 3GDVA 3KQ5A 2F9VA 1NESE 1K1OA 2XC0A 1GJDB 3N99A 4NA8A 3RXPA 2EI7A 2SNVA 2R2MB 3U8TH 2A7HA 1C2GA 4CHAB 5K7RA 5CHBA 2V3HH 2H5DA 4UFDH 1EPTC 2QIQA 2RFKC 1GI3A 1W3CA 3L6PA 1S81A 2ALPA 2ZO3H 2ZTXA 2BXUH 2ZECA 1P8VC 2HVXA 5GJ4B 1IQHA 4ZCNA 2BDYA 3UR9A 5FCRA 3E91A 1AVXA 2O8LA 1SGFA 4H6TA 3AW1A 4X2YA 3M5MA 1NRSH 1ELFA 2ZF0H 2BOKA 3MU5A 2XRCA 1OYTH 5FPTA 1L4DA 4NFEA 2OBOA 1O2KA 4DY7B 8GCHF 2ILNA 2H5CA 4JK6A 1OHHD 2J34A
chains in the Genus database with same CATH topology
1GBKA 1AVWA 1QBOA 1T4UH 2VGCC 1SOTA 1AFQC 4ABHA 1NFXA 2ZKSA 3QZQA 2GCHG 4IN2A 1TB6H 4ABGA 1ZSJA 1QQUA 1EB1H 4R0IA 3DHKH 2BD8A 1C2KA 2P16A 2PR3A 1A7SA 1QURH 2BY8X 3A8DA 3P70B 1VITH 4ASHA 1SLUB 5JBTA 4ZKRU 5EU8A 1CO7E 1MKWH 1P06A 1NPMA 4FUEA 1GDQA 1WOFA 3Q76A 1O5CB 1FY8E 5FPSA 2ZU2A 5A8ZA 2ESTE 4I8HA 1WAYB 1RJXB 1K1MA 3L3TA 1UMAH 3RUOA 1LVBA 1O3JA 2ANYA 1ESTA 1TNKA 2QXJA 4JZDH 1P2IA 1NY22 1EAXA 1ZPZA 1TLDA 2ZFSA 1GI4A 2D8WA 1UK3A 3NPSA 3KIDU 2ODQA 4MNWA 1O37A 2NU1E 2AERH 1NTPA 1ZGIA 2ZU3A 1Z1JA 1NT1A 3RXEA 1Y3WA 3V3MA 2ZDKA 1UTKA 2J92A 2OXSA 5CE1A 1K1PA 2W7UA 2A4RA 1O2RA 2AYWA 3I78A 1NFUA 1S6FA 2F83A 2FWWA 2H6MA 1ACBE 3LJOA 5LPRA 3BTFE 1S85A 1O3EA 4HTCH 1SFIA 2ZGCA 4NFFA 3A8AA 5GPIB 1W14U 2G4TA 2JH5D 2OP9A 3VB5A 3ITIA 1C5LH 4FU9A 5I25A 2W3KA 4X8TH 3SV9A 1EUFA 4OS1A 1G37A 3VB6A 4IMZA 1INCA 1TPSA 5F8XA 3PYHA 1VCPA 2VH0A 1AZZA 5LGOA 1C2LA 1ARBA 5FX6A 1CT0E 1C5XB 4ISHH 1C2MA 4FUGA 1SVPA 3LGUA 3SJOA 3SU1A 2F9OA 1O33A 3D23A 1GMDG 3SZNA 1P2MA 1DITH 3DFLA 3FAOA 5A8XA 3ZVBA 3K65B 3QK1A 4MPXA 1FAXA 1IQKA 1MTWA 1NS3A 2ZQ1A 3QTOH 1ZRKA 1C2HA 2ZU1A 3STJA 1K1LA 3SJ8A 4D9QA 1RGQA 2OCVB 2BX3A 2ANMH 1KXAA 1QA0A 4J2YB 3A8BA 1A3BH 3TK9A 2BLWA 2PSXA 3A7XA 3BG4C 2XW9A 4MTBA 3BTHE 1VGCB 4CRGA 4ZMAH 1VITG 1CA0C 2BDHA 4X2XA 1GCDA 1TE0A 4OS4A 4R8TB 2V3OH 1J15A 5AFZH 4MVNA 1O36A 5GDSH 1C2FA 3GDUA 2Q6GA 1ELGA 1NU7B 3PWCA 1JMOH 2VB0A 1AGJA 1V2RT 3UNRA 2PKSB 4O97A 1RS0A 4WWYA 3BTEE 2G55A 1BA8B 1AFEH 1JXPA 3NXPA 1PPCE 1D9IA 3ZZBA 1CSOE 1ZPBA 3A86A 3C27B 3KCGH 1HJAC 1C1PA 1A5IA 5EQQA 1K28D 2FDAA 1YCPK 1NRRH 1O2OA 4IW4E 2FO9A 2GTBA 2OQ5A 2QN5T 1EQ9A 3AAVA 5C3NA 1O2TA 1OPHB 5EODA 4WMDA 1XVOA 4XDEA 2BM2A 1SGNE 2JKHA 1QCPA 1C5MD 2ZI2H 5A2MH 3TNTA 2A31A 2XBWA 1C5OH 1SGYE 2XBVA 1Z8GA 3RXSA 1XXFA 1P2NA 2G81E 3V0XA 1ZLRA 5K0HA 3FZDA 2KAIA 1K1JA 2CV3A 1C4Y2 1JIRA 4FXGH 5SGAE 1HAHH 1UTLM 2GGVB 3RXHA 3MO6A 5J4SA 1TPPA 2SNWA 2VIPA 3RXTA 4AX9H 4AN7A 5GIBA 4I32A 2P8OB 4DCDA 1TGNA 1EP5A 3BSQA 3SNCA 4Z6AH 1AKSB 1BITA 1FZZA 2BZAA 4CRCA 3V7TA 3P8OA 4AG2A 4MNVA 4K8YA 1HAGE 1C5YB 3UTUH 3ATWA 1O2VA 3ZV9A 3PLBA 1YPJH 4AZ2B 4MG3A 4DW2U 4WXVA 4X6NA 1ANEA 1EATA 4WJG2 1HDTH 1P2OA 1FXYA 1B0EA 2IJOB 4O03A 2EA3A 2K1QA 5HYOA 2OC1A 2Q6DA 8GCHG 1GHAG 4OGYA 3V13A 1O3AA 2BD5A 3HATH 3SU6A 1OOKB 1F5LA 1KLTA 4AOQA 1BQYA 2J95A 3ZVGA 1UVUH 2CN0H 1V2KT 1DM4B 6CHAB 1PQ8A 2ZDAH 3AW0A 5HXFA 2PUXB 4ZKNU 1SLXB 3SGQE 5JBCS 4GHQA 1F92A 3B9FH 1WV7H 4K69A 2PLXA 1HAVB 4UE7H 1GL1A 1HAPH 2UWOA 3S7KB 1HUTH 1GJCB 3A85A 1GG6C 2PW8H 2JETC 5T6GA 2GX4A 1RIWB 1IOEA 1AY6H 3ZYEA 1SGDE 1O34A 4U2WA 1BHXB 5JDUB 1TOMH 2ODYB 1FV9A 5ESBA 3E3TA 1KTSB 5C1YA 1QGFA 1DVAH 5EGMA 1OP0A 1OYQA 3BTDE 1N8OC 3D62A 5F6MA 3RXBA 1Z6JH 3P8NA 2ZCLP 1O5BB 4A1VA 2A4QA 1C5NH 2FX4A 5G4BA 3SU3A 2ODPA 1HRTH 1VZQH 1MKWK 1UHBA 1BRUP 3QDZB 3RDZA 2WUBA 2IPHA 2FZZA 1FY3A 3VGCC 1GBIA 1H8DH 1P2KA 1G30B 1UTQA 1DWEH 1THSH 1SOZA 3RXJA 1TBQH 2DE8A 1BJUA 2FOMB 1T8MA 1LKBA 2PGBB 1ETTH 3VPKA 1MH0A 3EQ0H 1OWHA 3OY5U 3RMMH 4ISLA 4X1SU 1SGIB 3T28A 1BTPA 2PKAA 4LOYH 4WH6A 5TJXA 4FU7A 1E34B 3M7QA 2C3SA 3E6PH 2XNIA 1IQNA 2FOAA 2VIVA 3F9EA 1LKAA 1Y5UT 4NIYA 3M3SA 2FMJA 3A7ZA 2QC2A 2HGTH 4X8SH 3ZVEA 1W7GH 1V3XA 2BTCE 3LKWA 2R0LA 2A2QH 5BPEA 4GSOA 1LTOA 1YPMH 4X6OA 1FIWA 1HB0B 4Q7YA 1G2MA 3H7OA 1GVKB 1TRMA 1DOJA 3QLPH 1MTSA 1EZSC 4D76A 1QFKH 2ZCKP 1UJ1A 1TRNA 1SFQB 3EE0B 4X8VH 1O3LA 5JB8S 3DA9B 3P95A 3RU4T 3VEQB 2QYIA 3UQVA 1P0SH 2BDBA 1ELEE 1AMHA 1FQ3A 1PPFE 5F8TA 4RN6A 5C1XA 4JYVH 3T29A 2AH4X 5EQSA 4YOGA 3M7UA 3GYLB 3URDA 2ZPRA 2OC8A 2O8TA 2UWLA 4OGXA 3SUFA 3SV6A 2P8OC 4GAWA 5PTPA 2TGAA 3SJ9A 1TQ7B 2PWXA 5AFYH 1ARCA 1AN1E 4X6PA 3ZZ5A 1C5WB 2R2WU 1GJ5H 4ISOA 1X7AC 4IC5A 2H9HA 1ZJKA 1DS2E 1G32B 3BEUA 2P59A 1KXEA 3PLKA 2BDAA 3O8BA 2FTMA 1CA0B 4NIXA 3TU7H 1SGEE 3ZVDA 1TNLA 4QT8C 1K2I1 1P01A 1XUHA 1NN6A 3M5OA 2J2UA 3BF6H 2HNTF 1IQMA 3MFJA 1O3KA 1KLIH 5HM2A 1TX6A 5C67A 2AIPA 3E0NB 3S0NA 1P12E 1EPTA 3MMGA 3OTJE 1NRPH 1O2HA 2GDEH 3OY6U 1D3TB 5L30H 1C1NA 1ZTJA 3KN2A 4BAHB 2F9BH 3L33A 4HGCA 1T8OA 1NROH 1ZZZA 1T8LA 1XUGA 2G4UA 3UFAA 3ZZCA 3PV4A 4DIIH 4Y7BA 3O8DA 1TMTH 1XUFA 4JCNA 1BCUH 4GHTA 1QBVH 2FYRA 2ZDMA 1QL7A 1RFNA 3S69A 1O2LA 4E05H 4YM9A 2FOBA 5E0GA 4K3JA 2ZP0H 3RM0H 1GHBG 2A2XH 2I6SA 2GCTC 2H2ZA 1O2QA 2A7JA 4RSPA 1DT2A 4INLA 1PQ5A 3W94A 3IG6B 1ANBA 1C5ZB 2Z94A 3DD2H 3ATIA 1IHTH 1EAWA 1GMCF 3SGAE 1KY9A 5EXMA 3U8RH 1J8AA 4CBOA 5DPAA 3SV8A 1CBWC 3RXDA 1V2UT 3GY8A 4XE4A 4X0WU 1HAOH 4WMEA 1BIOA 1YBWA 2XWBI 4KELA 1YPKH 3KEEA 2A4GA 3I77A 4YLUA 1V2JT 1K1NA 2CHAB 1GMCG 1MMJN 2B9LA 1N8OB 1EZXC 3Q3YA 2QCYA 4B71A 3ZZAA 4A7IB 1QB1A 1E36B 2HOBA 1TNJA 2VIWA 1F2SE 1BHXF 4KTUA 1YCPH 3F9GA 4CBNA 1TPAE 1SGFG 1Y59T 1GBLA 9ESTA 3A89A 4K5ZA 1AUJA 1XKAC 1PJPA 5DG6A 2FP7B 4O3UA 4FVBA 2XTTB 2V6NA 5EQRA 2A5IA 5DKMA 3RXAA 2ZG0H 1W12U 4CH8B 3G01A 2VGCB 2VINA 2ZCHP 5CHAC 1HCGA 4INKA 1MTNB 2V0BA 1OXGA 2SGQE 1HJ8A 2XYAA 1F0UA 2V35A 3SNDA 2Y6TA 1GHVH 1AUTC 2BXTH 1MTVA 2GCHF 2D26C 1O31A 3BG8A 2AGGX 1WU1A 1S0QA 1W8BH 2C8WB 5DP4A 2R3UA 1GI9B 1O2XA 1XUKA 3TJNA 2BMGB 1JOUB 1BTZA 4UFFH 3ZVFA 2W5EA 1O5EH 3QTVH 1C5QA 3N7OA 1FY5A 1O5GH 3GCHB 3TGJE 3ZZ9A 3M37A 3FANA 5F03A 2A5KA 2NWNA 2BY9X 1AIXH 1PPEE 2VJ1A 1DE7H 3DFJA 1SGCA 1N1LA 1NFYA 4X2VA 3BEFB 2JETB 1SHYA 2Y80A 1UHBB 2BLVA 4ZXXH 1ZHRA 1KDQB 1J14A 3SBKA 1GL0E 3WY8A 3TNSA 1WYKA 2EEKA 1LHFH 3MI4A 4DT7B 1ZTLA 1V2WT 2FLBH 4CRDA 1Y5BT 1MCVA 3CENA 1BTWA 2FLRH 4A1XA 1O3MA 2ZFPH 3CP7A 3ELAH 4F49A 2JH0D 3VB7A 1YPEH 3SI3H 1P3EA 3U98H 3EAJA 3RXFA 4JYTA 3RXOA 2ANKH 1LVOA 2XXLA 4ABAA 3HKJB 3U1IB 3BV9B 3GCHC 4TY6A 1P02A 1GHWH 1BB0B 1OWEA 2NU4E 3EA7A 4AFQA 3UPEA 4UONA 2CF8H 1UTNA 1RTKA 3B8JA 3TJVA 3PO1B 4ZKOU 1QRZA 1L0ZA 1AFQB 3MNCA 2BX4A 2CJIA 1DUEA 1Y3YA 3EGKH 1SLVB 2KAIB 1P09A 1C5TA 2O8WA 2GV7A 5DK1A 1PQ7A 1TGBA 3SORA 3TH3H 2ZFQH 1SR5C 4K60A 2EI8A 3E90B 4BXSA 1O38A 1BZXE 3LDXH 3MWIU 5E2OA 1QHRB 1A5HA 4JMYA 3RXLA 2R9PA 4AFUA 4Y8YA 3KQCA 1E37B 1C2JA 1F0SA 4AB9A 1KXBA 3UNQA 1FPCH 1CHOG 5JBBS 4FUDA 1O39A 1TGCA 3RLWH 1RTFB 2A4OA 4I8JA 2GD4B 4B76A 1A0LA 2BZ6H 4OS5A 4IS5A 3RXMA 1CHOF 3OX7U 1OWDA 2F9PA 3GY5A 3MH4A 2Y7XA 3QGNB 5DP9A 1B5GH 1GBDA 1ZSLA 1O5FH 1IQEA 3ZZ8A 3QUMP 5DO4H 4YT7H 2VVVA 2ZHEH 2M5TA 4NCYA 1DWBH 4ZH8A 1P03A 2AGIX 1P2JA 3U1JB 1DANH 2AIQA 1LPZB 3S7HB 2B7DH 3LJJA 1QY6A 1BMLA 1FNIA 1Z8JB 5LPEA 3MNSA 1BRAA 3UWJH 4K2YA 3FP8E 3TK6A 2BY6X 5J4QA 1HAVA 4KGAA 4UFEH 2TPIZ 4Y71A 4GVUA 4Q7XA 3KNXA 4B2CA 1C2DA 3TH4H 1EAUA 4FU8A 2VU8E 5DP7A 1O30A 2G52A 1AZ8A 1W13U 1SL3A 2WPKS 4YOIA 1PYTD 1QJ7B 3RU4D 3SNBA 3ODFA 1FUJA 8KME2 1BTHH 1YKTA 2G5VA 1TOCB 1W10U 3KQBA 5L2YH 1L1GA 3NWUA 1QQ4A 1VJAU 2WPIS 3F9HA 1SC8U 2PHBA 2FIRH 5DP3A 2THFB 4AG1A 1CBWB 2FODA 4MQAA 1SQOA 1TMBH 1LPKB 2Y81A 3GCTF 2Q6FA 1W7XH 1WTHD 4DOQA 1Z8RA 2ANWA 3ESTA 4LK4A 1O2WA 1OP2A 2XWAA 3SU0A 1GBBA 1VJ9U 1AWFH 1LHGH 1CGHA 1GG6B 1LHEH 1MKXK 1V2PT 1HXFH 1V2TT 4FUIA 1TRYA 4ISNA 2P94A 3RXVA 3PMJA 1HAIH 1NU9A 2STBE 5LPFA 4FUCA 1YPHC 2TGPZ 4OS2A 2BLOA 1S6HA 2ZHWH 4YESB 5JPMH 1Y3UA 5C5OA 3PMHB 1BRCE 2XC5A 1ESAA 2C90B 2PKAB 2CHAC 1D3PB 2BY5X 1XUIA 5DP6A 3LONA 1AQ7A 3A80A 2A0QB 1QNJA 4Y10E 1SGTA 7GCHF 3TGIE 1O35A 2AMQA 4NGAH 4Q2KA 1TA2A 1E35B 4ABJA 2BDGA 2ZPQA 1JBUH 2O8UA 3H5CB 3C1KA 4XSKU 2HLCA 3ZZ4A 1SPJA 1C9TA 1TBRH 4Q80A 1UVPA 1LDTT 1DUAA 1C5PA 1D6WA 3RMOH 2ZFTA 1FONA 2UUJB 1S83A 3QN7A 2XBYA 1LQEA 1MD7A 2RA3A 3PLPA 2VWMA 3KQEA 4ABFA 1D4PB 3UUZA 1A46H 1LVMA 2Y82A 2W7SA 1THPB 2QXGA 4ZKSU 4I8KA 1IQFA 3A83A 5EXLA 1H8IH 1MBMA 2F9UA 1IAUA 3UNSA 1PPBH 1ZHMA 1HXEH 1ELDE 1GVLA 1MZDA 4X8UH 4VGCC 6ESTA 1G2LA 1G3EA 2QY0B 4AGJA 2P3TB 3I29A 1P3CA 1GGDB 3LGYA 1D3DB 3GY6A 2ZGBH 1QJ1B 3MO9A 6GCHG 2ZTZA 1SHHB 2FOCA 2EC9H 2OTVA 2QAAA 2TBSA 1EJNA 7LPRA 2BD9A 1MZAA 4X1QU 1Q31A 3HGPA 3LT3A 2FOHA 5T6FA 5FPYA 3SQHE 1XX9A 1GBTA 2LPRA 1H9IE 2GT7A 1S0RA 1QBNA 1BBRE 3BTTE 3PMBB 4BTIB 5IYTA 1EP6A 4CREA 3NZIA 1RXPA 1H9LB 1WQSA 2BVXH 3K2UA 2RG3A 4FVDA 4B2BA<