4NJ7A

Pb1 domain of atarf7 - semet derivative
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
77
Chain Sequence
YTAVQKRGSVGRSIDVNRYRGYDELRHDLARMFGIEGQLEDWKLVYVANAILLVGDDPWEEFVNCVQSIKILSSAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular basis for AUXIN RESPONSE FACTOR protein interaction and the control of auxin response repression.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
molecule keywords Auxin response factor 7
total genus 13
structure length 77
sequence length 84
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4nj7A00
5KHQA 2KJ6A 2LASA 3EC8A 2WX0A 3QARA 1ZGUB 1P98A 2XBBC 4FHKA 3SHQA 3B0AA 4HPLB 4IUMB 4BKSD 2ASQA 3A9KA 3HM6X 4EZLA 1WFYA 3T8MA 1U4AA 2KVRA 2NBUA 5CTRC 2MBOA 4XC2A 1WXSA 2GBJA 2V1YA 4HDQA 2AL6A 4MDKE 4BKGA 4DHJB 4ANVA 3LJ3A 3VH4B 4A3OA 2Z59B 4DDGD 1KLVA 1V49A 4BVUC 3ZKJC 3ZNZB 1IPGA 4MGKE 4FULA 2Z0EB 3KYDD 1UZXB 2N9EB 3PRPB 5C1ZA 1J8CA 5IAAC 3A9JA 4HPMB 2NPTA 3M63B 5G55A 4I6NB 2O6VB 2KTRB 1WI0A 3APDA 4MJSA 1WXMA 2ZZPB 5CHVC 3UINB 1F9JA 2K39A 3VDZA 3U30A 2K8BA 2NS5A 4DBGA 1SE9A 1HE8A 1Q1OA 2DZKA 2IO3B 2WYQA 3D32A 3AXCA 4YL8A 5AZGA 4G11A 3SD5A 2FIDA 2WX1A 4FA6A 4EKUA 2KTRA 3U7DA 4MJSB 2FCMA 2MP2A 5EDSA 5BO4B 4K1RB 4FJYA 3AU4A 3ZLZA 2RD0A 2CKHB 1UBQA 1LQBA 2MBHA 4RMAA 1WGDA 2M17A 3ZTDA 4IWPA 2G4SA 3R7QA 1OQYA 4E71A 2BWES 1WE7A 3AI5A 4MEMA 4EZJA 1V5OA 2LWPA 4GDLA 4GIVA 5JHAA 1WIAA 2JZZA 2RSUA 4PYUA 4DWFA 2FCQA 4M8NA 3CMMB 1P3QU 2FCSA 3RZWC 1J0GA 2LXCA 1GJZA 1WRDB 3U8ZA 1YX6B 3OLMD 2MBBB 1H4RA 1WX8A 3O65B 1E8XA 1L7YA 1XT9B 4IWOA 3MTNB 4I6PA 3R3MA 1K8RB 2J0JA 4W9KA 2BPSA 4LDTB 5AZFA 1V86A 2IYDB 4TKNA 2C60A 2KJHB 3KH0A 3Q3JA 3KUCB 4HXDA 4HCNB 4WWOA 4PS8A 5D6JB 3HM3A 4OVVA 4ASWC 3UIOB 3L54A 2NCNA 5DPSA 2LJ5A 4KV2A 3VXWA 2C5LC 3PRMB 1XD3B 4DHZB 3H6NA 3RZFA 4MH0E 3LDZE 4K7SA 4GDLB 3ML9A 5KHOA 1SIFA 2IZVB 3H7PB 2REXA 5J18A 1TTNA 2JVCA 2MBQA 4LJOB 4ZRJA 1ISNA 1V5TA 2XEWA 2UWQA 3P2BA 3OJ4B 3IVFA 3K9PB 5DPTA 2L3ZA 2ZNVB 4JIOU 4RM8A 4TV3A 3PSEB 2KDIA 2JRHA 1LXDA 2ZPYA 2KMAA 3PT2B 5LXHA 2MSED 2LVPA 2K8HA 3A4SC 4BBNF 3DQVA 3PHWB 1S3SG 3QHTA 1WE6A 2GBKA 3PREA 4URKA 2KJRA 1I42A 1V80A 3L13A 2KDEB 2KWVB 4JL9A 2KZRA 2MWSB 2LZ6A 2L0FA 4NAWA 4WJPA 1Q0WB 1YIWA 4G50A 3SDLC 3L17A 1KJTA 2FNJB 5HKHA 4ZRKA 2ZEQA 2I1JA 4TQ1A 2JWZA 2KFJA 4IW0A 4P7IA 3UQAA 1EF5A 4J6IA 4W9JA 1JRUA 1UH6A 2NBVB 2NVUI 2CHWA 3WAMA 2PJHA 4ICVA 5E6NA 4W9CA 2KMCA 4OVUA 2RR9A 3VTVA 3ZNHB 4BKSA 3V60A 3PHXB 2KN5A 4A20A 2KDBA 3ZIMA 4DHZE 2MRPA 3ZVVA 4DHJD 4CHKA 1UD7A 1A5RA 2KQSA 4AWJA 5GMVA 3QK0A 2LD9A 1GNUA 2KWCA 3H9DA 3ZO5B 4F1SA 2AWTA 3MJWA 3UQBA 2YLMA 3PLUA 4MSMB 3DBSA 4KSLC 1WMHB 2O6VD 2G45B 2KQ7A 3OJ3A 3QJZA 3WAPA 1J19A 2MCNB 5LLIA 2KLGA 1E8ZA 2Y5BB 4MELA 2KXJA 3VH3B 3TCAA 1UBIA 2DAJA 1L2NA 2V4LA 2KFKB 2GMIC 3VFKA 3QWZB 4G3XB 2BYEA 4W9EA 4GOCA 2PE9A 2KNBA 3MHSD 1WH3A 1IP9A 2UYZB 2K1FA 1WGGA 3A1QA 3H1UA 5C23A 3DBHI 4CYEA 4M0WB 2MX2A 3QAQA 3W1SA 2M1MA 3KUZA 4FN2A 4WQOB 3R7RA 3VHTC 1MG8A 2D10A 3NOBA 2XK5B 4TQ0A 1YQBA 3EECA 2M0XA 4GB9A 4ZDVA 4W9IA 4ZYNA 1P9DU 2RPQA 3EFUA 3UIPB 3AULA 3ALBA 3EHVA 2ZCBA 4GDKB 1IYFA 2HD5B 4WJOA 2IO1B 3DCGA 2NR2A 1UGMA 1WXAA 2WDTB 1YX5B 3R66C 1GC6A 1WMHA 4EEWA 3A33B 2A5UA 3APCA 4XZ4A 4LCDE 2ZVNA 5TR5A 3CF6E 2J7QB 3GZNI 1V81A 1WX7A 2DZJA 2JRIB 3QIJA 4WAAA 5D7GA 5AZHA 3ONSA 2IY1B 2N9XA 4KIKA 4W9DA 3T9LA 4ANUA 2JXXA 2G3QB 1TZ1A 1VD2A 4IM2A 4BKTA 1NI2A 3JSVA 4MSQB 4NY0A 5E6PA 3QQ8B 2J0KA 4JQWC 3K9OB 2LI5A 1PQSA 3DBLI 2DAFA 2D07B 4XX5A 1WM2A 3A1QB 2L8JA 2BYVE 2RGFA 1NDDA 3PGEA 2DENB 2KK8A 3SU8X 1V9JA 3TMPB 2DZIA 1WXVA 4W9FA 5AEKB 2PE6B 2JUOA 2M8SA 3ZDTA 2L7RA 2XK5A 1I35A 4FADA 2W9NA 2LGXA 4KSKC 3QX1A 2KX0A 3IBEA 2VRRB 3DVGY 4W9HA 2DYMA 2C7NB 3TBLD 2HJ8A 5JHBA 3KUDB 2C7MB 4II2B 4FHJA 3ENEA 4AOFA 4EFOA 2L0TA 4DK5A 5G2NA 4NAWB 2R2OA 3APFA 2KDFB 4E74A 4PYZA 4GSWA 2L05A 2GBNA 2BKRB 3UGBB 3WA0A 5LXIB 4LJPB 3VTUA 4K81A 4ANXA 3TIXA 1P1AA 3IHPC 3KYCD 2KOXA 1KM7A 4ANWA 5L95C 2FIFA 5J17A 1X1MA 3PS6A 2L00B 3V61A 1WX9A 1WGHA 3B1LX 2N7DA 3M3JA 3ZTCA 2ZPNA 2K6DB 1WF9A 1RAXA 1RFAA 2BWFA 2HE7A 2KD0A 1LM8B 2LGDA 2ZCCA 4HJKA 5JH5C 3L16A 4FJVB 4AP4C 2O2VA 3NZSA 4KDIC 4W9GA 2PPHA 4TUUA 3NHEB 1AARA 2DX5B 5IA7A 1EF1A 2ZNVC 4PS3A 4IM3A 3WIMA 4HVBA 4AUQC 3WALA 1Q5WB 4GU2A 4BOSC 5J2RA 2GOWA 2C9WB 2KTFA 1OEYJ 3X23A 2Z0DB 3JYUA 2WWZA 4HCPB 2QHOA 1TGZB 2V3SA 4NPNA 2EMSA 2JT4B 3VQIA 2IO0B 1C3TA 2KWUB 2NPTB 3RD2A 5JZEB 3PV1A 3ZNGC 2HTHA 2N4FA 1ZKHA 1R4MI 2NBWB 3M62B 3QCAA 4WWPA 4K7WA 5CX3A 2LVOA 4N9F4 1Z5SB 1OGWA 1C1YB 4B6WA 3JVZX 2LXAA 3VUXA 1WM3A 3Q3FA 1FXTB 1TBEA 4X57B 4RM9A 2IBIB 2AYOB 5DPWA 2MLBA 4NJ6A 3ZDMC 3DPDA 2R2QA 1OTRB 2PEAA 3VUWA 2N9PC 1SGHA 3OAWA 1WYWB 3TL5A 3ZRFA 1EO6A 4DXAB 4HWIB 2L76A 2DYBA 3DOWA 3L10B 2JY6A 4GGQA 4GMVA 4W9LA 1WR1A 4KIKB 3X0WA 3HK0A 4MGYE 1M94A 2FAZA 2J0MA 4KZ0A 1RRBA 2KC1A 4HLEA 4IWQA 2O2VB 2K8CA 4MM3A 3H7SA 2JF5A 2KC2A 4GXBA 2D2QA 2DHZA 4WJQA 3PVLA 3PTFC 1UELA 2N1WA 3M95A 4FLHA 4KVGB 4NJ7A 4WJNA 3I3TB 1GUAB 3C0RB 1CMXB 2LRWA 2GBRA 1S1QB 1WJ6A 2B3AA 1EUVB 4IM0A 2KFKA 5CHWA 2MBEA 2N7EA 2CHXA 3A9JB 4KDLB 2CHZA 4BBNC 2KX3A 3L0WB 2MQJA 3N32A 2EMTA 4II3B 1V2YA 1R4NI 4EUTA 1OEYA 3ZUNA 1T0YA 3W1YA 4FBJB 3PPAA 5D94A 1P0RA 2LVQA 3ML8A 3NS8A 3WANA 5E6OA 3S2AA 3IG3A 3CSTA 2IO2B 2BKFA 2FUHB 4F7ZA 3B08A 4FJZA 3IFWB 2C7HA 2K25A 3VVWB 3VAWA 2CR5A 4PS7A 2D11A 4B95A 5L83A 3RULA 1WZ3A 4A3PA 5FR6A 2MA9B 1Z2MA 4JGHB 3BINA 3NY5A 3TJPA 2K6QA 1ZW7A 3H7PA 3DBRI 2N1VA 3KVFB 2D3GA 2I1KA 3L08A 3RCZA 4AJYB 4NQLB 2KLCA 3UF8A 1KOTA 4MGIE 2O6VA 2M4NA 1NBFC 1WZ0A 2CS4A 4NQKE 5CHFA 1RLFA 4BOZB 4HDOA 1E8YA 2OOBB 2LRUA 1E8WA 3DVNU 4WWNA 1VCBA 4K7UA 3V6CB 4NNJB 1GC7A 3NZUA 1YD8U 3QA8A 2OJRA 2BGFA 1V6EA 2KHWB 4F8CB 4I6LB 3DDCB 4KZCA 2GBMA 3KW5B 5D2MB 4GN1A 3JW0X 1E90A 1WGRA 4EOYA 1WJ4A 3VUYA 3V62A 3PLVA 1G6JA 1YJ1A 2KO3A 2LUEA 4LDTD 1LFDA 2DYOA 1E7UA 3RT3B 2FCNA 1WGYA 3PZDA 4E3CA 3VTWA 2ZJDA 3RUIB 2AL3A 4BFRA 3V6EB 4IG7B 4DDID 3A4RA 2ZVOA 2YVCA 2JZ3B 4M8MA 3A9KB 4EZKA 4ZRIA 3GOEA 2IY0B 2AEHA 4B9KA 1XQQA 3ECIA 3AU5A 3ZRCA 1WR6E 4CO7A 2DZMA 4MGZE 3W1SC 2BYFA 2LGYA 3QC8B 2G4DB 1QZEA 1BT0A 3DVGX 4GDKA 2A4ZA 1WY8A 3CSFA 3DVNV 1WJUA 2BF8B 3HIZA 1WJNA 4IC7B 3N3KB 2JPHA 1GG3A 5DCNA 1H8CA 2KANA 4ICUA 2MP2B 3HHMA 4JLCA 3PRZA 2EKEC 3ZNID 4G0NB 4AJWA 3N30A 1D3ZA 2CU1A 3BY4B 4HK2A 2MW5A 1E5WA 3RYTA 3WAOA 5DPRA 3JSVB 1Y8RC 3ZW3A 1E7VA 2KKCA
chains in the Genus database with same CATH superfamily
1SBBB 3TSSA 1TS4A 4DXFA 3B0AA 3A9KA 1U4AA 3P1MA 3AE9B 2V4IB 1WXSA 2GBJA 3NVYA 4DHJB 3LJ3A 4A3OA 4M0WA 1V49A 3ZKJC 1UZXB 3PRPB 1FEHA 1OFFA 2KTRB 5IN7A 3APDA 4MJSA 5CHVC 1XLOA 1SE4A 2DZKA 2WYQA 3D32A 3C19A 1MHXA 2WXHA 5AZGA 2WX1A 3RNEC 3U7DA 2MP2A 2NMQA 5EDSA 4K1RB 1QLBB 2CKHB 1UBQA 1WGDA 4IWPA 2G4SA 1T6BX 2BWES 1CJEA 3U52E 4ACFA 2KT7A 4XWTA 5JHAA 3BWUD 4M8NA 2FCSA 1D5MC 1WRDB 1T0QC 1H4RA 1E8XA 1T0RC 3R3MA 1C78A 2BPSA 5AZFA 4TKNA 1DYQA 2M19A 3HM3A 2WNMA 2C5LC 3PRMB 4HROA 3LDZE 2BQQA 3RMKC 1JWMD 3ML9A 3H7PB 5J18A 1TTNA 4P1CC 1L4DB 4LJOB 4BAXA 1V5TA 2XEWA 4C7ZA 3IVFA 1VR9A 3K9PB 2ZNVB 3PSEB 3Q69A 1LXDA 2K0PA 1AW7A 3PT2B 2G9HD 3QHTA 1ZXIA 3L13A 2E6XA 2KDEB 4XDDA 5BMIA 1Q0WB 5HHDG 4TQ1A 3N20C 4W9JA 2NTSA 1UH6A 2MJDA 2PJHA 2YEPB 4ICVA 3VTVA 2KAJA 3V60A 4A20A 2KDBA 2WS3B 3Q8EA 1F1HA 2KQSA 2INPE 1AYFA 1ENFA 3H9DA 3MJWA 3UQBA 2YLMA 1TKEA 2QDFA 4RGTA 1L0XB 2ZW0A 1JCKB 2KLGA 3KQ4A 4TSSA 4C4VB 3MC0B 3QWZB 3AM9A 4GOCA 3MHSD 2GB1A 3DBHI 1PDXA 4M0WB 2M1MA 4WQOB 1GPXA 1NEKB 3DWGC 2M0XA 2QIEB 4ZYNA 3DBRB 1NENB 2QC8A 1CQVA 1B9RA 4ZOHC 1K52A 4S0RA 1N61A 2NR2A 3BVMA 1YX5B 1YN5A 1WRIA 4MM3B 3A33B 3O13A 1B1ZA 2ZVNA 4LCDE 1V81A 3QIJA 3ONSA 2BTEA 1TZ1A 3RPFC 4UDUC 2J53A 5AUKA 3FKYA 5E6PA 3AEDB 1HXYD 1J7AA 1EU3A 1YNTE 2QEJC 1PQSA 2FBWB 2LMCA 1P7EA 2DNFA 1E10A 1C4AA 2BYVE 1NDDA 2KK8A 1TT5B 2PE6B 2JUOA 2BB6A 5IP4D 2JYEA 1I35A 2W9NA 4GLSC 1ZP0B 2K9XA 3QX1A 2KX0A 3IBEA 2VRRB 2DYMA 5JHBA 4LNOA 4FXCA 2L0TA 4OHJA 2KVZA 4PYZA 4D2KA 3SR6A 3HVDA 3VTUA 4K81A 3TIXA 4LTUA 3IHPC 3SFDB 2KOXA 1KM7A 2FIFA 5J17A 2LEKA 1FIQA 1WGHA 1WX9A 3P4SB 3GS2A 3M3JA 1RFAA 2BWFA 2HE7A 1LM8B 3L16A 4AP4C 2O2VA 1PFDA 1TS3A 2WU5B 3VR8B 1R4NB 3CWIA 1AN8A 4HVBA 5J2RA 4OZAA 1E0ZA 2C9WB 4YSXB 4EE2A 2V3SA 4RNAA 2IO0B 2KWUB 1JMLA 3AH7A 4REZA 2HTHA 3QCAA 4K7WA 5CX3A 3VUXA 2WDRB 4NJ6A 1N5WA 1KH0A 2XNAC 1C79A 3DPDA 2R2QA 1OTRB 2PEAA 1SGHA 3ZRFA 3X0WA 4GGQA 1WR1A 4KIKB 3HK0A 4MGYE 1M94A 2FAZA 1TYGB 2X8XX 1I4GA 4IWQA 2O2VB 2K8CA 1SF0A 3W9CB 4GXBA 2DHZA 3PVLA 2JWUA 3PTFC 5LNK1 4FLHA 1XEEA 5IOIA 1WJ6A 2B3AA 1EUVB 1MPEA 1TY2A 2Q5WD 3I57A 2RPVA 5BYRA 4BBNC 4KKJA 2MQJA 1R4MB 1R4NI 3R2TA 4EUTA 4HKZE 2MJEA 3W1YA 4FBJB 1P0RA 4JWUC 3S2AA 3AE8B 2L32A 2FUHB 1BXTA 2C7HA 4RFBA 2UU7A 4JGHB 1I4QA 3NY5A 4YXDB 1HEZE 2D3GA 3L08A 3RCZA 1ACCA 1UGJA 3SEBA 1KOTA 1WYGA 2WXOA 2M4NA 1NBFC 2CS4A 3RN9C 1RLFA 4K3BA 1E8YA 2OOBB 5HG2A 1VCBA 3V6CB 1D5ZC 1TJEA 4F8CB 4I6LB 2G1EA 3DDCB 4KZCA 3KW5B 2CU3A 2BBCA 1WJ4A 2V3NA 3PLVA 4RGOS 2KO3A 1YOVB 2DYOA 1E7UA 2FCNA 5IKCM 3RUIB 4B0MA 3A4RA 4P16A 3KWLA 4B9KA 2BS3B 4CO7A 1FPYA 4MGZE 3AE5B 1QZEA 1BT0A 1C76A 3CSFA 3HIZA 1SXTA 3LYYA 1JQ4A 3BVZA 3N3KB 2CJOA 1HTOA 3PRZA 1FD6A 4RCOA 2J4XA 1Y8RC 1T3QA 2KKCA 5KHQA 2LGIA 2WX0A 1ZGUB 1P98A 1SB3C 4LNNA 4IUMB 4EZLA 1F77A 2L1AA 4A6QA 2KVRA 2NBUA 5CTRC 2V1YA 2BB5A 2AL6A 2N9KA 4DDGD 4BVUC 3VRBB 4FULA 3NZ3A 5C1ZA 3A9JA 2NPTA 1V8CA 3M63B 3N1YC 4I6NB 1WI0A 3E56A 2PTLA 3VR9B 4KX6B 2K39A 4WAFA 3U30A 2K8BA 2NS5A 4DBGA 2LHDA 1Q1OA 1YN4A 2IO3B 3SD5A 5FKAC 1KTKA 4EKUA 5EE9A 4O1NA 3AU4A 2RD0A 2L52A 2M17A 3ZTDA 1CK1A 3R7QA 1OQYA 3AEAB 1WE7A 1XCQL 1V5OA 1YMHE 2LWPA 1IBXA 2JZZA 2RSUA 1K50A 1ET6A 2FCQA 3NVWA 3U8ZA 3AV8A 1FNUA 1L6VA 1YX6B 1WX8A 3WCQA 3MTNB 1K8RB 4W9KA 4LDTB 1V86A 2IYDB 3Q6BA 3EGRA 2C60A 4ASWC 1XO3A 4OVVA 5DPSA 4YWGG 3OG5A 1L5PA 3RZFA 4MH0E 1PGBA 4RGNA 2FE8A 4N58A 3Q8FA 5KHOA 3ZXRA 2MBQA 4ZRJA 3OJ4B 4JIOU 4RM8A 4WH4A 1MVKA 3NJTA 1VLBA 2MSED 2JU6X 4BBNF 3PHWB 4XGAB 1WE6A 2WXRA 3AECB 1IGDA 4Q2JA 3BIID 2MWSB 3BK2A 4NAWA 2LHEA 1SSNA 3SDLC 3L17A 2WXMA 2FNJB 2I1JA 2JWZA 3N1XC 2KFJA 1SEBD 4J6IA 1JRUA 4XDCA 2CHWA 3EUB2 5FK9C 1V1OA 1V97A 2KYWA 4W9CA 2KMCA 3ZNHB 3PHXB 2WXKA 1M4VA 4DHZE 2MRPA 4KGRA 3ZVVA 2HDEA 4CHKA 1UD7A 4TMAB 1MG4A 3FILA 4JX1C 1SJHD 2KWCA 3ZO5B 4F1SA 4US9A 3PLUA 2O6VD 2G45B 2GRIA 3DBHB 3OJ3A 3AE6B 3Q2AC 3QJZA 3WAPA 2Y5BB 1E8ZA 3VH3B 5C3JB 1TKYA 2I38A 3VFKA 4G3XB 2BYEA 4W9EA 2PE9A 1YJJA 1IP9A 1FM0D 1JW9D 1WGGA 3A1QA 1NI3A 3VHTC 2D10A 3TUOA 3RNGC 1F0ZA 2WLBA 1NYQA 1EM7A 3MJ5A 4HRSA 1OQQA 2RPQA 4WURA 3EHVA 2ZCBA 1BMLC 4GDKB 1IYFA 2HD5B 2IO1B 3DCGA 1UGMA 1E7PB 1WMHA 3APCA 1J7CA 5TR5A 2RDHA 2DZJA 2M0AA 4KIKA 3T9LA 1CZPA 4IM2A 1VD2A 2N0SB 1Y56A 4A9AA 2LI5A 1D6EC 4XX5A 3A1QB 1I4HA 3MC9A 3PGEA 1V9JA 3P4QB 2KDMA 1ZXHA 2DZIA 4YTNB 2L7RA 1EWYC 1HA5A 4KSKC 3DVGY 4W9HA 3ZJVA 4AOFA 4EFOA 2R2OA 2OJWA 1EWCA 1F52A 4E74A 2JSVX 3U2SC 2BKRB 3UGBB 1LGRA 1N62A 4LJPB 1FNVA 5T8IA 5TSSA 1X1MA 3ZTCA 2K5PA 3MFGA 3PO0A 4FJVB 1TKGA 1SIJA 2W54A 4W9GA 1HQRD 1XLNA 5IA7A 1EF1A 3T3NA 5MPOA 1QOBA 3AE2B 3WALA 4BOSC 5E6JA 2KTFA 2INDC 1OEYJ 2K3UA 1FXAA 2EMSA 2JT4B 3VQIA 1FRDA 3ZNGC 4WWPA 1ZKHA 3M62B 2NBWB 1L4ZB 1ZDXA 1GOZA 4NZLB 1C77A 2LVOA 3AEFB 4N9F4 1OGWA 4B6WA 3JVZX 1VZ8A 4RM9A 5DPWA 2MLBA 3ZDMC 2WXJA 1YJIA 4ITKA 1N63A 4DXAB 4HWIB 1F2RC 2INCC 2RDBC 1RRBA 4HLEA 1TY0A 4MM3A 4WJQA 1SE3A 3NS1A 1UELA 1YN3A 4NJ7A 2RDGA 2LJIA 1HTQA 1CMXB 2LRWA 1S1QB 1UWXA 2N7EA 2CHXA 4KDLB 1BUIC 5JXVA 2PIAA 2W82A 2FUG1 2KX3A 3L0WB 3N32A 4BZAA 3IAM1 1QKZA 1T0YA 5D94A 2WXPA 5E6OA 1A70A 3B08A 2WP9B 3VVWB 3VAWA 2CR5A 4PS7A 5L83A 1WZ3A 2MA9B 3B9JA 2PMVA 1ZW7A 3KVFB 2N1VA 5H92C 3LB8C 1VZ7A 2JZPA 3UF8A 2ZW1A 1N60A 4MGIE 3TEYA 5CHFA 4BOZB 4HDOA 1E8WA 4K7UA 4NNJB 4ZRQA 3QA8A 4L2YA 1V1PB 1V6EA 5G5GA 1L0VB 2GBMA 3JW0X 1WGRA 4A90A 3J9CA 3VUYA 5GXGB 1G6JA 2LUEA 3N1ZC 4XWWA 1LFDA 1WGYA 3VTWA 1ZOYB 2ZJDA 1AWDA 2N9LA 4M00A 1GB1A 4IG7B 4DDID 2YEPF 2ZVOA 4M8MA 1MI0A 2AEHA 1XQQA 4LNIA 3AU5A 3W1SC 2BYFA 2G4DB 3DVGX 1WY8A 4OVZA 1WJUA 3HRDD 4DQOC 4IC7B 3N9YC 3IT4B 5DCNA 2AQ1B 1XLQA 2KANA 1N5XA 2EKEC 3ZNID 4PK1A 2CU1A 2MW5A 3RYTA 1WWTA 3ZW3A 4M02A 2Y3AA 3TEWA 3IFWB 2LASA 3EC8A 4N6EB 1ROEA 3DHHC 3SHQA 4BKSD 1WFYA 3NVZA 3HVZA 1RFKA 3T8MA 1FCLA 1VRAB 2MBOA 2DWQA 4YTMB 4MDKE 5AUIA 2AQ3B 2Z59B 1FO4A 1KLVA 3ZNZB 4MGKE 2R61A 2N9EB 5D3IB 5IAAC 4HPMB 1YQ3B 5IO9A 5G55A 3L4PA 1L6UA 2O6VB 1QILA 1MFWA 3Q3OC 2ZZPB 1SE9A 1HE8A 4YL8A 5C2TB 2FIDA 1R7SA 2PVGC 4MJSB 2FCMA 4C7YA 1FFVA 2J52A 1RWSA 4FJYA 1DGJA 4OZBA 3ZLZA 1LQBA 4RMAA 1FCCC 2AQ2B 1RYJA 1I7HA 1WIAA 4DWFA 1JWAD 1P3QU 3RZWC 1GJZA 4XYCA 1L7YA 4IWOA 2WDVB 2J0JA 3W5UB 4WWOA 3Q3JA 3KH0A 5D6JB 4HCNB 3Q8AA 2LJ5A 4KV2A 3VXWA 1XD3B 4DHZB 3H6NA 5HFYA 2QJLA 1XF5L 4K7SA 4GDLB 3I63C 3T3OA 1NVID 1SIFA 2IZVB 4OZCA 2JVCA 1ISNA 2UWQA 1D4BA 5EE1A 2L3ZA 4TV3A 2VZKD 2EKIA 4HJGE 5LXHA 2W3SA 2K8HA 1D5XC 3PREA 2GBKA 1I42A 2KJRA 1V80A 2BYTA 2M56B 2KWVB 4WJPA 4G50A 2GI9A 1JALA 3TEXA 2PVOD 1UUPA 4IW0A 1UNSA 2NBVB 3WAMA 4C80A 1QOFA 2OHFA 2RR9A 4BKSA 2OEDA 3ZIMA 3AEGB 4DHJD 1I4PA 1A5RA 3MHZA 3TEZA 4RF1A 4AWJA 5GMVA 2LD9A 3I5JC 3LXFA 1GNUA 3IXSA 3OWEB 3GZNB 2AWTA 2HTME 2W3RA 4MSMB 1WMHB 2KQ7A 1J19A 2MCNB 1J7BA 3E9SA 2KFKB 4ZRPA 4YT0B 1WH3A 2WDQB 3H1UA 2K1FA 4HEA1 3C8YA 3W1SA 3KUZA 3R7RA 1MG8A 3P4RB 2XK5B 3RNCC 3EECA 4GB9A 4P6VF 2JX5A 3AN1A 2B76B 3UIPB 2DBYA 1F2RI 1VDVA 5BYQA 1PGXA 2WDTB 1I4XA 1GC6A 4EEWA 4XZ4A 4LNKA 3CF6E 4WAAA 2N9XA 4ANUA 2JXXA 4RH6A 4BKTA 4MSQB 4NY0A 2JXTA 3KWVA 3U7ZA 2J0KA 2KACA 4M01A 4NJCA 2PLPA 2D07B 1WM2A 1DOXA 4KGSA 1QF6A 2RGFA 4AS1A 2DENB 3SU8X 3TMPB 3U4EG 1WXVA 4MT5A 4LK0M 1C4CA 2XK5A 2LGXA 2PKOA 4DXGA 3ETRA 2C7NB 2BW2A 3KUDB 4II2B 1RM6C 4FHJA 3ENEA 4DK5A 4NAWB 2L05A 1VJKA 4C56C 4L23A 5LXIB 3AB5A 3KYCD 1E6EB 4ANWA 5L95C 3PS6A 2L00B 1IUEA 1KRHA 2ZPNA 2K6DB 1SJED 2KD0A 2LGDA 5JH5C 4HJKA 4KDIC 4TUUA 1AARA 1JWUD 2ZNVC 2Y5CA 4PS3A 1ZPSA 2E3TA 1PGAA 4GU2A 2GOWA 4HKQA 1T0SC 3X23A 3DWMA 1LO5D 1TGZB 1FRRA 3RD2A 5JZEB 2N4FA 3MP9A 1T5XD 3NRZA 3EA6A 1Z5SB 3Q3FA 1FXTB 2IPKD 4KKIA 1SE2A 3FILB 3CIRB 1ZE3D 1IBXB 5BYSA 3VUWA 2N9PC 4L1BA 4WWMA 1EO6A 2QILA 2L76A 3DOWA 3L10B 2J42A 4GMVA 2BVCA 4USAA 3PZ7A 4KZ0A 4A8XC 3EFCA 1HZ5A 3R2IA 2WXLA 1DOIA 2IGHA 2TSSA 3V05A 2X38A 1KF6B 3I3TB 1GUAB 1MJDA 3C0RB 2CJNA 2GBRA 2SEBD 2ONQA 4IM0A 3A9JB 2CHZA 3V3XA 4RF0A 1QQRA 1OEYA 2WHIA 3ZUNA 2BS4B 1C4PA 3PPAA 3ML8A 4LLGM 5I4DA 3CSTA 2BKFA 1FNWA 3ZYYX 4C4VA 4FJZA 2K25A 3ZXVA 1KLGD 2D11A 4B95A 2WXQA 3HUIA 5FR6A 3RI7C 3NUHB 3B2FA 3H7PA 4ARCA 2I1KA 4AJYB 3GP7A 1V1PA 3URYA 4NQLB 2KLCA 2V3PA 2O6VA 1WZ0A 3UI3A 5EE3A 3W5VB 1GC7A 3NZUA 2KWDA 2BGFA 2OJRA 5BMHA 4GN1A 1KLUD 4EOYA 4CQNA 1ET9A 3B2GA 1STEA 3RT3B 3PZDA 4E3CA 4P1BC 4C00A 3A9KB 4EZKA 2RMMA 4ZRIA 2IY0B 4R3DA 3GE3C 3ZRCA 1WR6E 2LGYA 3QC8B 2A4ZA 4MH8A 1I4RA 1YQ4B 2BF8B 3AE4B 1WJNA 2LFIA 2JYTA 4RGMA 2L83A 2KMMA 4ICUA 2MP2B 3Q14C 3ZJUA 4G0NB 3N30A 1D3ZA 4IDIA 4HK2A 1KFYB 5DPRA 3JSVB 3ZGZA 1NYRA 1E7VA 3Q8BA 5FR3A 2KJ6A 4FHKA 3QARA 2XBBC 4HPLB 4J3OD 2ASQA 3HM6X 4K3CA 2WQYB 4KGTA 1ZDVA 4XE0A 4ZHOA 4XC2A 3BZDB 4HDQA 4BKGA 2N7JA 2MH7A 4ANVA 3VH4B 2NTTA 1QT9A 1IPGA 3ZQ4A 2Z0EB 3KYDD 1J8CA 1JRPA 4YSYB 1WXMA 3UINB 1F9JA 3VDZA 1IGCA 4ZHPA 3I9V1 3AXCA 4S17A 4G11A 2WU2B 2Y5PA 3NVVA 2D5GA 5G5HA 4FA6A 2V0GA 2KTRA 5BO4B 1GAQB 2MBHA 2WXFA 3SFEB 4E71A 5H8YE 4MEMA 3AI5A 4EZJA 4GDLA 4GIVA 4PYUA 3CMMB 1J0GA 2LXCA 4A55A 3OLMD 5EE0A 2MBBB 3O65B 2WXNA 4US8A 1XT9B 1ZUD2 4I6PA 2ACZB 4WIPA 3P4PB 2KJHB 3H8HA 3FAHA 3KUCB 4HXDA 4PS8A 2JQRB 3UIOB 3L54A 2NCNA 3AEEB 1WXQA 3W2DA 4HPPA 2REXA 2VH2A 2WGSA 2BS2B 3P2BA 3P42A 5DPTA 3AMZA 1K51A 2KDIA 2I2YA 2JRHA 1C9FA 2ZPYA 2KMAA 2LVPA 3A4SC 3DQVA 1TS2A 1S3SG 4URKA 4WQMA 3RNBC 4JL9A 2KZRA 2LZ6A 2L0FA 1YIWA 1P7FA 3BYYB 5HKHA 1KJTA 4ZRKA 2ZEQA 3KLSX 4P7IA 3UQAA 1EF5A 4JE3B 1JWSD 2NVUI 5E6NA 3RNFC 2SAKA 4OVUA 4ARIA 3AE7B 2KN5A 2LUMA 3QK0A 1UF0A 1XCTL 2D3BA 3DBSA 4KSLC 3RNAC 1PUTA 4IKGA 5LLIA 4MELA 2KXJA 3TCAA 1UBIA 2DAJA 1L2NA 2V4LA 2GMIC 2KNBA 2UYZB 3DHIC 4CYEA 5C23A 1UWMA 2MX2A 3QAQA 4FN2A 3NOBA 4TQ0A 1YQBA 4ZDVA 2QSDA 4W9IA 1P9DU 2DLBA 4N59A 3EFUA 5HI1A 3AULA 3ALBA 5D3DA 4WJOA 1OQRA 1WXAA 3R66C 2A5UA 3GZNI 2J7QB 5D7GA 1WX7A 2JRIB 5AZHA 2EELA 2IY1B 4W9DA 2G3QB 1NI2A 3JSVA 4YTPB 3QQ8B 2KN4A 4JQWC 3K9OB 1K53A 3DBLI 2BT6A 2DAFA 2VZKB 2L8JA 1XXGA 4W9FA 5AEKB 1L0YB 2IGGA 2Z8LA 3DHGC 2M8SA 3ZDTA 4FADA 2D3CA 1ESFA 1MHHE 3TBLD 2HJ8A 2C7MB 1E9MA 5G2NA 3AE3B 3APFA 2KDFB 4GSWA 2GBNA 3WA0A 4ANXA 1P1AA 3V61A 3B1LX 2N7DA 2PW9A 1WF9A 1RAXA 4LNFA 2ZCCA 3NZSA 2PPHA 3NHEB 2DX5B 1WSPA 2D3AA 1FXIA 4B0EA 3FC4A 4IM3A 3WIMA 1WGKA 1JWBD 4AUQC 2AX5A 1Q5WB 1TS5A 1XLPA 2Z0DB 3JYUA 2WWZA 4HCPB 2QHOA 4NPNA 4QAYA 2MEKA 2H89B 1C3TA 2NPTB 2WXGA 3PV1A 1R4MI 2GLSA 3IT6B 1QOAA 1VZ6A 1C1YB 2LXAA 1WM3A 4X57B 1TBEA 2QMTA 2IBIB 2AYOB 3IAS1 2W55A 2LGSA 3OAWA 1WYWB 3TL5A 3Q8CA 3RFZB 2DYBA 4W9LA 2JY6A 2KQ4X 1FFUA 1GB4A 4PT5A 2V9HA 2J0MA 2KC1A 3H7SA 2JF5A 2KC2A 2D2QA 2HJ1A 2IDYA 2VH1A 3BYTB 2N1WA 4WJNA 3M95A 4KVGB 2IGDA 1QOGA 4NAMA 4IOIE 4JWSC 2KFKA 5CHWA 2MBEA 3AE1B 1Q10A 3VRAB 2EMTA 4II3B 1V2YA 3P63A 3BK1A 2LVQA 3NS8A 2WXIA 3WANA 3IG3A 2IO2B 4F7ZA 4AQ7A 1HZ6A 3Q3MC 1JROA 3RULA 4A3PA 1Z2MA 3ZJTA 1TZOA 3BINA 4JPSA 3TJPA 2K6QA 3Q3NC 1DOYA 2ICIA 3DBRI 4H2AA 1TIFA 2QCZA 2INNE 4ZYSA 4NQKE 2IJ0A 4YSZB 1FMAD 5BMGA 2ON8A 1PYWD 3PZ8A 2LRUA 3DVNU 4WWNA 1YD8U 3ABVB 2KHWB 5D2MB 2MJ3A 2XN9C 1E90A 2K22A 3V62A 4LDTD 1YJ1A 4MACA 3NG0A 2AL3A 4BFRA 3V6EB 2YVCA 2JZ3B 3DBLB 3MC8A 3GOEA 3AEBB 3ECIA 2DZMA 3GB1A 3BVGA 4GDKA 2MHJA 3GE8C 3DVNV 1EU4A 2JPHA 1GG3A 1H8CA 1N6ZA 3HHMA 4JLCA 3R8BA 4AJWA 3BY4B 2H88B 1E5WA 4OW0A 3WAOA
chains in the Genus database with same CATH topology
5KHQA 2KJ6A 2LASA 3EC8A 2WX0A 3QARA 1ZGUB 1P98A 2XBBC 4FHKA 3SHQA 3B0AA 4HPLB 4IUMB 4BKSD 2ASQA 3A9KA 3HM6X 4EZLA 1WFYA 3T8MA 1U4AA 2KVRA 2NBUA 5CTRC 2MBOA 4XC2A 1WXSA 2GBJA 2V1YA 4HDQA 2AL6A 4MDKE 4BKGA 4DHJB 4ANVA 3LJ3A 3VH4B 4A3OA 2Z59B 4DDGD 1KLVA 1V49A 4BVUC 3ZKJC 3ZNZB 1IPGA 4MGKE 4FULA 2Z0EB 3KYDD 1UZXB 2N9EB 3PRPB 5C1ZA 1J8CA 5IAAC 3A9JA 4HPMB 2NPTA 3M63B 5G55A 4I6NB 2O6VB 2KTRB 1WI0A 3APDA 4MJSA 1WXMA 2ZZPB 5CHVC 3UINB 1F9JA 2K39A 3VDZA 3U30A 2K8BA 2NS5A 4DBGA 1SE9A 1HE8A 1Q1OA 2DZKA 2IO3B 2WYQA 3D32A 3AXCA 4YL8A 5AZGA 4G11A 3SD5A 2FIDA 2WX1A 4FA6A 4EKUA 2KTRA 3U7DA 4MJSB 2FCMA 2MP2A 5EDSA 5BO4B 4K1RB 4FJYA 3AU4A 3ZLZA 2RD0A 2CKHB 1UBQA 1LQBA 2MBHA 4RMAA 1WGDA 2M17A 3ZTDA 4IWPA 2G4SA 3R7QA 1OQYA 4E71A 2BWES 1WE7A 3AI5A 4MEMA 4EZJA 1V5OA 2LWPA 4GDLA 4GIVA 5JHAA 1WIAA 2JZZA 2RSUA 4PYUA 4DWFA 2FCQA 4M8NA 3CMMB 1P3QU 2FCSA 3RZWC 1J0GA 2LXCA 1GJZA 1WRDB 3U8ZA 1YX6B 3OLMD 2MBBB 1H4RA 1WX8A 3O65B 1E8XA 1L7YA 1XT9B 4IWOA 3MTNB 4I6PA 3R3MA 1K8RB 2J0JA 4W9KA 2BPSA 4LDTB 5AZFA 1V86A 2IYDB 4TKNA 2C60A 2KJHB 3KH0A 3Q3JA 3KUCB 4HXDA 4HCNB 4WWOA 4PS8A 5D6JB 3HM3A 4OVVA 4ASWC 3UIOB 3L54A 2NCNA 5DPSA 2LJ5A 4KV2A 3VXWA 2C5LC 3PRMB 1XD3B 4DHZB 3H6NA 3RZFA 4MH0E 3LDZE 4K7SA 4GDLB 3ML9A 5KHOA 1SIFA 2IZVB 3H7PB 2REXA 5J18A 1TTNA 2JVCA 2MBQA 4LJOB 4ZRJA 1ISNA 1V5TA 2XEWA 2UWQA 3P2BA 3OJ4B 3IVFA 3K9PB 5DPTA 2L3ZA 2ZNVB 4JIOU 4RM8A 4TV3A 3PSEB 2KDIA 2JRHA 1LXDA 2ZPYA 2KMAA 3PT2B 5LXHA 2MSED 2LVPA 2K8HA 3A4SC 4BBNF 3DQVA 3PHWB 1S3SG 3QHTA 1WE6A 2GBKA 3PREA 4URKA 2KJRA 1I42A 1V80A 3L13A 2KDEB 2KWVB 4JL9A 2KZRA 2MWSB 2LZ6A 2L0FA 4NAWA 4WJPA 1Q0WB 1YIWA 4G50A 3SDLC 3L17A 1KJTA 2FNJB 5HKHA 4ZRKA 2ZEQA 2I1JA 4TQ1A 2JWZA 2KFJA 4IW0A 4P7IA 3UQAA 1EF5A 4J6IA 4W9JA 1JRUA 1UH6A 2NBVB 2NVUI 2CHWA 3WAMA 2PJHA 4ICVA 5E6NA 4W9CA 2KMCA 4OVUA 2RR9A 3VTVA 3ZNHB 4BKSA 3V60A 3PHXB 2KN5A 4A20A 2KDBA 3ZIMA 4DHZE 2MRPA 3ZVVA 4DHJD 4CHKA 1UD7A 1A5RA 2KQSA 4AWJA 5GMVA 3QK0A 2LD9A 1GNUA 2KWCA 3H9DA 3ZO5B 4F1SA 2AWTA 3MJWA 3UQBA 2YLMA 3PLUA 4MSMB 3DBSA 4KSLC 1WMHB 2O6VD 2G45B 2KQ7A 3OJ3A 3QJZA 3WAPA 1J19A 2MCNB 5LLIA 2KLGA 1E8ZA 2Y5BB 4MELA 2KXJA 3VH3B 3TCAA 1UBIA 2DAJA 1L2NA 2V4LA 2KFKB 2GMIC 3VFKA 3QWZB 4G3XB 2BYEA 4W9EA 4GOCA 2PE9A 2KNBA 3MHSD 1WH3A 1IP9A 2UYZB 2K1FA 1WGGA 3A1QA 3H1UA 5C23A 3DBHI 4CYEA 4M0WB 2MX2A 3QAQA 3W1SA 2M1MA 3KUZA 4FN2A 4WQOB 3R7RA 3VHTC 1MG8A 2D10A 3NOBA 2XK5B 4TQ0A 1YQBA 3EECA 2M0XA 4GB9A 4ZDVA 4W9IA 4ZYNA 1P9DU 2RPQA 3EFUA 3UIPB 3AULA 3ALBA 3EHVA 2ZCBA 4GDKB 1IYFA 2HD5B 4WJOA 2IO1B 3DCGA 2NR2A 1UGMA 1WXAA 2WDTB 1YX5B 3R66C 1GC6A 1WMHA 4EEWA 3A33B 2A5UA 3APCA 4XZ4A 4LCDE 2ZVNA 5TR5A 3CF6E 2J7QB 3GZNI 1V81A 1WX7A 2DZJA 2JRIB 3QIJA 4WAAA 5D7GA 5AZHA 3ONSA 2IY1B 2N9XA 4KIKA 4W9DA 3T9LA 4ANUA 2JXXA 2G3QB 1TZ1A 1VD2A 4IM2A 4BKTA 1NI2A 3JSVA 4MSQB 4NY0A 5E6PA 3QQ8B 2J0KA 4JQWC 3K9OB 2LI5A 1PQSA 3DBLI 2DAFA 2D07B 4XX5A 1WM2A 3A1QB 2L8JA 2BYVE 2RGFA 1NDDA 3PGEA 2DENB 2KK8A 3SU8X 1V9JA 3TMPB 2DZIA 1WXVA 4W9FA 5AEKB 2PE6B 2JUOA 2M8SA 3ZDTA 2L7RA 2XK5A 1I35A 4FADA 2W9NA 2LGXA 4KSKC 3QX1A 2KX0A 3IBEA 2VRRB 3DVGY 4W9HA 2DYMA 2C7NB 3TBLD 2HJ8A 5JHBA 3KUDB 2C7MB 4II2B 4FHJA 3ENEA 4AOFA 4EFOA 2L0TA 4DK5A 5G2NA 4NAWB 2R2OA 3APFA 2KDFB 4E74A 4PYZA 4GSWA 2L05A 2GBNA 2BKRB 3UGBB 3WA0A 5LXIB 4LJPB 3VTUA 4K81A 4ANXA 3TIXA 1P1AA 3IHPC 3KYCD 2KOXA 1KM7A 4ANWA 5L95C 2FIFA 5J17A 1X1MA 3PS6A 2L00B 3V61A 1WX9A 1WGHA 3B1LX 2N7DA 3M3JA 3ZTCA 2ZPNA 2K6DB 1WF9A 1RAXA 1RFAA 2BWFA 2HE7A 2KD0A 1LM8B 2LGDA 2ZCCA 4HJKA 5JH5C 3L16A 4FJVB 4AP4C 2O2VA 3NZSA 4KDIC 4W9GA 2PPHA 4TUUA 3NHEB 1AARA 2DX5B 5IA7A 1EF1A 2ZNVC 4PS3A 4IM3A 3WIMA 4HVBA 4AUQC 3WALA 1Q5WB 4GU2A 4BOSC 5J2RA 2GOWA 2C9WB 2KTFA 1OEYJ 3X23A 2Z0DB 3JYUA 2WWZA 4HCPB 2QHOA 1TGZB 2V3SA 4NPNA 2EMSA 2JT4B 3VQIA 2IO0B 1C3TA 2KWUB 2NPTB 3RD2A 5JZEB 3PV1A 3ZNGC 2HTHA 2N4FA 1ZKHA 1R4MI 2NBWB 3M62B 3QCAA 4WWPA 4K7WA 5CX3A 2LVOA 4N9F4 1Z5SB 1OGWA 1C1YB 4B6WA 3JVZX 2LXAA 3VUXA 1WM3A 3Q3FA 1FXTB 1TBEA 4X57B 4RM9A 2IBIB 2AYOB 5DPWA 2MLBA 4NJ6A 3ZDMC 3DPDA 2R2QA 1OTRB 2PEAA 3VUWA 2N9PC 1SGHA 3OAWA 1WYWB 3TL5A 3ZRFA 1EO6A 4DXAB 4HWIB 2L76A 2DYBA 3DOWA 3L10B 2JY6A 4GGQA 4GMVA 4W9LA 1WR1A 4KIKB 3X0WA 3HK0A 4MGYE 1M94A 2FAZA 2J0MA 4KZ0A 1RRBA 2KC1A 4HLEA 4IWQA 2O2VB 2K8CA 4MM3A 3H7SA 2JF5A 2KC2A 4GXBA 2D2QA 2DHZA 4WJQA 3PVLA 3PTFC 1UELA 2N1WA 3M95A 4FLHA 4KVGB 4NJ7A 4WJNA 3I3TB 1GUAB 3C0RB 1CMXB 2LRWA 2GBRA 1S1QB 1WJ6A 2B3AA 1EUVB 4IM0A 2KFKA 5CHWA 2MBEA 2N7EA 2CHXA 3A9JB 4KDLB 2CHZA 4BBNC 2KX3A 3L0WB 2MQJA 3N32A 2EMTA 4II3B 1V2YA 1R4NI 4EUTA 1OEYA 3ZUNA 1T0YA 3W1YA 4FBJB 3PPAA 5D94A 1P0RA 2LVQA 3ML8A 3NS8A 3WANA 5E6OA 3S2AA 3IG3A 3CSTA 2IO2B 2BKFA 2FUHB 4F7ZA 3B08A 4FJZA 3IFWB 2C7HA 2K25A 3VVWB 3VAWA 2CR5A 4PS7A 2D11A 4B95A 5L83A 3RULA 1WZ3A 4A3PA 5FR6A 2MA9B 1Z2MA 4JGHB 3BINA 3NY5A 3TJPA 2K6QA 1ZW7A 3H7PA 3DBRI 2N1VA 3KVFB 2D3GA 2I1KA 3L08A 3RCZA 4AJYB 4NQLB 2KLCA 3UF8A 1KOTA 4MGIE 2O6VA 2M4NA 1NBFC 1WZ0A 2CS4A 4NQKE 5CHFA 1RLFA 4BOZB 4HDOA 1E8YA 2OOBB 2LRUA 1E8WA 3DVNU 4WWNA 1VCBA 4K7UA 3V6CB 4NNJB 1GC7A 3NZUA 1YD8U 3QA8A 2OJRA 2BGFA 1V6EA 2KHWB 4F8CB 4I6LB 3DDCB 4KZCA 2GBMA 3KW5B 5D2MB 4GN1A 3JW0X 1E90A 1WGRA 4EOYA 1WJ4A 3VUYA 3V62A 3PLVA 1G6JA 1YJ1A 2KO3A 2LUEA 4LDTD 1LFDA 2DYOA 1E7UA 3RT3B 2FCNA 1WGYA 3PZDA 4E3CA 3VTWA 2ZJDA 3RUIB 2AL3A 4BFRA 3V6EB 4IG7B 4DDID 3A4RA 2ZVOA 2YVCA 2JZ3B 4M8MA 3A9KB 4EZKA 4ZRIA 3GOEA 2IY0B 2AEHA 4B9KA 1XQQA 3ECIA 3AU5A 3ZRCA 1WR6E 4CO7A 2DZMA 4MGZE 3W1SC 2BYFA 2LGYA 3QC8B 2G4DB 1QZEA 1BT0A 3DVGX 4GDKA 2A4ZA 1WY8A 3CSFA 3DVNV 1WJUA 2BF8B 3HIZA 1WJNA 4IC7B 3N3KB 2JPHA 1GG3A 5DCNA 1H8CA 2KANA 4ICUA 2MP2B 3HHMA 4JLCA 3PRZA 2EKEC 3ZNID 4G0NB 4AJWA 3N30A 1D3ZA 2CU1A 3BY4B 4HK2A 2MW5A 1E5WA 3RYTA 3WAOA 5DPRA 3JSVB 1Y8RC 3ZW3A 1E7VA 2KKCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KHQ A;  2KJ6 A;  2LAS A;  3EC8 A;  2WX0 A;  3QAR A;  1ZGU B;  1P98 A;  2XBB C;  4FHK A;  3SHQ A;  3B0A A;  4HPL B;  4IUM B;  4BKS D;  2ASQ A;  3A9K A;  3HM6 X;  4EZL A;  1WFY A;  3T8M A;  1U4A A;  2KVR A;  2NBU A;  5CTR C;  2MBO A;  4XC2 A;  1WXS A;  2GBJ A;  2V1Y A;  4HDQ A;  2AL6 A;  4MDK E;  4BKG A;  4DHJ B;  4ANV A;  3LJ3 A;  3VH4 B;  4A3O A;  2Z59 B;  4DDG D;  1KLV A;  1V49 A;  4BVU C;  3ZKJ C;  3ZNZ B;  1IPG A;  4MGK E;  4FUL A;  2Z0E B;  3KYD D;  1UZX B;  2N9E B;  3PRP B;  5C1Z A;  1J8C A;  5IAA C;  3A9J A;  4HPM B;  2NPT A;  3M63 B;  5G55 A;  4I6N B;  2O6V B;  2KTR B;  1WI0 A;  3APD A;  4MJS A;  1WXM A;  2ZZP B;  5CHV C;  3UIN B;  1F9J A;  2K39 A;  3VDZ A;  3U30 A;  2K8B A;  2NS5 A;  4DBG A;  1SE9 A;  1HE8 A;  1Q1O A;  2DZK A;  2IO3 B;  2WYQ A;  3D32 A;  3AXC A;  4YL8 A;  5AZG A;  4G11 A;  3SD5 A;  2FID A;  2WX1 A;  4FA6 A;  4EKU A;  2KTR A;  3U7D A;  4MJS B;  2FCM A;  2MP2 A;  5EDS A;  5BO4 B;  4K1R B;  4FJY A;  3AU4 A;  3ZLZ A;  2RD0 A;  2CKH B;  1UBQ A;  1LQB A;  2MBH A;  4RMA A;  1WGD A;  2M17 A;  3ZTD A;  4IWP A;  2G4S A;  3R7Q A;  1OQY A;  4E71 A;  2BWE S;  1WE7 A;  3AI5 A;  4MEM A;  4EZJ A;  1V5O A;  2LWP A;  4GDL A;  4GIV A;  5JHA A;  1WIA A;  2JZZ A;  2RSU A;  4PYU A;  4DWF A;  2FCQ A;  4M8N A;  3CMM B;  1P3Q U;  2FCS A;  3RZW C;  1J0G A;  2LXC A;  1GJZ A;  1WRD B;  3U8Z A;  1YX6 B;  3OLM D;  2MBB B;  1H4R A;  1WX8 A;  3O65 B;  1E8X A;  1L7Y A;  1XT9 B;  4IWO A;  3MTN B;  4I6P A;  3R3M A;  1K8R B;  2J0J A;  4W9K A;  2BPS A;  4LDT B;  5AZF A;  1V86 A;  2IYD B;  4TKN A;  2C60 A;  2KJH B;  3KH0 A;  3Q3J A;  3KUC B;  4HXD A;  4HCN B;  4WWO A;  4PS8 A;  5D6J B;  3HM3 A;  4OVV A;  4ASW C;  3UIO B;  3L54 A;  2NCN A;  5DPS A;  2LJ5 A;  4KV2 A;  3VXW A;  2C5L C;  3PRM B;  1XD3 B;  4DHZ B;  3H6N A;  3RZF A;  4MH0 E;  3LDZ E;  4K7S A;  4GDL B;  3ML9 A;  5KHO A;  1SIF A;  2IZV B;  3H7P B;  2REX A;  5J18 A;  1TTN A;  2JVC A;  2MBQ A;  4LJO B;  4ZRJ A;  1ISN A;  1V5T A;  2XEW A;  2UWQ A;  3P2B A;  3OJ4 B;  3IVF A;  3K9P B;  5DPT A;  2L3Z A;  2ZNV B;  4JIO U;  4RM8 A;  4TV3 A;  3PSE B;  2KDI A;  2JRH A;  1LXD A;  2ZPY A;  2KMA A;  3PT2 B;  5LXH A;  2MSE D;  2LVP A;  2K8H A;  3A4S C;  4BBN F;  3DQV A;  3PHW B;  1S3S G;  3QHT A;  1WE6 A;  2GBK A;  3PRE A;  4URK A;  2KJR A;  1I42 A;  1V80 A;  3L13 A;  2KDE B;  2KWV B;  4JL9 A;  2KZR A;  2MWS B;  2LZ6 A;  2L0F A;  4NAW A;  4WJP A;  1Q0W B;  1YIW A;  4G50 A;  3SDL C;  3L17 A;  1KJT A;  2FNJ B;  5HKH A;  4ZRK A;  2ZEQ A;  2I1J A;  4TQ1 A;  2JWZ A;  2KFJ A;  4IW0 A;  4P7I A;  3UQA A;  1EF5 A;  4J6I A;  4W9J A;  1JRU A;  1UH6 A;  2NBV B;  2NVU I;  2CHW A;  3WAM A;  2PJH A;  4ICV A;  5E6N A;  4W9C A;  2KMC A;  4OVU A;  2RR9 A;  3VTV A;  3ZNH B;  4BKS A;  3V60 A;  3PHX B;  2KN5 A;  4A20 A;  2KDB A;  3ZIM A;  4DHZ E;  2MRP A;  3ZVV A;  4DHJ D;  4CHK A;  1UD7 A;  1A5R A;  2KQS A;  4AWJ A;  5GMV A;  3QK0 A;  2LD9 A;  1GNU A;  2KWC A;  3H9D A;  3ZO5 B;  4F1S A;  2AWT A;  3MJW A;  3UQB A;  2YLM A;  3PLU A;  4MSM B;  3DBS A;  4KSL C;  1WMH B;  2O6V D;  2G45 B;  2KQ7 A;  3OJ3 A;  3QJZ A;  3WAP A;  1J19 A;  2MCN B;  5LLI A;  2KLG A;  1E8Z A;  2Y5B B;  4MEL A;  2KXJ A;  3VH3 B;  3TCA A;  1UBI A;  2DAJ A;  1L2N A;  2V4L A;  2KFK B;  2GMI C;  3VFK A;  3QWZ B;  4G3X B;  2BYE A;  4W9E A;  4GOC A;  2PE9 A;  2KNB A;  3MHS D;  1WH3 A;  1IP9 A;  2UYZ B;  2K1F A;  1WGG A;  3A1Q A;  3H1U A;  5C23 A;  3DBH I;  4CYE A;  4M0W B;  2MX2 A;  3QAQ A;  3W1S A;  2M1M A;  3KUZ A;  4FN2 A;  4WQO B;  3R7R A;  3VHT C;  1MG8 A;  2D10 A;  3NOB A;  2XK5 B;  4TQ0 A;  1YQB A;  3EEC A;  2M0X A;  4GB9 A;  4ZDV A;  4W9I A;  4ZYN A;  1P9D U;  2RPQ A;  3EFU A;  3UIP B;  3AUL A;  3ALB A;  3EHV A;  2ZCB A;  4GDK B;  1IYF A;  2HD5 B;  4WJO A;  2IO1 B;  3DCG A;  2NR2 A;  1UGM A;  1WXA A;  2WDT B;  1YX5 B;  3R66 C;  1GC6 A;  1WMH A;  4EEW A;  3A33 B;  2A5U A;  3APC A;  4XZ4 A;  4LCD E;  2ZVN A;  5TR5 A;  3CF6 E;  2J7Q B;  3GZN I;  1V81 A;  1WX7 A;  2DZJ A;  2JRI B;  3QIJ A;  4WAA A;  5D7G A;  5AZH A;  3ONS A;  2IY1 B;  2N9X A;  4KIK A;  4W9D A;  3T9L A;  4ANU A;  2JXX A;  2G3Q B;  1TZ1 A;  1VD2 A;  4IM2 A;  4BKT A;  1NI2 A;  3JSV A;  4MSQ B;  4NY0 A;  5E6P A;  3QQ8 B;  2J0K A;  4JQW C;  3K9O B;  2LI5 A;  1PQS A;  3DBL I;  2DAF A;  2D07 B;  4XX5 A;  1WM2 A;  3A1Q B;  2L8J A;  2BYV E;  2RGF A;  1NDD A;  3PGE A;  2DEN B;  2KK8 A;  3SU8 X;  1V9J A;  3TMP B;  2DZI A;  1WXV A;  4W9F A;  5AEK B;  2PE6 B;  2JUO A;  2M8S A;  3ZDT A;  2L7R A;  2XK5 A;  1I35 A;  4FAD A;  2W9N A;  2LGX A;  4KSK C;  3QX1 A;  2KX0 A;  3IBE A;  2VRR B;  3DVG Y;  4W9H A;  2DYM A;  2C7N B;  3TBL D;  2HJ8 A;  5JHB A;  3KUD B;  2C7M B;  4II2 B;  4FHJ A;  3ENE A;  4AOF A;  4EFO A;  2L0T A;  4DK5 A;  5G2N A;  4NAW B;  2R2O A;  3APF A;  2KDF B;  4E74 A;  4PYZ A;  4GSW A;  2L05 A;  2GBN A;  2BKR B;  3UGB B;  3WA0 A;  5LXI B;  4LJP B;  3VTU A;  4K81 A;  4ANX A;  3TIX A;  1P1A A;  3IHP C;  3KYC D;  2KOX A;  1KM7 A;  4ANW A;  5L95 C;  2FIF A;  5J17 A;  1X1M A;  3PS6 A;  2L00 B;  3V61 A;  1WX9 A;  1WGH A;  3B1L X;  2N7D A;  3M3J A;  3ZTC A;  2ZPN A;  2K6D B;  1WF9 A;  1RAX A;  1RFA A;  2BWF A;  2HE7 A;  2KD0 A;  1LM8 B;  2LGD A;  2ZCC A;  4HJK A;  5JH5 C;  3L16 A;  4FJV B;  4AP4 C;  2O2V A;  3NZS A;  4KDI C;  4W9G A;  2PPH A;  4TUU A;  3NHE B;  1AAR A;  2DX5 B;  5IA7 A;  1EF1 A;  2ZNV C;  4PS3 A;  4IM3 A;  3WIM A;  4HVB A;  4AUQ C;  3WAL A;  1Q5W B;  4GU2 A;  4BOS C;  5J2R A;  2GOW A;  2C9W B;  2KTF A;  1OEY J;  3X23 A;  2Z0D B;  3JYU A;  2WWZ A;  4HCP B;  2QHO A;  1TGZ B;  2V3S A;  4NPN A;  2EMS A;  2JT4 B;  3VQI A;  2IO0 B;  1C3T A;  2KWU B;  2NPT B;  3RD2 A;  5JZE B;  3PV1 A;  3ZNG C;  2HTH A;  2N4F A;  1ZKH A;  1R4M I;  2NBW B;  3M62 B;  3QCA A;  4WWP A;  4K7W A;  5CX3 A;  2LVO A;  4N9F 4;  1Z5S B;  1OGW A;  1C1Y B;  4B6W A;  3JVZ X;  2LXA A;  3VUX A;  1WM3 A;  3Q3F A;  1FXT B;  1TBE A;  4X57 B;  4RM9 A;  2IBI B;  2AYO B;  5DPW A;  2MLB A;  4NJ6 A;  3ZDM C;  3DPD A;  2R2Q A;  1OTR B;  2PEA A;  3VUW A;  2N9P C;  1SGH A;  3OAW A;  1WYW B;  3TL5 A;  3ZRF A;  1EO6 A;  4DXA B;  4HWI B;  2L76 A;  2DYB A;  3DOW A;  3L10 B;  2JY6 A;  4GGQ A;  4GMV A;  4W9L A;  1WR1 A;  4KIK B;  3X0W A;  3HK0 A;  4MGY E;  1M94 A;  2FAZ A;  2J0M A;  4KZ0 A;  1RRB A;  2KC1 A;  4HLE A;  4IWQ A;  2O2V B;  2K8C A;  4MM3 A;  3H7S A;  2JF5 A;  2KC2 A;  4GXB A;  2D2Q A;  2DHZ A;  4WJQ A;  3PVL A;  3PTF C;  1UEL A;  2N1W A;  3M95 A;  4FLH A;  4KVG B;  4NJ7 A;  4WJN A;  3I3T B;  1GUA B;  3C0R B;  1CMX B;  2LRW A;  2GBR A;  1S1Q B;  1WJ6 A;  2B3A A;  1EUV B;  4IM0 A;  2KFK A;  5CHW A;  2MBE A;  2N7E A;  2CHX A;  3A9J B;  4KDL B;  2CHZ A;  4BBN C;  2KX3 A;  3L0W B;  2MQJ A;  3N32 A;  2EMT A;  4II3 B;  1V2Y A;  1R4N I;  4EUT A;  1OEY A;  3ZUN A;  1T0Y A;  3W1Y A;  4FBJ B;  3PPA A;  5D94 A;  1P0R A;  2LVQ A;  3ML8 A;  3NS8 A;  3WAN A;  5E6O A;  3S2A A;  3IG3 A;  3CST A;  2IO2 B;  2BKF A;  2FUH B;  4F7Z A;  3B08 A;  4FJZ A;  3IFW B;  2C7H A;  2K25 A;  3VVW B;  3VAW A;  2CR5 A;  4PS7 A;  2D11 A;  4B95 A;  5L83 A;  3RUL A;  1WZ3 A;  4A3P A;  5FR6 A;  2MA9 B;  1Z2M A;  4JGH B;  3BIN A;  3NY5 A;  3TJP A;  2K6Q A;  1ZW7 A;  3H7P A;  3DBR I;  2N1V A;  3KVF B;  2D3G A;  2I1K A;  3L08 A;  3RCZ A;  4AJY B;  4NQL B;  2KLC A;  3UF8 A;  1KOT A;  4MGI E;  2O6V A;  2M4N A;  1NBF C;  1WZ0 A;  2CS4 A;  4NQK E;  5CHF A;  1RLF A;  4BOZ B;  4HDO A;  1E8Y A;  2OOB B;  2LRU A;  1E8W A;  3DVN U;  4WWN A;  1VCB A;  4K7U A;  3V6C B;  4NNJ B;  1GC7 A;  3NZU A;  1YD8 U;  3QA8 A;  2OJR A;  2BGF A;  1V6E A;  2KHW B;  4F8C B;  4I6L B;  3DDC B;  4KZC A;  2GBM A;  3KW5 B;  5D2M B;  4GN1 A;  3JW0 X;  1E90 A;  1WGR A;  4EOY A;  1WJ4 A;  3VUY A;  3V62 A;  3PLV A;  1G6J A;  1YJ1 A;  2KO3 A;  2LUE A;  4LDT D;  1LFD A;  2DYO A;  1E7U A;  3RT3 B;  2FCN A;  1WGY A;  3PZD A;  4E3C A;  3VTW A;  2ZJD A;  3RUI B;  2AL3 A;  4BFR A;  3V6E B;  4IG7 B;  4DDI D;  3A4R A;  2ZVO A;  2YVC A;  2JZ3 B;  4M8M A;  3A9K B;  4EZK A;  4ZRI A;  3GOE A;  2IY0 B;  2AEH A;  4B9K A;  1XQQ A;  3ECI A;  3AU5 A;  3ZRC A;  1WR6 E;  4CO7 A;  2DZM A;  4MGZ E;  3W1S C;  2BYF A;  2LGY A;  3QC8 B;  2G4D B;  1QZE A;  1BT0 A;  3DVG X;  4GDK A;  2A4Z A;  1WY8 A;  3CSF A;  3DVN V;  1WJU A;  2BF8 B;  3HIZ A;  1WJN A;  4IC7 B;  3N3K B;  2JPH A;  1GG3 A;  5DCN A;  1H8C A;  2KAN A;  4ICU A;  2MP2 B;  3HHM A;  4JLC A;  3PRZ A;  2EKE C;  3ZNI D;  4G0N B;  4AJW A;  3N30 A;  1D3Z A;  2CU1 A;  3BY4 B;  4HK2 A;  2MW5 A;  1E5W A;  3RYT A;  3WAO A;  5DPR A;  3JSV B;  1Y8R C;  3ZW3 A;  1E7V A;  2KKC A; 
#chains in the Genus database with same CATH topology
 1SBB B;  3TSS A;  1TS4 A;  4DXF A;  3B0A A;  3A9K A;  1U4A A;  3P1M A;  3AE9 B;  2V4I B;  1WXS A;  2GBJ A;  3NVY A;  4DHJ B;  3LJ3 A;  4A3O A;  4M0W A;  1V49 A;  3ZKJ C;  1UZX B;  3PRP B;  1FEH A;  1OFF A;  2KTR B;  5IN7 A;  3APD A;  4MJS A;  5CHV C;  1XLO A;  1SE4 A;  2DZK A;  2WYQ A;  3D32 A;  3C19 A;  1MHX A;  2WXH A;  5AZG A;  2WX1 A;  3RNE C;  3U7D A;  2MP2 A;  2NMQ A;  5EDS A;  4K1R B;  1QLB B;  2CKH B;  1UBQ A;  1WGD A;  4IWP A;  2G4S A;  1T6B X;  2BWE S;  1CJE A;  3U52 E;  4ACF A;  2KT7 A;  4XWT A;  5JHA A;  3BWU D;  4M8N A;  2FCS A;  1D5M C;  1WRD B;  1T0Q C;  1H4R A;  1E8X A;  1T0R C;  3R3M A;  1C78 A;  2BPS A;  5AZF A;  4TKN A;  1DYQ A;  2M19 A;  3HM3 A;  2WNM A;  2C5L C;  3PRM B;  4HRO A;  3LDZ E;  2BQQ A;  3RMK C;  1JWM D;  3ML9 A;  3H7P B;  5J18 A;  1TTN A;  4P1C C;  1L4D B;  4LJO B;  4BAX A;  1V5T A;  2XEW A;  4C7Z A;  3IVF A;  1VR9 A;  3K9P B;  2ZNV B;  3PSE B;  3Q69 A;  1LXD A;  2K0P A;  1AW7 A;  3PT2 B;  2G9H D;  3QHT A;  1ZXI A;  3L13 A;  2E6X A;  2KDE B;  4XDD A;  5BMI A;  1Q0W B;  5HHD G;  4TQ1 A;  3N20 C;  4W9J A;  2NTS A;  1UH6 A;  2MJD A;  2PJH A;  2YEP B;  4ICV A;  3VTV A;  2KAJ A;  3V60 A;  4A20 A;  2KDB A;  2WS3 B;  3Q8E A;  1F1H A;  2KQS A;  2INP E;  1AYF A;  1ENF A;  3H9D A;  3MJW A;  3UQB A;  2YLM A;  1TKE A;  2QDF A;  4RGT A;  1L0X B;  2ZW0 A;  1JCK B;  2KLG A;  3KQ4 A;  4TSS A;  4C4V B;  3MC0 B;  3QWZ B;  3AM9 A;  4GOC A;  3MHS D;  2GB1 A;  3DBH I;  1PDX A;  4M0W B;  2M1M A;  4WQO B;  1GPX A;  1NEK B;  3DWG C;  2M0X A;  2QIE B;  4ZYN A;  3DBR B;  1NEN B;  2QC8 A;  1CQV A;  1B9R A;  4ZOH C;  1K52 A;  4S0R A;  1N61 A;  2NR2 A;  3BVM A;  1YX5 B;  1YN5 A;  1WRI A;  4MM3 B;  3A33 B;  3O13 A;  1B1Z A;  2ZVN A;  4LCD E;  1V81 A;  3QIJ A;  3ONS A;  2BTE A;  1TZ1 A;  3RPF C;  4UDU C;  2J53 A;  5AUK A;  3FKY A;  5E6P A;  3AED B;  1HXY D;  1J7A A;  1EU3 A;  1YNT E;  2QEJ C;  1PQS A;  2FBW B;  2LMC A;  1P7E A;  2DNF A;  1E10 A;  1C4A A;  2BYV E;  1NDD A;  2KK8 A;  1TT5 B;  2PE6 B;  2JUO A;  2BB6 A;  5IP4 D;  2JYE A;  1I35 A;  2W9N A;  4GLS C;  1ZP0 B;  2K9X A;  3QX1 A;  2KX0 A;  3IBE A;  2VRR B;  2DYM A;  5JHB A;  4LNO A;  4FXC A;  2L0T A;  4OHJ A;  2KVZ A;  4PYZ A;  4D2K A;  3SR6 A;  3HVD A;  3VTU A;  4K81 A;  3TIX A;  4LTU A;  3IHP C;  3SFD B;  2KOX A;  1KM7 A;  2FIF A;  5J17 A;  2LEK A;  1FIQ A;  1WGH A;  1WX9 A;  3P4S B;  3GS2 A;  3M3J A;  1RFA A;  2BWF A;  2HE7 A;  1LM8 B;  3L16 A;  4AP4 C;  2O2V A;  1PFD A;  1TS3 A;  2WU5 B;  3VR8 B;  1R4N B;  3CWI A;  1AN8 A;  4HVB A;  5J2R A;  4OZA A;  1E0Z A;  2C9W B;  4YSX B;  4EE2 A;  2V3S A;  4RNA A;  2IO0 B;  2KWU B;  1JML A;  3AH7 A;  4REZ A;  2HTH A;  3QCA A;  4K7W A;  5CX3 A;  3VUX A;  2WDR B;  4NJ6 A;  1N5W A;  1KH0 A;  2XNA C;  1C79 A;  3DPD A;  2R2Q A;  1OTR B;  2PEA A;  1SGH A;  3ZRF A;  3X0W A;  4GGQ A;  1WR1 A;  4KIK B;  3HK0 A;  4MGY E;  1M94 A;  2FAZ A;  1TYG B;  2X8X X;  1I4G A;  4IWQ A;  2O2V B;  2K8C A;  1SF0 A;  3W9C B;  4GXB A;  2DHZ A;  3PVL A;  2JWU A;  3PTF C;  5LNK 1;  4FLH A;  1XEE A;  5IOI A;  1WJ6 A;  2B3A A;  1EUV B;  1MPE A;  1TY2 A;  2Q5W D;  3I57 A;  2RPV A;  5BYR A;  4BBN C;  4KKJ A;  2MQJ A;  1R4M B;  1R4N I;  3R2T A;  4EUT A;  4HKZ E;  2MJE A;  3W1Y A;  4FBJ B;  1P0R A;  4JWU C;  3S2A A;  3AE8 B;  2L32 A;  2FUH B;  1BXT A;  2C7H A;  4RFB A;  2UU7 A;  4JGH B;  1I4Q A;  3NY5 A;  4YXD B;  1HEZ E;  2D3G A;  3L08 A;  3RCZ A;  1ACC A;  1UGJ A;  3SEB A;  1KOT A;  1WYG A;  2WXO A;  2M4N A;  1NBF C;  2CS4 A;  3RN9 C;  1RLF A;  4K3B A;  1E8Y A;  2OOB B;  5HG2 A;  1VCB A;  3V6C B;  1D5Z C;  1TJE A;  4F8C B;  4I6L B;  2G1E A;  3DDC B;  4KZC A;  3KW5 B;  2CU3 A;  2BBC A;  1WJ4 A;  2V3N A;  3PLV A;  4RGO S;  2KO3 A;  1YOV B;  2DYO A;  1E7U A;  2FCN A;  5IKC M;  3RUI B;  4B0M A;  3A4R A;  4P16 A;  3KWL A;  4B9K A;  2BS3 B;  4CO7 A;  1FPY A;  4MGZ E;  3AE5 B;  1QZE A;  1BT0 A;  1C76 A;  3CSF A;  3HIZ A;  1SXT A;  3LYY A;  1JQ4 A;  3BVZ A;  3N3K B;  2CJO A;  1HTO A;  3PRZ A;  1FD6 A;  4RCO A;  2J4X A;  1Y8R C;  1T3Q A;  2KKC A;  5KHQ A;  2LGI A;  2WX0 A;  1ZGU B;  1P98 A;  1SB3 C;  4LNN A;  4IUM B;  4EZL A;  1F77 A;  2L1A A;  4A6Q A;  2KVR A;  2NBU A;  5CTR C;  2V1Y A;  2BB5 A;  2AL6 A;  2N9K A;  4DDG D;  4BVU C;  3VRB B;  4FUL A;  3NZ3 A;  5C1Z A;  3A9J A;  2NPT A;  1V8C A;  3M63 B;  3N1Y C;  4I6N B;  1WI0 A;  3E56 A;  2PTL A;  3VR9 B;  4KX6 B;  2K39 A;  4WAF A;  3U30 A;  2K8B A;  2NS5 A;  4DBG A;  2LHD A;  1Q1O A;  1YN4 A;  2IO3 B;  3SD5 A;  5FKA C;  1KTK A;  4EKU A;  5EE9 A;  4O1N A;  3AU4 A;  2RD0 A;  2L52 A;  2M17 A;  3ZTD A;  1CK1 A;  3R7Q A;  1OQY A;  3AEA B;  1WE7 A;  1XCQ L;  1V5O A;  1YMH E;  2LWP A;  1IBX A;  2JZZ A;  2RSU A;  1K50 A;  1ET6 A;  2FCQ A;  3NVW A;  3U8Z A;  3AV8 A;  1FNU A;  1L6V A;  1YX6 B;  1WX8 A;  3WCQ A;  3MTN B;  1K8R B;  4W9K A;  4LDT B;  1V86 A;  2IYD B;  3Q6B A;  3EGR A;  2C60 A;  4ASW C;  1XO3 A;  4OVV A;  5DPS A;  4YWG G;  3OG5 A;  1L5P A;  3RZF A;  4MH0 E;  1PGB A;  4RGN A;  2FE8 A;  4N58 A;  3Q8F A;  5KHO A;  3ZXR A;  2MBQ A;  4ZRJ A;  3OJ4 B;  4JIO U;  4RM8 A;  4WH4 A;  1MVK A;  3NJT A;  1VLB A;  2MSE D;  2JU6 X;  4BBN F;  3PHW B;  4XGA B;  1WE6 A;  2WXR A;  3AEC B;  1IGD A;  4Q2J A;  3BII D;  2MWS B;  3BK2 A;  4NAW A;  2LHE A;  1SSN A;  3SDL C;  3L17 A;  2WXM A;  2FNJ B;  2I1J A;  2JWZ A;  3N1X C;  2KFJ A;  1SEB D;  4J6I A;  1JRU A;  4XDC A;  2CHW A;  3EUB 2;  5FK9 C;  1V1O A;  1V97 A;  2KYW A;  4W9C A;  2KMC A;  3ZNH B;  3PHX B;  2WXK A;  1M4V A;  4DHZ E;  2MRP A;  4KGR A;  3ZVV A;  2HDE A;  4CHK A;  1UD7 A;  4TMA B;  1MG4 A;  3FIL A;  4JX1 C;  1SJH D;  2KWC A;  3ZO5 B;  4F1S A;  4US9 A;  3PLU A;  2O6V D;  2G45 B;  2GRI A;  3DBH B;  3OJ3 A;  3AE6 B;  3Q2A C;  3QJZ A;  3WAP A;  2Y5B B;  1E8Z A;  3VH3 B;  5C3J B;  1TKY A;  2I38 A;  3VFK A;  4G3X B;  2BYE A;  4W9E A;  2PE9 A;  1YJJ A;  1IP9 A;  1FM0 D;  1JW9 D;  1WGG A;  3A1Q A;  1NI3 A;  3VHT C;  2D10 A;  3TUO A;  3RNG C;  1F0Z A;  2WLB A;  1NYQ A;  1EM7 A;  3MJ5 A;  4HRS A;  1OQQ A;  2RPQ A;  4WUR A;  3EHV A;  2ZCB A;  1BML C;  4GDK B;  1IYF A;  2HD5 B;  2IO1 B;  3DCG A;  1UGM A;  1E7P B;  1WMH A;  3APC A;  1J7C A;  5TR5 A;  2RDH A;  2DZJ A;  2M0A A;  4KIK A;  3T9L A;  1CZP A;  4IM2 A;  1VD2 A;  2N0S B;  1Y56 A;  4A9A A;  2LI5 A;  1D6E C;  4XX5 A;  3A1Q B;  1I4H A;  3MC9 A;  3PGE A;  1V9J A;  3P4Q B;  2KDM A;  1ZXH A;  2DZI A;  4YTN B;  2L7R A;  1EWY C;  1HA5 A;  4KSK C;  3DVG Y;  4W9H A;  3ZJV A;  4AOF A;  4EFO A;  2R2O A;  2OJW A;  1EWC A;  1F52 A;  4E74 A;  2JSV X;  3U2S C;  2BKR B;  3UGB B;  1LGR A;  1N62 A;  4LJP B;  1FNV A;  5T8I A;  5TSS A;  1X1M A;  3ZTC A;  2K5P A;  3MFG A;  3PO0 A;  4FJV B;  1TKG A;  1SIJ A;  2W54 A;  4W9G A;  1HQR D;  1XLN A;  5IA7 A;  1EF1 A;  3T3N A;  5MPO A;  1QOB A;  3AE2 B;  3WAL A;  4BOS C;  5E6J A;  2KTF A;  2IND C;  1OEY J;  2K3U A;  1FXA A;  2EMS A;  2JT4 B;  3VQI A;  1FRD A;  3ZNG C;  4WWP A;  1ZKH A;  3M62 B;  2NBW B;  1L4Z B;  1ZDX A;  1GOZ A;  4NZL B;  1C77 A;  2LVO A;  3AEF B;  4N9F 4;  1OGW A;  4B6W A;  3JVZ X;  1VZ8 A;  4RM9 A;  5DPW A;  2MLB A;  3ZDM C;  2WXJ A;  1YJI A;  4ITK A;  1N63 A;  4DXA B;  4HWI B;  1F2R C;  2INC C;  2RDB C;  1RRB A;  4HLE A;  1TY0 A;  4MM3 A;  4WJQ A;  1SE3 A;  3NS1 A;  1UEL A;  1YN3 A;  4NJ7 A;  2RDG A;  2LJI A;  1HTQ A;  1CMX B;  2LRW A;  1S1Q B;  1UWX A;  2N7E A;  2CHX A;  4KDL B;  1BUI C;  5JXV A;  2PIA A;  2W82 A;  2FUG 1;  2KX3 A;  3L0W B;  3N32 A;  4BZA A;  3IAM 1;  1QKZ A;  1T0Y A;  5D94 A;  2WXP A;  5E6O A;  1A70 A;  3B08 A;  2WP9 B;  3VVW B;  3VAW A;  2CR5 A;  4PS7 A;  5L83 A;  1WZ3 A;  2MA9 B;  3B9J A;  2PMV A;  1ZW7 A;  3KVF B;  2N1V A;  5H92 C;  3LB8 C;  1VZ7 A;  2JZP A;  3UF8 A;  2ZW1 A;  1N60 A;  4MGI E;  3TEY A;  5CHF A;  4BOZ B;  4HDO A;  1E8W A;  4K7U A;  4NNJ B;  4ZRQ A;  3QA8 A;  4L2Y A;  1V1P B;  1V6E A;  5G5G A;  1L0V B;  2GBM A;  3JW0 X;  1WGR A;  4A90 A;  3J9C A;  3VUY A;  5GXG B;  1G6J A;  2LUE A;  3N1Z C;  4XWW A;  1LFD A;  1WGY A;  3VTW A;  1ZOY B;  2ZJD A;  1AWD A;  2N9L A;  4M00 A;  1GB1 A;  4IG7 B;  4DDI D;  2YEP F;  2ZVO A;  4M8M A;  1MI0 A;  2AEH A;  1XQQ A;  4LNI A;  3AU5 A;  3W1S C;  2BYF A;  2G4D B;  3DVG X;  1WY8 A;  4OVZ A;  1WJU A;  3HRD D;  4DQO C;  4IC7 B;  3N9Y C;  3IT4 B;  5DCN A;  2AQ1 B;  1XLQ A;  2KAN A;  1N5X A;  2EKE C;  3ZNI D;  4PK1 A;  2CU1 A;  2MW5 A;  3RYT A;  1WWT A;  3ZW3 A;  4M02 A;  2Y3A A;  3TEW A;  3IFW B;  2LAS A;  3EC8 A;  4N6E B;  1ROE A;  3DHH C;  3SHQ A;  4BKS D;  1WFY A;  3NVZ A;  3HVZ A;  1RFK A;  3T8M A;  1FCL A;  1VRA B;  2MBO A;  2DWQ A;  4YTM B;  4MDK E;  5AUI A;  2AQ3 B;  2Z59 B;  1FO4 A;  1KLV A;  3ZNZ B;  4MGK E;  2R61 A;  2N9E B;  5D3I B;  5IAA C;  4HPM B;  1YQ3 B;  5IO9 A;  5G55 A;  3L4P A;  1L6U A;  2O6V B;  1QIL A;  1MFW A;  3Q3O C;  2ZZP B;  1SE9 A;  1HE8 A;  4YL8 A;  5C2T B;  2FID A;  1R7S A;  2PVG C;  4MJS B;  2FCM A;  4C7Y A;  1FFV A;  2J52 A;  1RWS A;  4FJY A;  1DGJ A;  4OZB A;  3ZLZ A;  1LQB A;  4RMA A;  1FCC C;  2AQ2 B;  1RYJ A;  1I7H A;  1WIA A;  4DWF A;  1JWA D;  1P3Q U;  3RZW C;  1GJZ A;  4XYC A;  1L7Y A;  4IWO A;  2WDV B;  2J0J A;  3W5U B;  4WWO A;  3Q3J A;  3KH0 A;  5D6J B;  4HCN B;  3Q8A A;  2LJ5 A;  4KV2 A;  3VXW A;  1XD3 B;  4DHZ B;  3H6N A;  5HFY A;  2QJL A;  1XF5 L;  4K7S A;  4GDL B;  3I63 C;  3T3O A;  1NVI D;  1SIF A;  2IZV B;  4OZC A;  2JVC A;  1ISN A;  2UWQ A;  1D4B A;  5EE1 A;  2L3Z A;  4TV3 A;  2VZK D;  2EKI A;  4HJG E;  5LXH A;  2W3S A;  2K8H A;  1D5X C;  3PRE A;  2GBK A;  1I42 A;  2KJR A;  1V80 A;  2BYT A;  2M56 B;  2KWV B;  4WJP A;  4G50 A;  2GI9 A;  1JAL A;  3TEX A;  2PVO D;  1UUP A;  4IW0 A;  1UNS A;  2NBV B;  3WAM A;  4C80 A;  1QOF A;  2OHF A;  2RR9 A;  4BKS A;  2OED A;  3ZIM A;  3AEG B;  4DHJ D;  1I4P A;  1A5R A;  3MHZ A;  3TEZ A;  4RF1 A;  4AWJ A;  5GMV A;  2LD9 A;  3I5J C;  3LXF A;  1GNU A;  3IXS A;  3OWE B;  3GZN B;  2AWT A;  2HTM E;  2W3R A;  4MSM B;  1WMH B;  2KQ7 A;  1J19 A;  2MCN B;  1J7B A;  3E9S A;  2KFK B;  4ZRP A;  4YT0 B;  1WH3 A;  2WDQ B;  3H1U A;  2K1F A;  4HEA 1;  3C8Y A;  3W1S A;  3KUZ A;  3R7R A;  1MG8 A;  3P4R B;  2XK5 B;  3RNC C;  3EEC A;  4GB9 A;  4P6V F;  2JX5 A;  3AN1 A;  2B76 B;  3UIP B;  2DBY A;  1F2R I;  1VDV A;  5BYQ A;  1PGX A;  2WDT B;  1I4X A;  1GC6 A;  4EEW A;  4XZ4 A;  4LNK A;  3CF6 E;  4WAA A;  2N9X A;  4ANU A;  2JXX A;  4RH6 A;  4BKT A;  4MSQ B;  4NY0 A;  2JXT A;  3KWV A;  3U7Z A;  2J0K A;  2KAC A;  4M01 A;  4NJC A;  2PLP A;  2D07 B;  1WM2 A;  1DOX A;  4KGS A;  1QF6 A;  2RGF A;  4AS1 A;  2DEN B;  3SU8 X;  3TMP B;  3U4E G;  1WXV A;  4MT5 A;  4LK0 M;  1C4C A;  2XK5 A;  2LGX A;  2PKO A;  4DXG A;  3ETR A;  2C7N B;  2BW2 A;  3KUD B;  4II2 B;  1RM6 C;  4FHJ A;  3ENE A;  4DK5 A;  4NAW B;  2L05 A;  1VJK A;  4C56 C;  4L23 A;  5LXI B;  3AB5 A;  3KYC D;  1E6E B;  4ANW A;  5L95 C;  3PS6 A;  2L00 B;  1IUE A;  1KRH A;  2ZPN A;  2K6D B;  1SJE D;  2KD0 A;  2LGD A;  5JH5 C;  4HJK A;  4KDI C;  4TUU A;  1AAR A;  1JWU D;  2ZNV C;  2Y5C A;  4PS3 A;  1ZPS A;  2E3T A;  1PGA A;  4GU2 A;  2GOW A;  4HKQ A;  1T0S C;  3X23 A;  3DWM A;  1LO5 D;  1TGZ B;  1FRR A;  3RD2 A;  5JZE B;  2N4F A;  3MP9 A;  1T5X D;  3NRZ A;  3EA6 A;  1Z5S B;  3Q3F A;  1FXT B;  2IPK D;  4KKI A;  1SE2 A;  3FIL B;  3CIR B;  1ZE3 D;  1IBX B;  5BYS A;  3VUW A;  2N9P C;  4L1B A;  4WWM A;  1EO6 A;  2QIL A;  2L76 A;  3DOW A;  3L10 B;  2J42 A;  4GMV A;  2BVC A;  4USA A;  3PZ7 A;  4KZ0 A;  4A8X C;  3EFC A;  1HZ5 A;  3R2I A;  2WXL A;  1DOI A;  2IGH A;  2TSS A;  3V05 A;  2X38 A;  1KF6 B;  3I3T B;  1GUA B;  1MJD A;  3C0R B;  2CJN A;  2GBR A;  2SEB D;  2ONQ A;  4IM0 A;  3A9J B;  2CHZ A;  3V3X A;  4RF0 A;  1QQR A;  1OEY A;  2WHI A;  3ZUN A;  2BS4 B;  1C4P A;  3PPA A;  3ML8 A;  4LLG M;  5I4D A;  3CST A;  2BKF A;  1FNW A;  3ZYY X;  4C4V A;  4FJZ A;  2K25 A;  3ZXV A;  1KLG D;  2D11 A;  4B95 A;  2WXQ A;  3HUI A;  5FR6 A;  3RI7 C;  3NUH B;  3B2F A;  3H7P A;  4ARC A;  2I1K A;  4AJY B;  3GP7 A;  1V1P A;  3URY A;  4NQL B;  2KLC A;  2V3P A;  2O6V A;  1WZ0 A;  3UI3 A;  5EE3 A;  3W5V B;  1GC7 A;  3NZU A;  2KWD A;  2BGF A;  2OJR A;  5BMH A;  4GN1 A;  1KLU D;  4EOY A;  4CQN A;  1ET9 A;  3B2G A;  1STE A;  3RT3 B;  3PZD A;  4E3C A;  4P1B C;  4C00 A;  3A9K B;  4EZK A;  2RMM A;  4ZRI A;  2IY0 B;  4R3D A;  3GE3 C;  3ZRC A;  1WR6 E;  2LGY A;  3QC8 B;  2A4Z A;  4MH8 A;  1I4R A;  1YQ4 B;  2BF8 B;  3AE4 B;  1WJN A;  2LFI A;  2JYT A;  4RGM A;  2L83 A;  2KMM A;  4ICU A;  2MP2 B;  3Q14 C;  3ZJU A;  4G0N B;  3N30 A;  1D3Z A;  4IDI A;  4HK2 A;  1KFY B;  5DPR A;  3JSV B;  3ZGZ A;  1NYR A;  1E7V A;  3Q8B A;  5FR3 A;  2KJ6 A;  4FHK A;  3QAR A;  2XBB C;  4HPL B;  4J3O D;  2ASQ A;  3HM6 X;  4K3C A;  2WQY B;  4KGT A;  1ZDV A;  4XE0 A;  4ZHO A;  4XC2 A;  3BZD B;  4HDQ A;  4BKG A;  2N7J A;  2MH7 A;  4ANV A;  3VH4 B;  2NTT A;  1QT9 A;  1IPG A;  3ZQ4 A;  2Z0E B;  3KYD D;  1J8C A;  1JRP A;  4YSY B;  1WXM A;  3UIN B;  1F9J A;  3VDZ A;  1IGC A;  4ZHP A;  3I9V 1;  3AXC A;  4S17 A;  4G11 A;  2WU2 B;  2Y5P A;  3NVV A;  2D5G A;  5G5H A;  4FA6 A;  2V0G A;  2KTR A;  5BO4 B;  1GAQ B;  2MBH A;  2WXF A;  3SFE B;  4E71 A;  5H8Y E;  4MEM A;  3AI5 A;  4EZJ A;  4GDL A;  4GIV A;  4PYU A;  3CMM B;  1J0G A;  2LXC A;  4A55 A;  3OLM D;  5EE0 A;  2MBB B;  3O65 B;  2WXN A;  4US8 A;  1XT9 B;  1ZUD 2;  4I6P A;  2ACZ B;  4WIP A;  3P4P B;  2KJH B;  3H8H A;  3FAH A;  3KUC B;  4HXD A;  4PS8 A;  2JQR B;  3UIO B;  3L54 A;  2NCN A;  3AEE B;  1WXQ A;  3W2D A;  4HPP A;  2REX A;  2VH2 A;  2WGS A;  2BS2 B;  3P2B A;  3P42 A;  5DPT A;  3AMZ A;  1K51 A;  2KDI A;  2I2Y A;  2JRH A;  1C9F A;  2ZPY A;  2KMA A;  2LVP A;  3A4S C;  3DQV A;  1TS2 A;  1S3S G;  4URK A;  4WQM A;  3RNB C;  4JL9 A;  2KZR A;  2LZ6 A;  2L0F A;  1YIW A;  1P7F A;  3BYY B;  5HKH A;  1KJT A;  4ZRK A;  2ZEQ A;  3KLS X;  4P7I A;  3UQA A;  1EF5 A;  4JE3 B;  1JWS D;  2NVU I;  5E6N A;  3RNF C;  2SAK A;  4OVU A;  4ARI A;  3AE7 B;  2KN5 A;  2LUM A;  3QK0 A;  1UF0 A;  1XCT L;  2D3B A;  3DBS A;  4KSL C;  3RNA C;  1PUT A;  4IKG A;  5LLI A;  4MEL A;  2KXJ A;  3TCA A;  1UBI A;  2DAJ A;  1L2N A;  2V4L A;  2GMI C;  2KNB A;  2UYZ B;  3DHI C;  4CYE A;  5C23 A;  1UWM A;  2MX2 A;  3QAQ A;  4FN2 A;  3NOB A;  4TQ0 A;  1YQB A;  4ZDV A;  2QSD A;  4W9I A;  1P9D U;  2DLB A;  4N59 A;  3EFU A;  5HI1 A;  3AUL A;  3ALB A;  5D3D A;  4WJO A;  1OQR A;  1WXA A;  3R66 C;  2A5U A;  3GZN I;  2J7Q B;  5D7G A;  1WX7 A;  2JRI B;  5AZH A;  2EEL A;  2IY1 B;  4W9D A;  2G3Q B;  1NI2 A;  3JSV A;  4YTP B;  3QQ8 B;  2KN4 A;  4JQW C;  3K9O B;  1K53 A;  3DBL I;  2BT6 A;  2DAF A;  2VZK B;  2L8J A;  1XXG A;  4W9F A;  5AEK B;  1L0Y B;  2IGG A;  2Z8L A;  3DHG C;  2M8S A;  3ZDT A;  4FAD A;  2D3C A;  1ESF A;  1MHH E;  3TBL D;  2HJ8 A;  2C7M B;  1E9M A;  5G2N A;  3AE3 B;  3APF A;  2KDF B;  4GSW A;  2GBN A;  3WA0 A;  4ANX A;  1P1A A;  3V61 A;  3B1L X;  2N7D A;  2PW9 A;  1WF9 A;  1RAX A;  4LNF A;  2ZCC A;  3NZS A;  2PPH A;  3NHE B;  2DX5 B;  1WSP A;  2D3A A;  1FXI A;  4B0E A;  3FC4 A;  4IM3 A;  3WIM A;  1WGK A;  1JWB D;  4AUQ C;  2AX5 A;  1Q5W B;  1TS5 A;  1XLP A;  2Z0D B;  3JYU A;  2WWZ A;  4HCP B;  2QHO A;  4NPN A;  4QAY A;  2MEK A;  2H89 B;  1C3T A;  2NPT B;  2WXG A;  3PV1 A;  1R4M I;  2GLS A;  3IT6 B;  1QOA A;  1VZ6 A;  1C1Y B;  2LXA A;  1WM3 A;  4X57 B;  1TBE A;  2QMT A;  2IBI B;  2AYO B;  3IAS 1;  2W55 A;  2LGS A;  3OAW A;  1WYW B;  3TL5 A;  3Q8C A;  3RFZ B;  2DYB A;  4W9L A;  2JY6 A;  2KQ4 X;  1FFU A;  1GB4 A;  4PT5 A;  2V9H A;  2J0M A;  2KC1 A;  3H7S A;  2JF5 A;  2KC2 A;  2D2Q A;  2HJ1 A;  2IDY A;  2VH1 A;  3BYT B;  2N1W A;  4WJN A;  3M95 A;  4KVG B;  2IGD A;  1QOG A;  4NAM A;  4IOI E;  4JWS C;  2KFK A;  5CHW A;  2MBE A;  3AE1 B;  1Q10 A;  3VRA B;  2EMT A;  4II3 B;  1V2Y A;  3P63 A;  3BK1 A;  2LVQ A;  3NS8 A;  2WXI A;  3WAN A;  3IG3 A;  2IO2 B;  4F7Z A;  4AQ7 A;  1HZ6 A;  3Q3M C;  1JRO A;  3RUL A;  4A3P A;  1Z2M A;  3ZJT A;  1TZO A;  3BIN A;  4JPS A;  3TJP A;  2K6Q A;  3Q3N C;  1DOY A;  2ICI A;  3DBR I;  4H2A A;  1TIF A;  2QCZ A;  2INN E;  4ZYS A;  4NQK E;  2IJ0 A;  4YSZ B;  1FMA D;  5BMG A;  2ON8 A;  1PYW D;  3PZ8 A;  2LRU A;  3DVN U;  4WWN A;  1YD8 U;  3ABV B;  2KHW B;  5D2M B;  2MJ3 A;  2XN9 C;  1E90 A;  2K22 A;  3V62 A;  4LDT D;  1YJ1 A;  4MAC A;  3NG0 A;  2AL3 A;  4BFR A;  3V6E B;  2YVC A;  2JZ3 B;  3DBL B;  3MC8 A;  3GOE A;  3AEB B;  3ECI A;  2DZM A;  3GB1 A;  3BVG A;  4GDK A;  2MHJ A;  3GE8 C;  3DVN V;  1EU4 A;  2JPH A;  1GG3 A;  1H8C A;  1N6Z A;  3HHM A;  4JLC A;  3R8B A;  4AJW A;  3BY4 B;  2H88 B;  1E5W A;  4OW0 A;  3WAO A; 
#chains in the Genus database with same CATH homology
 5KHQ A;  2KJ6 A;  2LAS A;  3EC8 A;  2WX0 A;  3QAR A;  1ZGU B;  1P98 A;  2XBB C;  4FHK A;  3SHQ A;  3B0A A;  4HPL B;  4IUM B;  4BKS D;  2ASQ A;  3A9K A;  3HM6 X;  4EZL A;  1WFY A;  3T8M A;  1U4A A;  2KVR A;  2NBU A;  5CTR C;  2MBO A;  4XC2 A;  1WXS A;  2GBJ A;  2V1Y A;  4HDQ A;  2AL6 A;  4MDK E;  4BKG A;  4DHJ B;  4ANV A;  3LJ3 A;  3VH4 B;  4A3O A;  2Z59 B;  4DDG D;  1KLV A;  1V49 A;  4BVU C;  3ZKJ C;  3ZNZ B;  1IPG A;  4MGK E;  4FUL A;  2Z0E B;  3KYD D;  1UZX B;  2N9E B;  3PRP B;  5C1Z A;  1J8C A;  5IAA C;  3A9J A;  4HPM B;  2NPT A;  3M63 B;  5G55 A;  4I6N B;  2O6V B;  2KTR B;  1WI0 A;  3APD A;  4MJS A;  1WXM A;  2ZZP B;  5CHV C;  3UIN B;  1F9J A;  2K39 A;  3VDZ A;  3U30 A;  2K8B A;  2NS5 A;  4DBG A;  1SE9 A;  1HE8 A;  1Q1O A;  2DZK A;  2IO3 B;  2WYQ A;  3D32 A;  3AXC A;  4YL8 A;  5AZG A;  4G11 A;  3SD5 A;  2FID A;  2WX1 A;  4FA6 A;  4EKU A;  2KTR A;  3U7D A;  4MJS B;  2FCM A;  2MP2 A;  5EDS A;  5BO4 B;  4K1R B;  4FJY A;  3AU4 A;  3ZLZ A;  2RD0 A;  2CKH B;  1UBQ A;  1LQB A;  2MBH A;  4RMA A;  1WGD A;  2M17 A;  3ZTD A;  4IWP A;  2G4S A;  3R7Q A;  1OQY A;  4E71 A;  2BWE S;  1WE7 A;  3AI5 A;  4MEM A;  4EZJ A;  1V5O A;  2LWP A;  4GDL A;  4GIV A;  5JHA A;  1WIA A;  2JZZ A;  2RSU A;  4PYU A;  4DWF A;  2FCQ A;  4M8N A;  3CMM B;  1P3Q U;  2FCS A;  3RZW C;  1J0G A;  2LXC A;  1GJZ A;  1WRD B;  3U8Z A;  1YX6 B;  3OLM D;  2MBB B;  1H4R A;  1WX8 A;  3O65 B;  1E8X A;  1L7Y A;  1XT9 B;  4IWO A;  3MTN B;  4I6P A;  3R3M A;  1K8R B;  2J0J A;  4W9K A;  2BPS A;  4LDT B;  5AZF A;  1V86 A;  2IYD B;  4TKN A;  2C60 A;  2KJH B;  3KH0 A;  3Q3J A;  3KUC B;  4HXD A;  4HCN B;  4WWO A;  4PS8 A;  5D6J B;  3HM3 A;  4OVV A;  4ASW C;  3UIO B;  3L54 A;  2NCN A;  5DPS A;  2LJ5 A;  4KV2 A;  3VXW A;  2C5L C;  3PRM B;  1XD3 B;  4DHZ B;  3H6N A;  3RZF A;  4MH0 E;  3LDZ E;  4K7S A;  4GDL B;  3ML9 A;  5KHO A;  1SIF A;  2IZV B;  3H7P B;  2REX A;  5J18 A;  1TTN A;  2JVC A;  2MBQ A;  4LJO B;  4ZRJ A;  1ISN A;  1V5T A;  2XEW A;  2UWQ A;  3P2B A;  3OJ4 B;  3IVF A;  3K9P B;  5DPT A;  2L3Z A;  2ZNV B;  4JIO U;  4RM8 A;  4TV3 A;  3PSE B;  2KDI A;  2JRH A;  1LXD A;  2ZPY A;  2KMA A;  3PT2 B;  5LXH A;  2MSE D;  2LVP A;  2K8H A;  3A4S C;  4BBN F;  3DQV A;  3PHW B;  1S3S G;  3QHT A;  1WE6 A;  2GBK A;  3PRE A;  4URK A;  2KJR A;  1I42 A;  1V80 A;  3L13 A;  2KDE B;  2KWV B;  4JL9 A;  2KZR A;  2MWS B;  2LZ6 A;  2L0F A;  4NAW A;  4WJP A;  1Q0W B;  1YIW A;  4G50 A;  3SDL C;  3L17 A;  1KJT A;  2FNJ B;  5HKH A;  4ZRK A;  2ZEQ A;  2I1J A;  4TQ1 A;  2JWZ A;  2KFJ A;  4IW0 A;  4P7I A;  3UQA A;  1EF5 A;  4J6I A;  4W9J A;  1JRU A;  1UH6 A;  2NBV B;  2NVU I;  2CHW A;  3WAM A;  2PJH A;  4ICV A;  5E6N A;  4W9C A;  2KMC A;  4OVU A;  2RR9 A;  3VTV A;  3ZNH B;  4BKS A;  3V60 A;  3PHX B;  2KN5 A;  4A20 A;  2KDB A;  3ZIM A;  4DHZ E;  2MRP A;  3ZVV A;  4DHJ D;  4CHK A;  1UD7 A;  1A5R A;  2KQS A;  4AWJ A;  5GMV A;  3QK0 A;  2LD9 A;  1GNU A;  2KWC A;  3H9D A;  3ZO5 B;  4F1S A;  2AWT A;  3MJW A;  3UQB A;  2YLM A;  3PLU A;  4MSM B;  3DBS A;  4KSL C;  1WMH B;  2O6V D;  2G45 B;  2KQ7 A;  3OJ3 A;  3QJZ A;  3WAP A;  1J19 A;  2MCN B;  5LLI A;  2KLG A;  1E8Z A;  2Y5B B;  4MEL A;  2KXJ A;  3VH3 B;  3TCA A;  1UBI A;  2DAJ A;  1L2N A;  2V4L A;  2KFK B;  2GMI C;  3VFK A;  3QWZ B;  4G3X B;  2BYE A;  4W9E A;  4GOC A;  2PE9 A;  2KNB A;  3MHS D;  1WH3 A;  1IP9 A;  2UYZ B;  2K1F A;  1WGG A;  3A1Q A;  3H1U A;  5C23 A;  3DBH I;  4CYE A;  4M0W B;  2MX2 A;  3QAQ A;  3W1S A;  2M1M A;  3KUZ A;  4FN2 A;  4WQO B;  3R7R A;  3VHT C;  1MG8 A;  2D10 A;  3NOB A;  2XK5 B;  4TQ0 A;  1YQB A;  3EEC A;  2M0X A;  4GB9 A;  4ZDV A;  4W9I A;  4ZYN A;  1P9D U;  2RPQ A;  3EFU A;  3UIP B;  3AUL A;  3ALB A;  3EHV A;  2ZCB A;  4GDK B;  1IYF A;  2HD5 B;  4WJO A;  2IO1 B;  3DCG A;  2NR2 A;  1UGM A;  1WXA A;  2WDT B;  1YX5 B;  3R66 C;  1GC6 A;  1WMH A;  4EEW A;  3A33 B;  2A5U A;  3APC A;  4XZ4 A;  4LCD E;  2ZVN A;  5TR5 A;  3CF6 E;  2J7Q B;  3GZN I;  1V81 A;  1WX7 A;  2DZJ A;  2JRI B;  3QIJ A;  4WAA A;  5D7G A;  5AZH A;  3ONS A;  2IY1 B;  2N9X A;  4KIK A;  4W9D A;  3T9L A;  4ANU A;  2JXX A;  2G3Q B;  1TZ1 A;  1VD2 A;  4IM2 A;  4BKT A;  1NI2 A;  3JSV A;  4MSQ B;  4NY0 A;  5E6P A;  3QQ8 B;  2J0K A;  4JQW C;  3K9O B;  2LI5 A;  1PQS A;  3DBL I;  2DAF A;  2D07 B;  4XX5 A;  1WM2 A;  3A1Q B;  2L8J A;  2BYV E;  2RGF A;  1NDD A;  3PGE A;  2DEN B;  2KK8 A;  3SU8 X;  1V9J A;  3TMP B;  2DZI A;  1WXV A;  4W9F A;  5AEK B;  2PE6 B;  2JUO A;  2M8S A;  3ZDT A;  2L7R A;  2XK5 A;  1I35 A;  4FAD A;  2W9N A;  2LGX A;  4KSK C;  3QX1 A;  2KX0 A;  3IBE A;  2VRR B;  3DVG Y;  4W9H A;  2DYM A;  2C7N B;  3TBL D;  2HJ8 A;  5JHB A;  3KUD B;  2C7M B;  4II2 B;  4FHJ A;  3ENE A;  4AOF A;  4EFO A;  2L0T A;  4DK5 A;  5G2N A;  4NAW B;  2R2O A;  3APF A;  2KDF B;  4E74 A;  4PYZ A;  4GSW A;  2L05 A;  2GBN A;  2BKR B;  3UGB B;  3WA0 A;  5LXI B;  4LJP B;  3VTU A;  4K81 A;  4ANX A;  3TIX A;  1P1A A;  3IHP C;  3KYC D;  2KOX A;  1KM7 A;  4ANW A;  5L95 C;  2FIF A;  5J17 A;  1X1M A;  3PS6 A;  2L00 B;  3V61 A;  1WX9 A;  1WGH A;  3B1L X;  2N7D A;  3M3J A;  3ZTC A;  2ZPN A;  2K6D B;  1WF9 A;  1RAX A;  1RFA A;  2BWF A;  2HE7 A;  2KD0 A;  1LM8 B;  2LGD A;  2ZCC A;  4HJK A;  5JH5 C;  3L16 A;  4FJV B;  4AP4 C;  2O2V A;  3NZS A;  4KDI C;  4W9G A;  2PPH A;  4TUU A;  3NHE B;  1AAR A;  2DX5 B;  5IA7 A;  1EF1 A;  2ZNV C;  4PS3 A;  4IM3 A;  3WIM A;  4HVB A;  4AUQ C;  3WAL A;  1Q5W B;  4GU2 A;  4BOS C;  5J2R A;  2GOW A;  2C9W B;  2KTF A;  1OEY J;  3X23 A;  2Z0D B;  3JYU A;  2WWZ A;  4HCP B;  2QHO A;  1TGZ B;  2V3S A;  4NPN A;  2EMS A;  2JT4 B;  3VQI A;  2IO0 B;  1C3T A;  2KWU B;  2NPT B;  3RD2 A;  5JZE B;  3PV1 A;  3ZNG C;  2HTH A;  2N4F A;  1ZKH A;  1R4M I;  2NBW B;  3M62 B;  3QCA A;  4WWP A;  4K7W A;  5CX3 A;  2LVO A;  4N9F 4;  1Z5S B;  1OGW A;  1C1Y B;  4B6W A;  3JVZ X;  2LXA A;  3VUX A;  1WM3 A;  3Q3F A;  1FXT B;  1TBE A;  4X57 B;  4RM9 A;  2IBI B;  2AYO B;  5DPW A;  2MLB A;  4NJ6 A;  3ZDM C;  3DPD A;  2R2Q A;  1OTR B;  2PEA A;  3VUW A;  2N9P C;  1SGH A;  3OAW A;  1WYW B;  3TL5 A;  3ZRF A;  1EO6 A;  4DXA B;  4HWI B;  2L76 A;  2DYB A;  3DOW A;  3L10 B;  2JY6 A;  4GGQ A;  4GMV A;  4W9L A;  1WR1 A;  4KIK B;  3X0W A;  3HK0 A;  4MGY E;  1M94 A;  2FAZ A;  2J0M A;  4KZ0 A;  1RRB A;  2KC1 A;  4HLE A;  4IWQ A;  2O2V B;  2K8C A;  4MM3 A;  3H7S A;  2JF5 A;  2KC2 A;  4GXB A;  2D2Q A;  2DHZ A;  4WJQ A;  3PVL A;  3PTF C;  1UEL A;  2N1W A;  3M95 A;  4FLH A;  4KVG B;  4NJ7 A;  4WJN A;  3I3T B;  1GUA B;  3C0R B;  1CMX B;  2LRW A;  2GBR A;  1S1Q B;  1WJ6 A;  2B3A A;  1EUV B;  4IM0 A;  2KFK A;  5CHW A;  2MBE A;  2N7E A;  2CHX A;  3A9J B;  4KDL B;  2CHZ A;  4BBN C;  2KX3 A;  3L0W B;  2MQJ A;  3N32 A;  2EMT A;  4II3 B;  1V2Y A;  1R4N I;  4EUT A;  1OEY A;  3ZUN A;  1T0Y A;  3W1Y A;  4FBJ B;  3PPA A;  5D94 A;  1P0R A;  2LVQ A;  3ML8 A;  3NS8 A;  3WAN A;  5E6O A;  3S2A A;  3IG3 A;  3CST A;  2IO2 B;  2BKF A;  2FUH B;  4F7Z A;  3B08 A;  4FJZ A;  3IFW B;  2C7H A;  2K25 A;  3VVW B;  3VAW A;  2CR5 A;  4PS7 A;  2D11 A;  4B95 A;  5L83 A;  3RUL A;  1WZ3 A;  4A3P A;  5FR6 A;  2MA9 B;  1Z2M A;  4JGH B;  3BIN A;  3NY5 A;  3TJP A;  2K6Q A;  1ZW7 A;  3H7P A;  3DBR I;  2N1V A;  3KVF B;  2D3G A;  2I1K A;  3L08 A;  3RCZ A;  4AJY B;  4NQL B;  2KLC A;  3UF8 A;  1KOT A;  4MGI E;  2O6V A;  2M4N A;  1NBF C;  1WZ0 A;  2CS4 A;  4NQK E;  5CHF A;  1RLF A;  4BOZ B;  4HDO A;  1E8Y A;  2OOB B;  2LRU A;  1E8W A;  3DVN U;  4WWN A;  1VCB A;  4K7U A;  3V6C B;  4NNJ B;  1GC7 A;  3NZU A;  1YD8 U;  3QA8 A;  2OJR A;  2BGF A;  1V6E A;  2KHW B;  4F8C B;  4I6L B;  3DDC B;  4KZC A;  2GBM A;  3KW5 B;  5D2M B;  4GN1 A;  3JW0 X;  1E90 A;  1WGR A;  4EOY A;  1WJ4 A;  3VUY A;  3V62 A;  3PLV A;  1G6J A;  1YJ1 A;  2KO3 A;  2LUE A;  4LDT D;  1LFD A;  2DYO A;  1E7U A;  3RT3 B;  2FCN A;  1WGY A;  3PZD A;  4E3C A;  3VTW A;  2ZJD A;  3RUI B;  2AL3 A;  4BFR A;  3V6E B;  4IG7 B;  4DDI D;  3A4R A;  2ZVO A;  2YVC A;  2JZ3 B;  4M8M A;  3A9K B;  4EZK A;  4ZRI A;  3GOE A;  2IY0 B;  2AEH A;  4B9K A;  1XQQ A;  3ECI A;  3AU5 A;  3ZRC A;  1WR6 E;  4CO7 A;  2DZM A;  4MGZ E;  3W1S C;  2BYF A;  2LGY A;  3QC8 B;  2G4D B;  1QZE A;  1BT0 A;  3DVG X;  4GDK A;  2A4Z A;  1WY8 A;  3CSF A;  3DVN V;  1WJU A;  2BF8 B;  3HIZ A;  1WJN A;  4IC7 B;  3N3K B;  2JPH A;  1GG3 A;  5DCN A;  1H8C A;  2KAN A;  4ICU A;  2MP2 B;  3HHM A;  4JLC A;  3PRZ A;  2EKE C;  3ZNI D;  4G0N B;  4AJW A;  3N30 A;  1D3Z A;  2CU1 A;  3BY4 B;  4HK2 A;  2MW5 A;  1E5W A;  3RYT A;  3WAO A;  5DPR A;  3JSV B;  1Y8R C;  3ZW3 A;  1E7V A;  2KKC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...