4NJ7A

Pb1 domain of atarf7 - semet derivative
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
84
structure length
77
Chain Sequence
YTAVQKRGSVGRSIDVNRYRGYDELRHDLARMFGIEGQLEDWKLVYVANAILLVGDDPWEEFVNCVQSIKILSSAEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Auxin response factor 7
publication title Molecular basis for AUXIN RESPONSE FACTOR protein interaction and the control of auxin response repression.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
total genus 13
structure length 77
sequence length 84
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P
ec nomenclature
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4nj7A00
2GBMA 4A20A 2KHWB 2N9EB 4XX5A 2AL6A 2MRPA 4EUTA 1YIWA 2L76A 2K39A 1MG8A 3H7PA 3QAQA 4KSKC 4G0NB 5J18A 4DHJD 4BKSA 3VTWA 4IG7B 2DYBA 4B95A 2D07B 1C1YB 1SE9A 3A9KA 3OJ3A 1WFYA 2JUOA 3QWZB 2IO1B 5L95C 1WF9A 4BFRA 4EKUA 3VDZA 2JF5A 4CYEA 4BOSC 2LUEA 5CHVC 5DCNA 3PHWB 3B08A 3L13A 3TBLD 2KO3A 2LJ5A 2MSED 3DBLI 2KN5A 3D32A 4W9DA 4HDQA 1V6EA 2BWES 2JT4B 4GN1A 2L7RA 3L0WB 3RD2A 1H4RA 1V86A 3WAOA 2LVQA 2O2VA 1L7YA 5IA7A 2FCQA 1Y8RC 3DVNU 4GU2A 2KQ7A 4NQKE 3ZKJC 2C9WB 4GDLB 4KZ0A 3RZFA 3UQAA 4PS3A 1V9JA 4TQ0A 4AP4C 2KD0A 1WGYA 1R4MI 2KZRA 4XZ4A 4LDTD 1V5TA 2FCNA 4HDOA 5JH5C 3CMMB 2ZVOA 4E71A 2FCMA 3ZW3A 1Z2MA 4NNJB 3B0AA 3QJZA 4W9EA 3HM3A 4ZYNA 4DHJB 3A9JA 4A3OA 3ZRFA 4EOYA 2M8SA 3N30A 4FBJB 1IPGA 2J0JA 4FULA 3HHMA 4I6LB 4AWJA 2LGYA 2ZEQA 4KIKB 3ML8A 4ZDVA 1Q1OA 3AU4A 3EFUA 3N32A 1S3SG 1A5RA 4DK5A 1LM8B 2MBHA 3OJ4B 4IM2A 2JRHA 5AZFA 2C7MB 4E3CA 2UYZB 2DYOA 2FNJB 2L05A 1KM7A 4FN2A 3VHTC 3UIOB 3DQVA 2J0KA 4MH0E 2FUHB 1EUVB 2HJ8A 2KFKA 2KLGA 2MWSB 1TGZB 4EFOA 4BVUC 2K6QA 4MJSB 1RLFA 4PS7A 2DX5B 1OEYA 4G11A 4W9CA 3ZNGC 2RD0A 2ZPYA 2LGDA 2XK5A 4MGIE 5EDSA 1WJ6A 4WAAA 1WZ0A 5CHWA 2AL3A 3ZNHB 1E8YA 1E8ZA 4E74A 5KHOA 3QIJA 1WJNA 3RULA 4HCPB 4GB9A 2O6VA 1VCBA 1Z5SB 4YL8A 2RPQA 3M95A 2FCSA 3LJ3A 3ONSA 1I42A 1I35A 2LVOA 3A33B 1S1QB 1E8XA 5TR5A 2RGFA 4OVUA 1FXTB 1OTRB 1WXMA 3IG3A 3UINB 4F7ZA 3A1QB 2PJHA 4MEMA 3ZVVA 3PS6A 2C7NB 1P3QU 3K9OB 2V3SA 1ISNA 3R66C 4EEWA 4FA6A 2MA9B 2ZNVC 3L17A 3IVFA 2KTRB 3Q3JA 2Z59B 2JZ3B 2K25A 4NAWB 2GMIC 2LRUA 3LDZE 4ANUA 3PREA 4FJZA 4ZRJA 2ZCCA 2I1JA 3DVGX 2KDFB 3RYTA 2NVUI 3ZLZA 1WMHA 2DZIA 3M62B 1WE6A 2K8HA 4WJNA 3SHQA 3APFA 4NJ7A 3APDA 2AWTA 2NBWB 3EECA 4HWIB 4ICVA 4GDKB 4WJPA 1YX5B 2DYMA 2GOWA 3WAPA 3ZRCA 4W9LA 3RUIB 1YQBA 2N7EA 3M63B 3CSTA 5G2NA 3VQIA 1XD3B 1NBFC 4DWFA 1SGHA 2BKRB 4W9FA 4HJKA 3NZUA 5LLIA 2G3QB 1E7VA 4II2B 2AYOB 3ZIMA 2A5UA 2IO0B 4GIVA 1OEYJ 2CS4A 2C5LC 2PE9A 4CO7A 2HTHA 3T9LA 1ZGUB 2WX0A 4X57B 3RT3B 2KC2A 5C23A 2AEHA 2KDIA 3AULA 4BKGA 2MBBB 4OVVA 4EZKA 5JHBA 4PYUA 4LJOB 1WRDB 3PGEA 1UZXB 2HE7A 1VD2A 2MP2B 2C7HA 4ASWC 2ZPNA 4II3B 2M1MA 1GNUA 4KDIC 1EO6A 1BT0A 3ZUNA 1J19A 2DAFA 2J0MA 3QQ8B 2L3ZA 3BY4B 5G55A 4B6WA 2L0TA 5E6NA 1E90A 2LXCA 2FIDA 3ECIA 1EF5A 2GBRA 4GXBA 3V62A 2BYEA 2V1YA 2NPTB 2M0XA 1UGMA 3L10B 3L54A 3PRPB 4W9KA 1L2NA 1T0YA 4AUQC 2KTFA 4W9GA 3QCAA 3JSVA 5BO4B 2D10A 2KOXA 4KV2A 2MBEA 4RMAA 2QHOA 2YLMA 3CF6E 4K7SA 1V81A 1EF1A 2DZJA 2K6DB 3PVLA 4LCDE 3VVWB 3PPAA 3R3MA 2DAJA 2JRIB 3PLVA 2I1KA 2REXA 5J17A 4P7IA 3U8ZA 2KJ6A 3KH0A 1PQSA 3CSFA 2RR9A 3JW0X 2BF8B 3VFKA 3PLUA 4FHJA 3TIXA 2KMAA 1WJUA 2LZ6A 1LXDA 4DHZB 2ASQA 3ZO5B 1KOTA 1WXSA 5CHFA 4FJYA 2CR5A 2PE6B 3QX1A 3M3JA 4MGZE 2KX0A 3B1LX 1ZKHA 2XEWA 1WGDA 1K8RB 1H8CA 4IWOA 5D94A 2ZVNA 3DDCB 3WALA 3L16A 4IW0A 1C3TA 2Z0DB 2G45B 2BYVE 4FJVB 2KX3A 3EHVA 4JL9A 4FHKA 4WQOB 1IP9A 3TJPA 2N9PC 1WM2A 1XT9B 5CX3A 1RAXA 2PEAA 3PHXB 3H7SA 2KWVB 2B3AA 4BKSD 1TZ1A 2K8BA 3RZWC 4ICUA 3QA8A 4EZJA 2GBKA 4RM8A 5JHAA 4HPLB 1KJTA 3QHTA 2MCNB 3U7DA 2LD9A 2MX2A 5AEKB 3UQBA 1R4NI 4DDGD 1WI0A 2JXXA 4JGHB 5D6JB 1U4AA 3ZTCA 3VUXA 2CU1A 1NDDA 2KANA 3KYCD 3N3KB 4WJQA 4XC2A 5D2MB 2N1VA 2KVRA 3S2AA 3W1YA 4GDLA 2LGXA 3SD5A 5JZEB 4KSLC 3X0WA 3VH3B 4MDKE 3SDLC 2N4FA 3VTUA 4PS8A 2PPHA 2KKCA 1OGWA 4M8MA 1HE8A 2KQSA 5DPWA 3ZNID 2LASA 3ZDMC 2W9NA 4MM3A 2R2OA 1YJ1A 4MGKE 4JQWC 2JPHA 1Q0WB 4M0WB 2JWZA 3KW5B 4WJOA 4I6PA 2BWFA 1WGGA 4TUUA 4KIKA 3VAWA 3DCGA 2FIFA 1Q5WB 1WM3A 3DOWA 2MBQA 3MHSD 4DBGA 3H7PB 4F8CB 2IBIB 1YX6B 3PRMB 1UELA 4G3XB 5C1ZA 4J6IA 1RRBA 1WYWB 1WXVA 1M94A 3MTNB 2ZZPB 4TQ1A 3R7QA 3V6CB 2ZCBA 2GBJA 2LVPA 3A9KB 1UH6A 1XQQA 2KC1A 4MJSA 2K1FA 3APCA 2MW5A 4W9JA 5CTRC 4ZRIA 5LXHA 2VRRB 3JVZX 1P1AA 2BPSA 1JRUA 3DVNV 3W1SC 3IFWB 4HVBA 1ZW7A 3ENEA 2NBVB 4K81A 4GMVA 3PZDA 4BOZB 5AZGA 4ANWA 1AARA 3WAMA 2Y5BB 2Z0EB 4MELA 4BKTA 2KWUB 3UF8A 3SU8X 1WIAA 4HLEA 2KNBA 2O2VB 2NCNA 4WWOA 3L08A 2L8JA 3NHEB 4TV3A 3A1QA 1CMXB 2KJHB 2BKFA 3Q3FA 1LQBA 2MBOA 1E7UA 1WX8A 2JZZA 2KTRA 2UWQA 4NAWA 4LJPB 3TMPB 3ALBA 2O6VD 3MJWA 1WGHA 3UGBB 3DPDA 2KDBA 1WR1A 2A4ZA 2D2QA 4MGYE 1TTNA 1UBIA 2J7QB 3DBSA 4GSWA 1KLVA 2JVCA 2N7DA 3WANA 3A9JB 4GDKA 1LFDA 5E6OA 4IM3A 2CHXA 2EMSA 2ZJDA 3RCZA 3GOEA 3AU5A 3K9PB 4HPMB 4KVGB 4HCNB 4BBNC 3KYDD 1TBEA 3V61A 3ZTDA 2WYQA 3JYUA 1WY8A 1WGRA 2OOBB 4IWPA 3VUYA 3OAWA 4AOFA 2HD5B 1D3ZA 3WA0A 1YD8U 4GGQA 5DPSA 1V2YA 3TL5A 4A3PA 3HM6X 5GMVA 2KFKB 4NY0A 2IO2B 4AJWA 5E6PA 4KZCA 2ZNVB 2MQJA 1WJ4A 2MP2A 4IWQA 5LXIB 4WWPA 4IM0A 1X1MA 1WX9A 2DHZA 1GJZA 2WWZA 1V80A 2XK5B 3X23A 4ZRKA 3U30A 1IYFA 4NQLB 3H9DA 3DBHI 1UBQA 2WX1A 3NZSA 2LWPA 1OQYA 2L0FA 3OLMD 2O6VB 4JIOU 4K7UA 2KLCA 2IO3B 1UD7A 2CHZA 3IHPC 3BINA 2NPTA 1SIFA 4WWNA 2XBBC 2BGFA 2C60A 1P9DU 4FLHA 3VTVA 2EMTA 2EKEC 5DPRA 3T8MA 3P2BA 4IUMB 4GOCA 2N9XA 2CHWA 1NI2A 3QK0A 1WMHB 2KJRA 1V49A 2YVCA 4HK2A 2FAZA 2N1WA 3EC8A 3KUDB 4DXAB 3DBRI 3AXCA 3QARA 1V5OA 2BYFA 2JY6A 4RM9A 3ML9A 3O65B 4URKA 2K8CA 1J8CA 3NOBA 2LI5A 4M8NA 4NPNA 3VUWA 1P98A 3GZNI 4F1SA 3TCAA 2WDTB 5IAAC 5L83A 4N9F4 4EZLA 3AI5A 4JLCA 3V60A 3W1SA 2IY1B 4FADA 3WIMA 2G4SA 4PYZA 1WXAA 2IY0B 2M4NA 3PT2B 5DPTA 1GUAB 5D7GA 4MSQB 4LDTB 4AJYB 4BBNF 3VH4B 3PV1A 3HK0A 2DZMA 2KFJA 3I3TB 1GC6A 1WR6E 4K7WA 1J0GA 2V4LA 3KVFB 3UIPB 3ZNZB 1GC7A 4DHZE 1E5WA 4W9IA 4B9KA 4NJ6A 3PRZA 3A4RA 3C0RB 4HXDA 4ANVA 3V6EB 2DZKA 4G50A 3VXWA 2R2QA 2L00B 4CHKA 1QZEA 3PSEB 3H6NA 1RFAA 1WE7A 4ANXA 1GG3A 3NY5A 4KDLB 4TKNA 3R7RA 4DDID 2G4DB 2D3GA 2MLBA 5AZHA 1WZ3A 2IYDB 2KWCA 2IZVB 3A4SC 1E8WA 2M17A 2NR2A 2LXAA 4K1RB 3KUCB 4IC7B 2RSUA 3JSVB 5HKHA 5KHQA 2KMCA 1WX7A 2KXJA 3QC8B 3HIZA 2CKHB 2LRWA 2NS5A 2GBNA 3IBEA 1P0RA 1G6JA 3ZDTA 1WH3A 5J2RA 2KK8A 2OJRA 2DENB 2KDEB 2NBUA 3PTFC 4MSMB 4W9HA 3H1UA 3NS8A 1F9JA 5FR6A 3DVGY 4I6NB 3KUZA 2D11A
chains in the Genus database with same CATH superfamily
1HEZE 1L0YB 2N9EB 3SEBA 3RNBC 3TSSA 3H7PA 4G0NB 5J18A 2DYBA 1TKGA 4WIPA 1WFYA 4EKUA 4C80A 4P16A 2GLSA 3DBLI 2KN5A 1HZ6A 3U52E 4GN1A 1IBXB 1V86A 2LVQA 2O2VA 1AWDA 1ZDXA 5IA7A 2RDGA 4GU2A 2KQ7A 2YEPB 3ZKJC 3RZFA 3HRDD 4AS1A 1V97A 2FCNA 3AEBB 3CMMB 2FCMA 3RNGC 4A8XC 4ZYNA 3A9JA 3FAHA 4A3OA 3TEYA 2W54A 4FBJB 2J0JA 1N63A 4ZDVA 1A5RA 3UI3A 2MBHA 3GP7A 1YN3A 2L05A 4FN2A 4B0MA 2KFKA 1QOFA 1R4MB 2KLGA 3WCQA 1TGZB 2K6QA 2JYEA 3N9YC 2L52A 2N0SB 1OEYA 3ZNGC 3GS2A 3DWMA 1C77A 2XK5A 2HDEA 1WJ6A 4KGSA 2V3NA 2AL3A 1JWSD 5KHOA 3RULA 3LB8C 4HCPB 2J52A 1Z5SB 2FCSA 3LJ3A 5FK9C 2EELA 1FXTB 4C4VA 2PJHA 2C7NB 4FA6A 4EEWA 1D5MC 4S17A 2ZNVC 3IVFA 2KTRB 4NAWB 1WYGA 5BYRA 4FJZA 2I1JA 3Q69A 5BMGA 2DZIA 4WJNA 2K8HA 4NJ7A 3APDA 2EKIA 1FD6A 1QF6A 1YX5B 3NJTA 1YQBA 2N7EA 4WQMA 3VQIA 3Q8BA 3NVVA 4W9FA 5BYQA 4HJKA 2G3QB 4II2B 4GIVA 2IDYA 4USAA 4CO7A 1ZE3D 2V4IB 4IDIA 5E6JA 2AEHA 5EE3A 5JXVA 3PGEA 1UZXB 2BT6A 5BMHA 2HE7A 2MP2B 2C7HA 4ASWC 1TKYA 4KDIC 2MJEA 1TYGB 3Q3NC 3QQ8B 5G55A 3FILA 5E6NA 2LXCA 4LNOA 2ACZB 3Q8AA 3ECIA 2IGDA 1B9RA 1TJEA 2B76B 3QCAA 2WGSA 2KOXA 2K5PA 1L4ZB 2QHOA 4K7SA 3MJ5A 3PVLA 1QT9A 1HXYD 1JROA 3PPAA 4A90A 4P7IA 2KJ6A 1PQSA 2KYWA 2BF8B 3TIXA 1WJUA 2LZ6A 2YEPF 4DHZB 3U4EG 2WDVB 2VH2A 1WXSA 2K22A 4HRSA 3M3JA 4MGZE 3B1LX 1ZKHA 1TIFA 3WALA 2CJNA 1FO4A 4LNNA 1NYRA 2WHIA 2N9PC 4M02A 3HVZA 4TSSA 4BKSD 3QA8A 4RM8A 2MX2A 3AE7B 5DPWA 1WI0A 2FE8A 4JGHB 3MC9A 3KYCD 3N3KB 2N1VA 1TY2A 1L0XB 1L6UA 3W1YA 1XXGA 2WP9B 3X0WA 3DHIC 3VTUA 1T5XD 3B2GA 1OGWA 1CK1A 4M8MA 2KQSA 5IN7A 2W9NA 4MM3A 2JPHA 1Q0WB 4M0WB 4M00A 4RCOA 1D4BA 3URYA 4N59A 1WGGA 3BVGA 1TT5B 3H7PB 1UELA 1WXVA 3MHZA 1IGCA 3MTNB 1FNWA 5IOIA 1MJDA 3V6CB 1XQQA 1EU3A 2K1FA 4L23A 4ZRPA 2MW5A 4A55A 1I4PA 2V9HA 2LEKA 1P1AA 4KGRA 2NBVB 4ANWA 3WAMA 1VJKA 2Z8LA 3SU8X 4HLEA 2KNBA 2O2VB 4WWOA 2KN4A 3MC8A 3NHEB 1JRPA 2KJHB 1TKEA 2JZZA 3AE8B 3ZJUA 4GLSC 5AUIA 4NJCA 2KDBA 4MGYE 2J7QB 4XGAB 3A9JB 2LMCA 2H89B 4IM3A 2EMSA 2ZJDA 3GOEA 1IUEA 3AE6B 2VZKB 4KVGB 4BBNC 1FXAA 2WYQA 2D3AA 3JYUA 4KKIA 1WGRA 3VR8B 4GGQA 4BAXA 3HM6X 2KT7A 1NI3A 2KFKB 4NY0A 1AW7A 5E6PA 4KZCA 4IWQA 5LXIB 2DHZA 2LJIA 2XK5B 3X23A 4WURA 1I4RA 2WX1A 4H2AA 4JIOU 1UD7A 1PFDA 2CHZA 1TS5A 4C4VB 2NPTA 4P1CC 1TZOA 1P9DU 3VTVA 2EKEC 4IUMB 1NI2A 1QOBA 1BUIC 4LNFA 2D5GA 2YVCA 4HK2A 2K9XA 4PT5A 3DBRI 3AXCA 4EE2A 3DBHB 3BYYB 1E6EB 1YJJA 3Q8EA 4F1SA 1RFKA 1EU4A 4D2KA 1WRIA 4JLCA 2IY1B 3AEDB 1XLNA 4K3BA 2M4NA 3PT2B 5IO9A 5D7GA 1DYQA 4MSQB 4JE3B 3VH4B 3PV1A 2INNE 1OFFA 1GC6A 4K7WA 3KVFB 1E5WA 1L0VB 1QOGA 3A4RA 3C0RB 4N6EB 4G50A 3VXWA 2MJ3A 3FILB 5TSSA 3ZGZA 1XF5L 1RFAA 3R2TA 4HROA 4ANXA 1GG3A 4XYCA 1HZ5A 3GZNB 1GAQB 4DDID 2KWCA 2IZVB 1E0ZA 1M4VA 2M17A 2NR2A 2NTSA 3KUCB 3N1ZC 5KHQA 1SSNA 2CKHB 3IBEA 1FRRA 2NBUA 1ESFA 2WU2B 1F9JA 2JXTA 2AL6A 2OJWA 4EUTA 1YIWA 1SE4A 2L76A 1MG8A 3P4PB 4DHJD 4BKSA 3AB5A 3VTWA 2E6XA 2M56B 3HUIA 2FUG1 1C1YB 3A9KA 3PZ8A 2BYTA 4JWSC 4P1BC 1WF9A 1N5XA 2PVOD 2WXPA 3MP9A 2PMVA 4ACFA 2PIAA 1YNTE 3ZJTA 2BWES 2L7RA 3L0WB 3RD2A 4BZAA 2KDMA 1N62A 3I63C 4XWTA 3DVNU 5IP4D 2C9WB 3Q8CA 3IT4B 4PS3A 4TQ0A 1NYQA 3NVWA 3ZJVA 5JH5C 4CQNA 4E71A 1Z2MA 3B0AA 3QJZA 4MM3B 4W9EA 4YTPB 3ZRFA 3N30A 1KTKA 3B2FA 1IPGA 3HHMA 1WXQA 2LGYA 2ZEQA 1Q1OA 1S3SG 2RDHA 4IM2A 1KRHA 2JRHA 5AZFA 1C76A 4OW0A 4E3CA 2UYZB 1NENB 2DYOA 1FXIA 3UIOB 3DQVA 2J0KA 1L6VA 2HJ8A 3ETRA 1FCLA 4W9CA 2RD0A 4RF0A 2LGDA 4WAAA 1K52A 1WZ0A 3QIJA 1PGXA 1QLBB 3P1MA 1ZP0B 1D6EC 1FPYA 3ONSA 2LVOA 1E8XA 1JCKB 5TR5A 4OVUA 3IG3A 1XLOA 4ZRQA 4MEMA 3ZVVA 3PS6A 1P3QU 3L17A 2JZ3B 2X8XX 4ZRJA 2J4XA 4IKGA 3U2SC 4ITKA 2KDFB 3AEAB 3SHQA 3RNAC 3APFA 1N60A 3EECA 3TUOA 3CSTA 1ENFA 1XD3B 4DWFA 1SGHA 3ZIMA 1E7VA 2AYOB 2C5LC 1GB4A 2PE9A 1ZGUB 2JWUA 3AULA 1UF0A 3ZYYX 5JHBA 3C8YA 1RWSA 2WXOA 1VZ7A 4KGTA 2M1MA 1BT0A 3ZUNA 1J19A 3NUHB 4B6WA 4C7YA 4PK1A 2BYEA 2V1YA 2NPTB 2M0XA 3L10B 5EE9A 3PRPB 3BVZA 3BYTB 2KTFA 4W9GA 3JSVA 4KV2A 4RMAA 1EF1A 2QILA 2JRIB 1J7BA 3PLVA 2WXFA 2WXGA 5J17A 2OHFA 3IAM1 3CSFA 2RR9A 3W5UB 3PLUA 2WLBA 2KMAA 3SR6A 1LXDA 1KOTA 5CHFA 2PVGC 2L1AA 3OWEB 1VRAB 1WGDA 5HG2A 1H8CA 4IWOA 4RGMA 3W2DA 3L16A 1EWCA 1C3TA 2Z0DB 2BYVE 2KX3A 3RFZB 3TJPA 1SEBD 1WM2A 3P4QB 3R8BA 2KWVB 1F52A 1TZ1A 2D3CA 4EZJA 1MHXA 2QSDA 5AEKB 2LD9A 4P6VF 1R4NI 2JXXA 4WAFA 5D6JB 1U4AA 4KKJA 1E7PB 3VUXA 2CU1A 5T8IA 2KANA 2KVRA 3SD5A 1C4AA 4MDKE 2N4FA 2IGGA 3ZNID 2LASA 2JWZA 5MPOA 3KW5B 4I6PA 4MH8A 2BWFA 2JYTA 4KIKA 3VAWA 1Q5WB 1SB3C 1E9MA 2MBQA 1E10A 4J6IA 1RRBA 1M94A 2ZZPB 1EM7A 2DNFA 3A9KB 2CU3A 2KC1A 5HI1A 2XNAC 5CTRC 2VRRB 3GE8C 1JRUA 3IFWB 2Y5BB 2Z0EB 4MELA 1I4QA 4JWUC 1LGRA 5GXGB 3A1QA 4K3CA 1TS4A 2JQRB 2BKFA 1RM6C 1E7UA 2J53A 2UWQA 3TMPB 3AM9A 1WGHA 1TY0A 3Q6BA 1WR1A 2A4ZA 4MT5A 2W3SA 5H8YE 4GDKA 3NG0A 3RCZA 4A9AA 3AU5A 3K9PB 4C7ZA 4HPMB 2Q5WD 1J7CA 1TBEA 2BBCA 3V61A 2N9LA 2OOBB 4N58A 3WA0A 1YD8U 3W5VB 4A3PA 1V2YA 1SJHD 5GMVA 1FFVA 4AJWA 2QC8A 1HQRD 1GJZA 1V80A 1C79A 2IJ0A 2PTLA 3NZSA 2LWPA 3CIRB 3OLMD 2JX5A 2I38A 1FM0D 2KLCA 2X38A 4XDCA 3IHPC 3BINA 3ZXRA 1T0RC 2XBBC 3RMKC 1VR9A 1D5ZC 5DPRA 3Q8FA 3P2BA 2LUMA 1PGBA 4GOCA 2N9XA 2CHWA 2KJRA 3KUDB 2BYFA 1AN8A 4UDUC 4URKA 1KLUD 2K8CA 3NOBA 4M8NA 4REZA 4N9F4 4EZLA 4C00A 2N9KA 3AN1A 1GUAB 4BBNF 1WR6E 4DHZE 3ZNZB 3BK2A 3PRZA 4HXDA 3EFCA 3V6EB 2DZKA 3IT6B 2L00B 2W82A 3VRBB 1QZEA 3PSEB 1JWUD 1MFWA 3SFDB 4HKQA 2WXMA 2WXKA 3R7RA 1QOAA 2G4DB 3IAS1 1SJED 2MLBA 2HJ1A 2IYDB 3A4SC 2ZW0A 3JSVB 5HKHA 1WX7A 2KXJA 2BTEA 2V3PA 2LRWA 2NS5A 3TEXA 1P0RA 1G6JA 4KX6B 1WH3A 3PTFC 4W9HA 2AQ1B 1C4CA 3H1UA 4W9IA 4BFRA 1T6BX 4I6NB 3KUZA 1OEYJ 2GBMA 4A20A 4XX5A 4JPSA 4RGOS 2MRPA 4RFBA 1QKZA 1KH0A 3DHHC 3QAQA 5G5HA 2Y5CA 2JZPA 1RYJA 4B95A 1SE9A 1ACCA 2WNMA 3QWZB 2IO1B 1XLPA 2JF5A 3FC4A 4BOSC 2LUEA 5CHVC 5DCNA 3B08A 4L2YA 3EA6A 2KO3A 4OZCA 2MSED 1V6EA 3C19A 1MG4A 1H4RA 1GOZA 3WAOA 4NQKE 2WU5B 4KZ0A 1V9JA 4AP4C 1WGYA 1R4MI 1V8CA 1STEA 2KZRA 4XZ4A 1V5TA 3Q14C 4HDOA 3AEFB 2PW9A 3GB1A 1QQRA 1ZOYB 3HM3A 4DHJB 1P7EA 4EOYA 2M8SA 4M01A 3DWGC 4AWJA 3DBLB 4KIKB 3ML8A 3EFUA 3N32A 1A70A 3OJ4B 2C7MB 2QCZA 3NS1A 2FNJB 3VHTC 4NZLB 1EUVB 4BVUC 1RLFA 4PS7A 4G11A 4MGIE 3ZNHB 1E8YA 4E74A 1WJNA 4GB9A 1D5XC 1VCBA 1I42A 3M95A 3BK1A 1S1QB 2RGFA 1OTRB 1WXMA 3UINB 2BW2A 3A1QB 4Q2JA 3K9OB 2G1EA 2V3SA 1ISNA 3R66C 2MA9B 3AE5B 3Q3JA 2LRUA 4ANUA 3P63A 2NVUI 1WMHA 1WE6A 2DWQA 2PKOA 4WJPA 4HWIB 2NBWB 5HFYA 3ZRCA 5IKCM 4GDKB 1F2RC 2DYMA 2GOWA 2INCC 3WAPA 1C9FA 1UNSA 3Q3OC 4OVZA 3RUIB 4IOIE 2BKRB 2WDRB 1Y56A 2CS4A 2LGSA 4YT0B 2HTHA 2WX0A 4X57B 1HTQA 2JSVX 4BKGA 4OVVA 3DHGC 2W55A 2I2YA 4PYUA 4LJOB 1WRDB 4RF1A 2ZPNA 4II3B 3NVZA 1GNUA 2WDQB 1EO6A 4OZBA 2ICIA 2WXJA 2J0MA 2L3ZA 1E90A 5AUKA 1GPXA 1EF5A 4GXBA 5I4DA 1L5PA 1UGMA 1VZ6A 5LNK1 1L2NA 1T0YA 4AUQC 1XEEA 3AE3B 5BO4B 2IPKD 2YLMA 3CF6E 4LCDE 3VVWB 2K6DB 2DAJA 2I1KA 3U8ZA 3KH0A 3AE4B 3JW0X 3VFKA 2SAKA 2KVZA 2XN9C 3BIID 4LTUA 1PDXA 4FJYA 2CR5A 2DBYA 2K0PA 2H88B 5H92C 5D94A 2ZVNA 4IW0A 3EHVA 4WQOB 1IP9A 1T3QA 1YN4A 3TEWA 1RAXA 3PHXB 1V1PA 2K8BA 5D3IB 4ICUA 3VR9B 5JHAA 3AMZA 4WH4A 3UQBA 3O13A 2UU7A 3ZTCA 1NDDA 3L4PA 4WJQA 4RNAA 5D2MB 3S2AA 4GDLA 2LGXA 5JZEB 1CQVA 3VH3B 2GB1A 3PZ7A 1FNUA 4XDDA 2WQYB 2PPHA 4L1BA 3ZDMC 4JX1C 1YJ1A 4MGKE 3R2IA 4MACA 1WM3A 3DOWA 3MHSD 2KQ4X 2Y3AA 4DBGA 4F8CB 1YX6B 4G3XB 5C1ZA 4ARIA 4HPPA 3U7ZA 1JWBD 2LVPA 1UH6A 4MJSA 2QJLA 4ZRIA 3JVZX 2BPSA 4YTNB 4TMAB 1B1ZA 3ENEA 1SE2A 3PZDA 1DGJA 4ZOHC 3RI7C 3E9SA 2NCNA 3L08A 3LXFA 1LQBA 2MBOA 5EE0A 1WX8A 1JW9D 1N6ZA 2CJOA 2O6VD 3MJWA 1T0SC 1TS2A 3UGBB 2D2QA 4LLGM 2JVCA 5E6OA 2CHXA 4US9A 3N20C 1HA5A 1JWAD 1WY8A 2BVCA 4IWPA 4YXDB 3OAWA 3EGRA 2QDFA 4AOFA 1AYFA 1EWYC 1J7AA 5BYSA 4ARCA 4WWPA 4IM0A 2WWZA 3VRAB 3U30A 4NQLB 3H9DA 3DBHI 2NMQA 3CWIA 3V3XA 4K7UA 2L0FA 3MC0B 1FMAD 3EUB2 1MPEA 3IXSA 1WGKA 3BWUD 2AQ3B 2IGHA 1N5WA 4FLHA 2WXNA 2EMTA 1JWMD 3T8MA 4NAMA 1YMHE 1XLQA 3QK0A 1WMHB 1V49A 1K53A 3E56A 2N1WA 4DXAB 3QARA 2KAJA 1V5OA 3V05A 3ML9A 1J8CA 3GZNI 3TCAA 1YQ3B 5L83A 3LYYA 1N61A 1WXAA 4YTMB 2RPVA 4AQ7A 2INPE 4LDTB 3RNCC 2DZMA 4DXFA 2KFJA 1J0GA 2V4LA 1GB1A 4B9KA 4NJ6A 2J42A 1ET6A 2G9HD 4ANVA 3DBRB 1JMLA 1WE7A 3T3NA 2BS3B 2BB5A 5AZHA 1WZ3A 2MHJA 1E8WA 4K1RB 1PYWD 2GRIA 2RSUA 5C3JB 3QC8B 1SF0A 3J9CA 2GBNA 2KACA 3ZDTA 2DENB 4MSMB 3NS8A 5FR3A 1JQ4A 1FNVA 2KHWB 2LGIA 3Q2AC 2K39A 1MHHE 4C56C 5BMIA 4KSKC 1PUTA 2RDBC 4IG7B 1FRDA 2D07B 3OJ3A 2JUOA 3I9V1 5L95C 3VDZA 2WXQA 4CYEA 2LHEA 1FCCC 3PHWB 3L13A 3TBLD 2WXLA 1OQRA 2KWDA 1V1PB 2LJ5A 2MEKA 3D32A 4W9DA 4HDQA 3SFEB 2JT4B 2QMTA 4B0EA 1XCTL 1L7YA 2FCQA 1VZ8A 1Y8RC 4GDLB 3UQAA 5EE1A 4OZAA 2KD0A 4LDTD 2ZW1A 1T0QC 1UGJA 2FBWB 2ZVOA 1DOIA 3ZW3A 4NNJB 1OQQA 1JALA 3BVMA 1XO3A 1PGAA 4FULA 4I6LB 4HJGE 1CJEA 4DXGA 1R7SA 2N7JA 3AU4A 4DK5A 1LM8B 1DOXA 3AEEB 3I57A 1SBBB 2LFIA 1KM7A 2PLPA 4MH0E 2FUHB 2MWSB 4EFOA 4MJSB 1CZPA 1P7FA 2DX5B 4QAYA 4A6QA 1I7HA 2ZPYA 1FIQA 2QIEB 5EDSA 5CHWA 1E8ZA 1VLBA 2VH1A 2O6VA 4YL8A 2RPQA 3P42A 1I35A 1FEHA 3A33B 1F0ZA 4F7ZA 1YJIA 1ROEA 2MH7A 3Q3MC 2M0AA 1MI0A 2Z59B 2K25A 2GMIC 3LDZE 3PREA 3B9JA 2ZCCA 3DVGX 3RYTA 1WWTA 3ZQ4A 2BB6A 3ZLZA 1IGDA 3M62B 3KWLA 2AWTA 4ICVA 3ZTDA 1DOYA 4W9LA 3PO0A 4ZHPA 3M63B 1SIJA 5G2NA 2HTME 1NBFC 1K50A 1VDVA 2NTTA 4HKZE 2GI9A 3NZUA 5LLIA 1L4DB 2A5UA 2IO0B 4ZYSA 3T9LA 2D3BA 1FFUA 3RT3B 2KC2A 5C23A 2KDIA 4EZKA 2MBBB 1VD2A 2WS3B 1SXTA 1C78A 3AV8A 2DAFA 1KLGD 3BY4B 2L0TA 3OG5A 3MFGA 1BMLC 2Y5PA 2FIDA 1MVKA 2BS4B 2GBRA 2JU6X 3AE1B 3V62A 1ZPSA 4YSXB 3L54A 4W9KA 1YN5A 3HVDA 4RGTA 2D10A 2MBEA 1QILA 1V1OA 2R61A 1V81A 2DZJA 2DLBA 3R3MA 2OEDA 2REXA 1LO5D 2BS2B 4FHJA 2E3TA 4XWWA 4YSYB 2RMMA 5FKAC 2ASQA 3ZO5B 2PE6B 3QX1A 2KX0A 2XEWA 1K8RB 2WXHA 3DDCB 1ZXHA 2G45B 3NZ3A 4FJVB 1I4XA 4JL9A 4FHKA 1I4GA 1XT9B 5CX3A 1KF6B 2PEAA 1NVID 3H7SA 5D3DA 2B3AA 3RZWC 3N1XC 2GBKA 1IBXA 4HPLB 1KJTA 3QHTA 2MCNB 3U7DA 1ZXIA 4DDGD 3KWVA 3NRZA 4XC2A 4KSLC 2LHDA 4O1NA 3SDLC 3AH7A 4PS8A 5C2TB 2KKCA 1HE8A 2R2OA 4JQWC 4RH6A 4LNKA 3TEZA 3P4SB 4WJOA 2M19A 4TUUA 2L32A 3DCGA 2FIFA 1R4NB 2BQQA 2QEJC 3RN9C 4LNIA 2IBIB 3PRMB 4HEA1 1ZUD2 1WYWB 4TQ1A 3R7QA 1HTOA 2ZCBA 2GBJA 5HHDG 2KMMA 2VZKD 3N1YC 3APCA 1UUPA 4W9JA 5LXHA 4YSZB 3DVNV 3W1SC 3FKYA 4HVBA 1ZW7A 4BOZB 2V0GA 4K81A 4GMVA 3GE3C 5AZGA 1AARA 1C4PA 4BKTA 2KWUB 3UF8A 4OHJA 1WIAA 3BZDB 1Q10A 3H8HA 2L8JA 1BXTA 4TV3A 1CMXB 2ON8A 3Q3FA 1KFYB 3AE9B 2KTRA 4NAWA 4LK0M 4LJPB 4R3DA 3ALBA 2AQ2B 2AX5A 3DPDA 1TTNA 1UBIA 3DBSA 4GSWA 1KLVA 2W3RA 2N7DA 3WANA 1ET9A 2L83A 3I5JC 1I4HA 1LFDA 5G5GA 1F2RI 3AECB 4HCNB 3KYDD 3W9CB 3VUYA 4WWMA 2HD5B 2TSSA 1D3ZA 5DPSA 3TL5A 3RPFC 3RNEC 2IO2B 3AEGB 4XE0A 2ZNVB 2MQJA 1WJ4A 2MP2A 3KLSX 3ZXVA 1X1MA 1WX9A 4S0RA 4ZRKA 1IYFA 1SE3A 1UBQA 4US8A 1XCQL 2WXRA 1OQYA 2O6VB 2IO3B 1F1HA 1YQ4B 1SIFA 4WWNA 1K51A 2BGFA 2C60A 3T3OA 2WXIA 1ZDVA 2FAZA 3EC8A 2MJDA 4ZHOA 3AE2B 2JY6A 4RM9A 3O65B 3VUWA 2LI5A 4NPNA 1P98A 2WDTB 5IAAC 2ONQA 3AI5A 1WSPA 3V60A 3W1SA 4FADA 3WIMA 2G4SA 4PYZA 2IY0B 5DPTA 1UWMA 4YWGG 2K3UA 3KQ4A 4AJYB 3HK0A 4DQOC 3I3TB 4RGNA 3UIPB 1GC7A 1TS3A 3NVYA 2R2QA 3ABVB 4CHKA 3H6NA 2SEBD 1F77A 3NY5A 4KDLB 4TKNA 2D3GA 3RNFC 2LXAA 4IC7B 1UWXA 2KMCA 3HIZA 2INDC 5J2RA 2KK8A 4M0WA 2OJRA 3P4RB 2KDEB 4J3OD 1NEKB 4FXCA 1YOVB 5FR6A 3DVGY 2D11A
chains in the Genus database with same CATH topology
2GBMA 4A20A 2KHWB 2N9EB 4XX5A 2AL6A 2MRPA 4EUTA 1YIWA 2L76A 2K39A 1MG8A 3H7PA 3QAQA 4KSKC 4G0NB 5J18A 4DHJD 4BKSA 3VTWA 4IG7B 2DYBA 4B95A 2D07B 1C1YB 1SE9A 3A9KA 3OJ3A 1WFYA 2JUOA 3QWZB 2IO1B 5L95C 1WF9A 4BFRA 4EKUA 3VDZA 2JF5A 4CYEA 4BOSC 2LUEA 5CHVC 5DCNA 3PHWB 3B08A 3L13A 3TBLD 2KO3A 2LJ5A 2MSED 3DBLI 2KN5A 3D32A 4W9DA 4HDQA 1V6EA 2BWES 2JT4B 4GN1A 2L7RA 3L0WB 3RD2A 1H4RA 1V86A 3WAOA 2LVQA 2O2VA 1L7YA 5IA7A 2FCQA 1Y8RC 3DVNU 4GU2A 2KQ7A 4NQKE 3ZKJC 2C9WB 4GDLB 4KZ0A 3RZFA 3UQAA 4PS3A 1V9JA 4TQ0A 4AP4C 2KD0A 1WGYA 1R4MI 2KZRA 4XZ4A 4LDTD 1V5TA 2FCNA 4HDOA 5JH5C 3CMMB 2ZVOA 4E71A 2FCMA 3ZW3A 1Z2MA 4NNJB 3B0AA 3QJZA 4W9EA 3HM3A 4ZYNA 4DHJB 3A9JA 4A3OA 3ZRFA 4EOYA 2M8SA 3N30A 4FBJB 1IPGA 2J0JA 4FULA 3HHMA 4I6LB 4AWJA 2LGYA 2ZEQA 4KIKB 3ML8A 4ZDVA 1Q1OA 3AU4A 3EFUA 3N32A 1S3SG 1A5RA 4DK5A 1LM8B 2MBHA 3OJ4B 4IM2A 2JRHA 5AZFA 2C7MB 4E3CA 2UYZB 2DYOA 2FNJB 2L05A 1KM7A 4FN2A 3VHTC 3UIOB 3DQVA 2J0KA 4MH0E 2FUHB 1EUVB 2HJ8A 2KFKA 2KLGA 2MWSB 1TGZB 4EFOA 4BVUC 2K6QA 4MJSB 1RLFA 4PS7A 2DX5B 1OEYA 4G11A 4W9CA 3ZNGC 2RD0A 2ZPYA 2LGDA 2XK5A 4MGIE 5EDSA 1WJ6A 4WAAA 1WZ0A 5CHWA 2AL3A 3ZNHB 1E8YA 1E8ZA 4E74A 5KHOA 3QIJA 1WJNA 3RULA 4HCPB 4GB9A 2O6VA 1VCBA 1Z5SB 4YL8A 2RPQA 3M95A 2FCSA 3LJ3A 3ONSA 1I42A 1I35A 2LVOA 3A33B 1S1QB 1E8XA 5TR5A 2RGFA 4OVUA 1FXTB 1OTRB 1WXMA 3IG3A 3UINB 4F7ZA 3A1QB 2PJHA 4MEMA 3ZVVA 3PS6A 2C7NB 1P3QU 3K9OB 2V3SA 1ISNA 3R66C 4EEWA 4FA6A 2MA9B 2ZNVC 3L17A 3IVFA 2KTRB 3Q3JA 2Z59B 2JZ3B 2K25A 4NAWB 2GMIC 2LRUA 3LDZE 4ANUA 3PREA 4FJZA 4ZRJA 2ZCCA 2I1JA 3DVGX 2KDFB 3RYTA 2NVUI 3ZLZA 1WMHA 2DZIA 3M62B 1WE6A 2K8HA 4WJNA 3SHQA 3APFA 4NJ7A 3APDA 2AWTA 2NBWB 3EECA 4HWIB 4ICVA 4GDKB 4WJPA 1YX5B 2DYMA 2GOWA 3WAPA 3ZRCA 4W9LA 3RUIB 1YQBA 2N7EA 3M63B 3CSTA 5G2NA 3VQIA 1XD3B 1NBFC 4DWFA 1SGHA 2BKRB 4W9FA 4HJKA 3NZUA 5LLIA 2G3QB 1E7VA 4II2B 2AYOB 3ZIMA 2A5UA 2IO0B 4GIVA 1OEYJ 2CS4A 2C5LC 2PE9A 4CO7A 2HTHA 3T9LA 1ZGUB 2WX0A 4X57B 3RT3B 2KC2A 5C23A 2AEHA 2KDIA 3AULA 4BKGA 2MBBB 4OVVA 4EZKA 5JHBA 4PYUA 4LJOB 1WRDB 3PGEA 1UZXB 2HE7A 1VD2A 2MP2B 2C7HA 4ASWC 2ZPNA 4II3B 2M1MA 1GNUA 4KDIC 1EO6A 1BT0A 3ZUNA 1J19A 2DAFA 2J0MA 3QQ8B 2L3ZA 3BY4B 5G55A 4B6WA 2L0TA 5E6NA 1E90A 2LXCA 2FIDA 3ECIA 1EF5A 2GBRA 4GXBA 3V62A 2BYEA 2V1YA 2NPTB 2M0XA 1UGMA 3L10B 3L54A 3PRPB 4W9KA 1L2NA 1T0YA 4AUQC 2KTFA 4W9GA 3QCAA 3JSVA 5BO4B 2D10A 2KOXA 4KV2A 2MBEA 4RMAA 2QHOA 2YLMA 3CF6E 4K7SA 1V81A 1EF1A 2DZJA 2K6DB 3PVLA 4LCDE 3VVWB 3PPAA 3R3MA 2DAJA 2JRIB 3PLVA 2I1KA 2REXA 5J17A 4P7IA 3U8ZA 2KJ6A 3KH0A 1PQSA 3CSFA 2RR9A 3JW0X 2BF8B 3VFKA 3PLUA 4FHJA 3TIXA 2KMAA 1WJUA 2LZ6A 1LXDA 4DHZB 2ASQA 3ZO5B 1KOTA 1WXSA 5CHFA 4FJYA 2CR5A 2PE6B 3QX1A 3M3JA 4MGZE 2KX0A 3B1LX 1ZKHA 2XEWA 1WGDA 1K8RB 1H8CA 4IWOA 5D94A 2ZVNA 3DDCB 3WALA 3L16A 4IW0A 1C3TA 2Z0DB 2G45B 2BYVE 4FJVB 2KX3A 3EHVA 4JL9A 4FHKA 4WQOB 1IP9A 3TJPA 2N9PC 1WM2A 1XT9B 5CX3A 1RAXA 2PEAA 3PHXB 3H7SA 2KWVB 2B3AA 4BKSD 1TZ1A 2K8BA 3RZWC 4ICUA 3QA8A 4EZJA 2GBKA 4RM8A 5JHAA 4HPLB 1KJTA 3QHTA 2MCNB 3U7DA 2LD9A 2MX2A 5AEKB 3UQBA 1R4NI 4DDGD 1WI0A 2JXXA 4JGHB 5D6JB 1U4AA 3ZTCA 3VUXA 2CU1A 1NDDA 2KANA 3KYCD 3N3KB 4WJQA 4XC2A 5D2MB 2N1VA 2KVRA 3S2AA 3W1YA 4GDLA 2LGXA 3SD5A 5JZEB 4KSLC 3X0WA 3VH3B 4MDKE 3SDLC 2N4FA 3VTUA 4PS8A 2PPHA 2KKCA 1OGWA 4M8MA 1HE8A 2KQSA 5DPWA 3ZNID 2LASA 3ZDMC 2W9NA 4MM3A 2R2OA 1YJ1A 4MGKE 4JQWC 2JPHA 1Q0WB 4M0WB 2JWZA 3KW5B 4WJOA 4I6PA 2BWFA 1WGGA 4TUUA 4KIKA 3VAWA 3DCGA 2FIFA 1Q5WB 1WM3A 3DOWA 2MBQA 3MHSD 4DBGA 3H7PB 4F8CB 2IBIB 1YX6B 3PRMB 1UELA 4G3XB 5C1ZA 4J6IA 1RRBA 1WYWB 1WXVA 1M94A 3MTNB 2ZZPB 4TQ1A 3R7QA 3V6CB 2ZCBA 2GBJA 2LVPA 3A9KB 1UH6A 1XQQA 2KC1A 4MJSA 2K1FA 3APCA 2MW5A 4W9JA 5CTRC 4ZRIA 5LXHA 2VRRB 3JVZX 1P1AA 2BPSA 1JRUA 3DVNV 3W1SC 3IFWB 4HVBA 1ZW7A 3ENEA 2NBVB 4K81A 4GMVA 3PZDA 4BOZB 5AZGA 4ANWA 1AARA 3WAMA 2Y5BB 2Z0EB 4MELA 4BKTA 2KWUB 3UF8A 3SU8X 1WIAA 4HLEA 2KNBA 2O2VB 2NCNA 4WWOA 3L08A 2L8JA 3NHEB 4TV3A 3A1QA 1CMXB 2KJHB 2BKFA 3Q3FA 1LQBA 2MBOA 1E7UA 1WX8A 2JZZA 2KTRA 2UWQA 4NAWA 4LJPB 3TMPB 3ALBA 2O6VD 3MJWA 1WGHA 3UGBB 3DPDA 2KDBA 1WR1A 2A4ZA 2D2QA 4MGYE 1TTNA 1UBIA 2J7QB 3DBSA 4GSWA 1KLVA 2JVCA 2N7DA 3WANA 3A9JB 4GDKA 1LFDA 5E6OA 4IM3A 2CHXA 2EMSA 2ZJDA 3RCZA 3GOEA 3AU5A 3K9PB 4HPMB 4KVGB 4HCNB 4BBNC 3KYDD 1TBEA 3V61A 3ZTDA 2WYQA 3JYUA 1WY8A 1WGRA 2OOBB 4IWPA 3VUYA 3OAWA 4AOFA 2HD5B 1D3ZA 3WA0A 1YD8U 4GGQA 5DPSA 1V2YA 3TL5A 4A3PA 3HM6X 5GMVA 2KFKB 4NY0A 2IO2B 4AJWA 5E6PA 4KZCA 2ZNVB 2MQJA 1WJ4A 2MP2A 4IWQA 5LXIB 4WWPA 4IM0A 1X1MA 1WX9A 2DHZA 1GJZA 2WWZA 1V80A 2XK5B 3X23A 4ZRKA 3U30A 1IYFA 4NQLB 3H9DA 3DBHI 1UBQA 2WX1A 3NZSA 2LWPA 1OQYA 2L0FA 3OLMD 2O6VB 4JIOU 4K7UA 2KLCA 2IO3B 1UD7A 2CHZA 3IHPC 3BINA 2NPTA 1SIFA 4WWNA 2XBBC 2BGFA 2C60A 1P9DU 4FLHA 3VTVA 2EMTA 2EKEC 5DPRA 3T8MA 3P2BA 4IUMB 4GOCA 2N9XA 2CHWA 1NI2A 3QK0A 1WMHB 2KJRA 1V49A 2YVCA 4HK2A 2FAZA 2N1WA 3EC8A 3KUDB 4DXAB 3DBRI 3AXCA 3QARA 1V5OA 2BYFA 2JY6A 4RM9A 3ML9A 3O65B 4URKA 2K8CA 1J8CA 3NOBA 2LI5A 4M8NA 4NPNA 3VUWA 1P98A 3GZNI 4F1SA 3TCAA 2WDTB 5IAAC 5L83A 4N9F4 4EZLA 3AI5A 4JLCA 3V60A 3W1SA 2IY1B 4FADA 3WIMA 2G4SA 4PYZA 1WXAA 2IY0B 2M4NA 3PT2B 5DPTA 1GUAB 5D7GA 4MSQB 4LDTB 4AJYB 4BBNF 3VH4B 3PV1A 3HK0A 2DZMA 2KFJA 3I3TB 1GC6A 1WR6E 4K7WA 1J0GA 2V4LA 3KVFB 3UIPB 3ZNZB 1GC7A 4DHZE 1E5WA 4W9IA 4B9KA 4NJ6A 3PRZA 3A4RA 3C0RB 4HXDA 4ANVA 3V6EB 2DZKA 4G50A 3VXWA 2R2QA 2L00B 4CHKA 1QZEA 3PSEB 3H6NA 1RFAA 1WE7A 4ANXA 1GG3A 3NY5A 4KDLB 4TKNA 3R7RA 4DDID 2G4DB 2D3GA 2MLBA 5AZHA 1WZ3A 2IYDB 2KWCA 2IZVB 3A4SC 1E8WA 2M17A 2NR2A 2LXAA 4K1RB 3KUCB 4IC7B 2RSUA 3JSVB 5HKHA 5KHQA 2KMCA 1WX7A 2KXJA 3QC8B 3HIZA 2CKHB 2LRWA 2NS5A 2GBNA 3IBEA 1P0RA 1G6JA 3ZDTA 1WH3A 5J2RA 2KK8A 2OJRA 2DENB 2KDEB 2NBUA 3PTFC 4MSMB 4W9HA 3H1UA 3NS8A 1F9JA 5FR6A 3DVGY 4I6NB 3KUZA 2D11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GBM A;  4A20 A;  2KHW B;  2N9E B;  4XX5 A;  2AL6 A;  2MRP A;  4EUT A;  1YIW A;  2L76 A;  2K39 A;  1MG8 A;  3H7P A;  3QAQ A;  4KSK C;  4G0N B;  5J18 A;  4DHJ D;  4BKS A;  3VTW A;  4IG7 B;  2DYB A;  4B95 A;  2D07 B;  1C1Y B;  1SE9 A;  3A9K A;  3OJ3 A;  1WFY A;  2JUO A;  3QWZ B;  2IO1 B;  5L95 C;  1WF9 A;  4BFR A;  4EKU A;  3VDZ A;  2JF5 A;  4CYE A;  4BOS C;  2LUE A;  5CHV C;  5DCN A;  3PHW B;  3B08 A;  3L13 A;  3TBL D;  2KO3 A;  2LJ5 A;  2MSE D;  3DBL I;  2KN5 A;  3D32 A;  4W9D A;  4HDQ A;  1V6E A;  2BWE S;  2JT4 B;  4GN1 A;  2L7R A;  3L0W B;  3RD2 A;  1H4R A;  1V86 A;  3WAO A;  2LVQ A;  2O2V A;  1L7Y A;  5IA7 A;  2FCQ A;  1Y8R C;  3DVN U;  4GU2 A;  2KQ7 A;  4NQK E;  3ZKJ C;  2C9W B;  4GDL B;  4KZ0 A;  3RZF A;  3UQA A;  4PS3 A;  1V9J A;  4TQ0 A;  4AP4 C;  2KD0 A;  1WGY A;  1R4M I;  2KZR A;  4XZ4 A;  4LDT D;  1V5T A;  2FCN A;  4HDO A;  5JH5 C;  3CMM B;  2ZVO A;  4E71 A;  2FCM A;  3ZW3 A;  1Z2M A;  4NNJ B;  3B0A A;  3QJZ A;  4W9E A;  3HM3 A;  4ZYN A;  4DHJ B;  3A9J A;  4A3O A;  3ZRF A;  4EOY A;  2M8S A;  3N30 A;  4FBJ B;  1IPG A;  2J0J A;  4FUL A;  3HHM A;  4I6L B;  4AWJ A;  2LGY A;  2ZEQ A;  4KIK B;  3ML8 A;  4ZDV A;  1Q1O A;  3AU4 A;  3EFU A;  3N32 A;  1S3S G;  1A5R A;  4DK5 A;  1LM8 B;  2MBH A;  3OJ4 B;  4IM2 A;  2JRH A;  5AZF A;  2C7M B;  4E3C A;  2UYZ B;  2DYO A;  2FNJ B;  2L05 A;  1KM7 A;  4FN2 A;  3VHT C;  3UIO B;  3DQV A;  2J0K A;  4MH0 E;  2FUH B;  1EUV B;  2HJ8 A;  2KFK A;  2KLG A;  2MWS B;  1TGZ B;  4EFO A;  4BVU C;  2K6Q A;  4MJS B;  1RLF A;  4PS7 A;  2DX5 B;  1OEY A;  4G11 A;  4W9C A;  3ZNG C;  2RD0 A;  2ZPY A;  2LGD A;  2XK5 A;  4MGI E;  5EDS A;  1WJ6 A;  4WAA A;  1WZ0 A;  5CHW A;  2AL3 A;  3ZNH B;  1E8Y A;  1E8Z A;  4E74 A;  5KHO A;  3QIJ A;  1WJN A;  3RUL A;  4HCP B;  4GB9 A;  2O6V A;  1VCB A;  1Z5S B;  4YL8 A;  2RPQ A;  3M95 A;  2FCS A;  3LJ3 A;  3ONS A;  1I42 A;  1I35 A;  2LVO A;  3A33 B;  1S1Q B;  1E8X A;  5TR5 A;  2RGF A;  4OVU A;  1FXT B;  1OTR B;  1WXM A;  3IG3 A;  3UIN B;  4F7Z A;  3A1Q B;  2PJH A;  4MEM A;  3ZVV A;  3PS6 A;  2C7N B;  1P3Q U;  3K9O B;  2V3S A;  1ISN A;  3R66 C;  4EEW A;  4FA6 A;  2MA9 B;  2ZNV C;  3L17 A;  3IVF A;  2KTR B;  3Q3J A;  2Z59 B;  2JZ3 B;  2K25 A;  4NAW B;  2GMI C;  2LRU A;  3LDZ E;  4ANU A;  3PRE A;  4FJZ A;  4ZRJ A;  2ZCC A;  2I1J A;  3DVG X;  2KDF B;  3RYT A;  2NVU I;  3ZLZ A;  1WMH A;  2DZI A;  3M62 B;  1WE6 A;  2K8H A;  4WJN A;  3SHQ A;  3APF A;  4NJ7 A;  3APD A;  2AWT A;  2NBW B;  3EEC A;  4HWI B;  4ICV A;  4GDK B;  4WJP A;  1YX5 B;  2DYM A;  2GOW A;  3WAP A;  3ZRC A;  4W9L A;  3RUI B;  1YQB A;  2N7E A;  3M63 B;  3CST A;  5G2N A;  3VQI A;  1XD3 B;  1NBF C;  4DWF A;  1SGH A;  2BKR B;  4W9F A;  4HJK A;  3NZU A;  5LLI A;  2G3Q B;  1E7V A;  4II2 B;  2AYO B;  3ZIM A;  2A5U A;  2IO0 B;  4GIV A;  1OEY J;  2CS4 A;  2C5L C;  2PE9 A;  4CO7 A;  2HTH A;  3T9L A;  1ZGU B;  2WX0 A;  4X57 B;  3RT3 B;  2KC2 A;  5C23 A;  2AEH A;  2KDI A;  3AUL A;  4BKG A;  2MBB B;  4OVV A;  4EZK A;  5JHB A;  4PYU A;  4LJO B;  1WRD B;  3PGE A;  1UZX B;  2HE7 A;  1VD2 A;  2MP2 B;  2C7H A;  4ASW C;  2ZPN A;  4II3 B;  2M1M A;  1GNU A;  4KDI C;  1EO6 A;  1BT0 A;  3ZUN A;  1J19 A;  2DAF A;  2J0M A;  3QQ8 B;  2L3Z A;  3BY4 B;  5G55 A;  4B6W A;  2L0T A;  5E6N A;  1E90 A;  2LXC A;  2FID A;  3ECI A;  1EF5 A;  2GBR A;  4GXB A;  3V62 A;  2BYE A;  2V1Y A;  2NPT B;  2M0X A;  1UGM A;  3L10 B;  3L54 A;  3PRP B;  4W9K A;  1L2N A;  1T0Y A;  4AUQ C;  2KTF A;  4W9G A;  3QCA A;  3JSV A;  5BO4 B;  2D10 A;  2KOX A;  4KV2 A;  2MBE A;  4RMA A;  2QHO A;  2YLM A;  3CF6 E;  4K7S A;  1V81 A;  1EF1 A;  2DZJ A;  2K6D B;  3PVL A;  4LCD E;  3VVW B;  3PPA A;  3R3M A;  2DAJ A;  2JRI B;  3PLV A;  2I1K A;  2REX A;  5J17 A;  4P7I A;  3U8Z A;  2KJ6 A;  3KH0 A;  1PQS A;  3CSF A;  2RR9 A;  3JW0 X;  2BF8 B;  3VFK A;  3PLU A;  4FHJ A;  3TIX A;  2KMA A;  1WJU A;  2LZ6 A;  1LXD A;  4DHZ B;  2ASQ A;  3ZO5 B;  1KOT A;  1WXS A;  5CHF A;  4FJY A;  2CR5 A;  2PE6 B;  3QX1 A;  3M3J A;  4MGZ E;  2KX0 A;  3B1L X;  1ZKH A;  2XEW A;  1WGD A;  1K8R B;  1H8C A;  4IWO A;  5D94 A;  2ZVN A;  3DDC B;  3WAL A;  3L16 A;  4IW0 A;  1C3T A;  2Z0D B;  2G45 B;  2BYV E;  4FJV B;  2KX3 A;  3EHV A;  4JL9 A;  4FHK A;  4WQO B;  1IP9 A;  3TJP A;  2N9P C;  1WM2 A;  1XT9 B;  5CX3 A;  1RAX A;  2PEA A;  3PHX B;  3H7S A;  2KWV B;  2B3A A;  4BKS D;  1TZ1 A;  2K8B A;  3RZW C;  4ICU A;  3QA8 A;  4EZJ A;  2GBK A;  4RM8 A;  5JHA A;  4HPL B;  1KJT A;  3QHT A;  2MCN B;  3U7D A;  2LD9 A;  2MX2 A;  5AEK B;  3UQB A;  1R4N I;  4DDG D;  1WI0 A;  2JXX A;  4JGH B;  5D6J B;  1U4A A;  3ZTC A;  3VUX A;  2CU1 A;  1NDD A;  2KAN A;  3KYC D;  3N3K B;  4WJQ A;  4XC2 A;  5D2M B;  2N1V A;  2KVR A;  3S2A A;  3W1Y A;  4GDL A;  2LGX A;  3SD5 A;  5JZE B;  4KSL C;  3X0W A;  3VH3 B;  4MDK E;  3SDL C;  2N4F A;  3VTU A;  4PS8 A;  2PPH A;  2KKC A;  1OGW A;  4M8M A;  1HE8 A;  2KQS A;  5DPW A;  3ZNI D;  2LAS A;  3ZDM C;  2W9N A;  4MM3 A;  2R2O A;  1YJ1 A;  4MGK E;  4JQW C;  2JPH A;  1Q0W B;  4M0W B;  2JWZ A;  3KW5 B;  4WJO A;  4I6P A;  2BWF A;  1WGG A;  4TUU A;  4KIK A;  3VAW A;  3DCG A;  2FIF A;  1Q5W B;  1WM3 A;  3DOW A;  2MBQ A;  3MHS D;  4DBG A;  3H7P B;  4F8C B;  2IBI B;  1YX6 B;  3PRM B;  1UEL A;  4G3X B;  5C1Z A;  4J6I A;  1RRB A;  1WYW B;  1WXV A;  1M94 A;  3MTN B;  2ZZP B;  4TQ1 A;  3R7Q A;  3V6C B;  2ZCB A;  2GBJ A;  2LVP A;  3A9K B;  1UH6 A;  1XQQ A;  2KC1 A;  4MJS A;  2K1F A;  3APC A;  2MW5 A;  4W9J A;  5CTR C;  4ZRI A;  5LXH A;  2VRR B;  3JVZ X;  1P1A A;  2BPS A;  1JRU A;  3DVN V;  3W1S C;  3IFW B;  4HVB A;  1ZW7 A;  3ENE A;  2NBV B;  4K81 A;  4GMV A;  3PZD A;  4BOZ B;  5AZG A;  4ANW A;  1AAR A;  3WAM A;  2Y5B B;  2Z0E B;  4MEL A;  4BKT A;  2KWU B;  3UF8 A;  3SU8 X;  1WIA A;  4HLE A;  2KNB A;  2O2V B;  2NCN A;  4WWO A;  3L08 A;  2L8J A;  3NHE B;  4TV3 A;  3A1Q A;  1CMX B;  2KJH B;  2BKF A;  3Q3F A;  1LQB A;  2MBO A;  1E7U A;  1WX8 A;  2JZZ A;  2KTR A;  2UWQ A;  4NAW A;  4LJP B;  3TMP B;  3ALB A;  2O6V D;  3MJW A;  1WGH A;  3UGB B;  3DPD A;  2KDB A;  1WR1 A;  2A4Z A;  2D2Q A;  4MGY E;  1TTN A;  1UBI A;  2J7Q B;  3DBS A;  4GSW A;  1KLV A;  2JVC A;  2N7D A;  3WAN A;  3A9J B;  4GDK A;  1LFD A;  5E6O A;  4IM3 A;  2CHX A;  2EMS A;  2ZJD A;  3RCZ A;  3GOE A;  3AU5 A;  3K9P B;  4HPM B;  4KVG B;  4HCN B;  4BBN C;  3KYD D;  1TBE A;  3V61 A;  3ZTD A;  2WYQ A;  3JYU A;  1WY8 A;  1WGR A;  2OOB B;  4IWP A;  3VUY A;  3OAW A;  4AOF A;  2HD5 B;  1D3Z A;  3WA0 A;  1YD8 U;  4GGQ A;  5DPS A;  1V2Y A;  3TL5 A;  4A3P A;  3HM6 X;  5GMV A;  2KFK B;  4NY0 A;  2IO2 B;  4AJW A;  5E6P A;  4KZC A;  2ZNV B;  2MQJ A;  1WJ4 A;  2MP2 A;  4IWQ A;  5LXI B;  4WWP A;  4IM0 A;  1X1M A;  1WX9 A;  2DHZ A;  1GJZ A;  2WWZ A;  1V80 A;  2XK5 B;  3X23 A;  4ZRK A;  3U30 A;  1IYF A;  4NQL B;  3H9D A;  3DBH I;  1UBQ A;  2WX1 A;  3NZS A;  2LWP A;  1OQY A;  2L0F A;  3OLM D;  2O6V B;  4JIO U;  4K7U A;  2KLC A;  2IO3 B;  1UD7 A;  2CHZ A;  3IHP C;  3BIN A;  2NPT A;  1SIF A;  4WWN A;  2XBB C;  2BGF A;  2C60 A;  1P9D U;  4FLH A;  3VTV A;  2EMT A;  2EKE C;  5DPR A;  3T8M A;  3P2B A;  4IUM B;  4GOC A;  2N9X A;  2CHW A;  1NI2 A;  3QK0 A;  1WMH B;  2KJR A;  1V49 A;  2YVC A;  4HK2 A;  2FAZ A;  2N1W A;  3EC8 A;  3KUD B;  4DXA B;  3DBR I;  3AXC A;  3QAR A;  1V5O A;  2BYF A;  2JY6 A;  4RM9 A;  3ML9 A;  3O65 B;  4URK A;  2K8C A;  1J8C A;  3NOB A;  2LI5 A;  4M8N A;  4NPN A;  3VUW A;  1P98 A;  3GZN I;  4F1S A;  3TCA A;  2WDT B;  5IAA C;  5L83 A;  4N9F 4;  4EZL A;  3AI5 A;  4JLC A;  3V60 A;  3W1S A;  2IY1 B;  4FAD A;  3WIM A;  2G4S A;  4PYZ A;  1WXA A;  2IY0 B;  2M4N A;  3PT2 B;  5DPT A;  1GUA B;  5D7G A;  4MSQ B;  4LDT B;  4AJY B;  4BBN F;  3VH4 B;  3PV1 A;  3HK0 A;  2DZM A;  2KFJ A;  3I3T B;  1GC6 A;  1WR6 E;  4K7W A;  1J0G A;  2V4L A;  3KVF B;  3UIP B;  3ZNZ B;  1GC7 A;  4DHZ E;  1E5W A;  4W9I A;  4B9K A;  4NJ6 A;  3PRZ A;  3A4R A;  3C0R B;  4HXD A;  4ANV A;  3V6E B;  2DZK A;  4G50 A;  3VXW A;  2R2Q A;  2L00 B;  4CHK A;  1QZE A;  3PSE B;  3H6N A;  1RFA A;  1WE7 A;  4ANX A;  1GG3 A;  3NY5 A;  4KDL B;  4TKN A;  3R7R A;  4DDI D;  2G4D B;  2D3G A;  2MLB A;  5AZH A;  1WZ3 A;  2IYD B;  2KWC A;  2IZV B;  3A4S C;  1E8W A;  2M17 A;  2NR2 A;  2LXA A;  4K1R B;  3KUC B;  4IC7 B;  2RSU A;  3JSV B;  5HKH A;  5KHQ A;  2KMC A;  1WX7 A;  2KXJ A;  3QC8 B;  3HIZ A;  2CKH B;  2LRW A;  2NS5 A;  2GBN A;  3IBE A;  1P0R A;  1G6J A;  3ZDT A;  1WH3 A;  5J2R A;  2KK8 A;  2OJR A;  2DEN B;  2KDE B;  2NBU A;  3PTF C;  4MSM B;  4W9H A;  3H1U A;  3NS8 A;  1F9J A;  5FR6 A;  3DVG Y;  4I6N B;  3KUZ A;  2D11 A; 
#chains in the Genus database with same CATH topology
 1HEZ E;  1L0Y B;  2N9E B;  3SEB A;  3RNB C;  3TSS A;  3H7P A;  4G0N B;  5J18 A;  2DYB A;  1TKG A;  4WIP A;  1WFY A;  4EKU A;  4C80 A;  4P16 A;  2GLS A;  3DBL I;  2KN5 A;  1HZ6 A;  3U52 E;  4GN1 A;  1IBX B;  1V86 A;  2LVQ A;  2O2V A;  1AWD A;  1ZDX A;  5IA7 A;  2RDG A;  4GU2 A;  2KQ7 A;  2YEP B;  3ZKJ C;  3RZF A;  3HRD D;  4AS1 A;  1V97 A;  2FCN A;  3AEB B;  3CMM B;  2FCM A;  3RNG C;  4A8X C;  4ZYN A;  3A9J A;  3FAH A;  4A3O A;  3TEY A;  2W54 A;  4FBJ B;  2J0J A;  1N63 A;  4ZDV A;  1A5R A;  3UI3 A;  2MBH A;  3GP7 A;  1YN3 A;  2L05 A;  4FN2 A;  4B0M A;  2KFK A;  1QOF A;  1R4M B;  2KLG A;  3WCQ A;  1TGZ B;  2K6Q A;  2JYE A;  3N9Y C;  2L52 A;  2N0S B;  1OEY A;  3ZNG C;  3GS2 A;  3DWM A;  1C77 A;  2XK5 A;  2HDE A;  1WJ6 A;  4KGS A;  2V3N A;  2AL3 A;  1JWS D;  5KHO A;  3RUL A;  3LB8 C;  4HCP B;  2J52 A;  1Z5S B;  2FCS A;  3LJ3 A;  5FK9 C;  2EEL A;  1FXT B;  4C4V A;  2PJH A;  2C7N B;  4FA6 A;  4EEW A;  1D5M C;  4S17 A;  2ZNV C;  3IVF A;  2KTR B;  4NAW B;  1WYG A;  5BYR A;  4FJZ A;  2I1J A;  3Q69 A;  5BMG A;  2DZI A;  4WJN A;  2K8H A;  4NJ7 A;  3APD A;  2EKI A;  1FD6 A;  1QF6 A;  1YX5 B;  3NJT A;  1YQB A;  2N7E A;  4WQM A;  3VQI A;  3Q8B A;  3NVV A;  4W9F A;  5BYQ A;  4HJK A;  2G3Q B;  4II2 B;  4GIV A;  2IDY A;  4USA A;  4CO7 A;  1ZE3 D;  2V4I B;  4IDI A;  5E6J A;  2AEH A;  5EE3 A;  5JXV A;  3PGE A;  1UZX B;  2BT6 A;  5BMH A;  2HE7 A;  2MP2 B;  2C7H A;  4ASW C;  1TKY A;  4KDI C;  2MJE A;  1TYG B;  3Q3N C;  3QQ8 B;  5G55 A;  3FIL A;  5E6N A;  2LXC A;  4LNO A;  2ACZ B;  3Q8A A;  3ECI A;  2IGD A;  1B9R A;  1TJE A;  2B76 B;  3QCA A;  2WGS A;  2KOX A;  2K5P A;  1L4Z B;  2QHO A;  4K7S A;  3MJ5 A;  3PVL A;  1QT9 A;  1HXY D;  1JRO A;  3PPA A;  4A90 A;  4P7I A;  2KJ6 A;  1PQS A;  2KYW A;  2BF8 B;  3TIX A;  1WJU A;  2LZ6 A;  2YEP F;  4DHZ B;  3U4E G;  2WDV B;  2VH2 A;  1WXS A;  2K22 A;  4HRS A;  3M3J A;  4MGZ E;  3B1L X;  1ZKH A;  1TIF A;  3WAL A;  2CJN A;  1FO4 A;  4LNN A;  1NYR A;  2WHI A;  2N9P C;  4M02 A;  3HVZ A;  4TSS A;  4BKS D;  3QA8 A;  4RM8 A;  2MX2 A;  3AE7 B;  5DPW A;  1WI0 A;  2FE8 A;  4JGH B;  3MC9 A;  3KYC D;  3N3K B;  2N1V A;  1TY2 A;  1L0X B;  1L6U A;  3W1Y A;  1XXG A;  2WP9 B;  3X0W A;  3DHI C;  3VTU A;  1T5X D;  3B2G A;  1OGW A;  1CK1 A;  4M8M A;  2KQS A;  5IN7 A;  2W9N A;  4MM3 A;  2JPH A;  1Q0W B;  4M0W B;  4M00 A;  4RCO A;  1D4B A;  3URY A;  4N59 A;  1WGG A;  3BVG A;  1TT5 B;  3H7P B;  1UEL A;  1WXV A;  3MHZ A;  1IGC A;  3MTN B;  1FNW A;  5IOI A;  1MJD A;  3V6C B;  1XQQ A;  1EU3 A;  2K1F A;  4L23 A;  4ZRP A;  2MW5 A;  4A55 A;  1I4P A;  2V9H A;  2LEK A;  1P1A A;  4KGR A;  2NBV B;  4ANW A;  3WAM A;  1VJK A;  2Z8L A;  3SU8 X;  4HLE A;  2KNB A;  2O2V B;  4WWO A;  2KN4 A;  3MC8 A;  3NHE B;  1JRP A;  2KJH B;  1TKE A;  2JZZ A;  3AE8 B;  3ZJU A;  4GLS C;  5AUI A;  4NJC A;  2KDB A;  4MGY E;  2J7Q B;  4XGA B;  3A9J B;  2LMC A;  2H89 B;  4IM3 A;  2EMS A;  2ZJD A;  3GOE A;  1IUE A;  3AE6 B;  2VZK B;  4KVG B;  4BBN C;  1FXA A;  2WYQ A;  2D3A A;  3JYU A;  4KKI A;  1WGR A;  3VR8 B;  4GGQ A;  4BAX A;  3HM6 X;  2KT7 A;  1NI3 A;  2KFK B;  4NY0 A;  1AW7 A;  5E6P A;  4KZC A;  4IWQ A;  5LXI B;  2DHZ A;  2LJI A;  2XK5 B;  3X23 A;  4WUR A;  1I4R A;  2WX1 A;  4H2A A;  4JIO U;  1UD7 A;  1PFD A;  2CHZ A;  1TS5 A;  4C4V B;  2NPT A;  4P1C C;  1TZO A;  1P9D U;  3VTV A;  2EKE C;  4IUM B;  1NI2 A;  1QOB A;  1BUI C;  4LNF A;  2D5G A;  2YVC A;  4HK2 A;  2K9X A;  4PT5 A;  3DBR I;  3AXC A;  4EE2 A;  3DBH B;  3BYY B;  1E6E B;  1YJJ A;  3Q8E A;  4F1S A;  1RFK A;  1EU4 A;  4D2K A;  1WRI A;  4JLC A;  2IY1 B;  3AED B;  1XLN A;  4K3B A;  2M4N A;  3PT2 B;  5IO9 A;  5D7G A;  1DYQ A;  4MSQ B;  4JE3 B;  3VH4 B;  3PV1 A;  2INN E;  1OFF A;  1GC6 A;  4K7W A;  3KVF B;  1E5W A;  1L0V B;  1QOG A;  3A4R A;  3C0R B;  4N6E B;  4G50 A;  3VXW A;  2MJ3 A;  3FIL B;  5TSS A;  3ZGZ A;  1XF5 L;  1RFA A;  3R2T A;  4HRO A;  4ANX A;  1GG3 A;  4XYC A;  1HZ5 A;  3GZN B;  1GAQ B;  4DDI D;  2KWC A;  2IZV B;  1E0Z A;  1M4V A;  2M17 A;  2NR2 A;  2NTS A;  3KUC B;  3N1Z C;  5KHQ A;  1SSN A;  2CKH B;  3IBE A;  1FRR A;  2NBU A;  1ESF A;  2WU2 B;  1F9J A;  2JXT A;  2AL6 A;  2OJW A;  4EUT A;  1YIW A;  1SE4 A;  2L76 A;  1MG8 A;  3P4P B;  4DHJ D;  4BKS A;  3AB5 A;  3VTW A;  2E6X A;  2M56 B;  3HUI A;  2FUG 1;  1C1Y B;  3A9K A;  3PZ8 A;  2BYT A;  4JWS C;  4P1B C;  1WF9 A;  1N5X A;  2PVO D;  2WXP A;  3MP9 A;  2PMV A;  4ACF A;  2PIA A;  1YNT E;  3ZJT A;  2BWE S;  2L7R A;  3L0W B;  3RD2 A;  4BZA A;  2KDM A;  1N62 A;  3I63 C;  4XWT A;  3DVN U;  5IP4 D;  2C9W B;  3Q8C A;  3IT4 B;  4PS3 A;  4TQ0 A;  1NYQ A;  3NVW A;  3ZJV A;  5JH5 C;  4CQN A;  4E71 A;  1Z2M A;  3B0A A;  3QJZ A;  4MM3 B;  4W9E A;  4YTP B;  3ZRF A;  3N30 A;  1KTK A;  3B2F A;  1IPG A;  3HHM A;  1WXQ A;  2LGY A;  2ZEQ A;  1Q1O A;  1S3S G;  2RDH A;  4IM2 A;  1KRH A;  2JRH A;  5AZF A;  1C76 A;  4OW0 A;  4E3C A;  2UYZ B;  1NEN B;  2DYO A;  1FXI A;  3UIO B;  3DQV A;  2J0K A;  1L6V A;  2HJ8 A;  3ETR A;  1FCL A;  4W9C A;  2RD0 A;  4RF0 A;  2LGD A;  4WAA A;  1K52 A;  1WZ0 A;  3QIJ A;  1PGX A;  1QLB B;  3P1M A;  1ZP0 B;  1D6E C;  1FPY A;  3ONS A;  2LVO A;  1E8X A;  1JCK B;  5TR5 A;  4OVU A;  3IG3 A;  1XLO A;  4ZRQ A;  4MEM A;  3ZVV A;  3PS6 A;  1P3Q U;  3L17 A;  2JZ3 B;  2X8X X;  4ZRJ A;  2J4X A;  4IKG A;  3U2S C;  4ITK A;  2KDF B;  3AEA B;  3SHQ A;  3RNA C;  3APF A;  1N60 A;  3EEC A;  3TUO A;  3CST A;  1ENF A;  1XD3 B;  4DWF A;  1SGH A;  3ZIM A;  1E7V A;  2AYO B;  2C5L C;  1GB4 A;  2PE9 A;  1ZGU B;  2JWU A;  3AUL A;  1UF0 A;  3ZYY X;  5JHB A;  3C8Y A;  1RWS A;  2WXO A;  1VZ7 A;  4KGT A;  2M1M A;  1BT0 A;  3ZUN A;  1J19 A;  3NUH B;  4B6W A;  4C7Y A;  4PK1 A;  2BYE A;  2V1Y A;  2NPT B;  2M0X A;  3L10 B;  5EE9 A;  3PRP B;  3BVZ A;  3BYT B;  2KTF A;  4W9G A;  3JSV A;  4KV2 A;  4RMA A;  1EF1 A;  2QIL A;  2JRI B;  1J7B A;  3PLV A;  2WXF A;  2WXG A;  5J17 A;  2OHF A;  3IAM 1;  3CSF A;  2RR9 A;  3W5U B;  3PLU A;  2WLB A;  2KMA A;  3SR6 A;  1LXD A;  1KOT A;  5CHF A;  2PVG C;  2L1A A;  3OWE B;  1VRA B;  1WGD A;  5HG2 A;  1H8C A;  4IWO A;  4RGM A;  3W2D A;  3L16 A;  1EWC A;  1C3T A;  2Z0D B;  2BYV E;  2KX3 A;  3RFZ B;  3TJP A;  1SEB D;  1WM2 A;  3P4Q B;  3R8B A;  2KWV B;  1F52 A;  1TZ1 A;  2D3C A;  4EZJ A;  1MHX A;  2QSD A;  5AEK B;  2LD9 A;  4P6V F;  1R4N I;  2JXX A;  4WAF A;  5D6J B;  1U4A A;  4KKJ A;  1E7P B;  3VUX A;  2CU1 A;  5T8I A;  2KAN A;  2KVR A;  3SD5 A;  1C4A A;  4MDK E;  2N4F A;  2IGG A;  3ZNI D;  2LAS A;  2JWZ A;  5MPO A;  3KW5 B;  4I6P A;  4MH8 A;  2BWF A;  2JYT A;  4KIK A;  3VAW A;  1Q5W B;  1SB3 C;  1E9M A;  2MBQ A;  1E10 A;  4J6I A;  1RRB A;  1M94 A;  2ZZP B;  1EM7 A;  2DNF A;  3A9K B;  2CU3 A;  2KC1 A;  5HI1 A;  2XNA C;  5CTR C;  2VRR B;  3GE8 C;  1JRU A;  3IFW B;  2Y5B B;  2Z0E B;  4MEL A;  1I4Q A;  4JWU C;  1LGR A;  5GXG B;  3A1Q A;  4K3C A;  1TS4 A;  2JQR B;  2BKF A;  1RM6 C;  1E7U A;  2J53 A;  2UWQ A;  3TMP B;  3AM9 A;  1WGH A;  1TY0 A;  3Q6B A;  1WR1 A;  2A4Z A;  4MT5 A;  2W3S A;  5H8Y E;  4GDK A;  3NG0 A;  3RCZ A;  4A9A A;  3AU5 A;  3K9P B;  4C7Z A;  4HPM B;  2Q5W D;  1J7C A;  1TBE A;  2BBC A;  3V61 A;  2N9L A;  2OOB B;  4N58 A;  3WA0 A;  1YD8 U;  3W5V B;  4A3P A;  1V2Y A;  1SJH D;  5GMV A;  1FFV A;  4AJW A;  2QC8 A;  1HQR D;  1GJZ A;  1V80 A;  1C79 A;  2IJ0 A;  2PTL A;  3NZS A;  2LWP A;  3CIR B;  3OLM D;  2JX5 A;  2I38 A;  1FM0 D;  2KLC A;  2X38 A;  4XDC A;  3IHP C;  3BIN A;  3ZXR A;  1T0R C;  2XBB C;  3RMK C;  1VR9 A;  1D5Z C;  5DPR A;  3Q8F A;  3P2B A;  2LUM A;  1PGB A;  4GOC A;  2N9X A;  2CHW A;  2KJR A;  3KUD B;  2BYF A;  1AN8 A;  4UDU C;  4URK A;  1KLU D;  2K8C A;  3NOB A;  4M8N A;  4REZ A;  4N9F 4;  4EZL A;  4C00 A;  2N9K A;  3AN1 A;  1GUA B;  4BBN F;  1WR6 E;  4DHZ E;  3ZNZ B;  3BK2 A;  3PRZ A;  4HXD A;  3EFC A;  3V6E B;  2DZK A;  3IT6 B;  2L00 B;  2W82 A;  3VRB B;  1QZE A;  3PSE B;  1JWU D;  1MFW A;  3SFD B;  4HKQ A;  2WXM A;  2WXK A;  3R7R A;  1QOA A;  2G4D B;  3IAS 1;  1SJE D;  2MLB A;  2HJ1 A;  2IYD B;  3A4S C;  2ZW0 A;  3JSV B;  5HKH A;  1WX7 A;  2KXJ A;  2BTE A;  2V3P A;  2LRW A;  2NS5 A;  3TEX A;  1P0R A;  1G6J A;  4KX6 B;  1WH3 A;  3PTF C;  4W9H A;  2AQ1 B;  1C4C A;  3H1U A;  4W9I A;  4BFR A;  1T6B X;  4I6N B;  3KUZ A;  1OEY J;  2GBM A;  4A20 A;  4XX5 A;  4JPS A;  4RGO S;  2MRP A;  4RFB A;  1QKZ A;  1KH0 A;  3DHH C;  3QAQ A;  5G5H A;  2Y5C A;  2JZP A;  1RYJ A;  4B95 A;  1SE9 A;  1ACC A;  2WNM A;  3QWZ B;  2IO1 B;  1XLP A;  2JF5 A;  3FC4 A;  4BOS C;  2LUE A;  5CHV C;  5DCN A;  3B08 A;  4L2Y A;  3EA6 A;  2KO3 A;  4OZC A;  2MSE D;  1V6E A;  3C19 A;  1MG4 A;  1H4R A;  1GOZ A;  3WAO A;  4NQK E;  2WU5 B;  4KZ0 A;  1V9J A;  4AP4 C;  1WGY A;  1R4M I;  1V8C A;  1STE A;  2KZR A;  4XZ4 A;  1V5T A;  3Q14 C;  4HDO A;  3AEF B;  2PW9 A;  3GB1 A;  1QQR A;  1ZOY B;  3HM3 A;  4DHJ B;  1P7E A;  4EOY A;  2M8S A;  4M01 A;  3DWG C;  4AWJ A;  3DBL B;  4KIK B;  3ML8 A;  3EFU A;  3N32 A;  1A70 A;  3OJ4 B;  2C7M B;  2QCZ A;  3NS1 A;  2FNJ B;  3VHT C;  4NZL B;  1EUV B;  4BVU C;  1RLF A;  4PS7 A;  4G11 A;  4MGI E;  3ZNH B;  1E8Y A;  4E74 A;  1WJN A;  4GB9 A;  1D5X C;  1VCB A;  1I42 A;  3M95 A;  3BK1 A;  1S1Q B;  2RGF A;  1OTR B;  1WXM A;  3UIN B;  2BW2 A;  3A1Q B;  4Q2J A;  3K9O B;  2G1E A;  2V3S A;  1ISN A;  3R66 C;  2MA9 B;  3AE5 B;  3Q3J A;  2LRU A;  4ANU A;  3P63 A;  2NVU I;  1WMH A;  1WE6 A;  2DWQ A;  2PKO A;  4WJP A;  4HWI B;  2NBW B;  5HFY A;  3ZRC A;  5IKC M;  4GDK B;  1F2R C;  2DYM A;  2GOW A;  2INC C;  3WAP A;  1C9F A;  1UNS A;  3Q3O C;  4OVZ A;  3RUI B;  4IOI E;  2BKR B;  2WDR B;  1Y56 A;  2CS4 A;  2LGS A;  4YT0 B;  2HTH A;  2WX0 A;  4X57 B;  1HTQ A;  2JSV X;  4BKG A;  4OVV A;  3DHG C;  2W55 A;  2I2Y A;  4PYU A;  4LJO B;  1WRD B;  4RF1 A;  2ZPN A;  4II3 B;  3NVZ A;  1GNU A;  2WDQ B;  1EO6 A;  4OZB A;  2ICI A;  2WXJ A;  2J0M A;  2L3Z A;  1E90 A;  5AUK A;  1GPX A;  1EF5 A;  4GXB A;  5I4D A;  1L5P A;  1UGM A;  1VZ6 A;  5LNK 1;  1L2N A;  1T0Y A;  4AUQ C;  1XEE A;  3AE3 B;  5BO4 B;  2IPK D;  2YLM A;  3CF6 E;  4LCD E;  3VVW B;  2K6D B;  2DAJ A;  2I1K A;  3U8Z A;  3KH0 A;  3AE4 B;  3JW0 X;  3VFK A;  2SAK A;  2KVZ A;  2XN9 C;  3BII D;  4LTU A;  1PDX A;  4FJY A;  2CR5 A;  2DBY A;  2K0P A;  2H88 B;  5H92 C;  5D94 A;  2ZVN A;  4IW0 A;  3EHV A;  4WQO B;  1IP9 A;  1T3Q A;  1YN4 A;  3TEW A;  1RAX A;  3PHX B;  1V1P A;  2K8B A;  5D3I B;  4ICU A;  3VR9 B;  5JHA A;  3AMZ A;  4WH4 A;  3UQB A;  3O13 A;  2UU7 A;  3ZTC A;  1NDD A;  3L4P A;  4WJQ A;  4RNA A;  5D2M B;  3S2A A;  4GDL A;  2LGX A;  5JZE B;  1CQV A;  3VH3 B;  2GB1 A;  3PZ7 A;  1FNU A;  4XDD A;  2WQY B;  2PPH A;  4L1B A;  3ZDM C;  4JX1 C;  1YJ1 A;  4MGK E;  3R2I A;  4MAC A;  1WM3 A;  3DOW A;  3MHS D;  2KQ4 X;  2Y3A A;  4DBG A;  4F8C B;  1YX6 B;  4G3X B;  5C1Z A;  4ARI A;  4HPP A;  3U7Z A;  1JWB D;  2LVP A;  1UH6 A;  4MJS A;  2QJL A;  4ZRI A;  3JVZ X;  2BPS A;  4YTN B;  4TMA B;  1B1Z A;  3ENE A;  1SE2 A;  3PZD A;  1DGJ A;  4ZOH C;  3RI7 C;  3E9S A;  2NCN A;  3L08 A;  3LXF A;  1LQB A;  2MBO A;  5EE0 A;  1WX8 A;  1JW9 D;  1N6Z A;  2CJO A;  2O6V D;  3MJW A;  1T0S C;  1TS2 A;  3UGB B;  2D2Q A;  4LLG M;  2JVC A;  5E6O A;  2CHX A;  4US9 A;  3N20 C;  1HA5 A;  1JWA D;  1WY8 A;  2BVC A;  4IWP A;  4YXD B;  3OAW A;  3EGR A;  2QDF A;  4AOF A;  1AYF A;  1EWY C;  1J7A A;  5BYS A;  4ARC A;  4WWP A;  4IM0 A;  2WWZ A;  3VRA B;  3U30 A;  4NQL B;  3H9D A;  3DBH I;  2NMQ A;  3CWI A;  3V3X A;  4K7U A;  2L0F A;  3MC0 B;  1FMA D;  3EUB 2;  1MPE A;  3IXS A;  1WGK A;  3BWU D;  2AQ3 B;  2IGH A;  1N5W A;  4FLH A;  2WXN A;  2EMT A;  1JWM D;  3T8M A;  4NAM A;  1YMH E;  1XLQ A;  3QK0 A;  1WMH B;  1V49 A;  1K53 A;  3E56 A;  2N1W A;  4DXA B;  3QAR A;  2KAJ A;  1V5O A;  3V05 A;  3ML9 A;  1J8C A;  3GZN I;  3TCA A;  1YQ3 B;  5L83 A;  3LYY A;  1N61 A;  1WXA A;  4YTM B;  2RPV A;  4AQ7 A;  2INP E;  4LDT B;  3RNC C;  2DZM A;  4DXF A;  2KFJ A;  1J0G A;  2V4L A;  1GB1 A;  4B9K A;  4NJ6 A;  2J42 A;  1ET6 A;  2G9H D;  4ANV A;  3DBR B;  1JML A;  1WE7 A;  3T3N A;  2BS3 B;  2BB5 A;  5AZH A;  1WZ3 A;  2MHJ A;  1E8W A;  4K1R B;  1PYW D;  2GRI A;  2RSU A;  5C3J B;  3QC8 B;  1SF0 A;  3J9C A;  2GBN A;  2KAC A;  3ZDT A;  2DEN B;  4MSM B;  3NS8 A;  5FR3 A;  1JQ4 A;  1FNV A;  2KHW B;  2LGI A;  3Q2A C;  2K39 A;  1MHH E;  4C56 C;  5BMI A;  4KSK C;  1PUT A;  2RDB C;  4IG7 B;  1FRD A;  2D07 B;  3OJ3 A;  2JUO A;  3I9V 1;  5L95 C;  3VDZ A;  2WXQ A;  4CYE A;  2LHE A;  1FCC C;  3PHW B;  3L13 A;  3TBL D;  2WXL A;  1OQR A;  2KWD A;  1V1P B;  2LJ5 A;  2MEK A;  3D32 A;  4W9D A;  4HDQ A;  3SFE B;  2JT4 B;  2QMT A;  4B0E A;  1XCT L;  1L7Y A;  2FCQ A;  1VZ8 A;  1Y8R C;  4GDL B;  3UQA A;  5EE1 A;  4OZA A;  2KD0 A;  4LDT D;  2ZW1 A;  1T0Q C;  1UGJ A;  2FBW B;  2ZVO A;  1DOI A;  3ZW3 A;  4NNJ B;  1OQQ A;  1JAL A;  3BVM A;  1XO3 A;  1PGA A;  4FUL A;  4I6L B;  4HJG E;  1CJE A;  4DXG A;  1R7S A;  2N7J A;  3AU4 A;  4DK5 A;  1LM8 B;  1DOX A;  3AEE B;  3I57 A;  1SBB B;  2LFI A;  1KM7 A;  2PLP A;  4MH0 E;  2FUH B;  2MWS B;  4EFO A;  4MJS B;  1CZP A;  1P7F A;  2DX5 B;  4QAY A;  4A6Q A;  1I7H A;  2ZPY A;  1FIQ A;  2QIE B;  5EDS A;  5CHW A;  1E8Z A;  1VLB A;  2VH1 A;  2O6V A;  4YL8 A;  2RPQ A;  3P42 A;  1I35 A;  1FEH A;  3A33 B;  1F0Z A;  4F7Z A;  1YJI A;  1ROE A;  2MH7 A;  3Q3M C;  2M0A A;  1MI0 A;  2Z59 B;  2K25 A;  2GMI C;  3LDZ E;  3PRE A;  3B9J A;  2ZCC A;  3DVG X;  3RYT A;  1WWT A;  3ZQ4 A;  2BB6 A;  3ZLZ A;  1IGD A;  3M62 B;  3KWL A;  2AWT A;  4ICV A;  3ZTD A;  1DOY A;  4W9L A;  3PO0 A;  4ZHP A;  3M63 B;  1SIJ A;  5G2N A;  2HTM E;  1NBF C;  1K50 A;  1VDV A;  2NTT A;  4HKZ E;  2GI9 A;  3NZU A;  5LLI A;  1L4D B;  2A5U A;  2IO0 B;  4ZYS A;  3T9L A;  2D3B A;  1FFU A;  3RT3 B;  2KC2 A;  5C23 A;  2KDI A;  4EZK A;  2MBB B;  1VD2 A;  2WS3 B;  1SXT A;  1C78 A;  3AV8 A;  2DAF A;  1KLG D;  3BY4 B;  2L0T A;  3OG5 A;  3MFG A;  1BML C;  2Y5P A;  2FID A;  1MVK A;  2BS4 B;  2GBR A;  2JU6 X;  3AE1 B;  3V62 A;  1ZPS A;  4YSX B;  3L54 A;  4W9K A;  1YN5 A;  3HVD A;  4RGT A;  2D10 A;  2MBE A;  1QIL A;  1V1O A;  2R61 A;  1V81 A;  2DZJ A;  2DLB A;  3R3M A;  2OED A;  2REX A;  1LO5 D;  2BS2 B;  4FHJ A;  2E3T A;  4XWW A;  4YSY B;  2RMM A;  5FKA C;  2ASQ A;  3ZO5 B;  2PE6 B;  3QX1 A;  2KX0 A;  2XEW A;  1K8R B;  2WXH A;  3DDC B;  1ZXH A;  2G45 B;  3NZ3 A;  4FJV B;  1I4X A;  4JL9 A;  4FHK A;  1I4G A;  1XT9 B;  5CX3 A;  1KF6 B;  2PEA A;  1NVI D;  3H7S A;  5D3D A;  2B3A A;  3RZW C;  3N1X C;  2GBK A;  1IBX A;  4HPL B;  1KJT A;  3QHT A;  2MCN B;  3U7D A;  1ZXI A;  4DDG D;  3KWV A;  3NRZ A;  4XC2 A;  4KSL C;  2LHD A;  4O1N A;  3SDL C;  3AH7 A;  4PS8 A;  5C2T B;  2KKC A;  1HE8 A;  2R2O A;  4JQW C;  4RH6 A;  4LNK A;  3TEZ A;  3P4S B;  4WJO A;  2M19 A;  4TUU A;  2L32 A;  3DCG A;  2FIF A;  1R4N B;  2BQQ A;  2QEJ C;  3RN9 C;  4LNI A;  2IBI B;  3PRM B;  4HEA 1;  1ZUD 2;  1WYW B;  4TQ1 A;  3R7Q A;  1HTO A;  2ZCB A;  2GBJ A;  5HHD G;  2KMM A;  2VZK D;  3N1Y C;  3APC A;  1UUP A;  4W9J A;  5LXH A;  4YSZ B;  3DVN V;  3W1S C;  3FKY A;  4HVB A;  1ZW7 A;  4BOZ B;  2V0G A;  4K81 A;  4GMV A;  3GE3 C;  5AZG A;  1AAR A;  1C4P A;  4BKT A;  2KWU B;  3UF8 A;  4OHJ A;  1WIA A;  3BZD B;  1Q10 A;  3H8H A;  2L8J A;  1BXT A;  4TV3 A;  1CMX B;  2ON8 A;  3Q3F A;  1KFY B;  3AE9 B;  2KTR A;  4NAW A;  4LK0 M;  4LJP B;  4R3D A;  3ALB A;  2AQ2 B;  2AX5 A;  3DPD A;  1TTN A;  1UBI A;  3DBS A;  4GSW A;  1KLV A;  2W3R A;  2N7D A;  3WAN A;  1ET9 A;  2L83 A;  3I5J C;  1I4H A;  1LFD A;  5G5G A;  1F2R I;  3AEC B;  4HCN B;  3KYD D;  3W9C B;  3VUY A;  4WWM A;  2HD5 B;  2TSS A;  1D3Z A;  5DPS A;  3TL5 A;  3RPF C;  3RNE C;  2IO2 B;  3AEG B;  4XE0 A;  2ZNV B;  2MQJ A;  1WJ4 A;  2MP2 A;  3KLS X;  3ZXV A;  1X1M A;  1WX9 A;  4S0R A;  4ZRK A;  1IYF A;  1SE3 A;  1UBQ A;  4US8 A;  1XCQ L;  2WXR A;  1OQY A;  2O6V B;  2IO3 B;  1F1H A;  1YQ4 B;  1SIF A;  4WWN A;  1K51 A;  2BGF A;  2C60 A;  3T3O A;  2WXI A;  1ZDV A;  2FAZ A;  3EC8 A;  2MJD A;  4ZHO A;  3AE2 B;  2JY6 A;  4RM9 A;  3O65 B;  3VUW A;  2LI5 A;  4NPN A;  1P98 A;  2WDT B;  5IAA C;  2ONQ A;  3AI5 A;  1WSP A;  3V60 A;  3W1S A;  4FAD A;  3WIM A;  2G4S A;  4PYZ A;  2IY0 B;  5DPT A;  1UWM A;  4YWG G;  2K3U A;  3KQ4 A;  4AJY B;  3HK0 A;  4DQO C;  3I3T B;  4RGN A;  3UIP B;  1GC7 A;  1TS3 A;  3NVY A;  2R2Q A;  3ABV B;  4CHK A;  3H6N A;  2SEB D;  1F77 A;  3NY5 A;  4KDL B;  4TKN A;  2D3G A;  3RNF C;  2LXA A;  4IC7 B;  1UWX A;  2KMC A;  3HIZ A;  2IND C;  5J2R A;  2KK8 A;  4M0W A;  2OJR A;  3P4R B;  2KDE B;  4J3O D;  1NEK B;  4FXC A;  1YOV B;  5FR6 A;  3DVG Y;  2D11 A; 
#chains in the Genus database with same CATH homology
 2GBM A;  4A20 A;  2KHW B;  2N9E B;  4XX5 A;  2AL6 A;  2MRP A;  4EUT A;  1YIW A;  2L76 A;  2K39 A;  1MG8 A;  3H7P A;  3QAQ A;  4KSK C;  4G0N B;  5J18 A;  4DHJ D;  4BKS A;  3VTW A;  4IG7 B;  2DYB A;  4B95 A;  2D07 B;  1C1Y B;  1SE9 A;  3A9K A;  3OJ3 A;  1WFY A;  2JUO A;  3QWZ B;  2IO1 B;  5L95 C;  1WF9 A;  4BFR A;  4EKU A;  3VDZ A;  2JF5 A;  4CYE A;  4BOS C;  2LUE A;  5CHV C;  5DCN A;  3PHW B;  3B08 A;  3L13 A;  3TBL D;  2KO3 A;  2LJ5 A;  2MSE D;  3DBL I;  2KN5 A;  3D32 A;  4W9D A;  4HDQ A;  1V6E A;  2BWE S;  2JT4 B;  4GN1 A;  2L7R A;  3L0W B;  3RD2 A;  1H4R A;  1V86 A;  3WAO A;  2LVQ A;  2O2V A;  1L7Y A;  5IA7 A;  2FCQ A;  1Y8R C;  3DVN U;  4GU2 A;  2KQ7 A;  4NQK E;  3ZKJ C;  2C9W B;  4GDL B;  4KZ0 A;  3RZF A;  3UQA A;  4PS3 A;  1V9J A;  4TQ0 A;  4AP4 C;  2KD0 A;  1WGY A;  1R4M I;  2KZR A;  4XZ4 A;  4LDT D;  1V5T A;  2FCN A;  4HDO A;  5JH5 C;  3CMM B;  2ZVO A;  4E71 A;  2FCM A;  3ZW3 A;  1Z2M A;  4NNJ B;  3B0A A;  3QJZ A;  4W9E A;  3HM3 A;  4ZYN A;  4DHJ B;  3A9J A;  4A3O A;  3ZRF A;  4EOY A;  2M8S A;  3N30 A;  4FBJ B;  1IPG A;  2J0J A;  4FUL A;  3HHM A;  4I6L B;  4AWJ A;  2LGY A;  2ZEQ A;  4KIK B;  3ML8 A;  4ZDV A;  1Q1O A;  3AU4 A;  3EFU A;  3N32 A;  1S3S G;  1A5R A;  4DK5 A;  1LM8 B;  2MBH A;  3OJ4 B;  4IM2 A;  2JRH A;  5AZF A;  2C7M B;  4E3C A;  2UYZ B;  2DYO A;  2FNJ B;  2L05 A;  1KM7 A;  4FN2 A;  3VHT C;  3UIO B;  3DQV A;  2J0K A;  4MH0 E;  2FUH B;  1EUV B;  2HJ8 A;  2KFK A;  2KLG A;  2MWS B;  1TGZ B;  4EFO A;  4BVU C;  2K6Q A;  4MJS B;  1RLF A;  4PS7 A;  2DX5 B;  1OEY A;  4G11 A;  4W9C A;  3ZNG C;  2RD0 A;  2ZPY A;  2LGD A;  2XK5 A;  4MGI E;  5EDS A;  1WJ6 A;  4WAA A;  1WZ0 A;  5CHW A;  2AL3 A;  3ZNH B;  1E8Y A;  1E8Z A;  4E74 A;  5KHO A;  3QIJ A;  1WJN A;  3RUL A;  4HCP B;  4GB9 A;  2O6V A;  1VCB A;  1Z5S B;  4YL8 A;  2RPQ A;  3M95 A;  2FCS A;  3LJ3 A;  3ONS A;  1I42 A;  1I35 A;  2LVO A;  3A33 B;  1S1Q B;  1E8X A;  5TR5 A;  2RGF A;  4OVU A;  1FXT B;  1OTR B;  1WXM A;  3IG3 A;  3UIN B;  4F7Z A;  3A1Q B;  2PJH A;  4MEM A;  3ZVV A;  3PS6 A;  2C7N B;  1P3Q U;  3K9O B;  2V3S A;  1ISN A;  3R66 C;  4EEW A;  4FA6 A;  2MA9 B;  2ZNV C;  3L17 A;  3IVF A;  2KTR B;  3Q3J A;  2Z59 B;  2JZ3 B;  2K25 A;  4NAW B;  2GMI C;  2LRU A;  3LDZ E;  4ANU A;  3PRE A;  4FJZ A;  4ZRJ A;  2ZCC A;  2I1J A;  3DVG X;  2KDF B;  3RYT A;  2NVU I;  3ZLZ A;  1WMH A;  2DZI A;  3M62 B;  1WE6 A;  2K8H A;  4WJN A;  3SHQ A;  3APF A;  4NJ7 A;  3APD A;  2AWT A;  2NBW B;  3EEC A;  4HWI B;  4ICV A;  4GDK B;  4WJP A;  1YX5 B;  2DYM A;  2GOW A;  3WAP A;  3ZRC A;  4W9L A;  3RUI B;  1YQB A;  2N7E A;  3M63 B;  3CST A;  5G2N A;  3VQI A;  1XD3 B;  1NBF C;  4DWF A;  1SGH A;  2BKR B;  4W9F A;  4HJK A;  3NZU A;  5LLI A;  2G3Q B;  1E7V A;  4II2 B;  2AYO B;  3ZIM A;  2A5U A;  2IO0 B;  4GIV A;  1OEY J;  2CS4 A;  2C5L C;  2PE9 A;  4CO7 A;  2HTH A;  3T9L A;  1ZGU B;  2WX0 A;  4X57 B;  3RT3 B;  2KC2 A;  5C23 A;  2AEH A;  2KDI A;  3AUL A;  4BKG A;  2MBB B;  4OVV A;  4EZK A;  5JHB A;  4PYU A;  4LJO B;  1WRD B;  3PGE A;  1UZX B;  2HE7 A;  1VD2 A;  2MP2 B;  2C7H A;  4ASW C;  2ZPN A;  4II3 B;  2M1M A;  1GNU A;  4KDI C;  1EO6 A;  1BT0 A;  3ZUN A;  1J19 A;  2DAF A;  2J0M A;  3QQ8 B;  2L3Z A;  3BY4 B;  5G55 A;  4B6W A;  2L0T A;  5E6N A;  1E90 A;  2LXC A;  2FID A;  3ECI A;  1EF5 A;  2GBR A;  4GXB A;  3V62 A;  2BYE A;  2V1Y A;  2NPT B;  2M0X A;  1UGM A;  3L10 B;  3L54 A;  3PRP B;  4W9K A;  1L2N A;  1T0Y A;  4AUQ C;  2KTF A;  4W9G A;  3QCA A;  3JSV A;  5BO4 B;  2D10 A;  2KOX A;  4KV2 A;  2MBE A;  4RMA A;  2QHO A;  2YLM A;  3CF6 E;  4K7S A;  1V81 A;  1EF1 A;  2DZJ A;  2K6D B;  3PVL A;  4LCD E;  3VVW B;  3PPA A;  3R3M A;  2DAJ A;  2JRI B;  3PLV A;  2I1K A;  2REX A;  5J17 A;  4P7I A;  3U8Z A;  2KJ6 A;  3KH0 A;  1PQS A;  3CSF A;  2RR9 A;  3JW0 X;  2BF8 B;  3VFK A;  3PLU A;  4FHJ A;  3TIX A;  2KMA A;  1WJU A;  2LZ6 A;  1LXD A;  4DHZ B;  2ASQ A;  3ZO5 B;  1KOT A;  1WXS A;  5CHF A;  4FJY A;  2CR5 A;  2PE6 B;  3QX1 A;  3M3J A;  4MGZ E;  2KX0 A;  3B1L X;  1ZKH A;  2XEW A;  1WGD A;  1K8R B;  1H8C A;  4IWO A;  5D94 A;  2ZVN A;  3DDC B;  3WAL A;  3L16 A;  4IW0 A;  1C3T A;  2Z0D B;  2G45 B;  2BYV E;  4FJV B;  2KX3 A;  3EHV A;  4JL9 A;  4FHK A;  4WQO B;  1IP9 A;  3TJP A;  2N9P C;  1WM2 A;  1XT9 B;  5CX3 A;  1RAX A;  2PEA A;  3PHX B;  3H7S A;  2KWV B;  2B3A A;  4BKS D;  1TZ1 A;  2K8B A;  3RZW C;  4ICU A;  3QA8 A;  4EZJ A;  2GBK A;  4RM8 A;  5JHA A;  4HPL B;  1KJT A;  3QHT A;  2MCN B;  3U7D A;  2LD9 A;  2MX2 A;  5AEK B;  3UQB A;  1R4N I;  4DDG D;  1WI0 A;  2JXX A;  4JGH B;  5D6J B;  1U4A A;  3ZTC A;  3VUX A;  2CU1 A;  1NDD A;  2KAN A;  3KYC D;  3N3K B;  4WJQ A;  4XC2 A;  5D2M B;  2N1V A;  2KVR A;  3S2A A;  3W1Y A;  4GDL A;  2LGX A;  3SD5 A;  5JZE B;  4KSL C;  3X0W A;  3VH3 B;  4MDK E;  3SDL C;  2N4F A;  3VTU A;  4PS8 A;  2PPH A;  2KKC A;  1OGW A;  4M8M A;  1HE8 A;  2KQS A;  5DPW A;  3ZNI D;  2LAS A;  3ZDM C;  2W9N A;  4MM3 A;  2R2O A;  1YJ1 A;  4MGK E;  4JQW C;  2JPH A;  1Q0W B;  4M0W B;  2JWZ A;  3KW5 B;  4WJO A;  4I6P A;  2BWF A;  1WGG A;  4TUU A;  4KIK A;  3VAW A;  3DCG A;  2FIF A;  1Q5W B;  1WM3 A;  3DOW A;  2MBQ A;  3MHS D;  4DBG A;  3H7P B;  4F8C B;  2IBI B;  1YX6 B;  3PRM B;  1UEL A;  4G3X B;  5C1Z A;  4J6I A;  1RRB A;  1WYW B;  1WXV A;  1M94 A;  3MTN B;  2ZZP B;  4TQ1 A;  3R7Q A;  3V6C B;  2ZCB A;  2GBJ A;  2LVP A;  3A9K B;  1UH6 A;  1XQQ A;  2KC1 A;  4MJS A;  2K1F A;  3APC A;  2MW5 A;  4W9J A;  5CTR C;  4ZRI A;  5LXH A;  2VRR B;  3JVZ X;  1P1A A;  2BPS A;  1JRU A;  3DVN V;  3W1S C;  3IFW B;  4HVB A;  1ZW7 A;  3ENE A;  2NBV B;  4K81 A;  4GMV A;  3PZD A;  4BOZ B;  5AZG A;  4ANW A;  1AAR A;  3WAM A;  2Y5B B;  2Z0E B;  4MEL A;  4BKT A;  2KWU B;  3UF8 A;  3SU8 X;  1WIA A;  4HLE A;  2KNB A;  2O2V B;  2NCN A;  4WWO A;  3L08 A;  2L8J A;  3NHE B;  4TV3 A;  3A1Q A;  1CMX B;  2KJH B;  2BKF A;  3Q3F A;  1LQB A;  2MBO A;  1E7U A;  1WX8 A;  2JZZ A;  2KTR A;  2UWQ A;  4NAW A;  4LJP B;  3TMP B;  3ALB A;  2O6V D;  3MJW A;  1WGH A;  3UGB B;  3DPD A;  2KDB A;  1WR1 A;  2A4Z A;  2D2Q A;  4MGY E;  1TTN A;  1UBI A;  2J7Q B;  3DBS A;  4GSW A;  1KLV A;  2JVC A;  2N7D A;  3WAN A;  3A9J B;  4GDK A;  1LFD A;  5E6O A;  4IM3 A;  2CHX A;  2EMS A;  2ZJD A;  3RCZ A;  3GOE A;  3AU5 A;  3K9P B;  4HPM B;  4KVG B;  4HCN B;  4BBN C;  3KYD D;  1TBE A;  3V61 A;  3ZTD A;  2WYQ A;  3JYU A;  1WY8 A;  1WGR A;  2OOB B;  4IWP A;  3VUY A;  3OAW A;  4AOF A;  2HD5 B;  1D3Z A;  3WA0 A;  1YD8 U;  4GGQ A;  5DPS A;  1V2Y A;  3TL5 A;  4A3P A;  3HM6 X;  5GMV A;  2KFK B;  4NY0 A;  2IO2 B;  4AJW A;  5E6P A;  4KZC A;  2ZNV B;  2MQJ A;  1WJ4 A;  2MP2 A;  4IWQ A;  5LXI B;  4WWP A;  4IM0 A;  1X1M A;  1WX9 A;  2DHZ A;  1GJZ A;  2WWZ A;  1V80 A;  2XK5 B;  3X23 A;  4ZRK A;  3U30 A;  1IYF A;  4NQL B;  3H9D A;  3DBH I;  1UBQ A;  2WX1 A;  3NZS A;  2LWP A;  1OQY A;  2L0F A;  3OLM D;  2O6V B;  4JIO U;  4K7U A;  2KLC A;  2IO3 B;  1UD7 A;  2CHZ A;  3IHP C;  3BIN A;  2NPT A;  1SIF A;  4WWN A;  2XBB C;  2BGF A;  2C60 A;  1P9D U;  4FLH A;  3VTV A;  2EMT A;  2EKE C;  5DPR A;  3T8M A;  3P2B A;  4IUM B;  4GOC A;  2N9X A;  2CHW A;  1NI2 A;  3QK0 A;  1WMH B;  2KJR A;  1V49 A;  2YVC A;  4HK2 A;  2FAZ A;  2N1W A;  3EC8 A;  3KUD B;  4DXA B;  3DBR I;  3AXC A;  3QAR A;  1V5O A;  2BYF A;  2JY6 A;  4RM9 A;  3ML9 A;  3O65 B;  4URK A;  2K8C A;  1J8C A;  3NOB A;  2LI5 A;  4M8N A;  4NPN A;  3VUW A;  1P98 A;  3GZN I;  4F1S A;  3TCA A;  2WDT B;  5IAA C;  5L83 A;  4N9F 4;  4EZL A;  3AI5 A;  4JLC A;  3V60 A;  3W1S A;  2IY1 B;  4FAD A;  3WIM A;  2G4S A;  4PYZ A;  1WXA A;  2IY0 B;  2M4N A;  3PT2 B;  5DPT A;  1GUA B;  5D7G A;  4MSQ B;  4LDT B;  4AJY B;  4BBN F;  3VH4 B;  3PV1 A;  3HK0 A;  2DZM A;  2KFJ A;  3I3T B;  1GC6 A;  1WR6 E;  4K7W A;  1J0G A;  2V4L A;  3KVF B;  3UIP B;  3ZNZ B;  1GC7 A;  4DHZ E;  1E5W A;  4W9I A;  4B9K A;  4NJ6 A;  3PRZ A;  3A4R A;  3C0R B;  4HXD A;  4ANV A;  3V6E B;  2DZK A;  4G50 A;  3VXW A;  2R2Q A;  2L00 B;  4CHK A;  1QZE A;  3PSE B;  3H6N A;  1RFA A;  1WE7 A;  4ANX A;  1GG3 A;  3NY5 A;  4KDL B;  4TKN A;  3R7R A;  4DDI D;  2G4D B;  2D3G A;  2MLB A;  5AZH A;  1WZ3 A;  2IYD B;  2KWC A;  2IZV B;  3A4S C;  1E8W A;  2M17 A;  2NR2 A;  2LXA A;  4K1R B;  3KUC B;  4IC7 B;  2RSU A;  3JSV B;  5HKH A;  5KHQ A;  2KMC A;  1WX7 A;  2KXJ A;  3QC8 B;  3HIZ A;  2CKH B;  2LRW A;  2NS5 A;  2GBN A;  3IBE A;  1P0R A;  1G6J A;  3ZDT A;  1WH3 A;  5J2R A;  2KK8 A;  2OJR A;  2DEN B;  2KDE B;  2NBU A;  3PTF C;  4MSM B;  4W9H A;  3H1U A;  3NS8 A;  1F9J A;  5FR6 A;  3DVG Y;  4I6N B;  3KUZ A;  2D11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...