4NJ7A

Pb1 domain of atarf7 - semet derivative
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
77
Chain Sequence
b'YTAVQKRGSVGRSIDVNRYRGYDELRHDLARMFGIEGQLEDWKLVYVANAILLVGDDPWEEFVNCVQSIKILSSAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Auxin response factor 7
publication title Molecular basis for AUXIN RESPONSE FACTOR protein interaction and the control of auxin response repression.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 13
structure length 77
sequence length 84
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4nj7A00
2MWSB 2EMSA 2KWVB 3N3KB 4IUMB 4BKGA 5CHFA 2KMAA 4MJSA 3Q3JA 1K8RB 4HJKA 2HJ8A 2G4DB 3DOWA 4RM9A 4II2B 4HDOA 2ZJDA 2AEHA 3QK0A 1WXSA 3JSVB 5LXIB 2PJHA 2IZVB 3D32A 1WX8A 2NR2A 2M17A 2ZPNA 2LWPA 3DVNU 2MBHA 3L54A 2JXXA 1TTNA 4IWOA 4AOFA 5DPWA 2JPHA 1WXVA 3AU5A 3N30A 5FR6A 3B1LX 1WR6E 1Q1OA 2WX1A 3PTFC 1R4NI 4J6IA 4AJWA 5JH5C 3U8ZA 4B6WA 4PYUA 4M8MA 5C1ZA 2KKCA 1YD8U 3A9KB 2N9PC 3AULA 2KJRA 2MBBB 1JRUA 2BWES 1D3ZA 1Z5SB 1RRBA 2PE6B 2I1JA 3ZNZB 2LVQA 4K7WA 4ICVA 3L16A 3RD2A 4II3B 3ZLZA 2NVUI 3WIMA 4GDKB 1I42A 2ZNVC 1UELA 1Q0WB 3PRPB 3SD5A 4KVGB 4NY0A 2GBMA 4G50A 2WWZA 4MGKE 4DBGA 3HM6X 4EEWA 1UD7A 2Z0EB 3PHXB 4I6LB 2VRRB 2MCNB 1ZKHA 2REXA 4KSLC 4MGIE 2XK5A 4DHZB 5DPTA 4KDIC 1EF5A 2LJ5A 2PE9A 4OVVA 4FHJA 2GBNA 1WMHA 1WRDB 2B3AA 2YVCA 3KYDD 3O65B 4WWPA 4BOZB 4DHJD 1KOTA 4KSKC 3DVNV 4NPNA 4HPMB 1I35A 2MQJA 2MX2A 4DXAB 3ZDMC 5JZEB 1WJUA 3DBRI 2L05A 1YIWA 3L17A 4IM0A 2O6VB 2KLGA 1E90A 2LZ6A 2KVRA 1J0GA 4K7UA 2KMCA 4DK5A 4BVUC 2KFKA 4W9HA 4DHZE 2K8CA 2KDFB 5J2RA 1PQSA 2KO3A 3IVFA 2ZEQA 2MP2A 2AL3A 4KDLB 3ZUNA 4PS8A 3UQBA 1FXTB 2A4ZA 2JZZA 4HPLB 3OAWA 3VDZA 3KUCB 2KJHB 4HCNB 5D2MB 1NI2A 4ASWC 2JRHA 2C7MB 2NPTB 3OLMD 4TV3A 2LASA 3BY4B 5HKHA 4HXDA 2CHZA 2IYDB 3PRMB 3QX1A 3UGBB 2IO0B 4NQKE 3ECIA 4MJSB 3QCAA 2DYOA 4G0NB 5IA7A 4N9F4 1WIAA 2BWFA 3PGEA 2NCNA 2D10A 1E7UA 2KX0A 5JHBA 2K6QA 3ALBA 2KD0A 4FULA 3KUDB 1E8WA 2RSUA 1TBEA 1MG8A 3PS6A 2EMTA 2M4NA 3JW0X 4K81A 4B9KA 2IY0B 2KX3A 2LRUA 3APDA 3OJ3A 2KDIA 3KW5B 3VTWA 1WE6A 5DPRA 2DAFA 3I3TB 1KJTA 2K8HA 3QQ8B 2DX5B 3SHQA 2K8BA 4W9IA 5C23A 4AP4C 1GC6A 4FHKA 1P98A 1OQYA 3X0WA 3N32A 4A20A 1L2NA 3JYUA 4TUUA 1WF9A 5AZGA 4GN1A 4URKA 3BINA 2HTHA 2LVPA 3HK0A 1GG3A 2JF5A 1GJZA 2V3SA 4FJYA 2L3ZA 2HE7A 4CYEA 1UZXB 1M94A 3ZNGC 4AUQC 2J0KA 2DZMA 2N7DA 4WJNA 2C60A 3PREA 2CHWA 1S1QB 2LGDA 2JRIB 4LDTD 1WGDA 2C9WB 1SE9A 4B95A 3PPAA 3T8MA 2FCNA 2DZKA 2D2QA 3QJZA 4LJOB 1TGZB 4XX5A 1WZ0A 4OVUA 2EKEC 2LGYA 1EUVB 4GDLA 2BF8B 1C1YB 5GMVA 1E5WA 2KLCA 2XK5B 1V9JA 4GU2A 2LVOA 5E6PA 2KQSA 3IFWB 2W9NA 1WMHB 2RGFA 2FUHB 3VUXA 4W9CA 3P2BA 3H9DA 2MLBA 4MH0E 2ZVNA 1CMXB 4PS7A 2LRWA 3PSEB 4EFOA 3U30A 2UWQA 1WX9A 5EDSA 4HLEA 4W9EA 2KZRA 4W9GA 3ZTCA 2N4FA 3AU4A 2MRPA 3ML8A 1YQBA 5G2NA 2KFKB 3RCZA 3VFKA 1WGGA 2L0FA 1P0RA 2BYFA 4LDTB 5IAAC 1H4RA 4F8CB 1IP9A 2MP2B 5CTRC 3AI5A 2NBUA 4JGHB 3UIPB 4BKSA 1WY8A 3QWZB 1OGWA 4DDID 1WJ6A 2O6VD 3UIOB 2KTRA 5AEKB 1G6JA 4JQWC 3KYCD 4KIKA 2MW5A 1X1MA 3H1UA 4WQOB 4MSQB 1WX7A 2ZZPB 3PZDA 4ZYNA 4EOYA 3DVGX 2KC2A 3M63B 3IG3A 1GUAB 2JY6A 5D6JB 3C0RB 4A3OA 4EZLA 1V6EA 1NBFC 3ZNHB 3M95A 3QIJA 2Z0DB 4NJ6A 1VD2A 4BBNF 2NS5A 4AWJA 1ZW7A 4XZ4A 3QAQA 4IWQA 4ZRKA 1GC7A 1V49A 3A33B 2DZJA 3H6NA 4NAWA 3A1QA 3DBLI 1A5RA 3DQVA 2CU1A 5LXHA 4WJPA 3LDZE 3WALA 1IYFA 1AARA 3ZTDA 2ZCBA 3RT3B 2XEWA 3DBSA 3PLVA 2HD5B 2KK8A 2NBWB 3UQAA 3L0WB 3RZFA 4AJYB 3VQIA 4GGQA 4W9KA 4WJQA 4NNJB 1EO6A 4A3PA 3ZNID 2KWCA 2K6DB 2L7RA 1OTRB 4W9DA 2GOWA 1KM7A 2AYOB 3PVLA 5E6NA 3K9OB 4KV2A 4WWNA 1WGHA 1R4MI 3K9PB 4IM3A 2D07B 5KHOA 4DWFA 2JT4B 2FCSA 4FJZA 2BKRB 3M62B 4FN2A 4GOCA 4JIOU 4ZRIA 2KDEB 2QHOA 4ZRJA 4ICUA 1V86A 4ANVA 3ZW3A 4M8NA 3DBHI 4XC2A 1L7YA 1LM8B 2MSED 3AXCA 3H7PA 3TJPA 3VH3B 3VH4B 4GDLB 2N9XA 3GOEA 3VVWB 2ZVOA 4HWIB 3MTNB 4GB9A 4EZKA 4RMAA 2KANA 2ZPYA 4E3CA 3APCA 3PRZA 3TMPB 1WJ4A 2RR9A 1P3QU 2V1YA 2GBJA 3VUYA 2G3QB 2L8JA 1QZEA 3CSTA 1TZ1A 2MBEA 3V60A 2J0MA 2CHXA 2XBBC 2J0JA 3PLUA 3W1YA 3TBLD 2ZNVB 1P9DU 2L76A 2IY1B 2PEAA 2R2OA 4W9JA 1ZGUB 1OEYA 3DDCB 3EC8A 3L13A 4W9FA 3ONSA 3EHVA 1IPGA 1SIFA 2CS4A 3UINB 5L95C 1ISNA 4FJVB 1WE7A 2LUEA 1T0YA 1EF1A 2I1KA 2FCQA 2L00B 2KTRB 4MGYE 1RFAA 3A9JB 4KIKB 3M3JA 5CHVC 4E71A 1Q5WB 1KLVA 3VHTC 2L0TA 2KJ6A 3OJ4B 5D7GA 2N1VA 5CX3A 1C3TA 1BT0A 2M0XA 4G3XB 1UBQA 2D3GA 4KZ0A 3HHMA 3WAOA 2DYBA 3QC8B 4HDQA 1WXAA 2KXJA 3RUIB 1VCBA 1WJNA 4IWPA 3ZIMA 2M1MA 5AZHA 1WZ3A 2BKFA 3ENEA 4F1SA 4NQLB 4E74A 3MHSD 3PT2B 2OJRA 3RYTA 2WDTB 2GBKA 4NAWB 3SU8X 4TQ0A 1WYWB 2BPSA 3A1QB 2Y5BB 3B0AA 1HE8A 2DHZA 2FCMA 2JUOA 3NZUA 4MEMA 3QA8A 1YX5B 4PS3A 2LD9A 2ZCCA 5AZFA 4TKNA 2C7NB 4GMVA 4HVBA 1V81A 3W1SC 1YJ1A 2IO2B 2NBVB 2ASQA 4W9LA 1SGHA 4FBJB 2A5UA 1LFDA 2Z59B 4MDKE 3WANA 4BBNC 1S3SG 1RLFA 3NHEB 1XT9B 2MA9B 3IHPC 3VTUA 4ANXA 2KWUB 2JWZA 3KUZA 3PHWB 4I6PA 2WYQA 2FAZA 2GMIC 1UBIA 3WA0A 4FA6A 3A9JA 2M8SA 4I6NB 2RD0A 4LJPB 3H7PB 4M0WB 1LQBA 1OEYJ 3WAMA 3L10B 4WJOA 2AWTA 4EUTA 4EZJA 2UYZB 1P1AA 3L08A 5LLIA 3R7RA 3V6EB 2DZIA 2N7EA 1V2YA 4FADA 2JZ3B 4JLCA 4RM8A 4MELA 4FLHA 4MM3A 3U7DA 1Z2MA 2LGXA 5DPSA 3ZRCA 2J7QB 1E8ZA 3ZDTA 3V6CB 3DCGA 3VUWA 4BFRA 2O2VA 3V62A 2K25A 2LI5A 3CMMB 5G55A 2BYVE 3CSFA 3Q3FA 1V5TA 2BGFA 1E8YA 4IC7B 1WM2A 3DPDA 3TL5A 2FNJB 2FIFA 2V4LA 3NS8A 1H8CA 3B08A 3EECA 3RZWC 4ZDVA 3R7QA 3HIZA 4K1RB 5KHQA 2DYMA 2GBRA 4ANWA 4DDGD 3JSVA 2KHWB 2RPQA 4NJ7A 5L83A 2MBOA 2R2QA 1RAXA 3H7SA 3QHTA 3TIXA 2LXCA 4LCDE 4BKSD 3RULA 3UF8A 2G45B 2KFJA 2K1FA 2CKHB 1WH3A 1E8XA 1U4AA 1V5OA 2C7HA 1NDDA 2IO1B 3R3MA 3DVGY 3T9LA 3MJWA 4P7IA 1WGRA 4IW0A 1V80A 2DAJA 3A4SC 4HK2A 1F9JA 2N1WA 5J18A 2KOXA 3A9KA 3A4RA 5TR5A 4MGZE 5D94A 3KVFB 1E7VA 4BOSC 5DCNA 2D11A 3EFUA 2KN5A 3ZKJC 3SDLC 2CR5A 3VXWA 1UGMA 3NY5A 4ANUA 4GDKA 4KZCA 4DHJB 4GSWA 4K7SA 4WWOA 5CHWA 2BYEA 3VTVA 3R66C 4IG7B 1YX6B 1WI0A 1J19A 2YLMA 3LJ3A 5JHAA 1J8CA 4YL8A 2AL6A 4G11A 2KTFA 3NZSA 2G4SA 2K39A 4WAAA 3PV1A 3QARA 5BO4B 4MSMB 2KDBA 3APFA 2KNBA 2WX0A 3WAPA 3S2AA 1UH6A 3ML9A 1Y8RC 2C5LC 3ZRFA 3CF6E 2FIDA 5E6OA 3W1SA 4CHKA 4F7ZA 3X23A 2JVCA 2LXAA 3JVZX 4PYZA 2O6VA 3IBEA 2IO3B 1WM3A 1XQQA 3HM3A 1WXMA 1WR1A 2KC1A 2KQ7A 3NOBA 1XD3B 3TCAA 4HCPB 4CO7A 3KH0A 4BKTA 3VAWA 2DENB 4EKUA 2MBQA 1GNUA 4TQ1A 4X57B 3GZNI 3ZVVA 3ZO5B 4IM2A 1WFYA 4GIVA 3V61A 4JL9A 2O2VB 5J17A 2OOBB 1LXDA 2N9EB 2NPTA 2IBIB 4GXBA 1WGYA 2PPHA
chains in the Genus database with same CATH superfamily
4B0MA 2MWSB 3RMKC 1Q10A 3FC4A 3NVVA 1T5XD 4S0RA 1FXIA 3QK0A 3JSVB 1FM0D 4FXCA 3DVNU 2Z8LA 3AH7A 2IGHA 2JXXA 2FE8A 4IWOA 3DBRB 2WX1A 2AQ1B 2H89B 5JH5C 4D2KA 2JZPA 1JRUA 1TT5B 1D3ZA 1Z5SB 3SFEB 2ON8A 3AE8B 2WXGA 4GDKB 2MJ3A 1Q0WB 3PRPB 1RFKA 4JPSA 3GE3C 1WGKA 4EEWA 1V97A 3PHXB 4ACFA 1MHXA 2Y5PA 1TS4A 5HFYA 5DPTA 3DHGC 2GBNA 1WMHA 3KYDD 2KQ4X 3Q8EA 1I4GA 3DBRI 4UDUC 1JRPA 2KLGA 4K7UA 1SE4A 2KFKA 2M0AA 1XLPA 1ROEA 1SE3A 1PQSA 3FKYA 2MP2A 1C77A 2JZZA 3KUCB 2GI9A 4HXDA 2IYDB 4MJSB 3R2IA 1WIAA 2BWFA 4YXDB 2D10A 2KX0A 2VH1A 3KUDB 3PS6A 3OJ3A 3APDA 3I3TB 2K8HA 2DX5B 1TJEA 4W9IA 4AP4C 3X0WA 3I9V1 4TUUA 4URKA 4GN1A 3BINA 2LVPA 1GG3A 2V3SA 4FJYA 4CYEA 1UZXB 3DHHC 2J0KA 2MEKA 2DZMA 2EELA 2N7DA 2E3TA 1S1QB 3HVDA 4B95A 3T8MA 2DZKA 5D3DA 2DBYA 2EKEC 2JWUA 2LGYA 5E6PA 3IFWB 4A6QA 1FRDA 2NTSA 5BMIA 1CMXB 1WX9A 3N1ZC 5EDSA 1C4AA 2KZRA 1XCQL 4W9GA 2N4FA 3ML8A 5G2NA 2KMMA 2BYFA 1IP9A 5CTRC 1WY8A 4N58A 2BS4B 2PIAA 2O6VD 3UIOB 1XCTL 4KIKA 2MW5A 1EM7A 4C80A 4XE0A 2ZZPB 3PZDA 3DVGX 3DBHB 1V6EA 1CJEA 1E9MA 3Q2AC 2MJEA 2Z0DB 1GB4A 3LXFA 1ZW7A 4XZ4A 4IWQA 1V49A 2DZJA 3H6NA 4NAWA 1A5RA 4WJPA 4IKGA 2WXKA 1C9FA 1SF0A 3HUIA 3DBSA 2HD5B 2KK8A 4TMAB 3UQAA 3RZFA 5EE0A 2L7RA 1KM7A 2OHFA 1TKEA 1YJJA 3I57A 4WWNA 4KV2A 3K9PB 5KHOA 2LHEA 4FJZA 2L52A 4RF1A 4ZRIA 2KDEB 2QHOA 3AB5A 3PZ8A 4ICUA 3ZW3A 4M8NA 3DBHI 4XC2A 3TJPA 3VH4B 2JYTA 4GDLB 4HWIB 4GB9A 4LLGM 4EZKA 4E3CA 1L4DB 1WJ4A 2L8JA 1QZEA 3H8HA 3RNBC 3BWUD 2WXMA 1FNUA 3RNAC 3I5JC 4KKJA 4W9JA 1QOGA 1WSPA 3IAS1 2R61A 2WXRA 1SIFA 2QIEB 3TEYA 1D5XC 1WE7A 4MGYE 3Q8FA 1Y56A 1PGXA 2LGIA 5BYSA 5CX3A 4KGSA 1CK1A 5H8YE 1T0RC 4KZ0A 1OQRA 4HDQA 3RUIB 1VCBA 5AZHA 3PT2B 1QQRA 3W5VB 4P6VF 4A8XC 3RI7C 2WDTB 2GBKA 1FNWA 1XEEA 4TQ0A 2BPSA 3A1QB 1IBXA 1QF6A 3DBLB 3NZUA 4MEMA 4USAA 4KKIA 4HVBA 1F1HA 1V81A 4W9LA 1TS3A 1SGHA 2A5UA 3B9JA 4RGMA 5IN7A 3AMZA 4ANXA 3KUZA 1C78A 2N9KA 2FAZA 2XN9C 3H7PB 1LQBA 1OEYJ 4WJOA 1J7BA 3R7RA 2N7EA 2WXHA 4MM3A 2LGXA 5DPSA 2PVOD 3ZJVA 1VZ8A 2J7QB 3NZ3A 1FNVA 2CJNA 3V62A 2LI5A 2JX5A 1V5TA 2TSSA 2I38A 4IC7B 4HKZE 3DHIC 3NS8A 3EECA 3RNGC 3WCQA 4ANWA 4DDGD 5L83A 2MBOA 3H7SA 2INNE 2LXCA 4L2YA 2G45B 2KFJA 1TY2A 1E8XA 1NDDA 1XF5L 1JWBD 3AM9A 4O1NA 3T9LA 1HZ6A 2DAJA 3A4SC 1F9JA 3P4SB 2W3RA 3N9YC 5TR5A 4MGZE 1MPEA 2KN5A 2ZW1A 1FCLA 2L1AA 2CR5A 3VXWA 4ANUA 2DWQA 4OZBA 3AE4B 4IG7B 1E7PB 1YX6B 1J19A 4WAFA 3NZSA 2G4SA 5BO4B 3T3NA 3APFA 2B76B 2OEDA 4OW0A 1UH6A 2C5LC 3OG5A 4F7ZA 3ZJTA 2LXAA 3IBEA 1WM3A 1GAQB 3TCAA 3N20C 4BKTA 2DENB 4EE2A 3GZNI 1N60A 2N9EB 1FFUA 2KACA 2PPHA 2EMSA 3N3KB 4BKGA 4DXGA 3Q3JA 5MPOA 4HJKA 4RM9A 4HDOA 2ZJDA 2AEHA 1E10A 1WX8A 2G1EA 2LWPA 1TTNA 4AOFA 5DPWA 1QT9A 1Q1OA 4RGNA 1OFFA 3U52E 1I4XA 4AJWA 4B6WA 3A9KB 2MBBB 1RRBA 1TZOA 4K7WA 5TSSA 3SD5A 4G50A 3Q8AA 4LNIA 4LNOA 4MGKE 4P1CC 4RF0A 4I6LB 2VRRB 2WXFA 1TS5A 2MCNB 3Q69A 2REXA 4DHZB 1YJIA 2XK5A 4KDIC 4ZYSA 1YQ4B 4OVVA 4DHJD 1KOTA 4KSKC 3DVNV 1KTKA 4HPMB 1JWMD 2MX2A 4DXAB 3ZYYX 1WJUA 4IM0A 2O6VB 3ZGZA 1E90A 2AQ3B 2LMCA 3O13A 4B0EA 4OVZA 4W9HA 1JWAD 1VLBA 1KH0A 2KDFB 5J2RA 2KAJA 3IVFA 3EUB2 2ZEQA 1V1PB 1FXTB 1NYQA 4XDDA 2KJHB 5D2MB 2JRHA 2C7MB 2LASA 3PRMB 3NG0A 2DYOA 2BS3B 4N9F4 1QKZA 3PGEA 1ACCA 5JHBA 2JXTA 3ALBA 2KD0A 4IOIE 1N61A 1ZUD2 1HA5A 1TKYA 4XDCA 3JW0X 2LRUA 3FILA 1V1OA 1WE6A 1KJTA 4LNNA 3P4QB 4ARCA 2ICIA 1HTOA 2SEBD 2YEPF 1YQ3B 1WF9A 1JALA 2HTHA 1GJZA 4US9A 2HE7A 4AUQC 1ZE3D 3TEXA 4WJNA 5I4DA 2WU5B 1UGJA 2GLSA 2LGDA 2JRIB 3SFDB 4MACA 2C9WB 1SE9A 4LJOB 1WZ0A 4OVUA 1C1YB 4KGTA 1E5WA 2VZKD 1V9JA 2W9NA 3P2BA 2KT7A 3UI3A 2NTTA 4NJCA 5HG2A 2MLBA 4MH0E 4M01A 1E0ZA 4W9EA 3MHZA 3AU4A 3GE8C 1ZXIA 4HKQA 1K53A 2L0FA 1NENB 4LDTB 1WXQA 3AI5A 3GB1A 1OGWA 4DDID 1WJ6A 4WURA 1GB1A 1R4MB 2KTRA 1G6JA 4WQOB 4MSQB 4ZYNA 2KC2A 5HI1A 5D6JB 3NUHB 2BQQA 1JWUD 1NEKB 2Y3AA 4EZLA 1NBFC 5H92C 2NS5A 1NI3A 3VR9B 4ZRKA 3A33B 5FR3A 3EGRA 2CU1A 4JWSC 3LDZE 3WALA 3IXSA 3BVZA 3B2FA 5FK9C 4BAXA 5FKAC 1FCCC 3VQIA 1IUEA 4GGQA 4A3PA 2KWCA 2K6DB 2WLBA 1OTRB 3PVLA 5E6NA 2EKIA 1MFWA 2MH7A 2CU3A 1R4MI 4IM3A 2D07B 4DWFA 2JT4B 2RDBC 1L0YB 1V86A 2WHIA 1WRIA 2WXOA 2W55A 3GOEA 3MC8A 2K0PA 3MTNB 2KANA 1P7FA 2ZPYA 1YN4A 3APCA 3PRZA 2RR9A 3SEBA 2GBJA 2G3QB 2MBEA 1SJED 2CHXA 2K22A 2XBBC 2ONQA 1ET9A 3W1YA 2WNMA 2L76A 3DDCB 1OEYA 5C2TB 4C56C 5AUIA 2KVZA 2CS4A 3UINB 2LUEA 2WDVB 1T0YA 1EF1A 2L00B 1K51A 3U4EG 4M00A 3C8YA 2KJ6A 5D7GA 1C4PA 1ESFA 1C3TA 4G3XB 4LNFA 3QC8B 2KXJA 3ZIMA 1WJNA 3HVZA 2BKFA 1I4RA 1WYWB 3AEFB 3BZDB 2DHZA 2JUOA 3LYYA 1YX5B 3W1SC 1YJ1A 2IO2B 2ASQA 5LNK1 1LFDA 2Z59B 4MDKE 3IHPC 2MA9B 1TKGA 2RDHA 2JWZA 3PHWB 3AEDB 2K3UA 2GMIC 1UBIA 3WA0A 4RCOA 4M0WB 2RD0A 2D3AA 1SB3C 2I2YA 1A70A 2UU7A 3EFCA 3L08A 5LLIA 3V6EB 2DZIA 1V2YA 4MELA 3U7DA 3URYA 3E9SA 1KLUD 3DCGA 3VUWA 4BFRA 2O2VA 5G55A 1F77A 2BGFA 1WM2A 3DPDA 3TL5A 2FIFA 4ZOHC 2BB6A 2CJOA 2N9LA 3P4RB 1SIJA 4K1RB 2GBRA 3JSVA 2R2QA 1RAXA 3QHTA 4ITKA 2K1FA 4YTMB 1V5OA 3DVGY 3MJWA 4P7IA 4A9AA 4RNAA 4HK2A 1FRRA 2N1WA 1SSNA 5J18A 1PGBA 1QOBA 1HTQA 2WGSA 4WH4A 5DCNA 3ZKJC 4YWGG 3SDLC 4GDKA 1GPXA 4N6EB 4KZCA 4DHJB 1RWSA 4WWOA 3VTVA 1EWCA 1WI0A 5JHAA 3LJ3A 5T8IA 4G11A 3AE1B 1UUPA 3PV1A 3AE6B 1TYGB 3ML9A 1Y8RC 2FIDA 3C19A 4RGTA 1R4NB 2PTLA 2IO3B 1XQQA 1WXMA 1WR1A 2KQ7A 3NOBA 1T3QA 2PMVA 3KH0A 3EA6A 1GNUA 4X57B 3ZO5B 4C7YA 3DWMA 5J17A 1LXDA 4GXBA 1JMLA 2KWVB 4XWWA 4LK0M 5CHFA 2YEPB 4MJSA 2G4DB 3J9CA 2WDRB 4II2B 2NMQA 3Q8CA 2V9HA 1IGDA 2IZVB 2V3PA 2ZPNA 4WQMA 2WXIA 1ENFA 2QEJC 2MBHA 4OHJA 3L54A 2JPHA 1WXVA 3AU5A 5FR6A 1WR6E 1YNTE 3VRBB 3PTFC 1D5ZC 2N7JA 1R4NI 4J6IA 3U8ZA 2W82A 3P1MA 4M8MA 4K3CA 1QILA 3AULA 2BWES 4YTPB 2PE6B 3BK1A 3ZNZB 4C4VA 3L16A 4II3B 1UELA 4KVGB 2QSDA 2WWZA 1PGAA 2WS3B 4DBGA 1UD7A 2Z0EB 3BVGA 2WQYB 3GS2A 1EF5A 1VR9A 1WRDB 2B3AA 2YVCA 1I35A 1MJDA 1TS2A 2MQJA 3ZDMC 2LZ6A 2KVRA 1J0GA 3L4PA 4DHZE 1HEZE 2K8CA 4PS8A 3UQBA 3RNEC 3IT4B 4HPLB 5BMHA 3VDZA 3KWVA 4ASWC 4HCNB 3GZNB 1NI2A 3OLMD 2NPTB 2WXNA 3V3XA 4LNKA 4DQOC 3QX1A 3UGBB 5G5HA 3ZXRA 5D3IB 3SR6A 4AQ7A 2NCNA 5EE9A 1E7UA 1KRHA 3FAHA 2K6QA 1VZ7A 1E8WA 2LUMA 1TBEA 4M02A 4HRSA 2M4NA 4B9KA 4YSZB 2IY0B 5DPRA 3W5UB 2K8BA 1GC6A 4QAYA 4FHKA 1ZPSA 2X38A 1OQYA 3NVWA 2INDC 1ZOYB 1L2NA 1E6EB 3JYUA 4US8A 5AZGA 1D5MC 3HK0A 2JF5A 2L3ZA 1M94A 2V3NA 4JWUC 3PREA 5BYQA 1WGDA 1JCKB 3PPAA 1NYRA 4XX5A 2N0SB 4GDLA 1EUVB 4WWMA 5GMVA 4Q2JA 2KLCA 4GU2A 1WMHB 3DWGC 2RDGA 1MG4A 2ZVNA 1L0XB 2LRWA 2RPVA 4EFOA 2UWQA 2KWDA 3BVMA 3ZTCA 2KFKB 3RCZA 2JU6X 1WGGA 2FBWB 1ZP0B 2MP2B 2NBUA 4JGHB 3UIPB 4BKSA 1DOXA 3QWZB 2ZW0A 4NAMA 5IKCM 4N59A 1K52A 1WX7A 4EOYA 2M56B 4HROA 3M63B 2Q5WD 3IG3A 1GUAB 2JY6A 4A3OA 3KLSX 5G5GA 1VZ6A 3W9CB 3ZNHB 3M95A 3NVYA 3QIJA 5IOIA 1B9RA 1YMHE 4NJ6A 4BBNF 3ABVB 2JQRB 1AW7A 3QAQA 1GC7A 3A1QA 5LXHA 2QC8A 4IDIA 1IYFA 3ZTDA 2ZCBA 2WDQB 3PO0A 3RT3B 1HQRD 4AJYB 4W9KA 4WJQA 4J3OD 3ZNID 4W9DA 2GOWA 3I63C 2AYOB 1PYWD 1XLQA 2FCSA 5HHDG 2KYWA 3M62B 2WP9B 4JIOU 4ZRJA 2HTME 3AXCA 3GP7A 3H7PA 3VH3B 3VVWB 2IPKD 2N9XA 4XGAB 1QLBB 5E6JA 3NVZA 1CZPA 3TMPB 1TIFA 1P3QU 2QJLA 3VUYA 4C7ZA 3CSTA 2J0MA 2J0JA 3R2TA 3PLUA 3TBLD 1P9DU 4XWTA 2R2OA 1SXTA 2GRIA 1ZGUB 4W9FA 3ONSA 1STEA 2LFIA 1L6UA 4ZHPA 2V4IB 5L95C 3MP9A 3AEBB 2FCQA 1RFAA 4KIKB 5CHVC 4E71A 1Q5WB 1KLVA 2QMTA 3VHTC 1WWTA 2L0TA 4RH6A 3OJ4B 2N1VA 2J53A 1BT0A 1UBQA 1N5WA 3HHMA 2DYBA 4HJGE 4IWPA 1RM6C 2M1MA 1WZ3A 3ENEA 5EE3A 4E74A 3MHSD 2PW9A 2OJRA 3AE3B 3RYTA 3Q3NC 4NAWB 2E6XA 3B0AA 2INCC 3TSSA 1HE8A 3KQ4A 2FCMA 3QA8A 4K3BA 2LD9A 4TKNA 1N63A 1FMAD 1M4VA 4BBNC 1S3SG 1R7SA 1RLFA 1D6EC 2VH2A 2KWUB 4I6PA 3A9JA 4I6NB 1J7CA 2AWTA 4EUTA 4EZJA 1BXTA 4S17A 4FADA 2JZ3B 4RM8A 4FLHA 3ZDTA 3V6CB 4DXFA 3CMMB 3Q3FA 3CSFA 2FNJB 1JW9D 2INPE 2KDMA 3RZWC 3ZJUA 4ZRQA 4ZDVA 4XYCA 2KHWB 4NJ7A 2PKOA 4AS1A 4H2AA 4BZAA 3UF8A 2MHJA 3Q6BA 1WH3A 2C7HA 3R3MA 4A55A 1WGRA 4IW0A 1V80A 2KOXA 3A9KA 3RN9C 1IBXB 2MJDA 1I4PA 5D94A 1XXGA 3EFUA 1AWDA 3MC9A 2WXLA 3NY5A 1MVKA 1VDVA 1JWSD 1LGRA 4GSWA 3VRAB 4K7SA 4RFBA 4MT5A 2BYEA 3RNFC 4OZCA 1PDXA 2J4XA 2YLMA 4YL8A 2AL6A 1FFVA 4HEA1 2BS2B 2KNBA 1T6BX 2W3SA 3S2AA 3ZRFA 5E6OA 3X23A 1B1ZA 4PYZA 3JVZX 2Y5CA 2O6VA 1TY0A 3HM3A 4PT5A 4MM3B 4HCPB 3AECB 4C4VB 1UWMA 3BIID 4EKUA 3ZVVA 1V1PA 4IM2A 1WFYA 4GIVA 3V61A 4JL9A 2WXQA 1YOVB 1SJHD 2IBIB 1WGYA 4OZAA 4IUMB 2KMAA 1K8RB 2JYEA 2HJ8A 3DOWA 2WXPA 1WXSA 5LXIB 2PJHA 2AX5A 3D32A 2NR2A 2M17A 1MHHE 3NJTA 1QOAA 1UWXA 2K9XA 3N30A 3B1LX 2LHDA 1L4ZB 1DOYA 4PYUA 5C1ZA 3VR8B 2KKCA 1KFYB 1YD8U 2N9PC 2KJRA 1KLGD 2I1JA 3IT6B 2LVQA 2G9HD 1JROA 4ICVA 1YN5A 3RD2A 2IJ0A 3ZLZA 2NVUI 3WIMA 1I42A 2ZNVC 4NY0A 4ARIA 2GBMA 3HM6X 1FPYA 3CIRB 3IAM1 1SEBD 1ZKHA 4ZRPA 4KSLC 4MGIE 1FO4A 1F2RC 2LJ5A 2PE9A 4FHJA 3O65B 4WWPA 4BOZB 4L1BA 1EU4A 3Q3OC 2KN4A 3Q3MC 4NPNA 5JZEB 1WYGA 2L05A 1YIWA 3L17A 2BYTA 2KMCA 4DK5A 4BVUC 4WIPA 1XLNA 2LEKA 2KO3A 5IO9A 3ZUNA 1ZXHA 2AL3A 4KDLB 2A4ZA 1T0SC 4TSSA 5C3JB 1C76A 3OAWA 2BVCA 4TV3A 5HKHA 3BY4B 3AEGB 2CHZA 2IO0B 4NQKE 3ECIA 3QCAA 4YT0B 4G0NB 5IA7A 2IGDA 1SE2A 4PK1A 4FULA 1ET6A 2RSUA 1MG8A 2EMTA 3Q8BA 4K81A 2KX3A 1ZDXA 2KDIA 2PLPA 3KW5B 3VTWA 2DAFA 1FIQA 3PZ7A 4JE3B 3QQ8B 3SHQA 5C23A 5AUKA 1P98A 3N32A 4A20A 4GLSC 3AV8A 3ZNGC 1J7AA 2L32A 2C60A 2CHWA 3ETRA 4LDTD 2FCNA 2RMMA 2D2QA 3QJZA 1TGZB 2HDEA 2BF8B 1JQ4A 3RNCC 1PFDA 2XK5B 2LVOA 2KQSA 1UF0A 2RGFA 1CQVA 2FUHB 3VUXA 4W9CA 1DYQA 3H9DA 3CWIA 1EU3A 4PS7A 4A90A 3PSEB 1AYFA 3U30A 2V0GA 4HLEA 2MRPA 1YQBA 2W54A 3VFKA 4ZHOA 1P0RA 1N6ZA 5IAAC 1H4RA 4F8CB 1V8CA 4YTNB 3OWEB 5AEKB 4JQWC 3BK2A 3KYCD 2BBCA 1SBBB 1X1MA 2VZKB 3AE2B 3H1UA 3C0RB 3Q14C 2WU2B 3P63A 1UNSA 1VD2A 1N62A 3NRZA 4AWJA 1KF6B 1F0ZA 2BW2A 3FILB 3ZXVA 1I4HA 2M19A 3DBLI 1I7HA 3W2DA 3DQVA 1YN3A 3AE9B 2J52A 5BYRA 1AARA 2XEWA 3PLVA 2D3BA 2NBWB 3L0WB 4NNJB 1EO6A 3RPFC 1C79A 3K9OB 1WGHA 2LJIA 2BKRB 4REZA 4FN2A 4GOCA 1QOFA 1D4BA 4ANVA 1C4CA 1L7YA 1LM8B 2MSED 4M0WA 2ZVOA 1VRAB 4RMAA 2XNAC 1HXYD 2V1YA 1TZ1A 1GOZA 3V60A 4YSXB 2DNFA 1F52A 2ZNVB 1BMLC 2IY1B 1L5PA 1L0VB 2PEAA 3EC8A 3L13A 3V05A 3EHVA 1IPGA 1FEHA 1ISNA 2HJ1A 1ZDVA 4FJVB 2I1KA 2KTRB 2X8XX 3A9JB 3M3JA 3AE7B 5BMGA 3NS1A 2QCZA 2M0XA 2D3GA 3HRDD 3R8BA 3WAOA 1NVID 1MI0A 2BTEA 1WXAA 1K50A 4F1SA 4NQLB 5EE1A 5GXGB 3AN1A 3SU8X 3N1YC 2IDYA 2J42A 2D3CA 2Y5BB 4PS3A 2ZCCA 5AZFA 2C7NB 4GMVA 2NBVB 4FBJB 3N1XC 3WANA 1F2RI 4KX6B 3NHEB 1XT9B 4MH8A 1L6VA 3VTUA 3LB8C 3MC0B 2FUG1 3P4PB 2WYQA 3MFGA 4FA6A 2M8SA 1VJKA 3BYTB 4LJPB 3ZQ4A 1DGJA 3WAMA 3L10B 1XLOA 1EWYC 2LGSA 4NZLB 2UYZB 2WXJA 1P1AA 2JSVX 1FD6A 2GB1A 1N5XA 1IGCA 3BYYB 4JLCA 2D5GA 1Z2MA 3AEEB 1P7EA 3ZRCA 4JX1C 1E8ZA 1LO5D 4KGRA 1I4QA 2K25A 2BYVE 5IP4D 4P1BC 1E8YA 1T0QC 2V4LA 1H8CA 3B08A 2SAKA 3R7QA 3HIZA 5KHQA 2DYMA 3RFZB 2RPQA 3TIXA 4LCDE 4BKSD 3KWLA 3RULA 2CKHB 1U4AA 2IO1B 1HZ5A 1FXAA 3P42A 3A4RA 3B2GA 3KVFB 1DOIA 1E7VA 3MJ5A 4BOSC 2D11A 1UGMA 1OQQA 4CQNA 2H88B 5JXVA 2QDFA 2QILA 5CHWA 2L83A 3R66C 1J8CA 4L23A 2OJWA 2KTFA 2K39A 3AE5B 2K5PA 4P16A 4WAAA 1PUTA 3QARA 4MSMB 2KDBA 3T3OA 2WX0A 3WAPA 3TEWA 3TUOA 2IGGA 3E56A 4C00A 3CF6E 3W1SA 4HPPA 4CHKA 3U7ZA 2JVCA 3AEAB 1XO3A 1RYJA 2DLBA 2KC1A 1AN8A 1XD3B 2PVGC 4CO7A 3VAWA 2AQ2B 2MBQA 4YSYB 2BB5A 4TQ1A 4LTUA 4RGOS 2BT6A 2O2VB 1BUIC 4R3DA 3U2SC 2OOBB 3TEZA 2NPTA 2ACZB
chains in the Genus database with same CATH topology
2MWSB 2EMSA 2KWVB 3N3KB 4IUMB 4BKGA 5CHFA 2KMAA 4MJSA 3Q3JA 1K8RB 4HJKA 2HJ8A 2G4DB 3DOWA 4RM9A 4II2B 4HDOA 2ZJDA 2AEHA 3QK0A 1WXSA 3JSVB 5LXIB 2PJHA 2IZVB 3D32A 1WX8A 2NR2A 2M17A 2ZPNA 2LWPA 3DVNU 2MBHA 3L54A 2JXXA 1TTNA 4IWOA 4AOFA 5DPWA 2JPHA 1WXVA 3AU5A 3N30A 5FR6A 3B1LX 1WR6E 1Q1OA 2WX1A 3PTFC 1R4NI 4J6IA 4AJWA 5JH5C 3U8ZA 4B6WA 4PYUA 4M8MA 5C1ZA 2KKCA 1YD8U 3A9KB 2N9PC 3AULA 2KJRA 2MBBB 1JRUA 2BWES 1D3ZA 1Z5SB 1RRBA 2PE6B 2I1JA 3ZNZB 2LVQA 4K7WA 4ICVA 3L16A 3RD2A 4II3B 3ZLZA 2NVUI 3WIMA 4GDKB 1I42A 2ZNVC 1UELA 1Q0WB 3PRPB 3SD5A 4KVGB 4NY0A 2GBMA 4G50A 2WWZA 4MGKE 4DBGA 3HM6X 4EEWA 1UD7A 2Z0EB 3PHXB 4I6LB 2VRRB 2MCNB 1ZKHA 2REXA 4KSLC 4MGIE 2XK5A 4DHZB 5DPTA 4KDIC 1EF5A 2LJ5A 2PE9A 4OVVA 4FHJA 2GBNA 1WMHA 1WRDB 2B3AA 2YVCA 3KYDD 3O65B 4WWPA 4BOZB 4DHJD 1KOTA 4KSKC 3DVNV 4NPNA 4HPMB 1I35A 2MQJA 2MX2A 4DXAB 3ZDMC 5JZEB 1WJUA 3DBRI 2L05A 1YIWA 3L17A 4IM0A 2O6VB 2KLGA 1E90A 2LZ6A 2KVRA 1J0GA 4K7UA 2KMCA 4DK5A 4BVUC 2KFKA 4W9HA 4DHZE 2K8CA 2KDFB 5J2RA 1PQSA 2KO3A 3IVFA 2ZEQA 2MP2A 2AL3A 4KDLB 3ZUNA 4PS8A 3UQBA 1FXTB 2A4ZA 2JZZA 4HPLB 3OAWA 3VDZA 3KUCB 2KJHB 4HCNB 5D2MB 1NI2A 4ASWC 2JRHA 2C7MB 2NPTB 3OLMD 4TV3A 2LASA 3BY4B 5HKHA 4HXDA 2CHZA 2IYDB 3PRMB 3QX1A 3UGBB 2IO0B 4NQKE 3ECIA 4MJSB 3QCAA 2DYOA 4G0NB 5IA7A 4N9F4 1WIAA 2BWFA 3PGEA 2NCNA 2D10A 1E7UA 2KX0A 5JHBA 2K6QA 3ALBA 2KD0A 4FULA 3KUDB 1E8WA 2RSUA 1TBEA 1MG8A 3PS6A 2EMTA 2M4NA 3JW0X 4K81A 4B9KA 2IY0B 2KX3A 2LRUA 3APDA 3OJ3A 2KDIA 3KW5B 3VTWA 1WE6A 5DPRA 2DAFA 3I3TB 1KJTA 2K8HA 3QQ8B 2DX5B 3SHQA 2K8BA 4W9IA 5C23A 4AP4C 1GC6A 4FHKA 1P98A 1OQYA 3X0WA 3N32A 4A20A 1L2NA 3JYUA 4TUUA 1WF9A 5AZGA 4GN1A 4URKA 3BINA 2HTHA 2LVPA 3HK0A 1GG3A 2JF5A 1GJZA 2V3SA 4FJYA 2L3ZA 2HE7A 4CYEA 1UZXB 1M94A 3ZNGC 4AUQC 2J0KA 2DZMA 2N7DA 4WJNA 2C60A 3PREA 2CHWA 1S1QB 2LGDA 2JRIB 4LDTD 1WGDA 2C9WB 1SE9A 4B95A 3PPAA 3T8MA 2FCNA 2DZKA 2D2QA 3QJZA 4LJOB 1TGZB 4XX5A 1WZ0A 4OVUA 2EKEC 2LGYA 1EUVB 4GDLA 2BF8B 1C1YB 5GMVA 1E5WA 2KLCA 2XK5B 1V9JA 4GU2A 2LVOA 5E6PA 2KQSA 3IFWB 2W9NA 1WMHB 2RGFA 2FUHB 3VUXA 4W9CA 3P2BA 3H9DA 2MLBA 4MH0E 2ZVNA 1CMXB 4PS7A 2LRWA 3PSEB 4EFOA 3U30A 2UWQA 1WX9A 5EDSA 4HLEA 4W9EA 2KZRA 4W9GA 3ZTCA 2N4FA 3AU4A 2MRPA 3ML8A 1YQBA 5G2NA 2KFKB 3RCZA 3VFKA 1WGGA 2L0FA 1P0RA 2BYFA 4LDTB 5IAAC 1H4RA 4F8CB 1IP9A 2MP2B 5CTRC 3AI5A 2NBUA 4JGHB 3UIPB 4BKSA 1WY8A 3QWZB 1OGWA 4DDID 1WJ6A 2O6VD 3UIOB 2KTRA 5AEKB 1G6JA 4JQWC 3KYCD 4KIKA 2MW5A 1X1MA 3H1UA 4WQOB 4MSQB 1WX7A 2ZZPB 3PZDA 4ZYNA 4EOYA 3DVGX 2KC2A 3M63B 3IG3A 1GUAB 2JY6A 5D6JB 3C0RB 4A3OA 4EZLA 1V6EA 1NBFC 3ZNHB 3M95A 3QIJA 2Z0DB 4NJ6A 1VD2A 4BBNF 2NS5A 4AWJA 1ZW7A 4XZ4A 3QAQA 4IWQA 4ZRKA 1GC7A 1V49A 3A33B 2DZJA 3H6NA 4NAWA 3A1QA 3DBLI 1A5RA 3DQVA 2CU1A 5LXHA 4WJPA 3LDZE 3WALA 1IYFA 1AARA 3ZTDA 2ZCBA 3RT3B 2XEWA 3DBSA 3PLVA 2HD5B 2KK8A 2NBWB 3UQAA 3L0WB 3RZFA 4AJYB 3VQIA 4GGQA 4W9KA 4WJQA 4NNJB 1EO6A 4A3PA 3ZNID 2KWCA 2K6DB 2L7RA 1OTRB 4W9DA 2GOWA 1KM7A 2AYOB 3PVLA 5E6NA 3K9OB 4KV2A 4WWNA 1WGHA 1R4MI 3K9PB 4IM3A 2D07B 5KHOA 4DWFA 2JT4B 2FCSA 4FJZA 2BKRB 3M62B 4FN2A 4GOCA 4JIOU 4ZRIA 2KDEB 2QHOA 4ZRJA 4ICUA 1V86A 4ANVA 3ZW3A 4M8NA 3DBHI 4XC2A 1L7YA 1LM8B 2MSED 3AXCA 3H7PA 3TJPA 3VH3B 3VH4B 4GDLB 2N9XA 3GOEA 3VVWB 2ZVOA 4HWIB 3MTNB 4GB9A 4EZKA 4RMAA 2KANA 2ZPYA 4E3CA 3APCA 3PRZA 3TMPB 1WJ4A 2RR9A 1P3QU 2V1YA 2GBJA 3VUYA 2G3QB 2L8JA 1QZEA 3CSTA 1TZ1A 2MBEA 3V60A 2J0MA 2CHXA 2XBBC 2J0JA 3PLUA 3W1YA 3TBLD 2ZNVB 1P9DU 2L76A 2IY1B 2PEAA 2R2OA 4W9JA 1ZGUB 1OEYA 3DDCB 3EC8A 3L13A 4W9FA 3ONSA 3EHVA 1IPGA 1SIFA 2CS4A 3UINB 5L95C 1ISNA 4FJVB 1WE7A 2LUEA 1T0YA 1EF1A 2I1KA 2FCQA 2L00B 2KTRB 4MGYE 1RFAA 3A9JB 4KIKB 3M3JA 5CHVC 4E71A 1Q5WB 1KLVA 3VHTC 2L0TA 2KJ6A 3OJ4B 5D7GA 2N1VA 5CX3A 1C3TA 1BT0A 2M0XA 4G3XB 1UBQA 2D3GA 4KZ0A 3HHMA 3WAOA 2DYBA 3QC8B 4HDQA 1WXAA 2KXJA 3RUIB 1VCBA 1WJNA 4IWPA 3ZIMA 2M1MA 5AZHA 1WZ3A 2BKFA 3ENEA 4F1SA 4NQLB 4E74A 3MHSD 3PT2B 2OJRA 3RYTA 2WDTB 2GBKA 4NAWB 3SU8X 4TQ0A 1WYWB 2BPSA 3A1QB 2Y5BB 3B0AA 1HE8A 2DHZA 2FCMA 2JUOA 3NZUA 4MEMA 3QA8A 1YX5B 4PS3A 2LD9A 2ZCCA 5AZFA 4TKNA 2C7NB 4GMVA 4HVBA 1V81A 3W1SC 1YJ1A 2IO2B 2NBVB 2ASQA 4W9LA 1SGHA 4FBJB 2A5UA 1LFDA 2Z59B 4MDKE 3WANA 4BBNC 1S3SG 1RLFA 3NHEB 1XT9B 2MA9B 3IHPC 3VTUA 4ANXA 2KWUB 2JWZA 3KUZA 3PHWB 4I6PA 2WYQA 2FAZA 2GMIC 1UBIA 3WA0A 4FA6A 3A9JA 2M8SA 4I6NB 2RD0A 4LJPB 3H7PB 4M0WB 1LQBA 1OEYJ 3WAMA 3L10B 4WJOA 2AWTA 4EUTA 4EZJA 2UYZB 1P1AA 3L08A 5LLIA 3R7RA 3V6EB 2DZIA 2N7EA 1V2YA 4FADA 2JZ3B 4JLCA 4RM8A 4MELA 4FLHA 4MM3A 3U7DA 1Z2MA 2LGXA 5DPSA 3ZRCA 2J7QB 1E8ZA 3ZDTA 3V6CB 3DCGA 3VUWA 4BFRA 2O2VA 3V62A 2K25A 2LI5A 3CMMB 5G55A 2BYVE 3CSFA 3Q3FA 1V5TA 2BGFA 1E8YA 4IC7B 1WM2A 3DPDA 3TL5A 2FNJB 2FIFA 2V4LA 3NS8A 1H8CA 3B08A 3EECA 3RZWC 4ZDVA 3R7QA 3HIZA 4K1RB 5KHQA 2DYMA 2GBRA 4ANWA 4DDGD 3JSVA 2KHWB 2RPQA 4NJ7A 5L83A 2MBOA 2R2QA 1RAXA 3H7SA 3QHTA 3TIXA 2LXCA 4LCDE 4BKSD 3RULA 3UF8A 2G45B 2KFJA 2K1FA 2CKHB 1WH3A 1E8XA 1U4AA 1V5OA 2C7HA 1NDDA 2IO1B 3R3MA 3DVGY 3T9LA 3MJWA 4P7IA 1WGRA 4IW0A 1V80A 2DAJA 3A4SC 4HK2A 1F9JA 2N1WA 5J18A 2KOXA 3A9KA 3A4RA 5TR5A 4MGZE 5D94A 3KVFB 1E7VA 4BOSC 5DCNA 2D11A 3EFUA 2KN5A 3ZKJC 3SDLC 2CR5A 3VXWA 1UGMA 3NY5A 4ANUA 4GDKA 4KZCA 4DHJB 4GSWA 4K7SA 4WWOA 5CHWA 2BYEA 3VTVA 3R66C 4IG7B 1YX6B 1WI0A 1J19A 2YLMA 3LJ3A 5JHAA 1J8CA 4YL8A 2AL6A 4G11A 2KTFA 3NZSA 2G4SA 2K39A 4WAAA 3PV1A 3QARA 5BO4B 4MSMB 2KDBA 3APFA 2KNBA 2WX0A 3WAPA 3S2AA 1UH6A 3ML9A 1Y8RC 2C5LC 3ZRFA 3CF6E 2FIDA 5E6OA 3W1SA 4CHKA 4F7ZA 3X23A 2JVCA 2LXAA 3JVZX 4PYZA 2O6VA 3IBEA 2IO3B 1WM3A 1XQQA 3HM3A 1WXMA 1WR1A 2KC1A 2KQ7A 3NOBA 1XD3B 3TCAA 4HCPB 4CO7A 3KH0A 4BKTA 3VAWA 2DENB 4EKUA 2MBQA 1GNUA 4TQ1A 4X57B 3GZNI 3ZVVA 3ZO5B 4IM2A 1WFYA 4GIVA 3V61A 4JL9A 2O2VB 5J17A 2OOBB 1LXDA 2N9EB 2NPTA 2IBIB 4GXBA 1WGYA 2PPHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MWS B;  2EMS A;  2KWV B;  3N3K B;  4IUM B;  4BKG A;  5CHF A;  2KMA A;  4MJS A;  3Q3J A;  1K8R B;  4HJK A;  2HJ8 A;  2G4D B;  3DOW A;  4RM9 A;  4II2 B;  4HDO A;  2ZJD A;  2AEH A;  3QK0 A;  1WXS A;  3JSV B;  5LXI B;  2PJH A;  2IZV B;  3D32 A;  1WX8 A;  2NR2 A;  2M17 A;  2ZPN A;  2LWP A;  3DVN U;  2MBH A;  3L54 A;  2JXX A;  1TTN A;  4IWO A;  4AOF A;  5DPW A;  2JPH A;  1WXV A;  3AU5 A;  3N30 A;  5FR6 A;  3B1L X;  1WR6 E;  1Q1O A;  2WX1 A;  3PTF C;  1R4N I;  4J6I A;  4AJW A;  5JH5 C;  3U8Z A;  4B6W A;  4PYU A;  4M8M A;  5C1Z A;  2KKC A;  1YD8 U;  3A9K B;  2N9P C;  3AUL A;  2KJR A;  2MBB B;  1JRU A;  2BWE S;  1D3Z A;  1Z5S B;  1RRB A;  2PE6 B;  2I1J A;  3ZNZ B;  2LVQ A;  4K7W A;  4ICV A;  3L16 A;  3RD2 A;  4II3 B;  3ZLZ A;  2NVU I;  3WIM A;  4GDK B;  1I42 A;  2ZNV C;  1UEL A;  1Q0W B;  3PRP B;  3SD5 A;  4KVG B;  4NY0 A;  2GBM A;  4G50 A;  2WWZ A;  4MGK E;  4DBG A;  3HM6 X;  4EEW A;  1UD7 A;  2Z0E B;  3PHX B;  4I6L B;  2VRR B;  2MCN B;  1ZKH A;  2REX A;  4KSL C;  4MGI E;  2XK5 A;  4DHZ B;  5DPT A;  4KDI C;  1EF5 A;  2LJ5 A;  2PE9 A;  4OVV A;  4FHJ A;  2GBN A;  1WMH A;  1WRD B;  2B3A A;  2YVC A;  3KYD D;  3O65 B;  4WWP A;  4BOZ B;  4DHJ D;  1KOT A;  4KSK C;  3DVN V;  4NPN A;  4HPM B;  1I35 A;  2MQJ A;  2MX2 A;  4DXA B;  3ZDM C;  5JZE B;  1WJU A;  3DBR I;  2L05 A;  1YIW A;  3L17 A;  4IM0 A;  2O6V B;  2KLG A;  1E90 A;  2LZ6 A;  2KVR A;  1J0G A;  4K7U A;  2KMC A;  4DK5 A;  4BVU C;  2KFK A;  4W9H A;  4DHZ E;  2K8C A;  2KDF B;  5J2R A;  1PQS A;  2KO3 A;  3IVF A;  2ZEQ A;  2MP2 A;  2AL3 A;  4KDL B;  3ZUN A;  4PS8 A;  3UQB A;  1FXT B;  2A4Z A;  2JZZ A;  4HPL B;  3OAW A;  3VDZ A;  3KUC B;  2KJH B;  4HCN B;  5D2M B;  1NI2 A;  4ASW C;  2JRH A;  2C7M B;  2NPT B;  3OLM D;  4TV3 A;  2LAS A;  3BY4 B;  5HKH A;  4HXD A;  2CHZ A;  2IYD B;  3PRM B;  3QX1 A;  3UGB B;  2IO0 B;  4NQK E;  3ECI A;  4MJS B;  3QCA A;  2DYO A;  4G0N B;  5IA7 A;  4N9F 4;  1WIA A;  2BWF A;  3PGE A;  2NCN A;  2D10 A;  1E7U A;  2KX0 A;  5JHB A;  2K6Q A;  3ALB A;  2KD0 A;  4FUL A;  3KUD B;  1E8W A;  2RSU A;  1TBE A;  1MG8 A;  3PS6 A;  2EMT A;  2M4N A;  3JW0 X;  4K81 A;  4B9K A;  2IY0 B;  2KX3 A;  2LRU A;  3APD A;  3OJ3 A;  2KDI A;  3KW5 B;  3VTW A;  1WE6 A;  5DPR A;  2DAF A;  3I3T B;  1KJT A;  2K8H A;  3QQ8 B;  2DX5 B;  3SHQ A;  2K8B A;  4W9I A;  5C23 A;  4AP4 C;  1GC6 A;  4FHK A;  1P98 A;  1OQY A;  3X0W A;  3N32 A;  4A20 A;  1L2N A;  3JYU A;  4TUU A;  1WF9 A;  5AZG A;  4GN1 A;  4URK A;  3BIN A;  2HTH A;  2LVP A;  3HK0 A;  1GG3 A;  2JF5 A;  1GJZ A;  2V3S A;  4FJY A;  2L3Z A;  2HE7 A;  4CYE A;  1UZX B;  1M94 A;  3ZNG C;  4AUQ C;  2J0K A;  2DZM A;  2N7D A;  4WJN A;  2C60 A;  3PRE A;  2CHW A;  1S1Q B;  2LGD A;  2JRI B;  4LDT D;  1WGD A;  2C9W B;  1SE9 A;  4B95 A;  3PPA A;  3T8M A;  2FCN A;  2DZK A;  2D2Q A;  3QJZ A;  4LJO B;  1TGZ B;  4XX5 A;  1WZ0 A;  4OVU A;  2EKE C;  2LGY A;  1EUV B;  4GDL A;  2BF8 B;  1C1Y B;  5GMV A;  1E5W A;  2KLC A;  2XK5 B;  1V9J A;  4GU2 A;  2LVO A;  5E6P A;  2KQS A;  3IFW B;  2W9N A;  1WMH B;  2RGF A;  2FUH B;  3VUX A;  4W9C A;  3P2B A;  3H9D A;  2MLB A;  4MH0 E;  2ZVN A;  1CMX B;  4PS7 A;  2LRW A;  3PSE B;  4EFO A;  3U30 A;  2UWQ A;  1WX9 A;  5EDS A;  4HLE A;  4W9E A;  2KZR A;  4W9G A;  3ZTC A;  2N4F A;  3AU4 A;  2MRP A;  3ML8 A;  1YQB A;  5G2N A;  2KFK B;  3RCZ A;  3VFK A;  1WGG A;  2L0F A;  1P0R A;  2BYF A;  4LDT B;  5IAA C;  1H4R A;  4F8C B;  1IP9 A;  2MP2 B;  5CTR C;  3AI5 A;  2NBU A;  4JGH B;  3UIP B;  4BKS A;  1WY8 A;  3QWZ B;  1OGW A;  4DDI D;  1WJ6 A;  2O6V D;  3UIO B;  2KTR A;  5AEK B;  1G6J A;  4JQW C;  3KYC D;  4KIK A;  2MW5 A;  1X1M A;  3H1U A;  4WQO B;  4MSQ B;  1WX7 A;  2ZZP B;  3PZD A;  4ZYN A;  4EOY A;  3DVG X;  2KC2 A;  3M63 B;  3IG3 A;  1GUA B;  2JY6 A;  5D6J B;  3C0R B;  4A3O A;  4EZL A;  1V6E A;  1NBF C;  3ZNH B;  3M95 A;  3QIJ A;  2Z0D B;  4NJ6 A;  1VD2 A;  4BBN F;  2NS5 A;  4AWJ A;  1ZW7 A;  4XZ4 A;  3QAQ A;  4IWQ A;  4ZRK A;  1GC7 A;  1V49 A;  3A33 B;  2DZJ A;  3H6N A;  4NAW A;  3A1Q A;  3DBL I;  1A5R A;  3DQV A;  2CU1 A;  5LXH A;  4WJP A;  3LDZ E;  3WAL A;  1IYF A;  1AAR A;  3ZTD A;  2ZCB A;  3RT3 B;  2XEW A;  3DBS A;  3PLV A;  2HD5 B;  2KK8 A;  2NBW B;  3UQA A;  3L0W B;  3RZF A;  4AJY B;  3VQI A;  4GGQ A;  4W9K A;  4WJQ A;  4NNJ B;  1EO6 A;  4A3P A;  3ZNI D;  2KWC A;  2K6D B;  2L7R A;  1OTR B;  4W9D A;  2GOW A;  1KM7 A;  2AYO B;  3PVL A;  5E6N A;  3K9O B;  4KV2 A;  4WWN A;  1WGH A;  1R4M I;  3K9P B;  4IM3 A;  2D07 B;  5KHO A;  4DWF A;  2JT4 B;  2FCS A;  4FJZ A;  2BKR B;  3M62 B;  4FN2 A;  4GOC A;  4JIO U;  4ZRI A;  2KDE B;  2QHO A;  4ZRJ A;  4ICU A;  1V86 A;  4ANV A;  3ZW3 A;  4M8N A;  3DBH I;  4XC2 A;  1L7Y A;  1LM8 B;  2MSE D;  3AXC A;  3H7P A;  3TJP A;  3VH3 B;  3VH4 B;  4GDL B;  2N9X A;  3GOE A;  3VVW B;  2ZVO A;  4HWI B;  3MTN B;  4GB9 A;  4EZK A;  4RMA A;  2KAN A;  2ZPY A;  4E3C A;  3APC A;  3PRZ A;  3TMP B;  1WJ4 A;  2RR9 A;  1P3Q U;  2V1Y A;  2GBJ A;  3VUY A;  2G3Q B;  2L8J A;  1QZE A;  3CST A;  1TZ1 A;  2MBE A;  3V60 A;  2J0M A;  2CHX A;  2XBB C;  2J0J A;  3PLU A;  3W1Y A;  3TBL D;  2ZNV B;  1P9D U;  2L76 A;  2IY1 B;  2PEA A;  2R2O A;  4W9J A;  1ZGU B;  1OEY A;  3DDC B;  3EC8 A;  3L13 A;  4W9F A;  3ONS A;  3EHV A;  1IPG A;  1SIF A;  2CS4 A;  3UIN B;  5L95 C;  1ISN A;  4FJV B;  1WE7 A;  2LUE A;  1T0Y A;  1EF1 A;  2I1K A;  2FCQ A;  2L00 B;  2KTR B;  4MGY E;  1RFA A;  3A9J B;  4KIK B;  3M3J A;  5CHV C;  4E71 A;  1Q5W B;  1KLV A;  3VHT C;  2L0T A;  2KJ6 A;  3OJ4 B;  5D7G A;  2N1V A;  5CX3 A;  1C3T A;  1BT0 A;  2M0X A;  4G3X B;  1UBQ A;  2D3G A;  4KZ0 A;  3HHM A;  3WAO A;  2DYB A;  3QC8 B;  4HDQ A;  1WXA A;  2KXJ A;  3RUI B;  1VCB A;  1WJN A;  4IWP A;  3ZIM A;  2M1M A;  5AZH A;  1WZ3 A;  2BKF A;  3ENE A;  4F1S A;  4NQL B;  4E74 A;  3MHS D;  3PT2 B;  2OJR A;  3RYT A;  2WDT B;  2GBK A;  4NAW B;  3SU8 X;  4TQ0 A;  1WYW B;  2BPS A;  3A1Q B;  2Y5B B;  3B0A A;  1HE8 A;  2DHZ A;  2FCM A;  2JUO A;  3NZU A;  4MEM A;  3QA8 A;  1YX5 B;  4PS3 A;  2LD9 A;  2ZCC A;  5AZF A;  4TKN A;  2C7N B;  4GMV A;  4HVB A;  1V81 A;  3W1S C;  1YJ1 A;  2IO2 B;  2NBV B;  2ASQ A;  4W9L A;  1SGH A;  4FBJ B;  2A5U A;  1LFD A;  2Z59 B;  4MDK E;  3WAN A;  4BBN C;  1S3S G;  1RLF A;  3NHE B;  1XT9 B;  2MA9 B;  3IHP C;  3VTU A;  4ANX A;  2KWU B;  2JWZ A;  3KUZ A;  3PHW B;  4I6P A;  2WYQ A;  2FAZ A;  2GMI C;  1UBI A;  3WA0 A;  4FA6 A;  3A9J A;  2M8S A;  4I6N B;  2RD0 A;  4LJP B;  3H7P B;  4M0W B;  1LQB A;  1OEY J;  3WAM A;  3L10 B;  4WJO A;  2AWT A;  4EUT A;  4EZJ A;  2UYZ B;  1P1A A;  3L08 A;  5LLI A;  3R7R A;  3V6E B;  2DZI A;  2N7E A;  1V2Y A;  4FAD A;  2JZ3 B;  4JLC A;  4RM8 A;  4MEL A;  4FLH A;  4MM3 A;  3U7D A;  1Z2M A;  2LGX A;  5DPS A;  3ZRC A;  2J7Q B;  1E8Z A;  3ZDT A;  3V6C B;  3DCG A;  3VUW A;  4BFR A;  2O2V A;  3V62 A;  2K25 A;  2LI5 A;  3CMM B;  5G55 A;  2BYV E;  3CSF A;  3Q3F A;  1V5T A;  2BGF A;  1E8Y A;  4IC7 B;  1WM2 A;  3DPD A;  3TL5 A;  2FNJ B;  2FIF A;  2V4L A;  3NS8 A;  1H8C A;  3B08 A;  3EEC A;  3RZW C;  4ZDV A;  3R7Q A;  3HIZ A;  4K1R B;  5KHQ A;  2DYM A;  2GBR A;  4ANW A;  4DDG D;  3JSV A;  2KHW B;  2RPQ A;  4NJ7 A;  5L83 A;  2MBO A;  2R2Q A;  1RAX A;  3H7S A;  3QHT A;  3TIX A;  2LXC A;  4LCD E;  4BKS D;  3RUL A;  3UF8 A;  2G45 B;  2KFJ A;  2K1F A;  2CKH B;  1WH3 A;  1E8X A;  1U4A A;  1V5O A;  2C7H A;  1NDD A;  2IO1 B;  3R3M A;  3DVG Y;  3T9L A;  3MJW A;  4P7I A;  1WGR A;  4IW0 A;  1V80 A;  2DAJ A;  3A4S C;  4HK2 A;  1F9J A;  2N1W A;  5J18 A;  2KOX A;  3A9K A;  3A4R A;  5TR5 A;  4MGZ E;  5D94 A;  3KVF B;  1E7V A;  4BOS C;  5DCN A;  2D11 A;  3EFU A;  2KN5 A;  3ZKJ C;  3SDL C;  2CR5 A;  3VXW A;  1UGM A;  3NY5 A;  4ANU A;  4GDK A;  4KZC A;  4DHJ B;  4GSW A;  4K7S A;  4WWO A;  5CHW A;  2BYE A;  3VTV A;  3R66 C;  4IG7 B;  1YX6 B;  1WI0 A;  1J19 A;  2YLM A;  3LJ3 A;  5JHA A;  1J8C A;  4YL8 A;  2AL6 A;  4G11 A;  2KTF A;  3NZS A;  2G4S A;  2K39 A;  4WAA A;  3PV1 A;  3QAR A;  5BO4 B;  4MSM B;  2KDB A;  3APF A;  2KNB A;  2WX0 A;  3WAP A;  3S2A A;  1UH6 A;  3ML9 A;  1Y8R C;  2C5L C;  3ZRF A;  3CF6 E;  2FID A;  5E6O A;  3W1S A;  4CHK A;  4F7Z A;  3X23 A;  2JVC A;  2LXA A;  3JVZ X;  4PYZ A;  2O6V A;  3IBE A;  2IO3 B;  1WM3 A;  1XQQ A;  3HM3 A;  1WXM A;  1WR1 A;  2KC1 A;  2KQ7 A;  3NOB A;  1XD3 B;  3TCA A;  4HCP B;  4CO7 A;  3KH0 A;  4BKT A;  3VAW A;  2DEN B;  4EKU A;  2MBQ A;  1GNU A;  4TQ1 A;  4X57 B;  3GZN I;  3ZVV A;  3ZO5 B;  4IM2 A;  1WFY A;  4GIV A;  3V61 A;  4JL9 A;  2O2V B;  5J17 A;  2OOB B;  1LXD A;  2N9E B;  2NPT A;  2IBI B;  4GXB A;  1WGY A;  2PPH A; 
#chains in the Genus database with same CATH topology
 4B0M A;  2MWS B;  3RMK C;  1Q10 A;  3FC4 A;  3NVV A;  1T5X D;  4S0R A;  1FXI A;  3QK0 A;  3JSV B;  1FM0 D;  4FXC A;  3DVN U;  2Z8L A;  3AH7 A;  2IGH A;  2JXX A;  2FE8 A;  4IWO A;  3DBR B;  2WX1 A;  2AQ1 B;  2H89 B;  5JH5 C;  4D2K A;  2JZP A;  1JRU A;  1TT5 B;  1D3Z A;  1Z5S B;  3SFE B;  2ON8 A;  3AE8 B;  2WXG A;  4GDK B;  2MJ3 A;  1Q0W B;  3PRP B;  1RFK A;  4JPS A;  3GE3 C;  1WGK A;  4EEW A;  1V97 A;  3PHX B;  4ACF A;  1MHX A;  2Y5P A;  1TS4 A;  5HFY A;  5DPT A;  3DHG C;  2GBN A;  1WMH A;  3KYD D;  2KQ4 X;  3Q8E A;  1I4G A;  3DBR I;  4UDU C;  1JRP A;  2KLG A;  4K7U A;  1SE4 A;  2KFK A;  2M0A A;  1XLP A;  1ROE A;  1SE3 A;  1PQS A;  3FKY A;  2MP2 A;  1C77 A;  2JZZ A;  3KUC B;  2GI9 A;  4HXD A;  2IYD B;  4MJS B;  3R2I A;  1WIA A;  2BWF A;  4YXD B;  2D10 A;  2KX0 A;  2VH1 A;  3KUD B;  3PS6 A;  3OJ3 A;  3APD A;  3I3T B;  2K8H A;  2DX5 B;  1TJE A;  4W9I A;  4AP4 C;  3X0W A;  3I9V 1;  4TUU A;  4URK A;  4GN1 A;  3BIN A;  2LVP A;  1GG3 A;  2V3S A;  4FJY A;  4CYE A;  1UZX B;  3DHH C;  2J0K A;  2MEK A;  2DZM A;  2EEL A;  2N7D A;  2E3T A;  1S1Q B;  3HVD A;  4B95 A;  3T8M A;  2DZK A;  5D3D A;  2DBY A;  2EKE C;  2JWU A;  2LGY A;  5E6P A;  3IFW B;  4A6Q A;  1FRD A;  2NTS A;  5BMI A;  1CMX B;  1WX9 A;  3N1Z C;  5EDS A;  1C4A A;  2KZR A;  1XCQ L;  4W9G A;  2N4F A;  3ML8 A;  5G2N A;  2KMM A;  2BYF A;  1IP9 A;  5CTR C;  1WY8 A;  4N58 A;  2BS4 B;  2PIA A;  2O6V D;  3UIO B;  1XCT L;  4KIK A;  2MW5 A;  1EM7 A;  4C80 A;  4XE0 A;  2ZZP B;  3PZD A;  3DVG X;  3DBH B;  1V6E A;  1CJE A;  1E9M A;  3Q2A C;  2MJE A;  2Z0D B;  1GB4 A;  3LXF A;  1ZW7 A;  4XZ4 A;  4IWQ A;  1V49 A;  2DZJ A;  3H6N A;  4NAW A;  1A5R A;  4WJP A;  4IKG A;  2WXK A;  1C9F A;  1SF0 A;  3HUI A;  3DBS A;  2HD5 B;  2KK8 A;  4TMA B;  3UQA A;  3RZF A;  5EE0 A;  2L7R A;  1KM7 A;  2OHF A;  1TKE A;  1YJJ A;  3I57 A;  4WWN A;  4KV2 A;  3K9P B;  5KHO A;  2LHE A;  4FJZ A;  2L52 A;  4RF1 A;  4ZRI A;  2KDE B;  2QHO A;  3AB5 A;  3PZ8 A;  4ICU A;  3ZW3 A;  4M8N A;  3DBH I;  4XC2 A;  3TJP A;  3VH4 B;  2JYT A;  4GDL B;  4HWI B;  4GB9 A;  4LLG M;  4EZK A;  4E3C A;  1L4D B;  1WJ4 A;  2L8J A;  1QZE A;  3H8H A;  3RNB C;  3BWU D;  2WXM A;  1FNU A;  3RNA C;  3I5J C;  4KKJ A;  4W9J A;  1QOG A;  1WSP A;  3IAS 1;  2R61 A;  2WXR A;  1SIF A;  2QIE B;  3TEY A;  1D5X C;  1WE7 A;  4MGY E;  3Q8F A;  1Y56 A;  1PGX A;  2LGI A;  5BYS A;  5CX3 A;  4KGS A;  1CK1 A;  5H8Y E;  1T0R C;  4KZ0 A;  1OQR A;  4HDQ A;  3RUI B;  1VCB A;  5AZH A;  3PT2 B;  1QQR A;  3W5V B;  4P6V F;  4A8X C;  3RI7 C;  2WDT B;  2GBK A;  1FNW A;  1XEE A;  4TQ0 A;  2BPS A;  3A1Q B;  1IBX A;  1QF6 A;  3DBL B;  3NZU A;  4MEM A;  4USA A;  4KKI A;  4HVB A;  1F1H A;  1V81 A;  4W9L A;  1TS3 A;  1SGH A;  2A5U A;  3B9J A;  4RGM A;  5IN7 A;  3AMZ A;  4ANX A;  3KUZ A;  1C78 A;  2N9K A;  2FAZ A;  2XN9 C;  3H7P B;  1LQB A;  1OEY J;  4WJO A;  1J7B A;  3R7R A;  2N7E A;  2WXH A;  4MM3 A;  2LGX A;  5DPS A;  2PVO D;  3ZJV A;  1VZ8 A;  2J7Q B;  3NZ3 A;  1FNV A;  2CJN A;  3V62 A;  2LI5 A;  2JX5 A;  1V5T A;  2TSS A;  2I38 A;  4IC7 B;  4HKZ E;  3DHI C;  3NS8 A;  3EEC A;  3RNG C;  3WCQ A;  4ANW A;  4DDG D;  5L83 A;  2MBO A;  3H7S A;  2INN E;  2LXC A;  4L2Y A;  2G45 B;  2KFJ A;  1TY2 A;  1E8X A;  1NDD A;  1XF5 L;  1JWB D;  3AM9 A;  4O1N A;  3T9L A;  1HZ6 A;  2DAJ A;  3A4S C;  1F9J A;  3P4S B;  2W3R A;  3N9Y C;  5TR5 A;  4MGZ E;  1MPE A;  2KN5 A;  2ZW1 A;  1FCL A;  2L1A A;  2CR5 A;  3VXW A;  4ANU A;  2DWQ A;  4OZB A;  3AE4 B;  4IG7 B;  1E7P B;  1YX6 B;  1J19 A;  4WAF A;  3NZS A;  2G4S A;  5BO4 B;  3T3N A;  3APF A;  2B76 B;  2OED A;  4OW0 A;  1UH6 A;  2C5L C;  3OG5 A;  4F7Z A;  3ZJT A;  2LXA A;  3IBE A;  1WM3 A;  1GAQ B;  3TCA A;  3N20 C;  4BKT A;  2DEN B;  4EE2 A;  3GZN I;  1N60 A;  2N9E B;  1FFU A;  2KAC A;  2PPH A;  2EMS A;  3N3K B;  4BKG A;  4DXG A;  3Q3J A;  5MPO A;  4HJK A;  4RM9 A;  4HDO A;  2ZJD A;  2AEH A;  1E10 A;  1WX8 A;  2G1E A;  2LWP A;  1TTN A;  4AOF A;  5DPW A;  1QT9 A;  1Q1O A;  4RGN A;  1OFF A;  3U52 E;  1I4X A;  4AJW A;  4B6W A;  3A9K B;  2MBB B;  1RRB A;  1TZO A;  4K7W A;  5TSS A;  3SD5 A;  4G50 A;  3Q8A A;  4LNI A;  4LNO A;  4MGK E;  4P1C C;  4RF0 A;  4I6L B;  2VRR B;  2WXF A;  1TS5 A;  2MCN B;  3Q69 A;  2REX A;  4DHZ B;  1YJI A;  2XK5 A;  4KDI C;  4ZYS A;  1YQ4 B;  4OVV A;  4DHJ D;  1KOT A;  4KSK C;  3DVN V;  1KTK A;  4HPM B;  1JWM D;  2MX2 A;  4DXA B;  3ZYY X;  1WJU A;  4IM0 A;  2O6V B;  3ZGZ A;  1E90 A;  2AQ3 B;  2LMC A;  3O13 A;  4B0E A;  4OVZ A;  4W9H A;  1JWA D;  1VLB A;  1KH0 A;  2KDF B;  5J2R A;  2KAJ A;  3IVF A;  3EUB 2;  2ZEQ A;  1V1P B;  1FXT B;  1NYQ A;  4XDD A;  2KJH B;  5D2M B;  2JRH A;  2C7M B;  2LAS A;  3PRM B;  3NG0 A;  2DYO A;  2BS3 B;  4N9F 4;  1QKZ A;  3PGE A;  1ACC A;  5JHB A;  2JXT A;  3ALB A;  2KD0 A;  4IOI E;  1N61 A;  1ZUD 2;  1HA5 A;  1TKY A;  4XDC A;  3JW0 X;  2LRU A;  3FIL A;  1V1O A;  1WE6 A;  1KJT A;  4LNN A;  3P4Q B;  4ARC A;  2ICI A;  1HTO A;  2SEB D;  2YEP F;  1YQ3 B;  1WF9 A;  1JAL A;  2HTH A;  1GJZ A;  4US9 A;  2HE7 A;  4AUQ C;  1ZE3 D;  3TEX A;  4WJN A;  5I4D A;  2WU5 B;  1UGJ A;  2GLS A;  2LGD A;  2JRI B;  3SFD B;  4MAC A;  2C9W B;  1SE9 A;  4LJO B;  1WZ0 A;  4OVU A;  1C1Y B;  4KGT A;  1E5W A;  2VZK D;  1V9J A;  2W9N A;  3P2B A;  2KT7 A;  3UI3 A;  2NTT A;  4NJC A;  5HG2 A;  2MLB A;  4MH0 E;  4M01 A;  1E0Z A;  4W9E A;  3MHZ A;  3AU4 A;  3GE8 C;  1ZXI A;  4HKQ A;  1K53 A;  2L0F A;  1NEN B;  4LDT B;  1WXQ A;  3AI5 A;  3GB1 A;  1OGW A;  4DDI D;  1WJ6 A;  4WUR A;  1GB1 A;  1R4M B;  2KTR A;  1G6J A;  4WQO B;  4MSQ B;  4ZYN A;  2KC2 A;  5HI1 A;  5D6J B;  3NUH B;  2BQQ A;  1JWU D;  1NEK B;  2Y3A A;  4EZL A;  1NBF C;  5H92 C;  2NS5 A;  1NI3 A;  3VR9 B;  4ZRK A;  3A33 B;  5FR3 A;  3EGR A;  2CU1 A;  4JWS C;  3LDZ E;  3WAL A;  3IXS A;  3BVZ A;  3B2F A;  5FK9 C;  4BAX A;  5FKA C;  1FCC C;  3VQI A;  1IUE A;  4GGQ A;  4A3P A;  2KWC A;  2K6D B;  2WLB A;  1OTR B;  3PVL A;  5E6N A;  2EKI A;  1MFW A;  2MH7 A;  2CU3 A;  1R4M I;  4IM3 A;  2D07 B;  4DWF A;  2JT4 B;  2RDB C;  1L0Y B;  1V86 A;  2WHI A;  1WRI A;  2WXO A;  2W55 A;  3GOE A;  3MC8 A;  2K0P A;  3MTN B;  2KAN A;  1P7F A;  2ZPY A;  1YN4 A;  3APC A;  3PRZ A;  2RR9 A;  3SEB A;  2GBJ A;  2G3Q B;  2MBE A;  1SJE D;  2CHX A;  2K22 A;  2XBB C;  2ONQ A;  1ET9 A;  3W1Y A;  2WNM A;  2L76 A;  3DDC B;  1OEY A;  5C2T B;  4C56 C;  5AUI A;  2KVZ A;  2CS4 A;  3UIN B;  2LUE A;  2WDV B;  1T0Y A;  1EF1 A;  2L00 B;  1K51 A;  3U4E G;  4M00 A;  3C8Y A;  2KJ6 A;  5D7G A;  1C4P A;  1ESF A;  1C3T A;  4G3X B;  4LNF A;  3QC8 B;  2KXJ A;  3ZIM A;  1WJN A;  3HVZ A;  2BKF A;  1I4R A;  1WYW B;  3AEF B;  3BZD B;  2DHZ A;  2JUO A;  3LYY A;  1YX5 B;  3W1S C;  1YJ1 A;  2IO2 B;  2ASQ A;  5LNK 1;  1LFD A;  2Z59 B;  4MDK E;  3IHP C;  2MA9 B;  1TKG A;  2RDH A;  2JWZ A;  3PHW B;  3AED B;  2K3U A;  2GMI C;  1UBI A;  3WA0 A;  4RCO A;  4M0W B;  2RD0 A;  2D3A A;  1SB3 C;  2I2Y A;  1A70 A;  2UU7 A;  3EFC A;  3L08 A;  5LLI A;  3V6E B;  2DZI A;  1V2Y A;  4MEL A;  3U7D A;  3URY A;  3E9S A;  1KLU D;  3DCG A;  3VUW A;  4BFR A;  2O2V A;  5G55 A;  1F77 A;  2BGF A;  1WM2 A;  3DPD A;  3TL5 A;  2FIF A;  4ZOH C;  2BB6 A;  2CJO A;  2N9L A;  3P4R B;  1SIJ A;  4K1R B;  2GBR A;  3JSV A;  2R2Q A;  1RAX A;  3QHT A;  4ITK A;  2K1F A;  4YTM B;  1V5O A;  3DVG Y;  3MJW A;  4P7I A;  4A9A A;  4RNA A;  4HK2 A;  1FRR A;  2N1W A;  1SSN A;  5J18 A;  1PGB A;  1QOB A;  1HTQ A;  2WGS A;  4WH4 A;  5DCN A;  3ZKJ C;  4YWG G;  3SDL C;  4GDK A;  1GPX A;  4N6E B;  4KZC A;  4DHJ B;  1RWS A;  4WWO A;  3VTV A;  1EWC A;  1WI0 A;  5JHA A;  3LJ3 A;  5T8I A;  4G11 A;  3AE1 B;  1UUP A;  3PV1 A;  3AE6 B;  1TYG B;  3ML9 A;  1Y8R C;  2FID A;  3C19 A;  4RGT A;  1R4N B;  2PTL A;  2IO3 B;  1XQQ A;  1WXM A;  1WR1 A;  2KQ7 A;  3NOB A;  1T3Q A;  2PMV A;  3KH0 A;  3EA6 A;  1GNU A;  4X57 B;  3ZO5 B;  4C7Y A;  3DWM A;  5J17 A;  1LXD A;  4GXB A;  1JML A;  2KWV B;  4XWW A;  4LK0 M;  5CHF A;  2YEP B;  4MJS A;  2G4D B;  3J9C A;  2WDR B;  4II2 B;  2NMQ A;  3Q8C A;  2V9H A;  1IGD A;  2IZV B;  2V3P A;  2ZPN A;  4WQM A;  2WXI A;  1ENF A;  2QEJ C;  2MBH A;  4OHJ A;  3L54 A;  2JPH A;  1WXV A;  3AU5 A;  5FR6 A;  1WR6 E;  1YNT E;  3VRB B;  3PTF C;  1D5Z C;  2N7J A;  1R4N I;  4J6I A;  3U8Z A;  2W82 A;  3P1M A;  4M8M A;  4K3C A;  1QIL A;  3AUL A;  2BWE S;  4YTP B;  2PE6 B;  3BK1 A;  3ZNZ B;  4C4V A;  3L16 A;  4II3 B;  1UEL A;  4KVG B;  2QSD A;  2WWZ A;  1PGA A;  2WS3 B;  4DBG A;  1UD7 A;  2Z0E B;  3BVG A;  2WQY B;  3GS2 A;  1EF5 A;  1VR9 A;  1WRD B;  2B3A A;  2YVC A;  1I35 A;  1MJD A;  1TS2 A;  2MQJ A;  3ZDM C;  2LZ6 A;  2KVR A;  1J0G A;  3L4P A;  4DHZ E;  1HEZ E;  2K8C A;  4PS8 A;  3UQB A;  3RNE C;  3IT4 B;  4HPL B;  5BMH A;  3VDZ A;  3KWV A;  4ASW C;  4HCN B;  3GZN B;  1NI2 A;  3OLM D;  2NPT B;  2WXN A;  3V3X A;  4LNK A;  4DQO C;  3QX1 A;  3UGB B;  5G5H A;  3ZXR A;  5D3I B;  3SR6 A;  4AQ7 A;  2NCN A;  5EE9 A;  1E7U A;  1KRH A;  3FAH A;  2K6Q A;  1VZ7 A;  1E8W A;  2LUM A;  1TBE A;  4M02 A;  4HRS A;  2M4N A;  4B9K A;  4YSZ B;  2IY0 B;  5DPR A;  3W5U B;  2K8B A;  1GC6 A;  4QAY A;  4FHK A;  1ZPS A;  2X38 A;  1OQY A;  3NVW A;  2IND C;  1ZOY B;  1L2N A;  1E6E B;  3JYU A;  4US8 A;  5AZG A;  1D5M C;  3HK0 A;  2JF5 A;  2L3Z A;  1M94 A;  2V3N A;  4JWU C;  3PRE A;  5BYQ A;  1WGD A;  1JCK B;  3PPA A;  1NYR A;  4XX5 A;  2N0S B;  4GDL A;  1EUV B;  4WWM A;  5GMV A;  4Q2J A;  2KLC A;  4GU2 A;  1WMH B;  3DWG C;  2RDG A;  1MG4 A;  2ZVN A;  1L0X B;  2LRW A;  2RPV A;  4EFO A;  2UWQ A;  2KWD A;  3BVM A;  3ZTC A;  2KFK B;  3RCZ A;  2JU6 X;  1WGG A;  2FBW B;  1ZP0 B;  2MP2 B;  2NBU A;  4JGH B;  3UIP B;  4BKS A;  1DOX A;  3QWZ B;  2ZW0 A;  4NAM A;  5IKC M;  4N59 A;  1K52 A;  1WX7 A;  4EOY A;  2M56 B;  4HRO A;  3M63 B;  2Q5W D;  3IG3 A;  1GUA B;  2JY6 A;  4A3O A;  3KLS X;  5G5G A;  1VZ6 A;  3W9C B;  3ZNH B;  3M95 A;  3NVY A;  3QIJ A;  5IOI A;  1B9R A;  1YMH E;  4NJ6 A;  4BBN F;  3ABV B;  2JQR B;  1AW7 A;  3QAQ A;  1GC7 A;  3A1Q A;  5LXH A;  2QC8 A;  4IDI A;  1IYF A;  3ZTD A;  2ZCB A;  2WDQ B;  3PO0 A;  3RT3 B;  1HQR D;  4AJY B;  4W9K A;  4WJQ A;  4J3O D;  3ZNI D;  4W9D A;  2GOW A;  3I63 C;  2AYO B;  1PYW D;  1XLQ A;  2FCS A;  5HHD G;  2KYW A;  3M62 B;  2WP9 B;  4JIO U;  4ZRJ A;  2HTM E;  3AXC A;  3GP7 A;  3H7P A;  3VH3 B;  3VVW B;  2IPK D;  2N9X A;  4XGA B;  1QLB B;  5E6J A;  3NVZ A;  1CZP A;  3TMP B;  1TIF A;  1P3Q U;  2QJL A;  3VUY A;  4C7Z A;  3CST A;  2J0M A;  2J0J A;  3R2T A;  3PLU A;  3TBL D;  1P9D U;  4XWT A;  2R2O A;  1SXT A;  2GRI A;  1ZGU B;  4W9F A;  3ONS A;  1STE A;  2LFI A;  1L6U A;  4ZHP A;  2V4I B;  5L95 C;  3MP9 A;  3AEB B;  2FCQ A;  1RFA A;  4KIK B;  5CHV C;  4E71 A;  1Q5W B;  1KLV A;  2QMT A;  3VHT C;  1WWT A;  2L0T A;  4RH6 A;  3OJ4 B;  2N1V A;  2J53 A;  1BT0 A;  1UBQ A;  1N5W A;  3HHM A;  2DYB A;  4HJG E;  4IWP A;  1RM6 C;  2M1M A;  1WZ3 A;  3ENE A;  5EE3 A;  4E74 A;  3MHS D;  2PW9 A;  2OJR A;  3AE3 B;  3RYT A;  3Q3N C;  4NAW B;  2E6X A;  3B0A A;  2INC C;  3TSS A;  1HE8 A;  3KQ4 A;  2FCM A;  3QA8 A;  4K3B A;  2LD9 A;  4TKN A;  1N63 A;  1FMA D;  1M4V A;  4BBN C;  1S3S G;  1R7S A;  1RLF A;  1D6E C;  2VH2 A;  2KWU B;  4I6P A;  3A9J A;  4I6N B;  1J7C A;  2AWT A;  4EUT A;  4EZJ A;  1BXT A;  4S17 A;  4FAD A;  2JZ3 B;  4RM8 A;  4FLH A;  3ZDT A;  3V6C B;  4DXF A;  3CMM B;  3Q3F A;  3CSF A;  2FNJ B;  1JW9 D;  2INP E;  2KDM A;  3RZW C;  3ZJU A;  4ZRQ A;  4ZDV A;  4XYC A;  2KHW B;  4NJ7 A;  2PKO A;  4AS1 A;  4H2A A;  4BZA A;  3UF8 A;  2MHJ A;  3Q6B A;  1WH3 A;  2C7H A;  3R3M A;  4A55 A;  1WGR A;  4IW0 A;  1V80 A;  2KOX A;  3A9K A;  3RN9 C;  1IBX B;  2MJD A;  1I4P A;  5D94 A;  1XXG A;  3EFU A;  1AWD A;  3MC9 A;  2WXL A;  3NY5 A;  1MVK A;  1VDV A;  1JWS D;  1LGR A;  4GSW A;  3VRA B;  4K7S A;  4RFB A;  4MT5 A;  2BYE A;  3RNF C;  4OZC A;  1PDX A;  2J4X A;  2YLM A;  4YL8 A;  2AL6 A;  1FFV A;  4HEA 1;  2BS2 B;  2KNB A;  1T6B X;  2W3S A;  3S2A A;  3ZRF A;  5E6O A;  3X23 A;  1B1Z A;  4PYZ A;  3JVZ X;  2Y5C A;  2O6V A;  1TY0 A;  3HM3 A;  4PT5 A;  4MM3 B;  4HCP B;  3AEC B;  4C4V B;  1UWM A;  3BII D;  4EKU A;  3ZVV A;  1V1P A;  4IM2 A;  1WFY A;  4GIV A;  3V61 A;  4JL9 A;  2WXQ A;  1YOV B;  1SJH D;  2IBI B;  1WGY A;  4OZA A;  4IUM B;  2KMA A;  1K8R B;  2JYE A;  2HJ8 A;  3DOW A;  2WXP A;  1WXS A;  5LXI B;  2PJH A;  2AX5 A;  3D32 A;  2NR2 A;  2M17 A;  1MHH E;  3NJT A;  1QOA A;  1UWX A;  2K9X A;  3N30 A;  3B1L X;  2LHD A;  1L4Z B;  1DOY A;  4PYU A;  5C1Z A;  3VR8 B;  2KKC A;  1KFY B;  1YD8 U;  2N9P C;  2KJR A;  1KLG D;  2I1J A;  3IT6 B;  2LVQ A;  2G9H D;  1JRO A;  4ICV A;  1YN5 A;  3RD2 A;  2IJ0 A;  3ZLZ A;  2NVU I;  3WIM A;  1I42 A;  2ZNV C;  4NY0 A;  4ARI A;  2GBM A;  3HM6 X;  1FPY A;  3CIR B;  3IAM 1;  1SEB D;  1ZKH A;  4ZRP A;  4KSL C;  4MGI E;  1FO4 A;  1F2R C;  2LJ5 A;  2PE9 A;  4FHJ A;  3O65 B;  4WWP A;  4BOZ B;  4L1B A;  1EU4 A;  3Q3O C;  2KN4 A;  3Q3M C;  4NPN A;  5JZE B;  1WYG A;  2L05 A;  1YIW A;  3L17 A;  2BYT A;  2KMC A;  4DK5 A;  4BVU C;  4WIP A;  1XLN A;  2LEK A;  2KO3 A;  5IO9 A;  3ZUN A;  1ZXH A;  2AL3 A;  4KDL B;  2A4Z A;  1T0S C;  4TSS A;  5C3J B;  1C76 A;  3OAW A;  2BVC A;  4TV3 A;  5HKH A;  3BY4 B;  3AEG B;  2CHZ A;  2IO0 B;  4NQK E;  3ECI A;  3QCA A;  4YT0 B;  4G0N B;  5IA7 A;  2IGD A;  1SE2 A;  4PK1 A;  4FUL A;  1ET6 A;  2RSU A;  1MG8 A;  2EMT A;  3Q8B A;  4K81 A;  2KX3 A;  1ZDX A;  2KDI A;  2PLP A;  3KW5 B;  3VTW A;  2DAF A;  1FIQ A;  3PZ7 A;  4JE3 B;  3QQ8 B;  3SHQ A;  5C23 A;  5AUK A;  1P98 A;  3N32 A;  4A20 A;  4GLS C;  3AV8 A;  3ZNG C;  1J7A A;  2L32 A;  2C60 A;  2CHW A;  3ETR A;  4LDT D;  2FCN A;  2RMM A;  2D2Q A;  3QJZ A;  1TGZ B;  2HDE A;  2BF8 B;  1JQ4 A;  3RNC C;  1PFD A;  2XK5 B;  2LVO A;  2KQS A;  1UF0 A;  2RGF A;  1CQV A;  2FUH B;  3VUX A;  4W9C A;  1DYQ A;  3H9D A;  3CWI A;  1EU3 A;  4PS7 A;  4A90 A;  3PSE B;  1AYF A;  3U30 A;  2V0G A;  4HLE A;  2MRP A;  1YQB A;  2W54 A;  3VFK A;  4ZHO A;  1P0R A;  1N6Z A;  5IAA C;  1H4R A;  4F8C B;  1V8C A;  4YTN B;  3OWE B;  5AEK B;  4JQW C;  3BK2 A;  3KYC D;  2BBC A;  1SBB B;  1X1M A;  2VZK B;  3AE2 B;  3H1U A;  3C0R B;  3Q14 C;  2WU2 B;  3P63 A;  1UNS A;  1VD2 A;  1N62 A;  3NRZ A;  4AWJ A;  1KF6 B;  1F0Z A;  2BW2 A;  3FIL B;  3ZXV A;  1I4H A;  2M19 A;  3DBL I;  1I7H A;  3W2D A;  3DQV A;  1YN3 A;  3AE9 B;  2J52 A;  5BYR A;  1AAR A;  2XEW A;  3PLV A;  2D3B A;  2NBW B;  3L0W B;  4NNJ B;  1EO6 A;  3RPF C;  1C79 A;  3K9O B;  1WGH A;  2LJI A;  2BKR B;  4REZ A;  4FN2 A;  4GOC A;  1QOF A;  1D4B A;  4ANV A;  1C4C A;  1L7Y A;  1LM8 B;  2MSE D;  4M0W A;  2ZVO A;  1VRA B;  4RMA A;  2XNA C;  1HXY D;  2V1Y A;  1TZ1 A;  1GOZ A;  3V60 A;  4YSX B;  2DNF A;  1F52 A;  2ZNV B;  1BML C;  2IY1 B;  1L5P A;  1L0V B;  2PEA A;  3EC8 A;  3L13 A;  3V05 A;  3EHV A;  1IPG A;  1FEH A;  1ISN A;  2HJ1 A;  1ZDV A;  4FJV B;  2I1K A;  2KTR B;  2X8X X;  3A9J B;  3M3J A;  3AE7 B;  5BMG A;  3NS1 A;  2QCZ A;  2M0X A;  2D3G A;  3HRD D;  3R8B A;  3WAO A;  1NVI D;  1MI0 A;  2BTE A;  1WXA A;  1K50 A;  4F1S A;  4NQL B;  5EE1 A;  5GXG B;  3AN1 A;  3SU8 X;  3N1Y C;  2IDY A;  2J42 A;  2D3C A;  2Y5B B;  4PS3 A;  2ZCC A;  5AZF A;  2C7N B;  4GMV A;  2NBV B;  4FBJ B;  3N1X C;  3WAN A;  1F2R I;  4KX6 B;  3NHE B;  1XT9 B;  4MH8 A;  1L6V A;  3VTU A;  3LB8 C;  3MC0 B;  2FUG 1;  3P4P B;  2WYQ A;  3MFG A;  4FA6 A;  2M8S A;  1VJK A;  3BYT B;  4LJP B;  3ZQ4 A;  1DGJ A;  3WAM A;  3L10 B;  1XLO A;  1EWY C;  2LGS A;  4NZL B;  2UYZ B;  2WXJ A;  1P1A A;  2JSV X;  1FD6 A;  2GB1 A;  1N5X A;  1IGC A;  3BYY B;  4JLC A;  2D5G A;  1Z2M A;  3AEE B;  1P7E A;  3ZRC A;  4JX1 C;  1E8Z A;  1LO5 D;  4KGR A;  1I4Q A;  2K25 A;  2BYV E;  5IP4 D;  4P1B C;  1E8Y A;  1T0Q C;  2V4L A;  1H8C A;  3B08 A;  2SAK A;  3R7Q A;  3HIZ A;  5KHQ A;  2DYM A;  3RFZ B;  2RPQ A;  3TIX A;  4LCD E;  4BKS D;  3KWL A;  3RUL A;  2CKH B;  1U4A A;  2IO1 B;  1HZ5 A;  1FXA A;  3P42 A;  3A4R A;  3B2G A;  3KVF B;  1DOI A;  1E7V A;  3MJ5 A;  4BOS C;  2D11 A;  1UGM A;  1OQQ A;  4CQN A;  2H88 B;  5JXV A;  2QDF A;  2QIL A;  5CHW A;  2L83 A;  3R66 C;  1J8C A;  4L23 A;  2OJW A;  2KTF A;  2K39 A;  3AE5 B;  2K5P A;  4P16 A;  4WAA A;  1PUT A;  3QAR A;  4MSM B;  2KDB A;  3T3O A;  2WX0 A;  3WAP A;  3TEW A;  3TUO A;  2IGG A;  3E56 A;  4C00 A;  3CF6 E;  3W1S A;  4HPP A;  4CHK A;  3U7Z A;  2JVC A;  3AEA B;  1XO3 A;  1RYJ A;  2DLB A;  2KC1 A;  1AN8 A;  1XD3 B;  2PVG C;  4CO7 A;  3VAW A;  2AQ2 B;  2MBQ A;  4YSY B;  2BB5 A;  4TQ1 A;  4LTU A;  4RGO S;  2BT6 A;  2O2V B;  1BUI C;  4R3D A;  3U2S C;  2OOB B;  3TEZ A;  2NPT A;  2ACZ B; 
#chains in the Genus database with same CATH homology
 2MWS B;  2EMS A;  2KWV B;  3N3K B;  4IUM B;  4BKG A;  5CHF A;  2KMA A;  4MJS A;  3Q3J A;  1K8R B;  4HJK A;  2HJ8 A;  2G4D B;  3DOW A;  4RM9 A;  4II2 B;  4HDO A;  2ZJD A;  2AEH A;  3QK0 A;  1WXS A;  3JSV B;  5LXI B;  2PJH A;  2IZV B;  3D32 A;  1WX8 A;  2NR2 A;  2M17 A;  2ZPN A;  2LWP A;  3DVN U;  2MBH A;  3L54 A;  2JXX A;  1TTN A;  4IWO A;  4AOF A;  5DPW A;  2JPH A;  1WXV A;  3AU5 A;  3N30 A;  5FR6 A;  3B1L X;  1WR6 E;  1Q1O A;  2WX1 A;  3PTF C;  1R4N I;  4J6I A;  4AJW A;  5JH5 C;  3U8Z A;  4B6W A;  4PYU A;  4M8M A;  5C1Z A;  2KKC A;  1YD8 U;  3A9K B;  2N9P C;  3AUL A;  2KJR A;  2MBB B;  1JRU A;  2BWE S;  1D3Z A;  1Z5S B;  1RRB A;  2PE6 B;  2I1J A;  3ZNZ B;  2LVQ A;  4K7W A;  4ICV A;  3L16 A;  3RD2 A;  4II3 B;  3ZLZ A;  2NVU I;  3WIM A;  4GDK B;  1I42 A;  2ZNV C;  1UEL A;  1Q0W B;  3PRP B;  3SD5 A;  4KVG B;  4NY0 A;  2GBM A;  4G50 A;  2WWZ A;  4MGK E;  4DBG A;  3HM6 X;  4EEW A;  1UD7 A;  2Z0E B;  3PHX B;  4I6L B;  2VRR B;  2MCN B;  1ZKH A;  2REX A;  4KSL C;  4MGI E;  2XK5 A;  4DHZ B;  5DPT A;  4KDI C;  1EF5 A;  2LJ5 A;  2PE9 A;  4OVV A;  4FHJ A;  2GBN A;  1WMH A;  1WRD B;  2B3A A;  2YVC A;  3KYD D;  3O65 B;  4WWP A;  4BOZ B;  4DHJ D;  1KOT A;  4KSK C;  3DVN V;  4NPN A;  4HPM B;  1I35 A;  2MQJ A;  2MX2 A;  4DXA B;  3ZDM C;  5JZE B;  1WJU A;  3DBR I;  2L05 A;  1YIW A;  3L17 A;  4IM0 A;  2O6V B;  2KLG A;  1E90 A;  2LZ6 A;  2KVR A;  1J0G A;  4K7U A;  2KMC A;  4DK5 A;  4BVU C;  2KFK A;  4W9H A;  4DHZ E;  2K8C A;  2KDF B;  5J2R A;  1PQS A;  2KO3 A;  3IVF A;  2ZEQ A;  2MP2 A;  2AL3 A;  4KDL B;  3ZUN A;  4PS8 A;  3UQB A;  1FXT B;  2A4Z A;  2JZZ A;  4HPL B;  3OAW A;  3VDZ A;  3KUC B;  2KJH B;  4HCN B;  5D2M B;  1NI2 A;  4ASW C;  2JRH A;  2C7M B;  2NPT B;  3OLM D;  4TV3 A;  2LAS A;  3BY4 B;  5HKH A;  4HXD A;  2CHZ A;  2IYD B;  3PRM B;  3QX1 A;  3UGB B;  2IO0 B;  4NQK E;  3ECI A;  4MJS B;  3QCA A;  2DYO A;  4G0N B;  5IA7 A;  4N9F 4;  1WIA A;  2BWF A;  3PGE A;  2NCN A;  2D10 A;  1E7U A;  2KX0 A;  5JHB A;  2K6Q A;  3ALB A;  2KD0 A;  4FUL A;  3KUD B;  1E8W A;  2RSU A;  1TBE A;  1MG8 A;  3PS6 A;  2EMT A;  2M4N A;  3JW0 X;  4K81 A;  4B9K A;  2IY0 B;  2KX3 A;  2LRU A;  3APD A;  3OJ3 A;  2KDI A;  3KW5 B;  3VTW A;  1WE6 A;  5DPR A;  2DAF A;  3I3T B;  1KJT A;  2K8H A;  3QQ8 B;  2DX5 B;  3SHQ A;  2K8B A;  4W9I A;  5C23 A;  4AP4 C;  1GC6 A;  4FHK A;  1P98 A;  1OQY A;  3X0W A;  3N32 A;  4A20 A;  1L2N A;  3JYU A;  4TUU A;  1WF9 A;  5AZG A;  4GN1 A;  4URK A;  3BIN A;  2HTH A;  2LVP A;  3HK0 A;  1GG3 A;  2JF5 A;  1GJZ A;  2V3S A;  4FJY A;  2L3Z A;  2HE7 A;  4CYE A;  1UZX B;  1M94 A;  3ZNG C;  4AUQ C;  2J0K A;  2DZM A;  2N7D A;  4WJN A;  2C60 A;  3PRE A;  2CHW A;  1S1Q B;  2LGD A;  2JRI B;  4LDT D;  1WGD A;  2C9W B;  1SE9 A;  4B95 A;  3PPA A;  3T8M A;  2FCN A;  2DZK A;  2D2Q A;  3QJZ A;  4LJO B;  1TGZ B;  4XX5 A;  1WZ0 A;  4OVU A;  2EKE C;  2LGY A;  1EUV B;  4GDL A;  2BF8 B;  1C1Y B;  5GMV A;  1E5W A;  2KLC A;  2XK5 B;  1V9J A;  4GU2 A;  2LVO A;  5E6P A;  2KQS A;  3IFW B;  2W9N A;  1WMH B;  2RGF A;  2FUH B;  3VUX A;  4W9C A;  3P2B A;  3H9D A;  2MLB A;  4MH0 E;  2ZVN A;  1CMX B;  4PS7 A;  2LRW A;  3PSE B;  4EFO A;  3U30 A;  2UWQ A;  1WX9 A;  5EDS A;  4HLE A;  4W9E A;  2KZR A;  4W9G A;  3ZTC A;  2N4F A;  3AU4 A;  2MRP A;  3ML8 A;  1YQB A;  5G2N A;  2KFK B;  3RCZ A;  3VFK A;  1WGG A;  2L0F A;  1P0R A;  2BYF A;  4LDT B;  5IAA C;  1H4R A;  4F8C B;  1IP9 A;  2MP2 B;  5CTR C;  3AI5 A;  2NBU A;  4JGH B;  3UIP B;  4BKS A;  1WY8 A;  3QWZ B;  1OGW A;  4DDI D;  1WJ6 A;  2O6V D;  3UIO B;  2KTR A;  5AEK B;  1G6J A;  4JQW C;  3KYC D;  4KIK A;  2MW5 A;  1X1M A;  3H1U A;  4WQO B;  4MSQ B;  1WX7 A;  2ZZP B;  3PZD A;  4ZYN A;  4EOY A;  3DVG X;  2KC2 A;  3M63 B;  3IG3 A;  1GUA B;  2JY6 A;  5D6J B;  3C0R B;  4A3O A;  4EZL A;  1V6E A;  1NBF C;  3ZNH B;  3M95 A;  3QIJ A;  2Z0D B;  4NJ6 A;  1VD2 A;  4BBN F;  2NS5 A;  4AWJ A;  1ZW7 A;  4XZ4 A;  3QAQ A;  4IWQ A;  4ZRK A;  1GC7 A;  1V49 A;  3A33 B;  2DZJ A;  3H6N A;  4NAW A;  3A1Q A;  3DBL I;  1A5R A;  3DQV A;  2CU1 A;  5LXH A;  4WJP A;  3LDZ E;  3WAL A;  1IYF A;  1AAR A;  3ZTD A;  2ZCB A;  3RT3 B;  2XEW A;  3DBS A;  3PLV A;  2HD5 B;  2KK8 A;  2NBW B;  3UQA A;  3L0W B;  3RZF A;  4AJY B;  3VQI A;  4GGQ A;  4W9K A;  4WJQ A;  4NNJ B;  1EO6 A;  4A3P A;  3ZNI D;  2KWC A;  2K6D B;  2L7R A;  1OTR B;  4W9D A;  2GOW A;  1KM7 A;  2AYO B;  3PVL A;  5E6N A;  3K9O B;  4KV2 A;  4WWN A;  1WGH A;  1R4M I;  3K9P B;  4IM3 A;  2D07 B;  5KHO A;  4DWF A;  2JT4 B;  2FCS A;  4FJZ A;  2BKR B;  3M62 B;  4FN2 A;  4GOC A;  4JIO U;  4ZRI A;  2KDE B;  2QHO A;  4ZRJ A;  4ICU A;  1V86 A;  4ANV A;  3ZW3 A;  4M8N A;  3DBH I;  4XC2 A;  1L7Y A;  1LM8 B;  2MSE D;  3AXC A;  3H7P A;  3TJP A;  3VH3 B;  3VH4 B;  4GDL B;  2N9X A;  3GOE A;  3VVW B;  2ZVO A;  4HWI B;  3MTN B;  4GB9 A;  4EZK A;  4RMA A;  2KAN A;  2ZPY A;  4E3C A;  3APC A;  3PRZ A;  3TMP B;  1WJ4 A;  2RR9 A;  1P3Q U;  2V1Y A;  2GBJ A;  3VUY A;  2G3Q B;  2L8J A;  1QZE A;  3CST A;  1TZ1 A;  2MBE A;  3V60 A;  2J0M A;  2CHX A;  2XBB C;  2J0J A;  3PLU A;  3W1Y A;  3TBL D;  2ZNV B;  1P9D U;  2L76 A;  2IY1 B;  2PEA A;  2R2O A;  4W9J A;  1ZGU B;  1OEY A;  3DDC B;  3EC8 A;  3L13 A;  4W9F A;  3ONS A;  3EHV A;  1IPG A;  1SIF A;  2CS4 A;  3UIN B;  5L95 C;  1ISN A;  4FJV B;  1WE7 A;  2LUE A;  1T0Y A;  1EF1 A;  2I1K A;  2FCQ A;  2L00 B;  2KTR B;  4MGY E;  1RFA A;  3A9J B;  4KIK B;  3M3J A;  5CHV C;  4E71 A;  1Q5W B;  1KLV A;  3VHT C;  2L0T A;  2KJ6 A;  3OJ4 B;  5D7G A;  2N1V A;  5CX3 A;  1C3T A;  1BT0 A;  2M0X A;  4G3X B;  1UBQ A;  2D3G A;  4KZ0 A;  3HHM A;  3WAO A;  2DYB A;  3QC8 B;  4HDQ A;  1WXA A;  2KXJ A;  3RUI B;  1VCB A;  1WJN A;  4IWP A;  3ZIM A;  2M1M A;  5AZH A;  1WZ3 A;  2BKF A;  3ENE A;  4F1S A;  4NQL B;  4E74 A;  3MHS D;  3PT2 B;  2OJR A;  3RYT A;  2WDT B;  2GBK A;  4NAW B;  3SU8 X;  4TQ0 A;  1WYW B;  2BPS A;  3A1Q B;  2Y5B B;  3B0A A;  1HE8 A;  2DHZ A;  2FCM A;  2JUO A;  3NZU A;  4MEM A;  3QA8 A;  1YX5 B;  4PS3 A;  2LD9 A;  2ZCC A;  5AZF A;  4TKN A;  2C7N B;  4GMV A;  4HVB A;  1V81 A;  3W1S C;  1YJ1 A;  2IO2 B;  2NBV B;  2ASQ A;  4W9L A;  1SGH A;  4FBJ B;  2A5U A;  1LFD A;  2Z59 B;  4MDK E;  3WAN A;  4BBN C;  1S3S G;  1RLF A;  3NHE B;  1XT9 B;  2MA9 B;  3IHP C;  3VTU A;  4ANX A;  2KWU B;  2JWZ A;  3KUZ A;  3PHW B;  4I6P A;  2WYQ A;  2FAZ A;  2GMI C;  1UBI A;  3WA0 A;  4FA6 A;  3A9J A;  2M8S A;  4I6N B;  2RD0 A;  4LJP B;  3H7P B;  4M0W B;  1LQB A;  1OEY J;  3WAM A;  3L10 B;  4WJO A;  2AWT A;  4EUT A;  4EZJ A;  2UYZ B;  1P1A A;  3L08 A;  5LLI A;  3R7R A;  3V6E B;  2DZI A;  2N7E A;  1V2Y A;  4FAD A;  2JZ3 B;  4JLC A;  4RM8 A;  4MEL A;  4FLH A;  4MM3 A;  3U7D A;  1Z2M A;  2LGX A;  5DPS A;  3ZRC A;  2J7Q B;  1E8Z A;  3ZDT A;  3V6C B;  3DCG A;  3VUW A;  4BFR A;  2O2V A;  3V62 A;  2K25 A;  2LI5 A;  3CMM B;  5G55 A;  2BYV E;  3CSF A;  3Q3F A;  1V5T A;  2BGF A;  1E8Y A;  4IC7 B;  1WM2 A;  3DPD A;  3TL5 A;  2FNJ B;  2FIF A;  2V4L A;  3NS8 A;  1H8C A;  3B08 A;  3EEC A;  3RZW C;  4ZDV A;  3R7Q A;  3HIZ A;  4K1R B;  5KHQ A;  2DYM A;  2GBR A;  4ANW A;  4DDG D;  3JSV A;  2KHW B;  2RPQ A;  4NJ7 A;  5L83 A;  2MBO A;  2R2Q A;  1RAX A;  3H7S A;  3QHT A;  3TIX A;  2LXC A;  4LCD E;  4BKS D;  3RUL A;  3UF8 A;  2G45 B;  2KFJ A;  2K1F A;  2CKH B;  1WH3 A;  1E8X A;  1U4A A;  1V5O A;  2C7H A;  1NDD A;  2IO1 B;  3R3M A;  3DVG Y;  3T9L A;  3MJW A;  4P7I A;  1WGR A;  4IW0 A;  1V80 A;  2DAJ A;  3A4S C;  4HK2 A;  1F9J A;  2N1W A;  5J18 A;  2KOX A;  3A9K A;  3A4R A;  5TR5 A;  4MGZ E;  5D94 A;  3KVF B;  1E7V A;  4BOS C;  5DCN A;  2D11 A;  3EFU A;  2KN5 A;  3ZKJ C;  3SDL C;  2CR5 A;  3VXW A;  1UGM A;  3NY5 A;  4ANU A;  4GDK A;  4KZC A;  4DHJ B;  4GSW A;  4K7S A;  4WWO A;  5CHW A;  2BYE A;  3VTV A;  3R66 C;  4IG7 B;  1YX6 B;  1WI0 A;  1J19 A;  2YLM A;  3LJ3 A;  5JHA A;  1J8C A;  4YL8 A;  2AL6 A;  4G11 A;  2KTF A;  3NZS A;  2G4S A;  2K39 A;  4WAA A;  3PV1 A;  3QAR A;  5BO4 B;  4MSM B;  2KDB A;  3APF A;  2KNB A;  2WX0 A;  3WAP A;  3S2A A;  1UH6 A;  3ML9 A;  1Y8R C;  2C5L C;  3ZRF A;  3CF6 E;  2FID A;  5E6O A;  3W1S A;  4CHK A;  4F7Z A;  3X23 A;  2JVC A;  2LXA A;  3JVZ X;  4PYZ A;  2O6V A;  3IBE A;  2IO3 B;  1WM3 A;  1XQQ A;  3HM3 A;  1WXM A;  1WR1 A;  2KC1 A;  2KQ7 A;  3NOB A;  1XD3 B;  3TCA A;  4HCP B;  4CO7 A;  3KH0 A;  4BKT A;  3VAW A;  2DEN B;  4EKU A;  2MBQ A;  1GNU A;  4TQ1 A;  4X57 B;  3GZN I;  3ZVV A;  3ZO5 B;  4IM2 A;  1WFY A;  4GIV A;  3V61 A;  4JL9 A;  2O2V B;  5J17 A;  2OOB B;  1LXD A;  2N9E B;  2NPT A;  2IBI B;  4GXB A;  1WGY A;  2PPH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...