4NJ7A

Pb1 domain of atarf7 - semet derivative
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
77
Chain Sequence
b'YTAVQKRGSVGRSIDVNRYRGYDELRHDLARMFGIEGQLEDWKLVYVANAILLVGDDPWEEFVNCVQSIKILSSAEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Auxin response factor 7
molecule tags Protein binding
source organism Arabidopsis thaliana
publication title Molecular basis for AUXIN RESPONSE FACTOR protein interaction and the control of auxin response repression.
pubmed doi rcsb
total genus 13
structure length 77
sequence length 84
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4nj7A00
2BKFA 3A1QA 2O6VD 2KZRA 3HIZA 2I1JA 1WFYA 2IO0B 1WGYA 2EMTA 2K8CA 4P7IA 4DDGD 3WAMA 4W9KA 4HCNB 3ZIMA 3PRZA 2MWSB 2O2VA 4GDLB 2DYBA 4RMAA 4A20A 1Q1OA 2Z59B 1CMXB 2K8BA 4IM2A 4W9FA 3RD2A 2NBVB 2V3SA 4II2B 3ZUNA 4CYEA 1BT0A 2C9WB 3WANA 4B95A 4CO7A 5AEKB 3PREA 2KHWB 3ALBA 2DHZA 4LDTD 2KVRA 1J0GA 3B08A 1YX5B 2LGYA 3ML9A 2C7NB 3RUIB 4ASWC 5JZEB 1WXAA 4IWPA 3U8ZA 2NCNA 2R2OA 4W9JA 1P98A 4II3B 5BO4B 3R7QA 4URKA 2YVCA 1GUAB 2MBBB 1WX9A 2BYEA 1R4MI 2MX2A 1K8RB 4G11A 4KV2A 4EZKA 4GDKA 3V6CB 1RFAA 1QZEA 1WMHA 2V4LA 4EFOA 4MGKE 2KJRA 4B9KA 4GGQA 1WI0A 3B1LX 2AL3A 4EZJA 5FR6A 3CSFA 1YIWA 1NDDA 2IO1B 4A3PA 3JSVB 4K7UA 1WF9A 3SDLC 3VAWA 4KDIC 4NQLB 1E5WA 4FJZA 5GMVA 2REXA 3L54A 2ZJDA 2IY0B 4MGZE 4E71A 2BWES 2UYZB 4KVGB 4ICVA 1A5RA 2LVQA 2KTRB 3PV1A 3DBLI 4LJOB 2PE9A 1WGGA 2BKRB 2D10A 3ZO5B 4BVUC 1OGWA 3H1UA 3L13A 2JRIB 3KVFB 1Z2MA 2BF8B 1WR6E 4DBGA 2D07B 2CS4A 3JYUA 1VD2A 2MBQA 3EC8A 4HLEA 4MSMB 2G4SA 4TKNA 1WGHA 2N7EA 1H4RA 2K8HA 1LFDA 1WH3A 2JT4B 4JQWC 5C23A 2N9XA 2DZMA 1ZKHA 3APFA 3QIJA 2GBRA 2XEWA 2L3ZA 4OVUA 1R4NI 2D2QA 2JRHA 3H9DA 3PHXB 5D6JB 2AYOB 2VRRB 3DVGY 4JL9A 3N30A 3VUYA 2O6VB 2MP2B 2K39A 4KZ0A 2LVPA 2AWTA 2NPTB 4WJNA 3AXCA 3ZTCA 2PPHA 1LXDA 2GBJA 2G4DB 2FCQA 2LASA 3GZNI 5AZHA 2BYVE 4ZYNA 2FNJB 3PLVA 4NNJB 3UGBB 2M17A 2L76A 2IO3B 2JXXA 3AI5A 3L10B 4W9DA 4TV3A 1J8CA 4ZRJA 5IAAC 3VUXA 3EHVA 1UGMA 4JGHB 2LD9A 4WWOA 1RRBA 5AZGA 2KC1A 2C60A 1LM8B 4HWIB 4MH0E 3H7PB 2FCNA 2ZNVC 4KSKC 2M1MA 4I6NB 4YL8A 3T9LA 4BFRA 4W9LA 2KFJA 1WJ6A 5L95C 4IG7B 4PYUA 4IWOA 2JF5A 4HXDA 1TGZB 3HK0A 3X23A 2GBNA 4MJSA 4F1SA 1UBIA 3K9PB 4IW0A 1V5TA 1UH6A 3VUWA 3CF6E 4HDQA 2M0XA 3A9JA 4AJYB 3TBLD 3PHWB 2LGDA 5LLIA 2DZKA 3A33B 2MRPA 3ZDTA 1E8ZA 4MGIE 4ZRKA 2K6QA 4BKGA 2JWZA 1E90A 3RT3B 3R66C 2D3GA 1Q5WB 3NY5A 2FCMA 2MQJA 4GMVA 2OJRA 2XBBC 3ZNID 5J17A 1C3TA 2WX0A 1WRDB 2L7RA 3NOBA 1V5OA 3V6EB 4DXAB 3AU4A 5J2RA 2DENB 4HJKA 4M0WB 3K9OB 3WA0A 2AEHA 4DHZB 1XQQA 4W9CA 3ZKJC 1V6EA 2ZPNA 3W1SA 2KMCA 1ISNA 3VTUA 2KFKB 3ZW3A 3A1QB 5HKHA 4WJPA 1WYWB 1E8YA 3CMMB 3H7SA 4MEMA 5JH5C 3DVNV 1X1MA 4X57B 4ZDVA 2KWUB 3ZDMC 3HM3A 3PVLA 4NAWA 5JHAA 2K1FA 1WXSA 4F8CB 2KJ6A 3R3MA 2BYFA 2KWVB 4GN1A 3QC8B 3A9KA 4FHJA 1U4AA 2WWZA 1GG3A 2MBEA 1Q0WB 1SGHA 2JZZA 1ZGUB 3IHPC 3TL5A 1MG8A 3KW5B 3SU8X 4M8NA 2KNBA 1PQSA 2KDIA 4HVBA 4IC7B 2NBWB 3VDZA 2LI5A 1WJUA 3A4SC 2DZJA 2LXCA 4MM3A 1L7YA 2LRWA 2KO3A 2DAJA 4EUTA 5L83A 4WQOB 3ML8A 3BY4B 3N32A 4XC2A 4EEWA 3PGEA 5D94A 2KLGA 2IY1B 1D3ZA 1VCBA 3OJ4B 2ZVNA 3QQ8B 3RCZA 3L17A 2A4ZA 4EZLA 3MTNB 3PRPB 1I35A 3NZUA 1GC7A 2ZNVB 2W9NA 2B3AA 3AULA 1TTNA 3PLUA 4KIKA 2GBKA 2MLBA 4B6WA 3C0RB 3JVZX 2Y5BB 3PS6A 2FIDA 4FJVB 2FIFA 4ICUA 3SHQA 3SD5A 2QHOA 4I6LB 4FJYA 5CHVC 3L16A 4GSWA 4AUQC 4PYZA 3APDA 3Q3JA 5DPSA 2DYMA 2JZ3B 4PS8A 2GBMA 4RM8A 5D2MB 4A3OA 4HDOA 4NJ7A 4WAAA 1V81A 3QJZA 5DCNA 4DHJD 4AP4C 2KC2A 5G2NA 5E6PA 4RM9A 1EF5A 3TMPB 1C1YB 3VTVA 4KIKB 2ASQA 2K6DB 4KDLB 2GOWA 2JY6A 1XD3B 3M63B 1WXVA 1YD8U 1H8CA 3RULA 4J6IA 2DYOA 4MDKE 2CHXA 2IBIB 3VXWA 2KLCA 3GOEA 1WZ3A 5CX3A 3VHTC 2KKCA 4WJOA 5TR5A 1L2NA 4DHZE 2WYQA 2CKHB 2EKEC 1P3QU 3TJPA 2AL6A 2LJ5A 1WJNA 2KTRA 1V86A 3M3JA 2KQ7A 4TUUA 1OEYJ 1JRUA 3ZVVA 4NY0A 4BKTA 2LZ6A 2O6VA 3A4RA 2RR9A 4W9IA 2JUOA 2RD0A 2LWPA 2KTFA 2L0FA 1KLVA 2R2QA 3UINB 4IUMB 3VFKA 1YQBA 2GMIC 2L0TA 2KK8A 1V9JA 2J0JA 3JSVA 3APCA 2C7HA 3IFWB 4BOSC 2BWFA 4XZ4A 2I1KA 3ZLZA 3QAQA 3ZNHB 2FCSA 1TBEA 4K7WA 4EOYA 5E6OA 1WMHB 3AU5A 4LJPB 3W1SC 1V80A 2MSED 5DPRA 3PRMB 3KUZA 4LCDE 1RAXA 3DQVA 2KFKA 2KWCA 3QWZB 1OQYA 1XT9B 1KOTA 3V60A 2KANA 3UF8A 3ONSA 2BPSA 2EMSA 3CSTA 2LVOA 4OVVA 1SE9A 1WXMA 3DBSA 2MA9B 3UQAA 4DHJB 4FADA 1WE6A 1GNUA 2KXJA 3IG3A 3RZWC 5CHFA 2V1YA 5E6NA 3MJWA 1EF1A 1NI2A 2IO2B 3OLMD 2OOBB 4W9HA 2L8JA 3DOWA 4JIOU 5AZFA 1WJ4A 2LRUA 1G6JA 3D32A 2N1WA 4E3CA 1E7VA 3TCAA 2KD0A 3QX1A 1FXTB 3U7DA 1ZW7A 4G3XB 1YJ1A 3WALA 3A9KB 2N9EB 4AJWA 3R7RA 3WAOA 4FBJB 4TQ0A 4HCPB 4NAWB 3A9JB 2G3QB 2ZCCA 2A5UA 3NZSA 4IM0A 4BKSA 5D7GA 1WE7A 1LQBA 3TIXA 4HPLB 2CHWA 2N1VA 3ZTDA 1GJZA 2IZVB 3ZNGC 2KDFB 2CHZA 3O65B 3EECA 1WM2A 3NS8A 4EKUA 2HE7A 2MW5A 4BBNC 4BOZB 3DDCB 3WIMA 1E8XA 3UQBA 1GC6A 2LGXA 3PT2B 3OAWA 5IA7A 4CHKA 4KSLC 3H6NA 2PEAA 3DBRI 4K1RB 3RZFA 3RYTA 1EO6A 2HJ8A 2KQSA 2WDTB 1RLFA 3VQIA 2N7DA 4G50A 3KYCD 1SIFA 1WGRA 5LXHA 2XK5A 2KDBA 3EFUA 3DVNU 5JHBA 4MGYE 2N9PC 5LXIB 4XX5A 2FAZA 2BGFA 1P0RA 2RGFA 5CTRC 4DDID 3QARA 3HHMA 4GIVA 2N4FA 1UD7A 3KUCB 1UZXB 4WWNA 3DVGX 2NPTA 3L0WB 4JLCA 4NQKE 4AOFA 3KYDD 4AWJA 5DPTA 2MP2A 2HTHA 3ZRFA 4W9GA 3ENEA 3PZDA 4NPNA 5CHWA 4WWPA 1TZ1A 1YX6B 1WZ0A 3U30A 3ZRCA 3QA8A 4W9EA 4DK5A 1WX8A 4GU2A 4FHKA 2KN5A 1EUVB 3KUDB 2ZVOA 1NBFC 3ZNZB 3LJ3A 3VTWA 3H7PA 2K25A 5C1ZA 2KMAA 4ANXA 4M8MA 1S3SG 2JVCA 2FUHB 2PE6B 4ANUA 2NBUA 2XK5B 4WJQA 3DBHI 2J0MA 4GOCA 1V49A 2Z0EB 3S2AA 1E7UA 2DAFA 1J19A 4PS7A 3VVWB 1E8WA 3QCAA 3X0WA 4BBNF 4BKSD 5DPWA 4I6PA 2RSUA 2ZPYA 3B0AA 1Y8RC 3VH4B 4K81A 1IPGA 1S1QB 4FULA 4ANWA 2KDEB 2LUEA 4ZRIA 5G55A 3MHSD 5J18A 2CR5A 2JPHA 2C5LC 1F9JA 4MELA 4E74A 2L05A 1WIAA 4G0NB 1P1AA 3JW0X 3ECIA 1Z5SB 2YLMA 1WR1A 3M62B 3DCGA 3PTFC 5KHOA 4F7ZA 1I42A 3NHEB 2MCNB 2IYDB 1V2YA 3PSEB 4GB9A 4DWFA 3KH0A 4N9F4 3UIPB 1KJTA 2MBOA 2KOXA 3IBEA 3N3KB 2RPQA 2UWQA 2Z0DB 3Q3FA 3QHTA 2J7QB 2J0KA 1M94A 1UELA 1OTRB 1IYFA 4KZCA 2ZCBA 2DX5B 2M8SA 2L00B 4FLHA 3I3TB 2M4NA 4HK2A 1P9DU 3V62A 3PPAA 3VH3B 3UIOB 5EDSA 3LDZE 4MSQB 2NVUI 3W1YA 1WGDA 2CU1A 2HD5B 1KM7A 3BINA 1HE8A 2G45B 3QK0A 2PJHA 1WX7A 3T8MA 4IM3A 1AARA 3V61A 2O2VB 4GDLA 2ZZPB 1OEYA 3M95A 4HPMB 2KJHB 4K7SA 2NR2A 4ANVA 3WAPA 5KHQA 2DZIA 1T0YA 2KX3A 2C7MB 2D11A 1WY8A 1WM3A 2KX0A 2WX1A 4GXBA 4FA6A 4NJ6A 1IP9A 2MBHA 3L08A 4TQ1A 3DPDA 3HM6X 2LXAA 3OJ3A 1UBQA 4PS3A 4GDKB 4IWQA 3P2BA 4LDTB 2NS5A 3IVFA 4MJSB 4FN2A 2ZEQA
chains in the Genus database with same CATH superfamily
3HIZA 1WFYA 2IO0B 5G5GA 3ZIMA 3PRZA 2MWSB 4GDLB 4RMAA 1EU4A 2DYBA 4A20A 4ZOHC 3RD2A 1VZ7A 5EE0A 2GRIA 4CO7A 5AEKB 2KHWB 1J0GA 2KVRA 1DOIA 1YX5B 4KX6B 1WXAA 2NCNA 4AQ7A 4RH6A 1KF6B 1P98A 5BO4B 3R7QA 2BYTA 1GUAB 5HI1A 2MX2A 2UU7A 5FKAC 4G11A 1D5XC 3Q8CA 3B1LX 2AL3A 3CSFA 4KDIC 1ACCA 1E5WA 4LLGM 4E71A 3V3XA 1XO3A 2YEPB 4KVGB 3NJTA 3PV1A 3DBLI 4LJOB 2L32A 3ZO5B 5MPOA 1N63A 1OGWA 1Z2MA 2BF8B 3NZ3A 2D07B 2BVCA 3EC8A 2K8HA 1F0ZA 1LFDA 3PO0A 3V05A 2JT4B 5BYRA 4KGRA 1FFVA 2XEWA 3TEXA 4M01A 1R4NI 2D2QA 3AEBB 3R2IA 3DBLB 4RCOA 2PKOA 4RGOS 2VRRB 2BS4B 3ETRA 3NRZA 1HZ5A 3N1XC 2BYVE 3VRBB 1FNUA 4ZYNA 4NNJB 4XYCA 3UGBB 2IO3B 2JXXA 2RPVA 4MH8A 4W9DA 1J7BA 2CJNA 4ZRJA 2AQ3B 3EHVA 4M0WA 1JWUD 2JXTA 1RRBA 1T0QC 1SF0A 4KSKC 2ON8A 4YTMB 3TEWA 2PVOD 4BFRA 4L1BA 4W9LA 1WJ6A 4IWOA 2TSSA 2WXMA 2JF5A 3TUOA 3E56A 1L0VB 2J52A 4HDQA 2M0XA 3A9JA 3A33B 3Q8EA 3ZDTA 4MGIE 2K6QA 3UI3A 1SXTA 1Q5WB 1PGBA 3GZNB 2FCMA 3Q3NC 3ZNID 1UNSA 2L7RA 1I4QA 1V5OA 4DXAB 5J2RA 1V1PB 4HJKA 4M0WB 3K9OB 1V6EA 3I5JC 1ISNA 1P7EA 4P6VF 3VTUA 3ZW3A 3NUHB 5HKHA 4WH4A 4WJPA 1WYWB 1ZDXA 3CMMB 4ZHPA 3H7SA 5JH5C 3DVNV 2K1FA 2KJ6A 1FXIA 4GN1A 3A9KA 4FHJA 4KGTA 2JZZA 3ZXRA 1MG8A 5GXGB 4N58A 3SU8X 2B76B 2W3RA 4M8NA 2ZW1A 1ZXHA 4HVBA 2DZJA 4MM3A 1HXYD 2DAJA 4WQOB 2KYWA 2KLGA 2IY1B 1VCBA 1ROEA 3RCZA 1C4CA 3AULA 3IXSA 3JVZX 3PS6A 5IO9A 2FIDA 3L4PA 3SHQA 3L16A 2KDMA 2DYMA 4PT5A 1T6BX 3DWMA 3KWLA 4WAAA 2ZW0A 4HJGE 3TEYA 3B2GA 1FXAA 4DHJD 1AWDA 4KIKB 2K6DB 4KDLB 1XD3B 2RDHA 1H8CA 3RULA 4J6IA 2IBIB 3GE3C 2KLCA 3VRAB 4JWSC 5CX3A 4WJOA 2WYQA 1STEA 2EKEC 2JU6X 3NVWA 3TSSA 1P3QU 3TJPA 2LJ5A 2MEKA 4C7YA 1V86A 5BYQA 1OEYJ 2LZ6A 4W9IA 1ZDVA 2PVGC 2JUOA 5D3DA 2EELA 2VH1A 2MJ3A 1V9JA 2J0JA 4BOSC 3ZNHB 2QCZA 2NMQA 1SSNA 2AQ2B 1RAXA 4LCDE 2KFKA 4P1CC 1SB3C 1EU3A 5LNK1 3OG5A 2LVOA 3UQAA 3N1YC 5CHFA 2V4IB 1EF1A 3Q3OC 2L8JA 4JIOU 1D6EC 3BZDB 3TCAA 2KD0A 3QX1A 2H88B 1FXTB 1E10A 1YJ1A 1RM6C 1JWSD 3WAOA 4TQ0A 4HCPB 4NAWB 2G3QB 4BKSA 2CHWA 2N1VA 3AE4B 2IZVB 2KDFB 3O65B 3P4QB 1WM2A 4LNFA 3DDCB 3I63C 1E8XA 2LGXA 4WAFA 4YSYB 2PEAA 3DBRI 2WDTB 1XCQL 1SE3A 2KQSA 3VQIA 2XN9C 1WGRA 5LXHA 2GLSA 3EFUA 1TKGA 2N9PC 5G5HA 4XX5A 5CTRC 2WXPA 3HHMA 1E9MA 2N7JA 3DVGX 2NPTA 3L0WB 4AWJA 4NQKE 3KYDD 2MP2A 2HTHA 5BYSA 3AEEB 3ENEA 4NPNA 5CHWA 1TZ1A 4GU2A 1EUVB 1V97A 2WXOA 3VTWA 1QQRA 1I4PA 1F2RI 2KMAA 3ABVB 2L1AA 3RMKC 1P7FA 1C79A 2FUHB 4ANUA 3W5UB 2H89B 2J0MA 1VRAB 1E7UA 3VVWB 3KQ4A 1M4VA 2ZPYA 4K81A 2KDEB 2CR5A 4MELA 2JPHA 1F9JA 4E74A 3JW0X 1XXGA 1WR1A 3BVGA 3DCGA 4F7ZA 4NAMA 2IYDB 1V2YA 1ZXIA 2KACA 4DWFA 3KH0A 2KT7A 2MBOA 2KOXA 2J0KA 4RNAA 1IYFA 2DX5B 2N9KA 3V62A 2AX5A 3PPAA 4XWWA 3VH3B 2LGIA 3P42A 3LDZE 1WWTA 2NVUI 2G45B 2GB1A 3AE6B 3QK0A 1JROA 5TSSA 3V61A 2O2VB 1XLQA 2KJHB 3WAPA 2NTTA 1L0YB 3AE1B 2C7MB 2X38A 1WY8A 1WM3A 4GXBA 2MBHA 1FPYA 2LXAA 3OJ3A 1UBQA 2LMCA 3P2BA 4LDTB 4J3OD 4FN2A 2O6VD 2KZRA 2I1JA 2WDVB 4W9KA 3U2SC 1UF0A 1CMXB 1E6EB 3ZUNA 4CYEA 4C7ZA 2C9WB 3WANA 3MP9A 3B08A 2C7NB 1QT9A 4IWPA 3U8ZA 2BYEA 4KV2A 4GDKA 1RFAA 2V4LA 4HRSA 3AEAB 5JXVA 1WI0A 4EZJA 5FR6A 1YIWA 1NDDA 1C77A 3KLSX 3VAWA 2REXA 4ZYSA 4MGZE 2BWES 1C76A 2LVQA 4LNOA 3H1UA 1OFFA 4DBGA 3Q8BA 3JYUA 2MBQA 1XEEA 3U4EG 4HLEA 4MSMB 1WGHA 2N7EA 4UDUC 1WH3A 4A6QA 5C23A 3LXFA 1ZKHA 1AN8A 3QIJA 4OVUA 2L3ZA 2W82A 1I7HA 1LXDA 2WXQA 2FCQA 2LASA 5IKCM 2FNJB 4LK0M 3AI5A 4NJCA 4H2AA 4XGAB 2LD9A 2C60A 4HWIB 4MH0E 1ZPSA 4YL8A 5L95C 4IG7B 2WXGA 3IAS1 1BUIC 4HXDA 5E6JA 4YT0B 1V5TA 3CF6E 3TBLD 3W2DA 2LGDA 1XLPA 3CIRB 3SFEB 2MRPA 2BTEA 3P4PB 2WP9B 1HZ6A 3R66C 2D3GA 1N61A 1XCTL 2MQJA 4GMVA 2OJRA 2XBBC 5J17A 1WRDB 3NOBA 3V6EB 2DENB 4DHZB 2AEHA 1XQQA 4W9CA 3ZKJC 2ZPNA 3W1SA 4K3BA 1YN5A 1X1MA 3ZDMC 4F8CB 1GPXA 1U4AA 1SGHA 2LJIA 1QILA 4XDDA 2SEBD 2KNBA 2LUMA 2NBWB 4TMAB 3A4SC 3AH7A 3EGRA 3NVZA 1EWYC 2QILA 3BY4B 1SIJA 1D3ZA 3OJ4B 4P16A 3QQ8B 2WXLA 2A4ZA 4EZLA 2KMMA 3PRPB 1I35A 3NZUA 2ZNVB 1MHHE 2W9NA 4B6WA 2GBKA 1KRHA 2MLBA 4ICUA 4A9AA 4FJVB 2FIFA 3DBHB 3SD5A 4YWGG 2QHOA 4I6LB 4GSWA 5DPSA 2JZ3B 4C80A 1KLGD 1FCLA 3W9CB 3QJZA 5I4DA 3Q2AC 3TMPB 2M56B 4FXCA 2ASQA 4JPSA 2GOWA 2M0AA 2KQ4X 1TS4A 4EE2A 2CHXA 2PMVA 3VXWA 4PK1A 1HTQA 1WZ3A 4C56C 1I4RA 4M02A 4DHZE 4QAYA 4REZA 5BMGA 3AE7B 1WJNA 3FKYA 2J53A 1Q10A 2KTRA 4TUUA 4NY0A 4BKTA 1L5PA 2O6VA 1QKZA 1QOBA 2KTFA 1KLVA 2R2QA 3UINB 3VFKA 5HFYA 1YQBA 3JSVA 3APCA 2C7HA 2W3SA 3QAQA 1SEBD 2FCSA 4OZBA 1XLOA 4CQNA 4XDCA 1WMHB 2MSED 3PRMB 3EFCA 1XT9B 1KOTA 2KANA 2L83A 1WXMA 1KTKA 2KXJA 1OQQA 2V1YA 3HUIA 3OLMD 4W9HA 2HDEA 5AZFA 1WJ4A 1G6JA 1TZOA 3U7DA 3N20C 4G3XB 3AMZA 1ET9A 2N9EB 3P4RB 4FBJB 3HVDA 2ZCCA 1QOFA 2A5UA 5D7GA 1EM7A 1WE7A 2QMTA 3NG0A 2V3NA 1J7CA 3RI7C 1OQRA 1GJZA 2CHZA 5IN7A 2HE7A 1WGKA 3ZYYX 4LNKA 1VR9A 2W55A 3WIMA 4BOZB 2JWUA 4LTUA 3UQBA 2OEDA 1ZE3D 5IOIA 3H6NA 1HQRD 4R3DA 1EO6A 3RYTA 3KYCD 1SIFA 2XK5A 1Y56A 5JHBA 4MGYE 2N9LA 5LXIB 4P1BC 2BGFA 3QARA 2D5GA 3AE2B 2Y5CA 2HTME 4L2YA 4XWTA 3EUB2 4AOFA 2LEKA 4RGMA 3U30A 1F77A 3J9CA 3KUDB 2ZVOA 2BB6A 5C1ZA 4ANXA 4M8MA 1UGJA 2PE6B 3DBHI 3S2AA 2DAFA 4PS7A 2J4XA 4WWMA 1Y8RC 1DGJA 4JX1C 4IDIA 4HROA 4ANWA 2IGGA 3MHSD 4G0NB 3BWUD 3ECIA 1Z5SB 3M62B 2WXKA 1C4PA 3PSEB 4N9F4 1L6VA 3DWGC 2UWQA 2J7QB 1OTRB 4N6EB 1NENB 2M8SA 4FLHA 1P9DU 3UIOB 1D5MC 4MSQB 3W1YA 4RGNA 1AYFA 5T8IA 1WX7A 3T8MA 2ZZPB 1OEYA 4HPMB 5KHQA 2DZIA 1WXQA 4WQMA 3R2TA 1SJHD 4FA6A 4TQ1A 3L08A 1E7PB 4GDKB 2WU5B 2ZEQA 2ICIA 2K8CA 4P7IA 1WGYA 2EMTA 1TS3A 3DHHC 3WAMA 4HCNB 2PIAA 1I4XA 1ET6A 1Q1OA 2Q5WD 2Z59B 1ZP0B 4W9FA 2NBVB 2N0SB 4II2B 3ZJTA 2PW9A 3PREA 1AW7A 1DOXA 1F2RC 2IPKD 4LDTD 1HA5A 3ML9A 3RUIB 3RNFC 4ASWC 5JZEB 4RF0A 3RNEC 4II3B 4URKA 2MBBB 1DOYA 1WX9A 1R4MI 1K8RB 4EZKA 3V6CB 1WMHA 1I4GA 4MGKE 4EFOA 4GGQA 2IO1B 4A3PA 4IKGA 3FILA 3JSVB 4K7UA 5IP4D 4FJZA 5GMVA 2IY0B 3URYA 4KKJA 2R61A 4ICVA 5H92C 3RNCC 2D3CA 2KTRB 4BZAA 4BVUC 4Q2JA 2JRIB 3KVFB 1WR6E 1VD2A 1HTOA 2QJLA 2G4SA 4TKNA 2BS2B 1H4RA 1WRIA 1FD6A 1PGXA 3AECB 2RDBC 4JQWC 2DZMA 3APFA 3MHZA 3ZXVA 1V8CA 2JRHA 1SE4A 3VUYA 3DVGY 4KZ0A 2LVPA 4WJNA 2PPHA 2GBJA 2G4DB 1RWSA 2MJDA 3L10B 3BK1A 1N60A 3VUXA 1FO4A 3RPFC 4WWOA 2KC1A 1LM8B 2LGSA 2FCNA 1C4AA 1L0XB 2M1MA 4I6NB 2E6XA 2INPE 2K3UA 2KFJA 1TGZB 2M19A 3HK0A 3X23A 2GBNA 2SAKA 1UBIA 3K9PB 4IW0A 1RFKA 3VUWA 3VR9B 4AJYB 3PHWB 5LLIA 3T3OA 1RYJA 3AEGB 1YNTE 1UWXA 4A8XC 2FUG1 4C00A 4BKGA 2VH2A 3AE3B 3B2FA 3GP7A 3NY5A 4DQOC 2WX0A 3AU4A 1E0ZA 1KFYB 1ZOYB 3WA0A 4HEA1 2KMCA 1F1HA 3MFGA 2WXRA 3A1QB 4N59A 4M00A 1BMLC 2PTLA 2JZPA 4X57B 2LHDA 2KWUB 3PVLA 4NAWA 2MHJA 3R3MA 1N5XA 2KWVB 3QC8B 2LFIA 4GLSC 2MBEA 3IHPC 4DXGA 3KW5B 1D5ZC 1MPEA 1TJEA 3VDZA 1L7YA 2LRWA 3SFDB 1K50A 3N32A 1QOAA 1MI0A 5D94A 4RGTA 1HEZE 3PLUA 2WXIA 2Y5BB 3RN9C 4OVZA 4AUQC 4PYZA 2OHFA 3APDA 2I38A 2BT6A 4PS8A 2GBMA 5D2MB 4HKQA 3U52E 5DCNA 5AUKA 1FNWA 2KC2A 1FFUA 5E6PA 4RM9A 1C1YB 1GAQB 3VTVA 2Z8LA 1TS2A 2JY6A 2BB5A 3AM9A 4AS1A 4A55A 3VHTC 2KKCA 1L2NA 2K0PA 2K22A 2CKHB 1NVID 2AL6A 3R8BA 2WNMA 3M3JA 2KQ7A 4OZCA 3ZVVA 2IGDA 2RR9A 1IBXA 2RD0A 2RMMA 5AUIA 2L0FA 4IUMB 2GMIC 2KK8A 2KWDA 1TBEA 3SEBA 2AQ1B 1V80A 5DPRA 1TY0A 3KUZA 3DQVA 2KWCA 1OQYA 3UF8A 3ONSA 2EMSA 4OVVA 1SE9A 3DBSA 2MA9B 1FMAD 4FADA 1WE6A 3RZWC 2KN4A 1JCKB 3DHIC 3MJWA 1PGAA 2WHIA 2OOBB 3DOWA 2YEPF 3GE8C 3GS2A 4S0RA 2N1WA 4E3CA 1IUEA 1LO5D 1ZW7A 1ZUD2 3A9KB 2BBCA 4S17A 1JRPA 1WYGA 1LQBA 3TIXA 4HPLB 2WGSA 2JQRB 3NS8A 4EKUA 4IOIE 2V3PA 2PLPA 1FIQA 4BBNC 1N62A 2BQQA 3EA6A 1V1PA 1XF5L 2OJWA 1CZPA 4OHJA 5D3IB 1VLBA 4KSLC 3I57A 3RZFA 2HJ8A 3BK2A 1RLFA 2N7DA 3DVNU 2E3TA 4DDID 1P0RA 3E9SA 4GIVA 1UD7A 2MJEA 2XNAC 4WWNA 4A90A 5DPTA 3ZRFA 4W9GA 1YN4A 3PZDA 1A70A 4L23A 4B0MA 1YX6B 1WZ0A 3DBRB 4W9EA 4DK5A 3HVZA 1WX8A 4YTPB 1NBFC 2K25A 3AE5B 3P1MA 2I2YA 1EWCA 4JWUC 2K5PA 2NBUA 2XK5B 4GOCA 1V49A 5DPWA 1J19A 4I6PA 2WXNA 3B0AA 5H8YE 3VH4B 1UUPA 2L52A 1S1QB 1QOGA 3PZ8A 3CWIA 1J7AA 5EE3A 2L05A 1P1AA 2QEJC 5KHOA 2YLMA 4ITKA 1VDVA 1B9RA 3NHEB 1IGCA 2MCNB 3C8YA 1FCCC 4YSZB 3UIPB 1KJTA 3IBEA 2Z0DB 3QHTA 3Q3FA 4C4VA 1M94A 3IT4B 3HRDD 4K3CA 1ESFA 4KZCA 2L00B 3Q3MC 1MHXA 1V1OA 1QF6A 1WGDA 3BINA 1KM7A 3LB8C 2PJHA 1PYWD 3RNAC 2VZKB 4XE0A 3M95A 4JE3B 1LGRA 4ANVA 1R4MB 1PFDA 2KX3A 1MVKA 3GB1A 2HJ1A 2EKIA 4NJ6A 1WSPA 2INDC 1IP9A 1YJJA 3DPDA 1JW9D 3IT6B 3HM6X 3MC0B 2QSDA 3IAM1 1NEKB 3ZQ4A 3IVFA 4MJSB 3Q8AA 2BKFA 3B9JA 3A1QA 4ZRQA 3BIID 1T5XD 4DDGD 3W5VB 1YMHE 4YSXB 4KGSA 2O2VA 2DLBA 2K8BA 4IM2A 2V3SA 1BT0A 4B95A 1TS5A 4YTNB 2K9XA 3ALBA 3MC8A 1YJIA 2DHZA 2IGHA 2LGYA 4HKZE 1N5WA 2R2OA 4W9JA 4ACFA 2YVCA 3BYYB 3Q14C 1QZEA 1SE2A 2KJRA 4B9KA 2IDYA 1VZ8A 1WF9A 1IBXB 3SDLC 1YOVB 4NQLB 1K53A 2KVZA 3L54A 2ZJDA 4RF1A 2UYZB 1A5RA 4LNIA 1L6UA 3AEDB 2PE9A 1WGGA 2BKRB 2D10A 3L13A 2G1EA 2CS4A 5HG2A 5FK9C 2N9XA 2WLBA 3ZJUA 4YXDB 2GBRA 3H9DA 3PHXB 5D6JB 2AYOB 4JL9A 2G9HD 3N30A 2O6VB 2MP2B 2K39A 2AWTA 2NPTB 3AXCA 3ZTCA 2NTSA 3GZNI 5AZHA 3WCQA 3PLVA 4OW0A 2M17A 2L76A 3RFZB 3SR6A 2Y3AA 4TV3A 1J8CA 3BVMA 3LYYA 5IAAC 1UGMA 4JGHB 5AZGA 1GB1A 1BXTA 3H7PB 4ARCA 2ZNVC 2WXHA 3T9LA 2QIEB 4ARIA 4PYUA 3NVYA 3BVZA 1GOZA 2V0GA 4USAA 3FILB 2BS3B 3AE9B 4MJSA 4F1SA 1UH6A 1MJDA 1CK1A 5C2TB 1GB4A 1YQ4B 4BAXA 2DZKA 2GI9A 1TT5B 1E8ZA 4ZRKA 2ACZB 3AN1A 2JWZA 1E90A 3RT3B 3AE8B 2DNFA 1L4ZB 2W54A 2JYTA 3N9YC 3P4SB 2JX5A 1C3TA 3NS1A 1PDXA 4LNNA 2WXJA 1C9FA 1R4NB 2KFKB 3KWVA 1E8YA 4MEMA 4C4VB 4ZDVA 2WS3B 1SJED 3HM3A 1R7SA 3Q69A 5JHAA 2DWQA 1WXSA 2BYFA 2WWZA 1GG3A 1Q0WB 3Q6BA 1ZGUB 3TL5A 4RFBA 2WDRB 1PQSA 2KDIA 4IC7B 2LI5A 1WJUA 3O13A 2LXCA 1T0RC 2KO3A 4EUTA 4ZHOA 5L83A 3ML8A 1IGDA 4XC2A 4EEWA 3PGEA 2BW2A 2D3BA 2V9HA 2ZVNA 3L17A 2WXFA 3MTNB 1KH0A 1GC7A 2B3AA 1TTNA 2J42A 4KIKA 3C0RB 4WURA 1L4DB 4NZLB 2WQYB 4FJYA 5CHVC 3Q3JA 3AEFB 4RM8A 4A3OA 4HDOA 1TY2A 4NJ7A 2WDQB 2CU3A 1V81A 4AP4C 1NYRA 5G2NA 1JQ4A 1JALA 1KLUD 4ZRPA 1EF5A 3AV8A 3M63B 1WXVA 1YD8U 3ZGZA 1B1ZA 3U7ZA 2DYOA 4MDKE 1MG4A 3GOEA 5FR3A 2ONQA 2LHEA 4MM3B 5TR5A 2QC8A 3FC4A 1C78A 4OZAA 2FBWB 1JRUA 2INNE 3A4RA 3MJ5A 4O1NA 2LWPA 2L0TA 1F52A 3IFWB 2BWFA 4XZ4A 2JYEA 1K51A 2I1KA 3ZLZA 1CQVA 4K7WA 4EOYA 5E6OA 3AU5A 3MC9A 4LJPB 3W1SC 3QWZB 3I9V1 1T3QA 3V60A 2FE8A 1SBBB 2BPSA 3CSTA 3BYTB 1JWAD 4DHJB 3T3NA 1GNUA 1TYGB 3IG3A 5C3JB 3Q8FA 3RNBC 5E6NA 1NI2A 2IO2B 3TEZA 2LRUA 3DHGC 3D32A 4WIPA 4DXFA 1E7VA 3PZ7A 3N1ZC 4TSSA 3WALA 1FEHA 4AJWA 3R7RA 1PUTA 5HHDG 2INCC 1FRDA 3A9JB 4IM0A 3NZSA 1DYQA 3NVVA 3ZTDA 3ZNGC 2VZKD 3EECA 4MACA 2D3AA 1VJKA 2MW5A 2KAJA 1GC6A 3PT2B 3OAWA 5IA7A 4CHKA 3ZJVA 2IJ0A 4K1RB 4G50A 1JWBD 2KDBA 1FRRA 2FAZA 2RGFA 4D2KA 1JWMD 1K52A 2N4FA 3KUCB 1UZXB 1NYQA 2Y5PA 5EE9A 4JLCA 1MFWA 5BMHA 1ENFA 4HPPA 1YN3A 1CJEA 4WWPA 1TKYA 3QA8A 3ZRCA 3RNGC 1FNVA 4FHKA 1UWMA 4B0EA 2KN5A 3ZNZB 3LJ3A 3H7PA 4US8A 1TKEA 4KKIA 1JMLA 1S3SG 2JVCA 4MT5A 1YQ3B 4WJQA 2Z0EB 2QDFA 4BBNF 1E8WA 3QCAA 3X0WA 2DBYA 4BKSD 2RSUA 2MH7A 3VR8B 2X8XX 1IPGA 4FULA 2LUEA 4ZRIA 5G55A 5J18A 5EE1A 1VZ6A 2JSVX 2C5LC 1WIAA 2RDGA 3PTFC 1I42A 5BMIA 4GB9A 3P63A 3N3KB 2RPQA 1FM0D 1T0SC 1UELA 4US9A 2ZCBA 1XLNA 3FAHA 4HK2A 3I3TB 2M4NA 3C19A 1NI3A 2WU2B 5EDSA 1D4BA 2CU1A 2HD5B 1HE8A 1N6ZA 2CJOA 4IM3A 1AARA 4GDLA 4K7SA 2NR2A 1T0YA 2D11A 2WX1A 2KX0A 3OWEB 3AB5A 1TIFA 4PS3A 1I4HA 4IWQA 1QLBB 2NS5A 3H8HA
chains in the Genus database with same CATH topology
2BKFA 3A1QA 2O6VD 2KZRA 3HIZA 2I1JA 1WFYA 2IO0B 1WGYA 2EMTA 2K8CA 4P7IA 4DDGD 3WAMA 4W9KA 4HCNB 3ZIMA 3PRZA 2MWSB 2O2VA 4GDLB 2DYBA 4RMAA 4A20A 1Q1OA 2Z59B 1CMXB 2K8BA 4IM2A 4W9FA 3RD2A 2NBVB 2V3SA 4II2B 3ZUNA 4CYEA 1BT0A 2C9WB 3WANA 4B95A 4CO7A 5AEKB 3PREA 2KHWB 3ALBA 2DHZA 4LDTD 2KVRA 1J0GA 3B08A 1YX5B 2LGYA 3ML9A 2C7NB 3RUIB 4ASWC 5JZEB 1WXAA 4IWPA 3U8ZA 2NCNA 2R2OA 4W9JA 1P98A 4II3B 5BO4B 3R7QA 4URKA 2YVCA 1GUAB 2MBBB 1WX9A 2BYEA 1R4MI 2MX2A 1K8RB 4G11A 4KV2A 4EZKA 4GDKA 3V6CB 1RFAA 1QZEA 1WMHA 2V4LA 4EFOA 4MGKE 2KJRA 4B9KA 4GGQA 1WI0A 3B1LX 2AL3A 4EZJA 5FR6A 3CSFA 1YIWA 1NDDA 2IO1B 4A3PA 3JSVB 4K7UA 1WF9A 3SDLC 3VAWA 4KDIC 4NQLB 1E5WA 4FJZA 5GMVA 2REXA 3L54A 2ZJDA 2IY0B 4MGZE 4E71A 2BWES 2UYZB 4KVGB 4ICVA 1A5RA 2LVQA 2KTRB 3PV1A 3DBLI 4LJOB 2PE9A 1WGGA 2BKRB 2D10A 3ZO5B 4BVUC 1OGWA 3H1UA 3L13A 2JRIB 3KVFB 1Z2MA 2BF8B 1WR6E 4DBGA 2D07B 2CS4A 3JYUA 1VD2A 2MBQA 3EC8A 4HLEA 4MSMB 2G4SA 4TKNA 1WGHA 2N7EA 1H4RA 2K8HA 1LFDA 1WH3A 2JT4B 4JQWC 5C23A 2N9XA 2DZMA 1ZKHA 3APFA 3QIJA 2GBRA 2XEWA 2L3ZA 4OVUA 1R4NI 2D2QA 2JRHA 3H9DA 3PHXB 5D6JB 2AYOB 2VRRB 3DVGY 4JL9A 3N30A 3VUYA 2O6VB 2MP2B 2K39A 4KZ0A 2LVPA 2AWTA 2NPTB 4WJNA 3AXCA 3ZTCA 2PPHA 1LXDA 2GBJA 2G4DB 2FCQA 2LASA 3GZNI 5AZHA 2BYVE 4ZYNA 2FNJB 3PLVA 4NNJB 3UGBB 2M17A 2L76A 2IO3B 2JXXA 3AI5A 3L10B 4W9DA 4TV3A 1J8CA 4ZRJA 5IAAC 3VUXA 3EHVA 1UGMA 4JGHB 2LD9A 4WWOA 1RRBA 5AZGA 2KC1A 2C60A 1LM8B 4HWIB 4MH0E 3H7PB 2FCNA 2ZNVC 4KSKC 2M1MA 4I6NB 4YL8A 3T9LA 4BFRA 4W9LA 2KFJA 1WJ6A 5L95C 4IG7B 4PYUA 4IWOA 2JF5A 4HXDA 1TGZB 3HK0A 3X23A 2GBNA 4MJSA 4F1SA 1UBIA 3K9PB 4IW0A 1V5TA 1UH6A 3VUWA 3CF6E 4HDQA 2M0XA 3A9JA 4AJYB 3TBLD 3PHWB 2LGDA 5LLIA 2DZKA 3A33B 2MRPA 3ZDTA 1E8ZA 4MGIE 4ZRKA 2K6QA 4BKGA 2JWZA 1E90A 3RT3B 3R66C 2D3GA 1Q5WB 3NY5A 2FCMA 2MQJA 4GMVA 2OJRA 2XBBC 3ZNID 5J17A 1C3TA 2WX0A 1WRDB 2L7RA 3NOBA 1V5OA 3V6EB 4DXAB 3AU4A 5J2RA 2DENB 4HJKA 4M0WB 3K9OB 3WA0A 2AEHA 4DHZB 1XQQA 4W9CA 3ZKJC 1V6EA 2ZPNA 3W1SA 2KMCA 1ISNA 3VTUA 2KFKB 3ZW3A 3A1QB 5HKHA 4WJPA 1WYWB 1E8YA 3CMMB 3H7SA 4MEMA 5JH5C 3DVNV 1X1MA 4X57B 4ZDVA 2KWUB 3ZDMC 3HM3A 3PVLA 4NAWA 5JHAA 2K1FA 1WXSA 4F8CB 2KJ6A 3R3MA 2BYFA 2KWVB 4GN1A 3QC8B 3A9KA 4FHJA 1U4AA 2WWZA 1GG3A 2MBEA 1Q0WB 1SGHA 2JZZA 1ZGUB 3IHPC 3TL5A 1MG8A 3KW5B 3SU8X 4M8NA 2KNBA 1PQSA 2KDIA 4HVBA 4IC7B 2NBWB 3VDZA 2LI5A 1WJUA 3A4SC 2DZJA 2LXCA 4MM3A 1L7YA 2LRWA 2KO3A 2DAJA 4EUTA 5L83A 4WQOB 3ML8A 3BY4B 3N32A 4XC2A 4EEWA 3PGEA 5D94A 2KLGA 2IY1B 1D3ZA 1VCBA 3OJ4B 2ZVNA 3QQ8B 3RCZA 3L17A 2A4ZA 4EZLA 3MTNB 3PRPB 1I35A 3NZUA 1GC7A 2ZNVB 2W9NA 2B3AA 3AULA 1TTNA 3PLUA 4KIKA 2GBKA 2MLBA 4B6WA 3C0RB 3JVZX 2Y5BB 3PS6A 2FIDA 4FJVB 2FIFA 4ICUA 3SHQA 3SD5A 2QHOA 4I6LB 4FJYA 5CHVC 3L16A 4GSWA 4AUQC 4PYZA 3APDA 3Q3JA 5DPSA 2DYMA 2JZ3B 4PS8A 2GBMA 4RM8A 5D2MB 4A3OA 4HDOA 4NJ7A 4WAAA 1V81A 3QJZA 5DCNA 4DHJD 4AP4C 2KC2A 5G2NA 5E6PA 4RM9A 1EF5A 3TMPB 1C1YB 3VTVA 4KIKB 2ASQA 2K6DB 4KDLB 2GOWA 2JY6A 1XD3B 3M63B 1WXVA 1YD8U 1H8CA 3RULA 4J6IA 2DYOA 4MDKE 2CHXA 2IBIB 3VXWA 2KLCA 3GOEA 1WZ3A 5CX3A 3VHTC 2KKCA 4WJOA 5TR5A 1L2NA 4DHZE 2WYQA 2CKHB 2EKEC 1P3QU 3TJPA 2AL6A 2LJ5A 1WJNA 2KTRA 1V86A 3M3JA 2KQ7A 4TUUA 1OEYJ 1JRUA 3ZVVA 4NY0A 4BKTA 2LZ6A 2O6VA 3A4RA 2RR9A 4W9IA 2JUOA 2RD0A 2LWPA 2KTFA 2L0FA 1KLVA 2R2QA 3UINB 4IUMB 3VFKA 1YQBA 2GMIC 2L0TA 2KK8A 1V9JA 2J0JA 3JSVA 3APCA 2C7HA 3IFWB 4BOSC 2BWFA 4XZ4A 2I1KA 3ZLZA 3QAQA 3ZNHB 2FCSA 1TBEA 4K7WA 4EOYA 5E6OA 1WMHB 3AU5A 4LJPB 3W1SC 1V80A 2MSED 5DPRA 3PRMB 3KUZA 4LCDE 1RAXA 3DQVA 2KFKA 2KWCA 3QWZB 1OQYA 1XT9B 1KOTA 3V60A 2KANA 3UF8A 3ONSA 2BPSA 2EMSA 3CSTA 2LVOA 4OVVA 1SE9A 1WXMA 3DBSA 2MA9B 3UQAA 4DHJB 4FADA 1WE6A 1GNUA 2KXJA 3IG3A 3RZWC 5CHFA 2V1YA 5E6NA 3MJWA 1EF1A 1NI2A 2IO2B 3OLMD 2OOBB 4W9HA 2L8JA 3DOWA 4JIOU 5AZFA 1WJ4A 2LRUA 1G6JA 3D32A 2N1WA 4E3CA 1E7VA 3TCAA 2KD0A 3QX1A 1FXTB 3U7DA 1ZW7A 4G3XB 1YJ1A 3WALA 3A9KB 2N9EB 4AJWA 3R7RA 3WAOA 4FBJB 4TQ0A 4HCPB 4NAWB 3A9JB 2G3QB 2ZCCA 2A5UA 3NZSA 4IM0A 4BKSA 5D7GA 1WE7A 1LQBA 3TIXA 4HPLB 2CHWA 2N1VA 3ZTDA 1GJZA 2IZVB 3ZNGC 2KDFB 2CHZA 3O65B 3EECA 1WM2A 3NS8A 4EKUA 2HE7A 2MW5A 4BBNC 4BOZB 3DDCB 3WIMA 1E8XA 3UQBA 1GC6A 2LGXA 3PT2B 3OAWA 5IA7A 4CHKA 4KSLC 3H6NA 2PEAA 3DBRI 4K1RB 3RZFA 3RYTA 1EO6A 2HJ8A 2KQSA 2WDTB 1RLFA 3VQIA 2N7DA 4G50A 3KYCD 1SIFA 1WGRA 5LXHA 2XK5A 2KDBA 3EFUA 3DVNU 5JHBA 4MGYE 2N9PC 5LXIB 4XX5A 2FAZA 2BGFA 1P0RA 2RGFA 5CTRC 4DDID 3QARA 3HHMA 4GIVA 2N4FA 1UD7A 3KUCB 1UZXB 4WWNA 3DVGX 2NPTA 3L0WB 4JLCA 4NQKE 4AOFA 3KYDD 4AWJA 5DPTA 2MP2A 2HTHA 3ZRFA 4W9GA 3ENEA 3PZDA 4NPNA 5CHWA 4WWPA 1TZ1A 1YX6B 1WZ0A 3U30A 3ZRCA 3QA8A 4W9EA 4DK5A 1WX8A 4GU2A 4FHKA 2KN5A 1EUVB 3KUDB 2ZVOA 1NBFC 3ZNZB 3LJ3A 3VTWA 3H7PA 2K25A 5C1ZA 2KMAA 4ANXA 4M8MA 1S3SG 2JVCA 2FUHB 2PE6B 4ANUA 2NBUA 2XK5B 4WJQA 3DBHI 2J0MA 4GOCA 1V49A 2Z0EB 3S2AA 1E7UA 2DAFA 1J19A 4PS7A 3VVWB 1E8WA 3QCAA 3X0WA 4BBNF 4BKSD 5DPWA 4I6PA 2RSUA 2ZPYA 3B0AA 1Y8RC 3VH4B 4K81A 1IPGA 1S1QB 4FULA 4ANWA 2KDEB 2LUEA 4ZRIA 5G55A 3MHSD 5J18A 2CR5A 2JPHA 2C5LC 1F9JA 4MELA 4E74A 2L05A 1WIAA 4G0NB 1P1AA 3JW0X 3ECIA 1Z5SB 2YLMA 1WR1A 3M62B 3DCGA 3PTFC 5KHOA 4F7ZA 1I42A 3NHEB 2MCNB 2IYDB 1V2YA 3PSEB 4GB9A 4DWFA 3KH0A 4N9F4 3UIPB 1KJTA 2MBOA 2KOXA 3IBEA 3N3KB 2RPQA 2UWQA 2Z0DB 3Q3FA 3QHTA 2J7QB 2J0KA 1M94A 1UELA 1OTRB 1IYFA 4KZCA 2ZCBA 2DX5B 2M8SA 2L00B 4FLHA 3I3TB 2M4NA 4HK2A 1P9DU 3V62A 3PPAA 3VH3B 3UIOB 5EDSA 3LDZE 4MSQB 2NVUI 3W1YA 1WGDA 2CU1A 2HD5B 1KM7A 3BINA 1HE8A 2G45B 3QK0A 2PJHA 1WX7A 3T8MA 4IM3A 1AARA 3V61A 2O2VB 4GDLA 2ZZPB 1OEYA 3M95A 4HPMB 2KJHB 4K7SA 2NR2A 4ANVA 3WAPA 5KHQA 2DZIA 1T0YA 2KX3A 2C7MB 2D11A 1WY8A 1WM3A 2KX0A 2WX1A 4GXBA 4FA6A 4NJ6A 1IP9A 2MBHA 3L08A 4TQ1A 3DPDA 3HM6X 2LXAA 3OJ3A 1UBQA 4PS3A 4GDKB 4IWQA 3P2BA 4LDTB 2NS5A 3IVFA 4MJSB 4FN2A 2ZEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BKF A;  3A1Q A;  2O6V D;  2KZR A;  3HIZ A;  2I1J A;  1WFY A;  2IO0 B;  1WGY A;  2EMT A;  2K8C A;  4P7I A;  4DDG D;  3WAM A;  4W9K A;  4HCN B;  3ZIM A;  3PRZ A;  2MWS B;  2O2V A;  4GDL B;  2DYB A;  4RMA A;  4A20 A;  1Q1O A;  2Z59 B;  1CMX B;  2K8B A;  4IM2 A;  4W9F A;  3RD2 A;  2NBV B;  2V3S A;  4II2 B;  3ZUN A;  4CYE A;  1BT0 A;  2C9W B;  3WAN A;  4B95 A;  4CO7 A;  5AEK B;  3PRE A;  2KHW B;  3ALB A;  2DHZ A;  4LDT D;  2KVR A;  1J0G A;  3B08 A;  1YX5 B;  2LGY A;  3ML9 A;  2C7N B;  3RUI B;  4ASW C;  5JZE B;  1WXA A;  4IWP A;  3U8Z A;  2NCN A;  2R2O A;  4W9J A;  1P98 A;  4II3 B;  5BO4 B;  3R7Q A;  4URK A;  2YVC A;  1GUA B;  2MBB B;  1WX9 A;  2BYE A;  1R4M I;  2MX2 A;  1K8R B;  4G11 A;  4KV2 A;  4EZK A;  4GDK A;  3V6C B;  1RFA A;  1QZE A;  1WMH A;  2V4L A;  4EFO A;  4MGK E;  2KJR A;  4B9K A;  4GGQ A;  1WI0 A;  3B1L X;  2AL3 A;  4EZJ A;  5FR6 A;  3CSF A;  1YIW A;  1NDD A;  2IO1 B;  4A3P A;  3JSV B;  4K7U A;  1WF9 A;  3SDL C;  3VAW A;  4KDI C;  4NQL B;  1E5W A;  4FJZ A;  5GMV A;  2REX A;  3L54 A;  2ZJD A;  2IY0 B;  4MGZ E;  4E71 A;  2BWE S;  2UYZ B;  4KVG B;  4ICV A;  1A5R A;  2LVQ A;  2KTR B;  3PV1 A;  3DBL I;  4LJO B;  2PE9 A;  1WGG A;  2BKR B;  2D10 A;  3ZO5 B;  4BVU C;  1OGW A;  3H1U A;  3L13 A;  2JRI B;  3KVF B;  1Z2M A;  2BF8 B;  1WR6 E;  4DBG A;  2D07 B;  2CS4 A;  3JYU A;  1VD2 A;  2MBQ A;  3EC8 A;  4HLE A;  4MSM B;  2G4S A;  4TKN A;  1WGH A;  2N7E A;  1H4R A;  2K8H A;  1LFD A;  1WH3 A;  2JT4 B;  4JQW C;  5C23 A;  2N9X A;  2DZM A;  1ZKH A;  3APF A;  3QIJ A;  2GBR A;  2XEW A;  2L3Z A;  4OVU A;  1R4N I;  2D2Q A;  2JRH A;  3H9D A;  3PHX B;  5D6J B;  2AYO B;  2VRR B;  3DVG Y;  4JL9 A;  3N30 A;  3VUY A;  2O6V B;  2MP2 B;  2K39 A;  4KZ0 A;  2LVP A;  2AWT A;  2NPT B;  4WJN A;  3AXC A;  3ZTC A;  2PPH A;  1LXD A;  2GBJ A;  2G4D B;  2FCQ A;  2LAS A;  3GZN I;  5AZH A;  2BYV E;  4ZYN A;  2FNJ B;  3PLV A;  4NNJ B;  3UGB B;  2M17 A;  2L76 A;  2IO3 B;  2JXX A;  3AI5 A;  3L10 B;  4W9D A;  4TV3 A;  1J8C A;  4ZRJ A;  5IAA C;  3VUX A;  3EHV A;  1UGM A;  4JGH B;  2LD9 A;  4WWO A;  1RRB A;  5AZG A;  2KC1 A;  2C60 A;  1LM8 B;  4HWI B;  4MH0 E;  3H7P B;  2FCN A;  2ZNV C;  4KSK C;  2M1M A;  4I6N B;  4YL8 A;  3T9L A;  4BFR A;  4W9L A;  2KFJ A;  1WJ6 A;  5L95 C;  4IG7 B;  4PYU A;  4IWO A;  2JF5 A;  4HXD A;  1TGZ B;  3HK0 A;  3X23 A;  2GBN A;  4MJS A;  4F1S A;  1UBI A;  3K9P B;  4IW0 A;  1V5T A;  1UH6 A;  3VUW A;  3CF6 E;  4HDQ A;  2M0X A;  3A9J A;  4AJY B;  3TBL D;  3PHW B;  2LGD A;  5LLI A;  2DZK A;  3A33 B;  2MRP A;  3ZDT A;  1E8Z A;  4MGI E;  4ZRK A;  2K6Q A;  4BKG A;  2JWZ A;  1E90 A;  3RT3 B;  3R66 C;  2D3G A;  1Q5W B;  3NY5 A;  2FCM A;  2MQJ A;  4GMV A;  2OJR A;  2XBB C;  3ZNI D;  5J17 A;  1C3T A;  2WX0 A;  1WRD B;  2L7R A;  3NOB A;  1V5O A;  3V6E B;  4DXA B;  3AU4 A;  5J2R A;  2DEN B;  4HJK A;  4M0W B;  3K9O B;  3WA0 A;  2AEH A;  4DHZ B;  1XQQ A;  4W9C A;  3ZKJ C;  1V6E A;  2ZPN A;  3W1S A;  2KMC A;  1ISN A;  3VTU A;  2KFK B;  3ZW3 A;  3A1Q B;  5HKH A;  4WJP A;  1WYW B;  1E8Y A;  3CMM B;  3H7S A;  4MEM A;  5JH5 C;  3DVN V;  1X1M A;  4X57 B;  4ZDV A;  2KWU B;  3ZDM C;  3HM3 A;  3PVL A;  4NAW A;  5JHA A;  2K1F A;  1WXS A;  4F8C B;  2KJ6 A;  3R3M A;  2BYF A;  2KWV B;  4GN1 A;  3QC8 B;  3A9K A;  4FHJ A;  1U4A A;  2WWZ A;  1GG3 A;  2MBE A;  1Q0W B;  1SGH A;  2JZZ A;  1ZGU B;  3IHP C;  3TL5 A;  1MG8 A;  3KW5 B;  3SU8 X;  4M8N A;  2KNB A;  1PQS A;  2KDI A;  4HVB A;  4IC7 B;  2NBW B;  3VDZ A;  2LI5 A;  1WJU A;  3A4S C;  2DZJ A;  2LXC A;  4MM3 A;  1L7Y A;  2LRW A;  2KO3 A;  2DAJ A;  4EUT A;  5L83 A;  4WQO B;  3ML8 A;  3BY4 B;  3N32 A;  4XC2 A;  4EEW A;  3PGE A;  5D94 A;  2KLG A;  2IY1 B;  1D3Z A;  1VCB A;  3OJ4 B;  2ZVN A;  3QQ8 B;  3RCZ A;  3L17 A;  2A4Z A;  4EZL A;  3MTN B;  3PRP B;  1I35 A;  3NZU A;  1GC7 A;  2ZNV B;  2W9N A;  2B3A A;  3AUL A;  1TTN A;  3PLU A;  4KIK A;  2GBK A;  2MLB A;  4B6W A;  3C0R B;  3JVZ X;  2Y5B B;  3PS6 A;  2FID A;  4FJV B;  2FIF A;  4ICU A;  3SHQ A;  3SD5 A;  2QHO A;  4I6L B;  4FJY A;  5CHV C;  3L16 A;  4GSW A;  4AUQ C;  4PYZ A;  3APD A;  3Q3J A;  5DPS A;  2DYM A;  2JZ3 B;  4PS8 A;  2GBM A;  4RM8 A;  5D2M B;  4A3O A;  4HDO A;  4NJ7 A;  4WAA A;  1V81 A;  3QJZ A;  5DCN A;  4DHJ D;  4AP4 C;  2KC2 A;  5G2N A;  5E6P A;  4RM9 A;  1EF5 A;  3TMP B;  1C1Y B;  3VTV A;  4KIK B;  2ASQ A;  2K6D B;  4KDL B;  2GOW A;  2JY6 A;  1XD3 B;  3M63 B;  1WXV A;  1YD8 U;  1H8C A;  3RUL A;  4J6I A;  2DYO A;  4MDK E;  2CHX A;  2IBI B;  3VXW A;  2KLC A;  3GOE A;  1WZ3 A;  5CX3 A;  3VHT C;  2KKC A;  4WJO A;  5TR5 A;  1L2N A;  4DHZ E;  2WYQ A;  2CKH B;  2EKE C;  1P3Q U;  3TJP A;  2AL6 A;  2LJ5 A;  1WJN A;  2KTR A;  1V86 A;  3M3J A;  2KQ7 A;  4TUU A;  1OEY J;  1JRU A;  3ZVV A;  4NY0 A;  4BKT A;  2LZ6 A;  2O6V A;  3A4R A;  2RR9 A;  4W9I A;  2JUO A;  2RD0 A;  2LWP A;  2KTF A;  2L0F A;  1KLV A;  2R2Q A;  3UIN B;  4IUM B;  3VFK A;  1YQB A;  2GMI C;  2L0T A;  2KK8 A;  1V9J A;  2J0J A;  3JSV A;  3APC A;  2C7H A;  3IFW B;  4BOS C;  2BWF A;  4XZ4 A;  2I1K A;  3ZLZ A;  3QAQ A;  3ZNH B;  2FCS A;  1TBE A;  4K7W A;  4EOY A;  5E6O A;  1WMH B;  3AU5 A;  4LJP B;  3W1S C;  1V80 A;  2MSE D;  5DPR A;  3PRM B;  3KUZ A;  4LCD E;  1RAX A;  3DQV A;  2KFK A;  2KWC A;  3QWZ B;  1OQY A;  1XT9 B;  1KOT A;  3V60 A;  2KAN A;  3UF8 A;  3ONS A;  2BPS A;  2EMS A;  3CST A;  2LVO A;  4OVV A;  1SE9 A;  1WXM A;  3DBS A;  2MA9 B;  3UQA A;  4DHJ B;  4FAD A;  1WE6 A;  1GNU A;  2KXJ A;  3IG3 A;  3RZW C;  5CHF A;  2V1Y A;  5E6N A;  3MJW A;  1EF1 A;  1NI2 A;  2IO2 B;  3OLM D;  2OOB B;  4W9H A;  2L8J A;  3DOW A;  4JIO U;  5AZF A;  1WJ4 A;  2LRU A;  1G6J A;  3D32 A;  2N1W A;  4E3C A;  1E7V A;  3TCA A;  2KD0 A;  3QX1 A;  1FXT B;  3U7D A;  1ZW7 A;  4G3X B;  1YJ1 A;  3WAL A;  3A9K B;  2N9E B;  4AJW A;  3R7R A;  3WAO A;  4FBJ B;  4TQ0 A;  4HCP B;  4NAW B;  3A9J B;  2G3Q B;  2ZCC A;  2A5U A;  3NZS A;  4IM0 A;  4BKS A;  5D7G A;  1WE7 A;  1LQB A;  3TIX A;  4HPL B;  2CHW A;  2N1V A;  3ZTD A;  1GJZ A;  2IZV B;  3ZNG C;  2KDF B;  2CHZ A;  3O65 B;  3EEC A;  1WM2 A;  3NS8 A;  4EKU A;  2HE7 A;  2MW5 A;  4BBN C;  4BOZ B;  3DDC B;  3WIM A;  1E8X A;  3UQB A;  1GC6 A;  2LGX A;  3PT2 B;  3OAW A;  5IA7 A;  4CHK A;  4KSL C;  3H6N A;  2PEA A;  3DBR I;  4K1R B;  3RZF A;  3RYT A;  1EO6 A;  2HJ8 A;  2KQS A;  2WDT B;  1RLF A;  3VQI A;  2N7D A;  4G50 A;  3KYC D;  1SIF A;  1WGR A;  5LXH A;  2XK5 A;  2KDB A;  3EFU A;  3DVN U;  5JHB A;  4MGY E;  2N9P C;  5LXI B;  4XX5 A;  2FAZ A;  2BGF A;  1P0R A;  2RGF A;  5CTR C;  4DDI D;  3QAR A;  3HHM A;  4GIV A;  2N4F A;  1UD7 A;  3KUC B;  1UZX B;  4WWN A;  3DVG X;  2NPT A;  3L0W B;  4JLC A;  4NQK E;  4AOF A;  3KYD D;  4AWJ A;  5DPT A;  2MP2 A;  2HTH A;  3ZRF A;  4W9G A;  3ENE A;  3PZD A;  4NPN A;  5CHW A;  4WWP A;  1TZ1 A;  1YX6 B;  1WZ0 A;  3U30 A;  3ZRC A;  3QA8 A;  4W9E A;  4DK5 A;  1WX8 A;  4GU2 A;  4FHK A;  2KN5 A;  1EUV B;  3KUD B;  2ZVO A;  1NBF C;  3ZNZ B;  3LJ3 A;  3VTW A;  3H7P A;  2K25 A;  5C1Z A;  2KMA A;  4ANX A;  4M8M A;  1S3S G;  2JVC A;  2FUH B;  2PE6 B;  4ANU A;  2NBU A;  2XK5 B;  4WJQ A;  3DBH I;  2J0M A;  4GOC A;  1V49 A;  2Z0E B;  3S2A A;  1E7U A;  2DAF A;  1J19 A;  4PS7 A;  3VVW B;  1E8W A;  3QCA A;  3X0W A;  4BBN F;  4BKS D;  5DPW A;  4I6P A;  2RSU A;  2ZPY A;  3B0A A;  1Y8R C;  3VH4 B;  4K81 A;  1IPG A;  1S1Q B;  4FUL A;  4ANW A;  2KDE B;  2LUE A;  4ZRI A;  5G55 A;  3MHS D;  5J18 A;  2CR5 A;  2JPH A;  2C5L C;  1F9J A;  4MEL A;  4E74 A;  2L05 A;  1WIA A;  4G0N B;  1P1A A;  3JW0 X;  3ECI A;  1Z5S B;  2YLM A;  1WR1 A;  3M62 B;  3DCG A;  3PTF C;  5KHO A;  4F7Z A;  1I42 A;  3NHE B;  2MCN B;  2IYD B;  1V2Y A;  3PSE B;  4GB9 A;  4DWF A;  3KH0 A;  4N9F 4;  3UIP B;  1KJT A;  2MBO A;  2KOX A;  3IBE A;  3N3K B;  2RPQ A;  2UWQ A;  2Z0D B;  3Q3F A;  3QHT A;  2J7Q B;  2J0K A;  1M94 A;  1UEL A;  1OTR B;  1IYF A;  4KZC A;  2ZCB A;  2DX5 B;  2M8S A;  2L00 B;  4FLH A;  3I3T B;  2M4N A;  4HK2 A;  1P9D U;  3V62 A;  3PPA A;  3VH3 B;  3UIO B;  5EDS A;  3LDZ E;  4MSQ B;  2NVU I;  3W1Y A;  1WGD A;  2CU1 A;  2HD5 B;  1KM7 A;  3BIN A;  1HE8 A;  2G45 B;  3QK0 A;  2PJH A;  1WX7 A;  3T8M A;  4IM3 A;  1AAR A;  3V61 A;  2O2V B;  4GDL A;  2ZZP B;  1OEY A;  3M95 A;  4HPM B;  2KJH B;  4K7S A;  2NR2 A;  4ANV A;  3WAP A;  5KHQ A;  2DZI A;  1T0Y A;  2KX3 A;  2C7M B;  2D11 A;  1WY8 A;  1WM3 A;  2KX0 A;  2WX1 A;  4GXB A;  4FA6 A;  4NJ6 A;  1IP9 A;  2MBH A;  3L08 A;  4TQ1 A;  3DPD A;  3HM6 X;  2LXA A;  3OJ3 A;  1UBQ A;  4PS3 A;  4GDK B;  4IWQ A;  3P2B A;  4LDT B;  2NS5 A;  3IVF A;  4MJS B;  4FN2 A;  2ZEQ A; 
#chains in the Genus database with same CATH topology
 3HIZ A;  1WFY A;  2IO0 B;  5G5G A;  3ZIM A;  3PRZ A;  2MWS B;  4GDL B;  4RMA A;  1EU4 A;  2DYB A;  4A20 A;  4ZOH C;  3RD2 A;  1VZ7 A;  5EE0 A;  2GRI A;  4CO7 A;  5AEK B;  2KHW B;  1J0G A;  2KVR A;  1DOI A;  1YX5 B;  4KX6 B;  1WXA A;  2NCN A;  4AQ7 A;  4RH6 A;  1KF6 B;  1P98 A;  5BO4 B;  3R7Q A;  2BYT A;  1GUA B;  5HI1 A;  2MX2 A;  2UU7 A;  5FKA C;  4G11 A;  1D5X C;  3Q8C A;  3B1L X;  2AL3 A;  3CSF A;  4KDI C;  1ACC A;  1E5W A;  4LLG M;  4E71 A;  3V3X A;  1XO3 A;  2YEP B;  4KVG B;  3NJT A;  3PV1 A;  3DBL I;  4LJO B;  2L32 A;  3ZO5 B;  5MPO A;  1N63 A;  1OGW A;  1Z2M A;  2BF8 B;  3NZ3 A;  2D07 B;  2BVC A;  3EC8 A;  2K8H A;  1F0Z A;  1LFD A;  3PO0 A;  3V05 A;  2JT4 B;  5BYR A;  4KGR A;  1FFV A;  2XEW A;  3TEX A;  4M01 A;  1R4N I;  2D2Q A;  3AEB B;  3R2I A;  3DBL B;  4RCO A;  2PKO A;  4RGO S;  2VRR B;  2BS4 B;  3ETR A;  3NRZ A;  1HZ5 A;  3N1X C;  2BYV E;  3VRB B;  1FNU A;  4ZYN A;  4NNJ B;  4XYC A;  3UGB B;  2IO3 B;  2JXX A;  2RPV A;  4MH8 A;  4W9D A;  1J7B A;  2CJN A;  4ZRJ A;  2AQ3 B;  3EHV A;  4M0W A;  1JWU D;  2JXT A;  1RRB A;  1T0Q C;  1SF0 A;  4KSK C;  2ON8 A;  4YTM B;  3TEW A;  2PVO D;  4BFR A;  4L1B A;  4W9L A;  1WJ6 A;  4IWO A;  2TSS A;  2WXM A;  2JF5 A;  3TUO A;  3E56 A;  1L0V B;  2J52 A;  4HDQ A;  2M0X A;  3A9J A;  3A33 B;  3Q8E A;  3ZDT A;  4MGI E;  2K6Q A;  3UI3 A;  1SXT A;  1Q5W B;  1PGB A;  3GZN B;  2FCM A;  3Q3N C;  3ZNI D;  1UNS A;  2L7R A;  1I4Q A;  1V5O A;  4DXA B;  5J2R A;  1V1P B;  4HJK A;  4M0W B;  3K9O B;  1V6E A;  3I5J C;  1ISN A;  1P7E A;  4P6V F;  3VTU A;  3ZW3 A;  3NUH B;  5HKH A;  4WH4 A;  4WJP A;  1WYW B;  1ZDX A;  3CMM B;  4ZHP A;  3H7S A;  5JH5 C;  3DVN V;  2K1F A;  2KJ6 A;  1FXI A;  4GN1 A;  3A9K A;  4FHJ A;  4KGT A;  2JZZ A;  3ZXR A;  1MG8 A;  5GXG B;  4N58 A;  3SU8 X;  2B76 B;  2W3R A;  4M8N A;  2ZW1 A;  1ZXH A;  4HVB A;  2DZJ A;  4MM3 A;  1HXY D;  2DAJ A;  4WQO B;  2KYW A;  2KLG A;  2IY1 B;  1VCB A;  1ROE A;  3RCZ A;  1C4C A;  3AUL A;  3IXS A;  3JVZ X;  3PS6 A;  5IO9 A;  2FID A;  3L4P A;  3SHQ A;  3L16 A;  2KDM A;  2DYM A;  4PT5 A;  1T6B X;  3DWM A;  3KWL A;  4WAA A;  2ZW0 A;  4HJG E;  3TEY A;  3B2G A;  1FXA A;  4DHJ D;  1AWD A;  4KIK B;  2K6D B;  4KDL B;  1XD3 B;  2RDH A;  1H8C A;  3RUL A;  4J6I A;  2IBI B;  3GE3 C;  2KLC A;  3VRA B;  4JWS C;  5CX3 A;  4WJO A;  2WYQ A;  1STE A;  2EKE C;  2JU6 X;  3NVW A;  3TSS A;  1P3Q U;  3TJP A;  2LJ5 A;  2MEK A;  4C7Y A;  1V86 A;  5BYQ A;  1OEY J;  2LZ6 A;  4W9I A;  1ZDV A;  2PVG C;  2JUO A;  5D3D A;  2EEL A;  2VH1 A;  2MJ3 A;  1V9J A;  2J0J A;  4BOS C;  3ZNH B;  2QCZ A;  2NMQ A;  1SSN A;  2AQ2 B;  1RAX A;  4LCD E;  2KFK A;  4P1C C;  1SB3 C;  1EU3 A;  5LNK 1;  3OG5 A;  2LVO A;  3UQA A;  3N1Y C;  5CHF A;  2V4I B;  1EF1 A;  3Q3O C;  2L8J A;  4JIO U;  1D6E C;  3BZD B;  3TCA A;  2KD0 A;  3QX1 A;  2H88 B;  1FXT B;  1E10 A;  1YJ1 A;  1RM6 C;  1JWS D;  3WAO A;  4TQ0 A;  4HCP B;  4NAW B;  2G3Q B;  4BKS A;  2CHW A;  2N1V A;  3AE4 B;  2IZV B;  2KDF B;  3O65 B;  3P4Q B;  1WM2 A;  4LNF A;  3DDC B;  3I63 C;  1E8X A;  2LGX A;  4WAF A;  4YSY B;  2PEA A;  3DBR I;  2WDT B;  1XCQ L;  1SE3 A;  2KQS A;  3VQI A;  2XN9 C;  1WGR A;  5LXH A;  2GLS A;  3EFU A;  1TKG A;  2N9P C;  5G5H A;  4XX5 A;  5CTR C;  2WXP A;  3HHM A;  1E9M A;  2N7J A;  3DVG X;  2NPT A;  3L0W B;  4AWJ A;  4NQK E;  3KYD D;  2MP2 A;  2HTH A;  5BYS A;  3AEE B;  3ENE A;  4NPN A;  5CHW A;  1TZ1 A;  4GU2 A;  1EUV B;  1V97 A;  2WXO A;  3VTW A;  1QQR A;  1I4P A;  1F2R I;  2KMA A;  3ABV B;  2L1A A;  3RMK C;  1P7F A;  1C79 A;  2FUH B;  4ANU A;  3W5U B;  2H89 B;  2J0M A;  1VRA B;  1E7U A;  3VVW B;  3KQ4 A;  1M4V A;  2ZPY A;  4K81 A;  2KDE B;  2CR5 A;  4MEL A;  2JPH A;  1F9J A;  4E74 A;  3JW0 X;  1XXG A;  1WR1 A;  3BVG A;  3DCG A;  4F7Z A;  4NAM A;  2IYD B;  1V2Y A;  1ZXI A;  2KAC A;  4DWF A;  3KH0 A;  2KT7 A;  2MBO A;  2KOX A;  2J0K A;  4RNA A;  1IYF A;  2DX5 B;  2N9K A;  3V62 A;  2AX5 A;  3PPA A;  4XWW A;  3VH3 B;  2LGI A;  3P42 A;  3LDZ E;  1WWT A;  2NVU I;  2G45 B;  2GB1 A;  3AE6 B;  3QK0 A;  1JRO A;  5TSS A;  3V61 A;  2O2V B;  1XLQ A;  2KJH B;  3WAP A;  2NTT A;  1L0Y B;  3AE1 B;  2C7M B;  2X38 A;  1WY8 A;  1WM3 A;  4GXB A;  2MBH A;  1FPY A;  2LXA A;  3OJ3 A;  1UBQ A;  2LMC A;  3P2B A;  4LDT B;  4J3O D;  4FN2 A;  2O6V D;  2KZR A;  2I1J A;  2WDV B;  4W9K A;  3U2S C;  1UF0 A;  1CMX B;  1E6E B;  3ZUN A;  4CYE A;  4C7Z A;  2C9W B;  3WAN A;  3MP9 A;  3B08 A;  2C7N B;  1QT9 A;  4IWP A;  3U8Z A;  2BYE A;  4KV2 A;  4GDK A;  1RFA A;  2V4L A;  4HRS A;  3AEA B;  5JXV A;  1WI0 A;  4EZJ A;  5FR6 A;  1YIW A;  1NDD A;  1C77 A;  3KLS X;  3VAW A;  2REX A;  4ZYS A;  4MGZ E;  2BWE S;  1C76 A;  2LVQ A;  4LNO A;  3H1U A;  1OFF A;  4DBG A;  3Q8B A;  3JYU A;  2MBQ A;  1XEE A;  3U4E G;  4HLE A;  4MSM B;  1WGH A;  2N7E A;  4UDU C;  1WH3 A;  4A6Q A;  5C23 A;  3LXF A;  1ZKH A;  1AN8 A;  3QIJ A;  4OVU A;  2L3Z A;  2W82 A;  1I7H A;  1LXD A;  2WXQ A;  2FCQ A;  2LAS A;  5IKC M;  2FNJ B;  4LK0 M;  3AI5 A;  4NJC A;  4H2A A;  4XGA B;  2LD9 A;  2C60 A;  4HWI B;  4MH0 E;  1ZPS A;  4YL8 A;  5L95 C;  4IG7 B;  2WXG A;  3IAS 1;  1BUI C;  4HXD A;  5E6J A;  4YT0 B;  1V5T A;  3CF6 E;  3TBL D;  3W2D A;  2LGD A;  1XLP A;  3CIR B;  3SFE B;  2MRP A;  2BTE A;  3P4P B;  2WP9 B;  1HZ6 A;  3R66 C;  2D3G A;  1N61 A;  1XCT L;  2MQJ A;  4GMV A;  2OJR A;  2XBB C;  5J17 A;  1WRD B;  3NOB A;  3V6E B;  2DEN B;  4DHZ B;  2AEH A;  1XQQ A;  4W9C A;  3ZKJ C;  2ZPN A;  3W1S A;  4K3B A;  1YN5 A;  1X1M A;  3ZDM C;  4F8C B;  1GPX A;  1U4A A;  1SGH A;  2LJI A;  1QIL A;  4XDD A;  2SEB D;  2KNB A;  2LUM A;  2NBW B;  4TMA B;  3A4S C;  3AH7 A;  3EGR A;  3NVZ A;  1EWY C;  2QIL A;  3BY4 B;  1SIJ A;  1D3Z A;  3OJ4 B;  4P16 A;  3QQ8 B;  2WXL A;  2A4Z A;  4EZL A;  2KMM A;  3PRP B;  1I35 A;  3NZU A;  2ZNV B;  1MHH E;  2W9N A;  4B6W A;  2GBK A;  1KRH A;  2MLB A;  4ICU A;  4A9A A;  4FJV B;  2FIF A;  3DBH B;  3SD5 A;  4YWG G;  2QHO A;  4I6L B;  4GSW A;  5DPS A;  2JZ3 B;  4C80 A;  1KLG D;  1FCL A;  3W9C B;  3QJZ A;  5I4D A;  3Q2A C;  3TMP B;  2M56 B;  4FXC A;  2ASQ A;  4JPS A;  2GOW A;  2M0A A;  2KQ4 X;  1TS4 A;  4EE2 A;  2CHX A;  2PMV A;  3VXW A;  4PK1 A;  1HTQ A;  1WZ3 A;  4C56 C;  1I4R A;  4M02 A;  4DHZ E;  4QAY A;  4REZ A;  5BMG A;  3AE7 B;  1WJN A;  3FKY A;  2J53 A;  1Q10 A;  2KTR A;  4TUU A;  4NY0 A;  4BKT A;  1L5P A;  2O6V A;  1QKZ A;  1QOB A;  2KTF A;  1KLV A;  2R2Q A;  3UIN B;  3VFK A;  5HFY A;  1YQB A;  3JSV A;  3APC A;  2C7H A;  2W3S A;  3QAQ A;  1SEB D;  2FCS A;  4OZB A;  1XLO A;  4CQN A;  4XDC A;  1WMH B;  2MSE D;  3PRM B;  3EFC A;  1XT9 B;  1KOT A;  2KAN A;  2L83 A;  1WXM A;  1KTK A;  2KXJ A;  1OQQ A;  2V1Y A;  3HUI A;  3OLM D;  4W9H A;  2HDE A;  5AZF A;  1WJ4 A;  1G6J A;  1TZO A;  3U7D A;  3N20 C;  4G3X B;  3AMZ A;  1ET9 A;  2N9E B;  3P4R B;  4FBJ B;  3HVD A;  2ZCC A;  1QOF A;  2A5U A;  5D7G A;  1EM7 A;  1WE7 A;  2QMT A;  3NG0 A;  2V3N A;  1J7C A;  3RI7 C;  1OQR A;  1GJZ A;  2CHZ A;  5IN7 A;  2HE7 A;  1WGK A;  3ZYY X;  4LNK A;  1VR9 A;  2W55 A;  3WIM A;  4BOZ B;  2JWU A;  4LTU A;  3UQB A;  2OED A;  1ZE3 D;  5IOI A;  3H6N A;  1HQR D;  4R3D A;  1EO6 A;  3RYT A;  3KYC D;  1SIF A;  2XK5 A;  1Y56 A;  5JHB A;  4MGY E;  2N9L A;  5LXI B;  4P1B C;  2BGF A;  3QAR A;  2D5G A;  3AE2 B;  2Y5C A;  2HTM E;  4L2Y A;  4XWT A;  3EUB 2;  4AOF A;  2LEK A;  4RGM A;  3U30 A;  1F77 A;  3J9C A;  3KUD B;  2ZVO A;  2BB6 A;  5C1Z A;  4ANX A;  4M8M A;  1UGJ A;  2PE6 B;  3DBH I;  3S2A A;  2DAF A;  4PS7 A;  2J4X A;  4WWM A;  1Y8R C;  1DGJ A;  4JX1 C;  4IDI A;  4HRO A;  4ANW A;  2IGG A;  3MHS D;  4G0N B;  3BWU D;  3ECI A;  1Z5S B;  3M62 B;  2WXK A;  1C4P A;  3PSE B;  4N9F 4;  1L6V A;  3DWG C;  2UWQ A;  2J7Q B;  1OTR B;  4N6E B;  1NEN B;  2M8S A;  4FLH A;  1P9D U;  3UIO B;  1D5M C;  4MSQ B;  3W1Y A;  4RGN A;  1AYF A;  5T8I A;  1WX7 A;  3T8M A;  2ZZP B;  1OEY A;  4HPM B;  5KHQ A;  2DZI A;  1WXQ A;  4WQM A;  3R2T A;  1SJH D;  4FA6 A;  4TQ1 A;  3L08 A;  1E7P B;  4GDK B;  2WU5 B;  2ZEQ A;  2ICI A;  2K8C A;  4P7I A;  1WGY A;  2EMT A;  1TS3 A;  3DHH C;  3WAM A;  4HCN B;  2PIA A;  1I4X A;  1ET6 A;  1Q1O A;  2Q5W D;  2Z59 B;  1ZP0 B;  4W9F A;  2NBV B;  2N0S B;  4II2 B;  3ZJT A;  2PW9 A;  3PRE A;  1AW7 A;  1DOX A;  1F2R C;  2IPK D;  4LDT D;  1HA5 A;  3ML9 A;  3RUI B;  3RNF C;  4ASW C;  5JZE B;  4RF0 A;  3RNE C;  4II3 B;  4URK A;  2MBB B;  1DOY A;  1WX9 A;  1R4M I;  1K8R B;  4EZK A;  3V6C B;  1WMH A;  1I4G A;  4MGK E;  4EFO A;  4GGQ A;  2IO1 B;  4A3P A;  4IKG A;  3FIL A;  3JSV B;  4K7U A;  5IP4 D;  4FJZ A;  5GMV A;  2IY0 B;  3URY A;  4KKJ A;  2R61 A;  4ICV A;  5H92 C;  3RNC C;  2D3C A;  2KTR B;  4BZA A;  4BVU C;  4Q2J A;  2JRI B;  3KVF B;  1WR6 E;  1VD2 A;  1HTO A;  2QJL A;  2G4S A;  4TKN A;  2BS2 B;  1H4R A;  1WRI A;  1FD6 A;  1PGX A;  3AEC B;  2RDB C;  4JQW C;  2DZM A;  3APF A;  3MHZ A;  3ZXV A;  1V8C A;  2JRH A;  1SE4 A;  3VUY A;  3DVG Y;  4KZ0 A;  2LVP A;  4WJN A;  2PPH A;  2GBJ A;  2G4D B;  1RWS A;  2MJD A;  3L10 B;  3BK1 A;  1N60 A;  3VUX A;  1FO4 A;  3RPF C;  4WWO A;  2KC1 A;  1LM8 B;  2LGS A;  2FCN A;  1C4A A;  1L0X B;  2M1M A;  4I6N B;  2E6X A;  2INP E;  2K3U A;  2KFJ A;  1TGZ B;  2M19 A;  3HK0 A;  3X23 A;  2GBN A;  2SAK A;  1UBI A;  3K9P B;  4IW0 A;  1RFK A;  3VUW A;  3VR9 B;  4AJY B;  3PHW B;  5LLI A;  3T3O A;  1RYJ A;  3AEG B;  1YNT E;  1UWX A;  4A8X C;  2FUG 1;  4C00 A;  4BKG A;  2VH2 A;  3AE3 B;  3B2F A;  3GP7 A;  3NY5 A;  4DQO C;  2WX0 A;  3AU4 A;  1E0Z A;  1KFY B;  1ZOY B;  3WA0 A;  4HEA 1;  2KMC A;  1F1H A;  3MFG A;  2WXR A;  3A1Q B;  4N59 A;  4M00 A;  1BML C;  2PTL A;  2JZP A;  4X57 B;  2LHD A;  2KWU B;  3PVL A;  4NAW A;  2MHJ A;  3R3M A;  1N5X A;  2KWV B;  3QC8 B;  2LFI A;  4GLS C;  2MBE A;  3IHP C;  4DXG A;  3KW5 B;  1D5Z C;  1MPE A;  1TJE A;  3VDZ A;  1L7Y A;  2LRW A;  3SFD B;  1K50 A;  3N32 A;  1QOA A;  1MI0 A;  5D94 A;  4RGT A;  1HEZ E;  3PLU A;  2WXI A;  2Y5B B;  3RN9 C;  4OVZ A;  4AUQ C;  4PYZ A;  2OHF A;  3APD A;  2I38 A;  2BT6 A;  4PS8 A;  2GBM A;  5D2M B;  4HKQ A;  3U52 E;  5DCN A;  5AUK A;  1FNW A;  2KC2 A;  1FFU A;  5E6P A;  4RM9 A;  1C1Y B;  1GAQ B;  3VTV A;  2Z8L A;  1TS2 A;  2JY6 A;  2BB5 A;  3AM9 A;  4AS1 A;  4A55 A;  3VHT C;  2KKC A;  1L2N A;  2K0P A;  2K22 A;  2CKH B;  1NVI D;  2AL6 A;  3R8B A;  2WNM A;  3M3J A;  2KQ7 A;  4OZC A;  3ZVV A;  2IGD A;  2RR9 A;  1IBX A;  2RD0 A;  2RMM A;  5AUI A;  2L0F A;  4IUM B;  2GMI C;  2KK8 A;  2KWD A;  1TBE A;  3SEB A;  2AQ1 B;  1V80 A;  5DPR A;  1TY0 A;  3KUZ A;  3DQV A;  2KWC A;  1OQY A;  3UF8 A;  3ONS A;  2EMS A;  4OVV A;  1SE9 A;  3DBS A;  2MA9 B;  1FMA D;  4FAD A;  1WE6 A;  3RZW C;  2KN4 A;  1JCK B;  3DHI C;  3MJW A;  1PGA A;  2WHI A;  2OOB B;  3DOW A;  2YEP F;  3GE8 C;  3GS2 A;  4S0R A;  2N1W A;  4E3C A;  1IUE A;  1LO5 D;  1ZW7 A;  1ZUD 2;  3A9K B;  2BBC A;  4S17 A;  1JRP A;  1WYG A;  1LQB A;  3TIX A;  4HPL B;  2WGS A;  2JQR B;  3NS8 A;  4EKU A;  4IOI E;  2V3P A;  2PLP A;  1FIQ A;  4BBN C;  1N62 A;  2BQQ A;  3EA6 A;  1V1P A;  1XF5 L;  2OJW A;  1CZP A;  4OHJ A;  5D3I B;  1VLB A;  4KSL C;  3I57 A;  3RZF A;  2HJ8 A;  3BK2 A;  1RLF A;  2N7D A;  3DVN U;  2E3T A;  4DDI D;  1P0R A;  3E9S A;  4GIV A;  1UD7 A;  2MJE A;  2XNA C;  4WWN A;  4A90 A;  5DPT A;  3ZRF A;  4W9G A;  1YN4 A;  3PZD A;  1A70 A;  4L23 A;  4B0M A;  1YX6 B;  1WZ0 A;  3DBR B;  4W9E A;  4DK5 A;  3HVZ A;  1WX8 A;  4YTP B;  1NBF C;  2K25 A;  3AE5 B;  3P1M A;  2I2Y A;  1EWC A;  4JWU C;  2K5P A;  2NBU A;  2XK5 B;  4GOC A;  1V49 A;  5DPW A;  1J19 A;  4I6P A;  2WXN A;  3B0A A;  5H8Y E;  3VH4 B;  1UUP A;  2L52 A;  1S1Q B;  1QOG A;  3PZ8 A;  3CWI A;  1J7A A;  5EE3 A;  2L05 A;  1P1A A;  2QEJ C;  5KHO A;  2YLM A;  4ITK A;  1VDV A;  1B9R A;  3NHE B;  1IGC A;  2MCN B;  3C8Y A;  1FCC C;  4YSZ B;  3UIP B;  1KJT A;  3IBE A;  2Z0D B;  3QHT A;  3Q3F A;  4C4V A;  1M94 A;  3IT4 B;  3HRD D;  4K3C A;  1ESF A;  4KZC A;  2L00 B;  3Q3M C;  1MHX A;  1V1O A;  1QF6 A;  1WGD A;  3BIN A;  1KM7 A;  3LB8 C;  2PJH A;  1PYW D;  3RNA C;  2VZK B;  4XE0 A;  3M95 A;  4JE3 B;  1LGR A;  4ANV A;  1R4M B;  1PFD A;  2KX3 A;  1MVK A;  3GB1 A;  2HJ1 A;  2EKI A;  4NJ6 A;  1WSP A;  2IND C;  1IP9 A;  1YJJ A;  3DPD A;  1JW9 D;  3IT6 B;  3HM6 X;  3MC0 B;  2QSD A;  3IAM 1;  1NEK B;  3ZQ4 A;  3IVF A;  4MJS B;  3Q8A A;  2BKF A;  3B9J A;  3A1Q A;  4ZRQ A;  3BII D;  1T5X D;  4DDG D;  3W5V B;  1YMH E;  4YSX B;  4KGS A;  2O2V A;  2DLB A;  2K8B A;  4IM2 A;  2V3S A;  1BT0 A;  4B95 A;  1TS5 A;  4YTN B;  2K9X A;  3ALB A;  3MC8 A;  1YJI A;  2DHZ A;  2IGH A;  2LGY A;  4HKZ E;  1N5W A;  2R2O A;  4W9J A;  4ACF A;  2YVC A;  3BYY B;  3Q14 C;  1QZE A;  1SE2 A;  2KJR A;  4B9K A;  2IDY A;  1VZ8 A;  1WF9 A;  1IBX B;  3SDL C;  1YOV B;  4NQL B;  1K53 A;  2KVZ A;  3L54 A;  2ZJD A;  4RF1 A;  2UYZ B;  1A5R A;  4LNI A;  1L6U A;  3AED B;  2PE9 A;  1WGG A;  2BKR B;  2D10 A;  3L13 A;  2G1E A;  2CS4 A;  5HG2 A;  5FK9 C;  2N9X A;  2WLB A;  3ZJU A;  4YXD B;  2GBR A;  3H9D A;  3PHX B;  5D6J B;  2AYO B;  4JL9 A;  2G9H D;  3N30 A;  2O6V B;  2MP2 B;  2K39 A;  2AWT A;  2NPT B;  3AXC A;  3ZTC A;  2NTS A;  3GZN I;  5AZH A;  3WCQ A;  3PLV A;  4OW0 A;  2M17 A;  2L76 A;  3RFZ B;  3SR6 A;  2Y3A A;  4TV3 A;  1J8C A;  3BVM A;  3LYY A;  5IAA C;  1UGM A;  4JGH B;  5AZG A;  1GB1 A;  1BXT A;  3H7P B;  4ARC A;  2ZNV C;  2WXH A;  3T9L A;  2QIE B;  4ARI A;  4PYU A;  3NVY A;  3BVZ A;  1GOZ A;  2V0G A;  4USA A;  3FIL B;  2BS3 B;  3AE9 B;  4MJS A;  4F1S A;  1UH6 A;  1MJD A;  1CK1 A;  5C2T B;  1GB4 A;  1YQ4 B;  4BAX A;  2DZK A;  2GI9 A;  1TT5 B;  1E8Z A;  4ZRK A;  2ACZ B;  3AN1 A;  2JWZ A;  1E90 A;  3RT3 B;  3AE8 B;  2DNF A;  1L4Z B;  2W54 A;  2JYT A;  3N9Y C;  3P4S B;  2JX5 A;  1C3T A;  3NS1 A;  1PDX A;  4LNN A;  2WXJ A;  1C9F A;  1R4N B;  2KFK B;  3KWV A;  1E8Y A;  4MEM A;  4C4V B;  4ZDV A;  2WS3 B;  1SJE D;  3HM3 A;  1R7S A;  3Q69 A;  5JHA A;  2DWQ A;  1WXS A;  2BYF A;  2WWZ A;  1GG3 A;  1Q0W B;  3Q6B A;  1ZGU B;  3TL5 A;  4RFB A;  2WDR B;  1PQS A;  2KDI A;  4IC7 B;  2LI5 A;  1WJU A;  3O13 A;  2LXC A;  1T0R C;  2KO3 A;  4EUT A;  4ZHO A;  5L83 A;  3ML8 A;  1IGD A;  4XC2 A;  4EEW A;  3PGE A;  2BW2 A;  2D3B A;  2V9H A;  2ZVN A;  3L17 A;  2WXF A;  3MTN B;  1KH0 A;  1GC7 A;  2B3A A;  1TTN A;  2J42 A;  4KIK A;  3C0R B;  4WUR A;  1L4D B;  4NZL B;  2WQY B;  4FJY A;  5CHV C;  3Q3J A;  3AEF B;  4RM8 A;  4A3O A;  4HDO A;  1TY2 A;  4NJ7 A;  2WDQ B;  2CU3 A;  1V81 A;  4AP4 C;  1NYR A;  5G2N A;  1JQ4 A;  1JAL A;  1KLU D;  4ZRP A;  1EF5 A;  3AV8 A;  3M63 B;  1WXV A;  1YD8 U;  3ZGZ A;  1B1Z A;  3U7Z A;  2DYO A;  4MDK E;  1MG4 A;  3GOE A;  5FR3 A;  2ONQ A;  2LHE A;  4MM3 B;  5TR5 A;  2QC8 A;  3FC4 A;  1C78 A;  4OZA A;  2FBW B;  1JRU A;  2INN E;  3A4R A;  3MJ5 A;  4O1N A;  2LWP A;  2L0T A;  1F52 A;  3IFW B;  2BWF A;  4XZ4 A;  2JYE A;  1K51 A;  2I1K A;  3ZLZ A;  1CQV A;  4K7W A;  4EOY A;  5E6O A;  3AU5 A;  3MC9 A;  4LJP B;  3W1S C;  3QWZ B;  3I9V 1;  1T3Q A;  3V60 A;  2FE8 A;  1SBB B;  2BPS A;  3CST A;  3BYT B;  1JWA D;  4DHJ B;  3T3N A;  1GNU A;  1TYG B;  3IG3 A;  5C3J B;  3Q8F A;  3RNB C;  5E6N A;  1NI2 A;  2IO2 B;  3TEZ A;  2LRU A;  3DHG C;  3D32 A;  4WIP A;  4DXF A;  1E7V A;  3PZ7 A;  3N1Z C;  4TSS A;  3WAL A;  1FEH A;  4AJW A;  3R7R A;  1PUT A;  5HHD G;  2INC C;  1FRD A;  3A9J B;  4IM0 A;  3NZS A;  1DYQ A;  3NVV A;  3ZTD A;  3ZNG C;  2VZK D;  3EEC A;  4MAC A;  2D3A A;  1VJK A;  2MW5 A;  2KAJ A;  1GC6 A;  3PT2 B;  3OAW A;  5IA7 A;  4CHK A;  3ZJV A;  2IJ0 A;  4K1R B;  4G50 A;  1JWB D;  2KDB A;  1FRR A;  2FAZ A;  2RGF A;  4D2K A;  1JWM D;  1K52 A;  2N4F A;  3KUC B;  1UZX B;  1NYQ A;  2Y5P A;  5EE9 A;  4JLC A;  1MFW A;  5BMH A;  1ENF A;  4HPP A;  1YN3 A;  1CJE A;  4WWP A;  1TKY A;  3QA8 A;  3ZRC A;  3RNG C;  1FNV A;  4FHK A;  1UWM A;  4B0E A;  2KN5 A;  3ZNZ B;  3LJ3 A;  3H7P A;  4US8 A;  1TKE A;  4KKI A;  1JML A;  1S3S G;  2JVC A;  4MT5 A;  1YQ3 B;  4WJQ A;  2Z0E B;  2QDF A;  4BBN F;  1E8W A;  3QCA A;  3X0W A;  2DBY A;  4BKS D;  2RSU A;  2MH7 A;  3VR8 B;  2X8X X;  1IPG A;  4FUL A;  2LUE A;  4ZRI A;  5G55 A;  5J18 A;  5EE1 A;  1VZ6 A;  2JSV X;  2C5L C;  1WIA A;  2RDG A;  3PTF C;  1I42 A;  5BMI A;  4GB9 A;  3P63 A;  3N3K B;  2RPQ A;  1FM0 D;  1T0S C;  1UEL A;  4US9 A;  2ZCB A;  1XLN A;  3FAH A;  4HK2 A;  3I3T B;  2M4N A;  3C19 A;  1NI3 A;  2WU2 B;  5EDS A;  1D4B A;  2CU1 A;  2HD5 B;  1HE8 A;  1N6Z A;  2CJO A;  4IM3 A;  1AAR A;  4GDL A;  4K7S A;  2NR2 A;  1T0Y A;  2D11 A;  2WX1 A;  2KX0 A;  3OWE B;  3AB5 A;  1TIF A;  4PS3 A;  1I4H A;  4IWQ A;  1QLB B;  2NS5 A;  3H8H A; 
#chains in the Genus database with same CATH homology
 2BKF A;  3A1Q A;  2O6V D;  2KZR A;  3HIZ A;  2I1J A;  1WFY A;  2IO0 B;  1WGY A;  2EMT A;  2K8C A;  4P7I A;  4DDG D;  3WAM A;  4W9K A;  4HCN B;  3ZIM A;  3PRZ A;  2MWS B;  2O2V A;  4GDL B;  2DYB A;  4RMA A;  4A20 A;  1Q1O A;  2Z59 B;  1CMX B;  2K8B A;  4IM2 A;  4W9F A;  3RD2 A;  2NBV B;  2V3S A;  4II2 B;  3ZUN A;  4CYE A;  1BT0 A;  2C9W B;  3WAN A;  4B95 A;  4CO7 A;  5AEK B;  3PRE A;  2KHW B;  3ALB A;  2DHZ A;  4LDT D;  2KVR A;  1J0G A;  3B08 A;  1YX5 B;  2LGY A;  3ML9 A;  2C7N B;  3RUI B;  4ASW C;  5JZE B;  1WXA A;  4IWP A;  3U8Z A;  2NCN A;  2R2O A;  4W9J A;  1P98 A;  4II3 B;  5BO4 B;  3R7Q A;  4URK A;  2YVC A;  1GUA B;  2MBB B;  1WX9 A;  2BYE A;  1R4M I;  2MX2 A;  1K8R B;  4G11 A;  4KV2 A;  4EZK A;  4GDK A;  3V6C B;  1RFA A;  1QZE A;  1WMH A;  2V4L A;  4EFO A;  4MGK E;  2KJR A;  4B9K A;  4GGQ A;  1WI0 A;  3B1L X;  2AL3 A;  4EZJ A;  5FR6 A;  3CSF A;  1YIW A;  1NDD A;  2IO1 B;  4A3P A;  3JSV B;  4K7U A;  1WF9 A;  3SDL C;  3VAW A;  4KDI C;  4NQL B;  1E5W A;  4FJZ A;  5GMV A;  2REX A;  3L54 A;  2ZJD A;  2IY0 B;  4MGZ E;  4E71 A;  2BWE S;  2UYZ B;  4KVG B;  4ICV A;  1A5R A;  2LVQ A;  2KTR B;  3PV1 A;  3DBL I;  4LJO B;  2PE9 A;  1WGG A;  2BKR B;  2D10 A;  3ZO5 B;  4BVU C;  1OGW A;  3H1U A;  3L13 A;  2JRI B;  3KVF B;  1Z2M A;  2BF8 B;  1WR6 E;  4DBG A;  2D07 B;  2CS4 A;  3JYU A;  1VD2 A;  2MBQ A;  3EC8 A;  4HLE A;  4MSM B;  2G4S A;  4TKN A;  1WGH A;  2N7E A;  1H4R A;  2K8H A;  1LFD A;  1WH3 A;  2JT4 B;  4JQW C;  5C23 A;  2N9X A;  2DZM A;  1ZKH A;  3APF A;  3QIJ A;  2GBR A;  2XEW A;  2L3Z A;  4OVU A;  1R4N I;  2D2Q A;  2JRH A;  3H9D A;  3PHX B;  5D6J B;  2AYO B;  2VRR B;  3DVG Y;  4JL9 A;  3N30 A;  3VUY A;  2O6V B;  2MP2 B;  2K39 A;  4KZ0 A;  2LVP A;  2AWT A;  2NPT B;  4WJN A;  3AXC A;  3ZTC A;  2PPH A;  1LXD A;  2GBJ A;  2G4D B;  2FCQ A;  2LAS A;  3GZN I;  5AZH A;  2BYV E;  4ZYN A;  2FNJ B;  3PLV A;  4NNJ B;  3UGB B;  2M17 A;  2L76 A;  2IO3 B;  2JXX A;  3AI5 A;  3L10 B;  4W9D A;  4TV3 A;  1J8C A;  4ZRJ A;  5IAA C;  3VUX A;  3EHV A;  1UGM A;  4JGH B;  2LD9 A;  4WWO A;  1RRB A;  5AZG A;  2KC1 A;  2C60 A;  1LM8 B;  4HWI B;  4MH0 E;  3H7P B;  2FCN A;  2ZNV C;  4KSK C;  2M1M A;  4I6N B;  4YL8 A;  3T9L A;  4BFR A;  4W9L A;  2KFJ A;  1WJ6 A;  5L95 C;  4IG7 B;  4PYU A;  4IWO A;  2JF5 A;  4HXD A;  1TGZ B;  3HK0 A;  3X23 A;  2GBN A;  4MJS A;  4F1S A;  1UBI A;  3K9P B;  4IW0 A;  1V5T A;  1UH6 A;  3VUW A;  3CF6 E;  4HDQ A;  2M0X A;  3A9J A;  4AJY B;  3TBL D;  3PHW B;  2LGD A;  5LLI A;  2DZK A;  3A33 B;  2MRP A;  3ZDT A;  1E8Z A;  4MGI E;  4ZRK A;  2K6Q A;  4BKG A;  2JWZ A;  1E90 A;  3RT3 B;  3R66 C;  2D3G A;  1Q5W B;  3NY5 A;  2FCM A;  2MQJ A;  4GMV A;  2OJR A;  2XBB C;  3ZNI D;  5J17 A;  1C3T A;  2WX0 A;  1WRD B;  2L7R A;  3NOB A;  1V5O A;  3V6E B;  4DXA B;  3AU4 A;  5J2R A;  2DEN B;  4HJK A;  4M0W B;  3K9O B;  3WA0 A;  2AEH A;  4DHZ B;  1XQQ A;  4W9C A;  3ZKJ C;  1V6E A;  2ZPN A;  3W1S A;  2KMC A;  1ISN A;  3VTU A;  2KFK B;  3ZW3 A;  3A1Q B;  5HKH A;  4WJP A;  1WYW B;  1E8Y A;  3CMM B;  3H7S A;  4MEM A;  5JH5 C;  3DVN V;  1X1M A;  4X57 B;  4ZDV A;  2KWU B;  3ZDM C;  3HM3 A;  3PVL A;  4NAW A;  5JHA A;  2K1F A;  1WXS A;  4F8C B;  2KJ6 A;  3R3M A;  2BYF A;  2KWV B;  4GN1 A;  3QC8 B;  3A9K A;  4FHJ A;  1U4A A;  2WWZ A;  1GG3 A;  2MBE A;  1Q0W B;  1SGH A;  2JZZ A;  1ZGU B;  3IHP C;  3TL5 A;  1MG8 A;  3KW5 B;  3SU8 X;  4M8N A;  2KNB A;  1PQS A;  2KDI A;  4HVB A;  4IC7 B;  2NBW B;  3VDZ A;  2LI5 A;  1WJU A;  3A4S C;  2DZJ A;  2LXC A;  4MM3 A;  1L7Y A;  2LRW A;  2KO3 A;  2DAJ A;  4EUT A;  5L83 A;  4WQO B;  3ML8 A;  3BY4 B;  3N32 A;  4XC2 A;  4EEW A;  3PGE A;  5D94 A;  2KLG A;  2IY1 B;  1D3Z A;  1VCB A;  3OJ4 B;  2ZVN A;  3QQ8 B;  3RCZ A;  3L17 A;  2A4Z A;  4EZL A;  3MTN B;  3PRP B;  1I35 A;  3NZU A;  1GC7 A;  2ZNV B;  2W9N A;  2B3A A;  3AUL A;  1TTN A;  3PLU A;  4KIK A;  2GBK A;  2MLB A;  4B6W A;  3C0R B;  3JVZ X;  2Y5B B;  3PS6 A;  2FID A;  4FJV B;  2FIF A;  4ICU A;  3SHQ A;  3SD5 A;  2QHO A;  4I6L B;  4FJY A;  5CHV C;  3L16 A;  4GSW A;  4AUQ C;  4PYZ A;  3APD A;  3Q3J A;  5DPS A;  2DYM A;  2JZ3 B;  4PS8 A;  2GBM A;  4RM8 A;  5D2M B;  4A3O A;  4HDO A;  4NJ7 A;  4WAA A;  1V81 A;  3QJZ A;  5DCN A;  4DHJ D;  4AP4 C;  2KC2 A;  5G2N A;  5E6P A;  4RM9 A;  1EF5 A;  3TMP B;  1C1Y B;  3VTV A;  4KIK B;  2ASQ A;  2K6D B;  4KDL B;  2GOW A;  2JY6 A;  1XD3 B;  3M63 B;  1WXV A;  1YD8 U;  1H8C A;  3RUL A;  4J6I A;  2DYO A;  4MDK E;  2CHX A;  2IBI B;  3VXW A;  2KLC A;  3GOE A;  1WZ3 A;  5CX3 A;  3VHT C;  2KKC A;  4WJO A;  5TR5 A;  1L2N A;  4DHZ E;  2WYQ A;  2CKH B;  2EKE C;  1P3Q U;  3TJP A;  2AL6 A;  2LJ5 A;  1WJN A;  2KTR A;  1V86 A;  3M3J A;  2KQ7 A;  4TUU A;  1OEY J;  1JRU A;  3ZVV A;  4NY0 A;  4BKT A;  2LZ6 A;  2O6V A;  3A4R A;  2RR9 A;  4W9I A;  2JUO A;  2RD0 A;  2LWP A;  2KTF A;  2L0F A;  1KLV A;  2R2Q A;  3UIN B;  4IUM B;  3VFK A;  1YQB A;  2GMI C;  2L0T A;  2KK8 A;  1V9J A;  2J0J A;  3JSV A;  3APC A;  2C7H A;  3IFW B;  4BOS C;  2BWF A;  4XZ4 A;  2I1K A;  3ZLZ A;  3QAQ A;  3ZNH B;  2FCS A;  1TBE A;  4K7W A;  4EOY A;  5E6O A;  1WMH B;  3AU5 A;  4LJP B;  3W1S C;  1V80 A;  2MSE D;  5DPR A;  3PRM B;  3KUZ A;  4LCD E;  1RAX A;  3DQV A;  2KFK A;  2KWC A;  3QWZ B;  1OQY A;  1XT9 B;  1KOT A;  3V60 A;  2KAN A;  3UF8 A;  3ONS A;  2BPS A;  2EMS A;  3CST A;  2LVO A;  4OVV A;  1SE9 A;  1WXM A;  3DBS A;  2MA9 B;  3UQA A;  4DHJ B;  4FAD A;  1WE6 A;  1GNU A;  2KXJ A;  3IG3 A;  3RZW C;  5CHF A;  2V1Y A;  5E6N A;  3MJW A;  1EF1 A;  1NI2 A;  2IO2 B;  3OLM D;  2OOB B;  4W9H A;  2L8J A;  3DOW A;  4JIO U;  5AZF A;  1WJ4 A;  2LRU A;  1G6J A;  3D32 A;  2N1W A;  4E3C A;  1E7V A;  3TCA A;  2KD0 A;  3QX1 A;  1FXT B;  3U7D A;  1ZW7 A;  4G3X B;  1YJ1 A;  3WAL A;  3A9K B;  2N9E B;  4AJW A;  3R7R A;  3WAO A;  4FBJ B;  4TQ0 A;  4HCP B;  4NAW B;  3A9J B;  2G3Q B;  2ZCC A;  2A5U A;  3NZS A;  4IM0 A;  4BKS A;  5D7G A;  1WE7 A;  1LQB A;  3TIX A;  4HPL B;  2CHW A;  2N1V A;  3ZTD A;  1GJZ A;  2IZV B;  3ZNG C;  2KDF B;  2CHZ A;  3O65 B;  3EEC A;  1WM2 A;  3NS8 A;  4EKU A;  2HE7 A;  2MW5 A;  4BBN C;  4BOZ B;  3DDC B;  3WIM A;  1E8X A;  3UQB A;  1GC6 A;  2LGX A;  3PT2 B;  3OAW A;  5IA7 A;  4CHK A;  4KSL C;  3H6N A;  2PEA A;  3DBR I;  4K1R B;  3RZF A;  3RYT A;  1EO6 A;  2HJ8 A;  2KQS A;  2WDT B;  1RLF A;  3VQI A;  2N7D A;  4G50 A;  3KYC D;  1SIF A;  1WGR A;  5LXH A;  2XK5 A;  2KDB A;  3EFU A;  3DVN U;  5JHB A;  4MGY E;  2N9P C;  5LXI B;  4XX5 A;  2FAZ A;  2BGF A;  1P0R A;  2RGF A;  5CTR C;  4DDI D;  3QAR A;  3HHM A;  4GIV A;  2N4F A;  1UD7 A;  3KUC B;  1UZX B;  4WWN A;  3DVG X;  2NPT A;  3L0W B;  4JLC A;  4NQK E;  4AOF A;  3KYD D;  4AWJ A;  5DPT A;  2MP2 A;  2HTH A;  3ZRF A;  4W9G A;  3ENE A;  3PZD A;  4NPN A;  5CHW A;  4WWP A;  1TZ1 A;  1YX6 B;  1WZ0 A;  3U30 A;  3ZRC A;  3QA8 A;  4W9E A;  4DK5 A;  1WX8 A;  4GU2 A;  4FHK A;  2KN5 A;  1EUV B;  3KUD B;  2ZVO A;  1NBF C;  3ZNZ B;  3LJ3 A;  3VTW A;  3H7P A;  2K25 A;  5C1Z A;  2KMA A;  4ANX A;  4M8M A;  1S3S G;  2JVC A;  2FUH B;  2PE6 B;  4ANU A;  2NBU A;  2XK5 B;  4WJQ A;  3DBH I;  2J0M A;  4GOC A;  1V49 A;  2Z0E B;  3S2A A;  1E7U A;  2DAF A;  1J19 A;  4PS7 A;  3VVW B;  1E8W A;  3QCA A;  3X0W A;  4BBN F;  4BKS D;  5DPW A;  4I6P A;  2RSU A;  2ZPY A;  3B0A A;  1Y8R C;  3VH4 B;  4K81 A;  1IPG A;  1S1Q B;  4FUL A;  4ANW A;  2KDE B;  2LUE A;  4ZRI A;  5G55 A;  3MHS D;  5J18 A;  2CR5 A;  2JPH A;  2C5L C;  1F9J A;  4MEL A;  4E74 A;  2L05 A;  1WIA A;  4G0N B;  1P1A A;  3JW0 X;  3ECI A;  1Z5S B;  2YLM A;  1WR1 A;  3M62 B;  3DCG A;  3PTF C;  5KHO A;  4F7Z A;  1I42 A;  3NHE B;  2MCN B;  2IYD B;  1V2Y A;  3PSE B;  4GB9 A;  4DWF A;  3KH0 A;  4N9F 4;  3UIP B;  1KJT A;  2MBO A;  2KOX A;  3IBE A;  3N3K B;  2RPQ A;  2UWQ A;  2Z0D B;  3Q3F A;  3QHT A;  2J7Q B;  2J0K A;  1M94 A;  1UEL A;  1OTR B;  1IYF A;  4KZC A;  2ZCB A;  2DX5 B;  2M8S A;  2L00 B;  4FLH A;  3I3T B;  2M4N A;  4HK2 A;  1P9D U;  3V62 A;  3PPA A;  3VH3 B;  3UIO B;  5EDS A;  3LDZ E;  4MSQ B;  2NVU I;  3W1Y A;  1WGD A;  2CU1 A;  2HD5 B;  1KM7 A;  3BIN A;  1HE8 A;  2G45 B;  3QK0 A;  2PJH A;  1WX7 A;  3T8M A;  4IM3 A;  1AAR A;  3V61 A;  2O2V B;  4GDL A;  2ZZP B;  1OEY A;  3M95 A;  4HPM B;  2KJH B;  4K7S A;  2NR2 A;  4ANV A;  3WAP A;  5KHQ A;  2DZI A;  1T0Y A;  2KX3 A;  2C7M B;  2D11 A;  1WY8 A;  1WM3 A;  2KX0 A;  2WX1 A;  4GXB A;  4FA6 A;  4NJ6 A;  1IP9 A;  2MBH A;  3L08 A;  4TQ1 A;  3DPD A;  3HM6 X;  2LXA A;  3OJ3 A;  1UBQ A;  4PS3 A;  4GDK B;  4IWQ A;  3P2B A;  4LDT B;  2NS5 A;  3IVF A;  4MJS B;  4FN2 A;  2ZEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...