4NJAH

Crystal structure of fab 6c8 in complex with mpts
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
b'EVQLQQSGPELVKPGASVKMSCKASGYTFTDYYMHWVKQSHGKSLEWIGYIYPNNGGNGYNQKFKGKATLTVDKSSSTAYMELRSLTSDDSAVYYCARRGGYGIRGYFDVWGTGTTVTVSSAKTTPPSVYPLAPGCGDTTGSSVTSGCLVKGYFPEPVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6C8 light chain
molecule tags Immune system
publication title Adaptive Mutations Alter Antibody Structure and Dynamics during Affinity Maturation.
pubmed doi rcsb
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4njaH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4njaH02
3JUYA 1FVEB 2CGRL 1B2WL 1KIPB 3MRGA 5T3XD 1Z6JT 2JK5B 4PY8I 4PJHF 2YUZA 2R8SH 4PJBF 2VDKH 2A9MH 3MSPA 5IG7A 4HXAL 4TYUA 3R4DA 1SY6A 1RZFL 4APQD 1IFHL 5J4MA 1BQLL 5HI5C 4JN1L 1YA5A 4KI5C 1U8JA 1HSBB 2R0KL 3EO1B 1G7LB 1RZKC 5DJ0B 4HXBH 5IFHH 3MLTB 1HIMH 3H42L 4RFEB 3PDGA 2P5WA 5IG7B 4NPYA 5HYJB 3T8XA 3HRPA 3MGOB 1I8IB 1KIRB 4FQIH 1YMMD 2VLJA 4LPCA 4S1SL 3IFNH 3O4LA 2BNQB 4X7DC 5J12B 2ENYA 3VJ6A 2WWKT 2GSIB 3L3DB 2AGJL 4HC1L 1RZJH 3OF6A 3QQ4B 5GGVL 3HI6L 3U4BL 4DZBA 3MV7D 2B4CC 3JVGA 2VMFA 1LQSR 3KNBB 3NZHL 4NN5C 1CDHA 1CFQA 2VZSA 2CMRH 2BNQE 1CDIA 4E0RA 3C6LD 2PW2B 3VFRB 2FBJL 2KQMA 1ZA3B 3U2SB 1OAQH 5JORB 35C8H 1XIWC 4MAYD 2FJGA 4O9HH 3HPJB 3CFBB 3FOLA 4K2UH 2AJZB 4MJIB 3KS0J 3S36L 3WS3B 4ETQB 5J3HD 4X6FB 5TPWL 3QJFA 1N6QH 3ULUF 5CIPH 5TH2B 1U8LA 1D6EA 4JFDB 2NY4C 1N0XH 1UWGH 3QUMH 3OG4B 5HHPA 5LGJA 1I85A 2LU7A 2Q7YA 2FSEA 1IM9D 5J11B 2WUBH 1BAFH 1R6VA 5CCKH 1NJ9B 2FLBT 4PGDB 3CVHL 3WFEH 4LOUC 2Q76B 5DJAB 4NHUB 3UPAA 3FQRA 5T3ZD 2CR6A 2VC2H 3BQUA 3GMRB 5CSBA 3KYMA 4Y89A 2R0KH 1QA9B 2EDHA 2X4QA 5T1KA 1S7TB 4DK3A 1H0DA 2ADGA 3L3HA 1T66D 4OUUA 4UINL 4WO4B 5E9DE 4M7ZB 4LP4A 2FGWL 3QDJD 1KFAH 3SKMA 3E0GA 2WBJC 2XA8L 1GC1H 4LRIA 5C0JB 1ZLUK 4BM7A 2OQJB 1SVCP 2DOCA 4X4MA 4ZFOB 5J56B 5D7IB 5EC2A 4WFGE 4WEMB 2P45B 4K3JL 5GRYA 1C1EH 2B5IB 2OTUB 4P48A 3BKCL 4OM1H 5C0AE 5KJRH 5D70L 5JQHC 1RIVL 1K2DA 2ZJSH 1S9KC 3PWNB 4YBLC 1QSED 1T1WB 1UQSB 5AZEH 4B7IA 1QPXA 1IAKA 1DQLL 2X40A 4YBLB 4ZS6C 1JYVA 1MPAH 3MLWL 3LMJL 1OGAB 1UJ3A 1MJJA 4LF3B 3LOWA 1MCEA 4M3JA 4TRPH 1H3XA 4KJPD 1AHWA 4JRXA 3MCKB 4TULL 4BYHA 1NCUA 5DA0B 5BRZD 1KV3A 3QH3B 4PJBA 4N0YL 3L7FB 2CLZA 4I0KA 2Y36H 4HEME 1KCLA 2XZCL 3ZDZE 3TP4A 3GK8L 1QOKA 4TNWK 4LKXB 3L3IA 4NKQB 5HDLA 1KIUA 3F6LA 4NCC1 2Q7NA 1Q9KB 1MFCH 4N8CH 1U2HA 3D18A 1OTTD 3O9WB 4K7PL 5BZWB 3ZLQC 2A1WL 2N4IA 2R4RL 1S9WB 3T65A 4HMDA 4QXWA 4HDIA 3AY4C 1N64L 3CFJA 3BXNB 5E5MB 4EZMA 2Z31D 3WKNA 1BVKB 4RMVA 4PB0H 2CQVA 4JFXB 5ISZA 3ROLA 4ZFZA 1QRNB 5ALBH 3GUTA 1A6UL 4M8QB 2FEDC 1FRGH 1UZ6F 4LARH 2ERJB 1A1MB 3L7EB 2DQCH 5E2VL 1S7QA 3HZYA 3LPWA 4WUUE 1YJDH 4FFZH 4ZQKB 1NCCL 2P5EE 4UTBL 2DWDB 2NX5B 3IRPX 1OP5K 3IAPA 2CO7B 1UH3A 4FTVD 1AC0A 4JRXB 1NUFA 4PY8J 1U36A 1TQCC 3OKEA 3FT3A 5T33H 1V3LA 4JY6B 5CGTA 4C58B 2ADGB 3IKKA 4Q6IC 3HUJE 4JAMA 3KWWB 4PJXE 3GSVB 2GUOA 4LHUA 3RTQC 4HPYL 2E9BA 4A6YL 1X3DA 1CLYL 4R0LB 2HMIC 3MJ7B 5I1DA 5BRZB 1UJ3C 3AS0A 3VG0H 1JPTL 4JY6A 2EH8L 4KRPB 4GBXD 3UZQA 2QKIB 4QWWC 3VFWB 2FWOB 1YN6A 3QXAB 5ENWA 1A3RL 2JB5H 2APBA 3FQUA 4Y1AB 4D3CH 3JTSA 4KROB 3SKMB 4DGYH 4JDZB 5TE4L 1DFBH 3EW3B 2NY3B 4GKNB 4M8QA 4MNQE 4CMHC 5E8OB 5IQ9B 3AU1A 3T3ME 1W0WB 5FGSA 5I1CL 1QKZL 1TITA 5I15L 3BRGC 3J7HA 1O0VA 1JWSB 1A7RL 3NFNA 4NQXB 3X14A 1R3HB 4P2RB 5KW9L 2NXYC 4MDIA 3CDYA 1FGNL 3DV4B 3WHE1 1KEML 5JLZB 2J6EL 5E00A 4O9HL 1IGJB 3BZEA 2DQIL 4JFFD 3BUYB 4LBEB 1VERA 4U1MB 2FSEB 3WO3B 2JJWA 4HJGB 3BQUC 1J1XH 4HFWB 1GCFA 4K7PX 1GRWA 4ZPVB 3W9DB 5HYSA 3KWWA 1N0LA 2DJSA 4Z7UF 5CILL 1EO7A 1AP2B 3EOTH 5FOBA 3TN0D 5CLWA 5E8DH 3OKEB 3C60D 4J7RA 1NANI 5ECJE 4FFZL 1VPOH 3I6GB 1CF8H 3HFML 2EZ0D 5CJ8A 5BO1H 4IRJD 5ID1A 2VITB 5D6DA 1T7YA 1Q1JL 1SMOA 3I75A 4OT1H 5D6CA 1DDHA 4UNUA 3NFPB 4HGMA 3THMH 3HC0A 1NCBH 2ZUWA 2PTUA 3ARED 3KDMA 4LLMB 4YHYB 3K1KC 3LD8C 4TOYH 3H6JA 3RJQB 3CUPB 2W38A 5KSBB 4WEUD 3BN3B 4M4RA 5AZ2L 4XMKH 5ISZB 4G8EA 2VISA 4HPYH 4RISL 1BVKA 1F2XK 1OM3L 5DLML 5T1LD 5I19L 1BQHG 1X5ZA 1NLBL 1S9XB 3B2VL 4PRAA 3ESVF 3G04B 4UTAH 4DCQA 1C8PA 5I8OL 1RHHB 3WJJA 1GZQB 3ARGA 5DRNA 1IEHA 4XNQA 1TVHA 1NUGA 3Q1SH 4NNPH 4HS6A 4P2CG 2W0FB 2F9BT 5CS7A 3D0LB 1WVZA 1KEGL 4KVCL 1RU9L 2BSTA 2XN9B 3H9SE 3KPRA 1QEWA 4GJTB 4KQ4L 3DLQR 5DO2D 3O3AA 3ZKND 2VN7A 3BPCB 1OQXA 3SDCD 2JKXA 3CDGB 1S8DA 4L4TA 1GZPA 3RBSA 3EOBB 5FF6B 3HG1D 1H0DB 1RZIB 1QHPA 1JYNA 1KIQB 3FJTA 4TSBH 2PYEB 5ID0B 1Q0XL 4XCNA 1QBBA 3H9SB 2HTKC 5I6XC 5DUPH 2O5XH 3RL2B 1QPPA 3QIBD 3I3BA 1RUQH 2FX9L 4GW1A 3TYGH 3WFBH 1NLBH 2HJKB 1F4WL 1MEXH 2DMKA 4JFPA 3ZTNH 5FA4B 4PD4K 5L9DL 3L6FA 3CU1A 2FX7L 2EYSB 4ZPTB 1D5XB 3HPJA 3WJJC 1FDLH 3ZDXE 1ZT1B 3TO4A 1MCPL 1J8HA 1CFQB 4LGRB 4X4XA 3TO2A 1I9IL 4UUJB 4WY7H 4NQCA 1XGYL 2X4PA 4I0CC 4XNMB 4PJ9A 3OV6A 1ZSDB 3QUXA 3CK0H 2X09A 4RMWA 2CXGA 2DMCA 5DHVA 1LK2A 3QXDB 2AJ3B 3MRDA 3QR2A 5TGBB 1SJHB 3MV8E 3DECA 4ZD3L 5FYKH 5SWSB 2COQA 2H8PA 4NWTL 3S3SA 1DQJB 1U8KB 3EFDH 4D9QE 4G43A 5M7QA 3L3OB 3W82A 2AJUL 4PGDA 2IALB 3SDDD 1T80A 3IFLL 4X6CA 4PB0L 1DBBH 3FT2A 3RVUC 1OGTA 3TC9A 5LGJB 3RNKA 1A7NH 1NMCC 3RZWA 1PQZA 1DLFH 1VGKA 5KS9F 2DS4A 2APXA 4YXHH 2CLVA 1R3JA 4L8CB 3CVHB 3OB0K 1OY3B 1AQDB 1X5HA 4JY4A 3TBWB 4JKWA 1VKXB 4H20H 5GGQH 4DW2H 2VIRB 3DROB 2YA1A 5FA3B 5E03A 3WUWB 1UFUA 5I74B 1T66C 4ESKA 3CVHA 4N0UE 1TETH 1MI5D 3E2HC 4B50A 1HXMB 2Q8BL 1A3RH 4Y4FB 1LHZA 4B7LA 5A2FA 5C1MB 5INCA 1U91A 2GT9B 4HZLB 4NDMB 5HHOB 4XX1E 4Y2DD 1D9KC 4LRNL 2FGZA 4JFZL 5HD8C 5GRJH 3MJ8A 1PQZB 4KROC 5DSCB 2W9DL 1MCOH 3WNKA 4OQ1A 1MY7A 1RUMH 2BSSA 2AJXL 4M6NL 3CZFA 3GJEB 4JRYE 3P11H 5JHLL 4V1DD 4Q2ZA 3L3OA 5DVMA 5TDOB 4OFKA 4NNYA 4PFEA 4P0DA 4HWZB 1LO3L 1A1NB 4D9RE 3BRFA 4WCYL 2DLFL 25C8H 3U0WH 4JGUA 4PY7A 1NGYB 2W9LA 5C07B 3QFJE 5EDXA 2R1WA 4KU1A 1OTUD 2Y72A 4XNMA 5GGTL 5IMOA 5IJVB 4K23H 4TULH 3BO8A 4KI5E 4QTIH 5E08H 3MFFA 1HH6A 2UUDK 5DFVC 5JOFA 2YKLL 4OGAD 3U4BH 1MHPL 1LDSA 1I7UA 3RGVB 4WDIB 1YNKL 3BH8B 2IANE 4L4VE 3TT1H 3DXAA 3QHFH 3MOQA 3NABH 5I1AB 5I73B 1AQKH 3V4VL 1OWRM 3NFNB 5KSAB 2F5AL 4HCRH 3G6JF 4H25B 1BLNB 3QO1B 4HK0A 3MA9H 5F89B 5J6HB 5IBTL 1U93A 5J13B 1AGFB 1C5DB 2B0SL 4GOSA 1N7MH 5F72S 5I8EA 1D9KA 1U3HA 4GKNA 2NY3C 2VXTH 3KLHC 1NEZA 5BV7L 1QO3A 5HGDA 4ODXB 4R2GC 4RDQG 5IBLC 1OCWH 1U2CA 3OGCB 3RAJL 2IADA 4PS4H 2DM4A 1MF2H 3BPNB 4NNPL 1LEGA 4PJEB 2V9QA 1NBZA 1PKQE 3QXDA 4WW2F 1TZHB 4AL8L 5IKCB 4BELD 3VFSA 5D93C 2F53A 4HX1A 4ZDHB 4ODVH 1MFDH 2BX5A 5EPMA 3F7VB 2NQCA 3RVWD 3NPSC 3M17A 2VZUA 2NTFA 2JJSC 4M6ML 5JZ7D 1ZWIB 2FHCA 3CFEB 3EYUL 2H3NB 4L3EA 5DC9B 3B9DA 3EUUA 2EYTA 2DIBA 3QHZH 4IDJH 1XH3A 1N0XL 5IB5A 4LSTH 4NJAH 1FNFA 4G9DA 5KAQF 4RGND 1H3PL 2XACC 4QRTA 5SX5H 4YBHA 4E41D 2P8PA 4CMMA 1XIWB 5ESAA 4QXGL 4D2NA 4PGEA 2BDNH 4Q9RH 2YD2A 5ESVA 4H88H 4RFOL 2AEPH 3LKRB 3P9MA 1HZHH 5GXBB 3HZYB 3RHWK 2BVEA 3LSOB 4XCNB 4PJIE 4HBCH 3DRTB 3GMMA 1E6OL 3HNTH 5MERB 3LKOB 4XVTH 1P5VA 2CKNA 1I3GL 3QEHA 5T33L 1Y6NR 5GHWL 2Z91A 1FL3A 4PBVC 4JRYD 3TT1L 3RQ3A 3QCTL 5D5MB 3BKJH 4XXDA 4RGNC 1RZ7L 4U0RC 4FQCL 4TTDD 3HMWH 5E6IC 1MHEA 2GJ6E 1MNUH 1UGNA 3ZT6A 4QRQB 2X70B 2Z35A 3AC0A 5JZ7C 3CXDH 2DM7A 5A2IH 4LVNC 3O6LL 4LQFL 1R3HA 2PXYB 4BZ1L 3G04A 2JB5L 5A2JH 5E1AB 2DQTH 3JTTA 2VSCA 5D6CB 1OWWA 4U1SA 2A6JA 1MF2L 5IBUB 3ZDYF 3D3VD 2I9TA 4OB5H 1FIEA 3I6GA 4HWBL 2GTWA 5FFLA 3TVMA 1S7XB 4ZUVA 4I4WA 4L8BA 4N0CD 4OGYH 4NP4L 5DWUL 5CEZE 3V5HA 2WWKO 2K1MA 3IB4A 2D9CA 3AMLA 4NKMA 2AV7B 1NCWL 3GMOA 2IQAA 5I1KL 4G3YH 4OM0H 5JXEC 5ALBL 2OK0L 1NSNH 5CINL 3ZE2F 1BJ1J 3TBTB 1NGXB 4U6YA 4PP1D 1JWSA 3H2WA 4XPFH 1VDGA 3QQNA 4N9GA 3FHQA 5C7XH 1T1WA 4LHJB 5IQ7H 1IGYA 1WICA 5DFVD 2C4XA 1ETZA 4IOFD 4X6DE 3T08A 4WI3A 4HKXA 4NQED 3B9AA 2V17L 1DVFA 2R1YA 4GFTB 2DI9A 1OTUC 2J4WL 4X4ME 4LMQI 4NCC2 3BIKA 3UXFA 2R29L 3NCBB 5D6DC 3OAYH 1CBVH 4M1DL 2XXCB 4JQIL 4AMKH 1H3UA 4LVOB 1H5BC 1MCHA 4UV4H 1JNNH 4WW2A 4ZUWA 3W0WD 1KNOB 5EU6A 3RVXD 4MCZA 2HKFH 4M6NH 4UIKL 3GSUB 1MWAH 5IESL 2A9NL 3ZE0E 3QUYA 5I1IH 5KSAA 3WS3A 5KZCD 5C0BE 3U46A 5HD8D 4LAJH 3RZCA 1YN7B 1R24A 2PCPA 1WUNT 4KI1A 1OF2B 4CW1A 1Q8MA 4ODWB 2H2SD 5KOVC 3EYOB 2AV7A 4HWEL 2EE9A 2IG2L 3GMOB 3PWVA 2Q7YB 3VGFA 1TJHH 1DBKH 2ZOLA 1A1MA 2E6JA 1IC7H 1IGFL 3WE6B 3LV3A 4XRCA 3HE7A 5L7XH 1TZIA 3P0VL 1X6NA 2IBBA 4DZBB 4UINH 1AHWB 2I60H 4HAFA 5FKAB 2FH6A 3O3EB 1LO5A 4CAGA 3G5YB 3JTTB 2NY5C 5IVNA 3ZKMC 4MQXD 2HVJB 3C5ZB 2YXMA 5J6GB 5KANI 1DEDA 3LHPL 2A9ML 5JMOC 4KY1L 4WJ5A 4BKLA 3MZTA 5I1HL 5D5ME 2P8MA 3MO1A 5JA9A 1CGTA 5I1AA 5CIPB 2H1PL 2YN5A 3QXUA 1AIFB 2IAMA 4PG9B 3INUH 4R7DB 3RVWC 3SPVB 5KG9B 2PUQT 1ZTXL 1XF1A 2DMBA 1FNLA 3C8KA 3X13A 2DM3A 1ADQL 4NQTA 5BV7C 1I3RA 5DMJB 4OD1L 2N7BA 2Z4QB 3EYFB 3GI9H 3O2DA 4QF1B 4Y5VA 1YMHB 1NFDE 1B90A 3NTCL 4G8IA 3IFNL 3MOAL 4X7EC 5KS9E 4RFEA 4QXTB 1AFVL 3AS3A 4XVTL 1R3JB 3BQUB 3QUMA 2HFGH 5D2NA 2DLHA 4S2SA 5EB9A 2JF1A 4UI2A 1X7QB 2DI7A 3T77A 4QCIA 2X4NA 4DZ8B 4TOYL 5JOPD 4QGTA 2V5TA 2IWGA 1FNEB 3BT2H 2GCYA 3QIWB 1JNLL 3A6BL 1WC7B 2DM2A 4XWGL 1EBPA 1T5XB 4HWEH 1OAZL 1S7VA 4OGAC 5ADOL 2XTLA 5BQ7B 5KVGL 3H7BB 3OZ9H 1JWMA 3SN6N 3WUWG 1UM4L 4XP4H 1TTUA 5T3ZE 3V5KA 3INUL 3X12A 4POZC 4LPUA 5C0IA 1PG7W 3WIHL 1YYLL 4MCYB 1D5BA 4HIXH 4L3CB 3QA3A 3TO4B 1YY8B 5H37G 2WBJB 3VXRB 4K3HA 4FG6D 1QBLH 2EYSA 2BFVH 4ZXBB 1A5FH 4YH6A 3EBAA 2YA0A 4YWGH 2JIXD 2EO1A 3GJFA 2E7LA 5F9OH 5L2KB 5L88H 1T5WB 1T2QH 4WGVB 4JFDA 5CJXC 1J05A 5HBBA 3FB5A 1T1YB 5E2TL 4S11A 4M00A 2X6MA 4M7KH 1V7MH 2AEQH 3MV7E 1HN1A 2J7LA 3AVEA 3U7WL 4AG4L 3BZ4B 3RA7L 4UQ3A 5F6HJ 1B6UA 3VGEA 3QI9D 1OD7A 4R90L 5C0FA 3S98A 3IDMB 1MRCH 2PYEA 1EHLL 2OJEA 2FJFA 3NZ8B 3NABL 1T1YA 2G2RA 3IDYB 1VB9A 1HHJA 2BMKB 5I6XB 1U8OB 4OLEA 5CEYA 3N9GL 5DZNA 3V7MA 2F53B 5DGRA 2AQ3A 3QJFB 3DRQB 5D7LD 3C6SA 3D39B 4XTRC 2ZCLL 4HJJH 4QRRD 2DLGA 4GAGH 5DFWH 5L9DH 5TDPA 4DN3L 4NZJA 1N6UA 2DN7A 3B2UD 4CU8A 2BSTB 2HVKB 5GGSB 1UXWB 1VFMA 4I0PD 2XZQH 3HAEG 4D0BB 4QT5A 1CD8A 3X12B 1FVEA 4JFEA 3RVUD 1WBXB 2W9EH 2MKWA 5L0QC 3RGVD 1QTYT 2B2XL 5I66A 3IDGB 2PN5A 1HQRA 4MAYA 4R26H 4YGVB 1GOGA 5D2NE 5CBAA 5DSCA 4U1LA 4GRMA 4ZXBC 3KYAA 4U6XA 3LIZL 5EZJA 5HYQA 2EDFA 5SX4H 1FH5H 3QSKB 1MELA 3EO0A 3RPIA 1U8JB 4HJ0C 4C54A 3VMPA 4JCLA 3VDBA 1J86A 1HSAB 3MMEB 4M48H 1M7DA 3OKKA 1FNSL 1EGJH 3SE8L 4HIIB 5B8CA 3ILPB 1RUKL 4M1DH 4AMKL 3LQAL 2ZNWA 1I3UA 1XEDA 2AJSH 4F8QA 4ZTPL 1MFAL 2A73B 5FGBC 3O3DB 5MI0C 1T6VN 3CH8A 5JDJA 2I60L 4MS8D 4WNQA 3OXSA 2YR3A 3BHBA 5C0AD 5BCAA 15C8H 3EO9H 3H9HA 1Z9OA 2AXGA 5D1ZB 1LK3H 1NGZB 4X6CB 1WCQA 1B4JH 3CCHB 1AY1H 2NXZB 3QFJB 5MENA 5MI0B 3MRGB 5E70A 3G6AA 1AD0B 1XGTA 4YDIH 3D39D 4NQXA 4NDMA 4EOWL 4G7VL 3K4DA 3SJVA 8FABA 4EN3B 3BN9C 5IUSA 3F7YA 3QO0A 5ACZB 5IOPA 2WUCL 4BSVA 3C5ZA 1N2RB 1L9NA 4D94A 5IEHA 1GGBH 1S7UB 2VXSL 2YOCA 3DX9B 3NPSB 4NM4L 1QSFA 1UWGL 2OR9L 4HH9B 3DURB 2KKQA 3GI9L 4ZPTA 1J8HE 2EDEA 4MDJB 3JSSA 4FFYL 4TUKH 4M7ZC 4MXVF 4YLQT 3ARFB 5F8QC 1BEYL 2FCBA 4OB5L 3CSPA 1I9JH 1NKOA 3P0YH 5B8CC 1PAMA 1Y0LB 3I2CL 5BRZA 1WFNA 3WV0A 4U49A 2EXWC 4GRMB 3ULUL 1OHQA 4P4RA 3CXHJ 1F4YH 1XCTA 1BBJB 1BX2B 1EMTH 1HXYB 2OXHA 2ATPA 5A40E 1TJGH 2XQYK 2VOTA 3QEQB 1JVKA 2D4FA 3VWJA 4NBYB 4ZG1A 4OD1H 4WUUD 1SMAA 5HYSG 1U92B 5DHVB 3HZMB 2YD1A 1OP5H 1X44A 3VE0B 1BHGA 5M95B 5L8LB 2RBLA 4MGXA 5FF6A 4TVPE 4LVEA 5I30L 3DX7A 5C0DA 3FHAA 32C2B 4PJXF 3FCTB 4I1NB 3HAEA 4KC3B 5EZLB 3JWOL 1U8HA 5KSUB 3I02B 3D2UB 1QVOA 5CP3A 2F8VA 4DVRL 3B9KA 1I9RL 3BP6A 1MCWW 2HRPH 4P2YA 1DBJL 3ECBA 2VLRB 4GRLA 5D70H 5GS0L 3GRWA 3I6KA 3D69A 1M05B 1T22B 4KVNL 2WMPA 3FTGB 4L1HA 1BQLH 4P2QA 1G7QA 2DD8L 3DETC 2YPVL 3SE4C 3C8DA 1P5UA 1N5YH 3GSVA 2XWTB 2D7MA 2LABA 4MWFA 1XF4B 4X5XA 5CJOH 1OAYH 5M94B 4HW6A 2B1AH 1ITBB 3WIHH 4R97C 5FYJU 3LAFA 3OAUL 3QXWA 4PJEE 5CD3B 4LHUD 4J3XA 5CKAA 1G7MA 4HUUA 1H15B 4OLVH 5F1NB 5MEQB 1WT5C 4TUKL 4QRSA 4X4ZA 2AABL 5TF1H 1MCNA 5EO0B 5LCVL 3RDTD 3K81A 3HC3L 4XNZB 2YA2A 4UT7H 3X17A 2D03L 1S7XA 4ZUVB 3TCLA 5BZDB 5IHZB 1AP2A 1JRHL 1XAUA 4IRSA 2PO6B 2XICA 1K8IB 2ZWLT 2RHEA 2IFFH 3BJLA 5I8KL 1TQCB 5J6GA 1JCKA 4JG1L 1KACB 5IB2A 1GPOL 2NY4D 3VRIB 4R7DA 1CT8A 4Y19E 3LKSA 1UM5H 3RHWF 3T65B 4DKDC 5A43C 5CEZH 4HWBH 3DV4A 3WN5C 1QRNE 5LAXA 3BAEH 43CAA 2WW8A 4W4OA 1UEYA 2YPVH 4OZFH 1IBGL 1OAKL 2QEJA 5K59E 2V7HA 3MBXL 3P73B 4KVNH 5GGUB 1PKQA 4OCSH 4QXUL 2CPCA 3RWHA 5E6IB 4M43H 4ALAL 1QLRA 4MD5A 2HN7A 3SO3B 4WHYH 3CFKB 2XTJD 3ARPA 5E7BA 7FABH 4PRDB 5HHMD 4ZUSA 3PP4H 1NGQH 3QQ9C 1ZANL 3KYMB 6FABH 4LGSB 2X4RB 4K23L 5EO9B 3TN0A 4LGPB 3HCVB 1E4XL 1YEHH 3TJEL 3OKMA 2J12B 3DRTA 4I3RL 2OM5A 5JXAL 3X3GL 4U6TA 5DQ9B 3KLSA 3UTPD 3TBVB 4F2MA 4LEOB 4PJAE 3W9DA 5FDWB 5K59F 1FYTE 1MQ8A 4FXLA 4MCZB 3CDFA 1U95A 4BKLB 3S8WA 4K3EL 5SWZE 3DMMD 2AK4E 3RWDB 2OTUA 3AUVA 1G7PA 1M7IB 3AREA 4OCXH 3W39B 1OARL 1I8LA 1EV2E 1II4E 2FIKA 2YEZA 1HWHB 5C09A 2EYTB 4PJIA 3MA9L 2A0LC 3KG5A 4XCFL 2C1PB 5C2BL 3EJJX 4RGMC 3IDJA 3LKQB 4HCRL 2F5AH 5FHBL 3NTCH 5BJTB 3MZGB 4G7YH 1OAUH 4HXAH 2W65A 4NC1C 1MUJA 2QL1A 2LQRA 5H94B 4JDZA 3CH1B 1RZGA 4X6EA 3IFLH 3SDYH 4U4BA 3RU8L 4FXGB 5H35B 1FORH 5E8NB 1U6AL 3MR9B 3V6BR 4KDTC 3IXTA 3QULA 2YC1B 4F9PA 3QUZC 2V5SA 2ZZUT 3P9WB 3MBEB 4FQLL 1MI5E 4BSJA 1MPAL 2ICWB 2FIKB 2YEZB 1WBZA 2XQYG 1RIHH 4ONHB 3QEUA 1BD2B 3F12B 2UZYB 3ZTJH 5F8RC 1FG2B 4L4TD 4OZGE 5EFIA 4P5MA 1INEL 1ED3A 5HPMA 1GGIH 1KJVA 2JCCF 3D9AH 4QRPE 1NFDF 3IF1B 4B41A 5HHXL 4D0CB 3DGGA 3L3JB 1CF8L 1WV7T 4EDXA 1KNOA 1UACH 1HHKB 4PREB 5F1IB 3K2UL 3FB7A 4F2MB 1RMFL 1KLUA 4QRSB 4ZUSB 4XNUH 1ACZA 1A6PA 3MLRL 1ODAA 2IGFH 3F58L 3QIBA 1DBKL 3HCVA 1PD6A 3MJ6A 1UWEL 1JGVH 3BEWB 4Y4HB 2ZUYA 1I9JL 4F7EB 4HKXB 2BSRB 4HUVB 3AAZA 1HYRC 2P5WE 5HVGB 4Y19D 2IANA 4L4VA 3T4YB 4APQB 3RWFA 3N85H 5D1XC 5LAXB 3IXAA 1I9RH 3ORJA 1NCAL 1LE5A 4JN2A 1YYML 2IMMA 5IB3A 4PJ9D 4NFBA 5D7IE 5E2WL 2EEBA 1T0NA 1RIUH 3QUXD 3S88H 5ETUA 5J3HC 3GM8A 3T0BA 3MRRA 5LGKA 3GSNA 1J9CT 1TXKA 1UVQB 4PJAA 1MJ7H 1Q9KA 3V7AE 1I1FA 2HG5B 3PQYB 2QHRL 4ZAKB 1A4KB 3C60B 1RZGB 1Q0XH 1MH5A 2OJZL 2L0DA 3P4NA 4L29B 1OGAE 4PGJA 3OJDB 5CP3H 2YD5A 4XBEH 2B4CL 3QH3A 3GB7A 1GH7A 2BVOB 1S7TA 3KPMB 2EDDA 5SWZA 2V2WB 3KYNA 1OP9A 3MXVH 1UEMA 2W60B 2ZUXA 3EGSB 1INDL 4JHWL 4ZTPH 3MRCA 4YK4C 3PXJA 4HULB 3L5WA 3K3QA 4HG4J 3QDJE 1INEH 1CQKA 3WLBA 2FLRT 5IMKB 1P4LA 4ZUWB 3TBYA 4M03A 5C0BD 5MP6H 3VWKC 2P8PB 4CMMB 4LLYB 4RZCB 5T1LB 2XWJB 1FLRH 1IC5H 2FO4A 5EOQH 4YHZH 5E8EB 4Y2DA 5AZEL 1CS6A 1RMFH 3MRMB 1IQDA 3CK0L 3FAWA 4O5LH 1QLFB 3QQ3B 5HGDB 2FJGB 1CXEA 4KI5D 2Z92B 4XZUB 3B9KB 1FO0L 1QBML 5TGBA 2VUOA 4PJCE 1MJ7L 4PLNC 3TVMC 4OLUL 1P6FA 4FZEH 5D7JC 1NC4D 3FCTA 1EX0A 5GPRA 3U7YL 1Y18A 1QFOA 1CL7H 5I2IA 3O4OC 2H26B 3MLVL 5CFHA 1WJ3A 1YYMH 2AI0L 4WTZA 4PJ9C 4NSKA 2F54D 2MTPA 5HGBA 1JTTA 1G7HA 3CNKA 4KHTL 1FFQA 5CILH 4JPVH 4B0MM 2Z8VC 5EBMB 2APWA 5CJBA 2LFGA 1T83C 4PG2C 4PJFA 3MNVB 4U1JB 2FEEL 3WIFB 2X4SA 2G75B 4NO5B 3QUZD 2OR7A 1AH1A 1F3DJ 4J1UA 5EO0A 4MNQB 3P4MB 3U0PA 4QYOB 4TVPL 1V8HA 3MV01 3IETA 1H3VA 5C0CE 5CSZA 5CZKA 2J8UF 1E4KC 4LLWA 1EH9A 4I9WE 3F7YB 3QO0B 12E8H 3NIDE 3I84A 5C86A 3OAYK 1A6WL 1JV5A 3L9RB 4NQDD 3IAQA 3C2SA 4G8FA 5IGXL 3HS0A 4AH2B 1LILA 1UZ6E 3QQ4A 1BMGA 4HK0B 5F89A 1P7KA 4Q6IB 3MJ8B 1HI6A 1TQBC 4FTVE 2JLLA 3DHJA 3IDNA 1FLRL 3G08A 5DD0L 3PGFL 2C1OB 1OSPL 2VXVL 4Y16B 5IF0B 1EK3A 4GRLB 3QEHB 1R5IB 3JV6A 3QBTB 4P4KC 5CSZB 3DUSB 3D9AL 3U0TA 4KRMB 3MLPA 3DUUB 3TNNB 3HB3D 3KYNB 4G8EB 4M7LT 2GTZB 1L9MA 2MCPH 3MFFB 1P53A 4HZLA 1Q9OB 2C3HA 1TCRB 1X9QA 1NGPL 4XNUL 1FZJB 2F54B 2XTJC 3E3QE 4LCCC 4PG2A 1FNGA 1JTOA 4A6YH 3V6ZA 1GC1L 2ZSVB 3JXAA 2CUHA 4GKOA 4FQ2H 4MMZC 2ICWI 3ULSA 3WDJA 2A83B 1VEOA 3MOAH 3SKOA 1QFWI 5E0QA 1X5GA 4AQ1B 4L9LC 5JO5A 3HC3H 1AD9A 1FGNH 1OSZB 2O5ZL 1VESA 2BJML 1S9YB 2MHAB 3G5XB 3C09C 5I1GL 4QT5B 1E28B 1XF5A 4G5ZL 1B0GA 2IFFL 5KSBF 1SBSL 4HUVA 2E7BA 2WV3A 1TQBB 3OPZH 3OZ9L 5DJXA 4RNRB 4JO1H 5EOTA 4RGMB 3GBML 4JFHD 4LCWA 1EFXA 5JPMA 3U79A 4BSVB 3KPQB 4OV5B 2BVTA 4EN3D 4OBSA 5FM8A 3FRPG 1CI5A 3UTZB 5KW9H 4NFCA 3MLYL 2QTEA 3C6SB 1NGQL 2F8XC 4HKJB 2UWEF 4EXPX 3VXOA 3D25B 3EOTL 1D5XA 1KJ2A 2D7QA 5EUKB 5GRXG 3L5WB 3VFWA 3CFIC 5F7WC 4RFOH 4DN4H 1ZLSH 3BJ91 1C16A 3T2PA 4EBQH 5D1ZA 2AEWA 3F65A 2GAZB 1IBGH 1BOGA 4HPOL 4PGCB 3P0YL 5D1QD 3S96B 4ZS7L 4P2RD 4JLRA 3U9UA 3VFVB 3NCJH 2VDMH 4U31A 2A73A 2A2QT 4DAGL 1ZV5A 3QNZB 1R3LB 1UB5B 4OGXH 5TE7L 2CIIB 4JFQB 1DSFL 1IMHC 1DBJH 1SBSH 5EUOB 5JDSA 3SQOL 1NGYA 3GBLA 2WIIA 1I1FB 2DYPD 1FL5A 3MXVL 5ALCL 2YD3A 4X9FA 1LGVA 4CJ0A 4KDVA 4LPTA 1RFDL 5B4MC 5GGVY 4G6JL 3LEYH 2H2PC 2Y06L 5DD1L 1VFAA 2VLKA 4M1GL 3B9KC 2BOCA 5E8EA 4GBXB 9CGTA 4KZDL 2PR4H 3ARDD 1PDKA 3KPTA 3MV9A 2DLIA 3BKYH 5I1JL 1K3IA 4QOKA 1K8DA 4NNXA 1U42A 3IVKA 4BZ1H 2OSLA 4JQXC 1UC6A 3L1OH 5IB3B 3SCMC 4M5YL 3UX9B 1S9XA 4EUPH 2VR5A 4KKAD 3EJYD 1KB5H 5EZIL 1TMCB 4L3AA 3MRLB 2VDML 3PABA 4JM2F 1Z0NA 2VDNH 1YMHA 3RZCD 4LKXA 1EJOL 1KN4H 3OXRA 2A0LD 5DK2B 3ARQA 5JA8B 2VDLL 2IH1A 4U1MA 1F4WH 1T6WA 5DGQA 2GQHA 4JFDE 5C92A 4EXKA 1BFTA 1WBZB 1AJ7H 1ZHKB 4RCAA 2JJVA 4D0DA 4JZJC 2DQGH 2GJ6A 5EULV 5LWYL 4IS6A 3WJLC 4ZYKA 1A6TA 1IEAB 3F5WB 4JFHE 2FYYA 2YBRA 5ILTL 1JZ4A 2C3VA 4O02H 1A7OL 3STZB 4D8PB 1MCDA 1OW0A 4PRIB 2XRAL 4UZGA 5CGMA 1VPOL 1PG7X 3IDYC 2PO6C 1BFOA 5BJTA 4Z0XB 1T21B 3FO9A 5KVGH 3NIGE 4WW1A 1NAMB 4GW1B 5H94A 2GK2A 4FFVD 4R8WL 1M6OA 2P5ED 1A3LH 1DE4A 1F2QA 4XMPH 4MWFB 2CUIA 4OZFB 2JTDA 3I50L 3ARBB 4DUVA 3VGAB 2QKIA 4FQ2L 3FFDB 3O6FB 4OCRL 4DWHA 1JFQL 1YC8A 4G8GD 3ULUH 3O8XC 1I1AD 1QFUL 3ARYA 4FQPA 5F97E 2DQHH 5F9OL 3BPOC 2QHRH 1ZS8A 2A6IB 3OKMB 4P2QE 3BE1H 4OD3H 4X4YB 2J5LC 4P23B 3UCRA 1QVOB 2ICWJ 4OQTH 1KGCD 1V7NL 1I7TB 1KTDA 4S1QH 5E99H 5C0RL 5E8OA 5IQ9A 3L3GA 4X7FC 5DURD 2FYYB 2CMRL 2QSVA 3IDUA 4FFWD 1MRDL 4DGIL 5HSFA 1AC6A 1JF1B 1JF5A 4LK4A 4IOSD 5J57B 2GJ6B 4RMSA 1EBAA 1QFWM 3P73A 5EU5A 5GGUA 4HIJB 5GZOD 3MRJA 4FQ1H 4FQCH 4PRAB 2PW2A 4POUB 1ZLVK 4HS3B 4HH8A 4PIRF 5D1ZC 1P1ZB 4KRLB 3OAZH 2EDBA 3RGVC 1OAXL 4X7SL 4XAKD 1U95B 4JKPH 4NHCL 5F6IB 4R4FL 2DLFH 4XVUC 1W72A 1K8IA 3HI1B 1ONQA 3GSQB 1A9BB 3U9PH 4KI5F 5HI3D 5MEQA 2AW2A 3OSKA 1RURH 4Z6AT 4ZOCA 3KVQA 3RVXC 2V6HA 4MLIA 3PWPB 2P5EB 3K7UA 3FQNB 4QHKJ 3AFLA 4K2UL 5IMMA 3SBWA 2AKRB 3QPXL 4IJ3B 4PPTA 5BVPL 5GRWA 1PFCA 2RJMA 1BQHA 1N4XH 5C0EB 1TCRA 3WL9A 3QI9C 4PJBB 2GSGB 2HFFB 5CEXA 4PRPE 5HVFB 3NIFE 5FYJE 5JQ6L 5F3HB 3FKUS 3KPLB 1EO8L 5GSVA 3D85B 1KTKE 3DXAE 4KMLB 2UVFA 4OCSL 5C08B 4QRRA 3DUSA 2YK1L 4RMRA 1XF4A 4X5XB 2MQCA 5D2LF 5CMAA 5EOCJ 2OSLB 1A1OA 5AD0A 3PNWB 4XVSH 3G9VA 1UA6L 1RZJC 1ZGLM 5JXED 4F9LA 1T1XB 1XR9B 4I9WD 1Y6KR 4Q6IA 2DIJA 1P2CA 5JOEA 3D69B 4JFED 3DO7A 4QY8A 5DS8A 1HQ4A 2BOCB 4RGNE 2YWYA 1QSVA 4S1DD 4X5LA 5D7JB 1H8NA 2H32H 4K3DH 3T0EE 3MXWH 2FZ3A 2VWEC 1A6ZB 2Q76A 4NGHL 3VI3F 2P24A 1A6AB 5IFAH 4XBGA 2MPAL 3RVTC 5EG6C 4Z77A 3BKCH 3NA9H 2ITCA 5I1EL 4JGMA 1D6EB 4FQIL 5SX4I 5HVHB 3CC5A 3HUJB 1OSPH 3K8MA 1EEZA 1YY9D 1JPST 3GSNL 1BBJA 4EDWH 3SKOB 2D7TH 4QHUB 5FAAA 2PXYC 1ZWIA 1MFCL 4N8CL 4H1LB 1UYWL 2HT4C 4NO0B 4TSCH 2HKFL 4KTEH 1C16B 4OAWA 4KXZI 4P5TD 2ZUQC 4WHDA 4LCUB 3B43A 3ZKMD 3BIAX 1ND0B 5C0NC 1LD9A 5E8PB 1EUUA 1VSCA 4I5BA 3DX9A 4PB9H 4ACPA 5BMFH 1CDBA 3WXVH 5IOPB 1G7IB 3MA7A 3MUZ1 5ABDE 3LPGA 3IS0X 3FT4A 1CTNA 1PYWB 2P5WD 3S5LG 3FQTA 3OR6B 5HHQB 3O6KL 3GIZL 4KY1H 1MNUL 4XAWL 2BSED 4P3DB 3RY6A 1N6QL 5TDNA 3SGDH 1NGWB 1BX2A 3O3BA 3T8XB 4P4KB 4NJ9H 5SWSE 3KR3L 3RWGB 3DUHA 1KT2B 3RIFF 4XC3L 3OF6D 1UWEH 3DWTA 1PEZA 3MV7A 5F96H 1V3JA 3WLBB 3RI5F 5IW6B 5J1SC 1FNAA 3VXNB 3SOBH 1HH6B 2D7TL 3BVNB 4N0RA 3QA3B 4N8VG 4PUBH 4O2CB 2AXHA 2VLJE 3NCYS 1DSFH 1KG0B 5BVJB 4PJ8A 4Y8AA 4HIEB 3P77A 1FFOA 3GSOA 4GSDL 3VWJD 1G9NH 4AEHH 2J4WH 3NA9L 4I18A 3AB0B 1NSNL 5HVWA 1FPTH 2EEAA 5DEGB 4E41B 5GSRB 3P40A 4TVPH 2HYMA 2FRGP 1WIPA 1WK0A 1OL0A 5FYKL 5KSBE 2PW1A 2XXMB 3ARFC 3BP4A 1A7BA 4MAYB 4YGVA 2HKHL 4ZOEA 4PR5B 4UT7L 2LE9A 4MXQC 5E1HB 4EI5A 4FA8A 2BNQA 1WT5A 3ALWA 4FXKB 5C0CA 5FA3A 3TIEA 1KCVL 4K94H 4KHXH 5J9PA 5B3JE 4UDUB 4HFUH 2CRIA 2FATL 1SJEB 2X89D 3H3BC 4ZDHA 3E6HA 5CHNB 5EBWA 4F37K 4OGZA 3QCUL 1CIUA 1FL6A 5D71H 2VDKL 4P3WA 5IB1A 5AAWA 5C3LD 1CDGA 3EYFA 4HAGA 1J8HB 4HBCL 5ELIA 1JNNL 2NXZC 4HT1L 1DTUA 4IMKC 3NH7H 4JREC 4LCCA 4G80A 3MV7B 4NT6A 4XX1G 1NCBL 1WWCA 5BOPA 1KLUB 5IHLB 4BFEA 4KUZL 3S35H 1KIPA 3ZSSA 4ONGL 1VFBA 1BF8A 4XWOD 2VE6A 5KVFH 4G6AD 4OF5A 1Y18B 2VZ3A 2HJLB 1FGVH 4S1SH 4F7TB 4P2OB 1IC4L 1PEWA 3MLWH 3V8OA 3U4EB 4MJIA 5C6WH 4N68A 7CGTA 5E6ID 1YJDC 1I4FB 2R2HA 5J12C 3CLFL 3DX6A 4NQCB 3NCCB 4X83A 5DC0A 4P46C 5I1GH 5LBSH 2P7TA 1F45A 1U41A 3CZJA 1J0ZA 1BZ7B 2D2OA 1GZPB 4LU5L 4MCYA 4L9LA 4OLYH 5DQDH 4DQOH 2FBJH 3G5XA 3GBMH 1IAII 2XN9A 4ZTOL 3QWRA 5F1SA 4JANB 4X98A 1K85A 5J9PB 1QR1A 2R56L 3PNWA 4NNYB 4BUHA 3BW9A 2EIBA 2VAAB 4ORGA 2DIAA 2A83A 2GK0B 1FE8H 5CP7A 3LQMA 2AV1B 4KH2A 4AENA 3BWUC 5E6YA 2DKMA 5GGTH 5HYJA 4NBXB 3V4VH 3EHBC 4YNYA 4P9MH 3VXUE 1WFTA 3VXSB 3MV8B 4GKSB 3W5MA 2I07B 1XGPA 2BNRE 5CKGA 1JPTH 2W91A 2DQHL 4L29A 3FQWB 4Z7VE 1KG0A 5BVJA 5IROA 5BS0B 3U36B 3V9FA 2DTSA 1VENA 2I5YH 4OFYD 5DJ8A 4PRID 2W60A 2VZOA 2XKSA 2CRZA 1TIUA 4WEBL 2ARWA 1DUZB 1QNZH 3UZVB 5DEFB 1NLDH 1YECL 4Y5VB 5HDOA 2EE3A 3DX8A 1ES0B 1RFDH 12E8L 1D7FA 5C9KA 2C3XA 2R8SL 2V2TA 5ALCH 2PXYD 3GEWB 3OKNB 3QIBC 4FP8H 1MQKH 4ZFOL 5FO7A 4PTUB 4IRSC 4G43B 2A6KB 2HLFC 4M62H 4PRBB 4P46A 3B8YA 3K74B 4P9ML 3FO2A 1CICB 1K3ZA 2YZ1A 3FQXB 1ZVHA 5D2NB 3AGVA 3TLRA 4RQQB 5IHUL 4M5YH 1S7WB 3KPOB 5FM5O 3LN4A 4PREA 5F1IA 4JE4B 1EEYA 5L8JB 1EZVY 5H2BA 4BK4A 3ARRA 1JK8B 5ENWB 2VITA 4JO3H 5ADPH 1OQOA 1G6VK 2YD9A 4TVSa 1UXSB 5F70A 5L88L 1H9VA 1X4ZA 5FECB 3VGAC 1VADA 4JM2B 4JZOA 2Q87A 3OKOB 2DQIH 4P57B 1MIEH 1CR9H 2FJHA 3RZCB 4YIQB 5KVDH 3JVGC 3MNZB 3NPZB 3OHXB 4I13B 4GG6B 2Y9RT 2AK4B 1FN4B 1SYVA 2NX5E 4P3DA 1ORSB 4HQQH 4XPHH 4OZFA 3P11L 4TRPL 2EO9A 3TH3T 4CVZA 1K6QH 2BNUA 1UENA 4X6BA 2VDOL 4HKBA 5F7DB 1WTLA 4OLWH 1QLFA 5ILTH 1WITA 3UPRB 1YUHB 3AREC 1H5BA 3NFSL 1TVBB 2ARJA 1IM9A 3VWJC 4ERSL 2AK1L 2P4AB 5GRUH 4H0IA 4LVOC 5LWYH 2XTJE 2EDRA 3E3QC 5FXCH 1ZGLP 3UJIH 4KZEL 1F58H 4MX7B 1K4CA 1PKQB 2IQ9H 3PHOA 2GJZA 4YHKL 4RZCA 1QFUH 2YBRB 4HT1H 4CDGC 1TVBA 2ARJB 4XPTL 1JGDB 1OF2A 1HE7A 2VTFA 4Y1AA 2AJXH 5D72H 4QRTB 5E56A 2RFXA 3R8QA 4BFIB 2EXYC 2Q20A 4DEPC 4Z7VA 4GKZA 4QRRB 2ICEB 5C08A 4XVUD 1CE6B 5FECA 4KROD 1VFUA 1FHGA 4GRLC 1XGUB 1AQKL 4JB9L 4YHML 3WDIA 2X4UA 3U0WL 4JEGB 3O9WA 3LQAH 5GS0H 1BVZA 4OCYL 4GG6A 3UTQA 5ACMA 3LN4B 4H0HB 2XNAB 4XHJC 1BPVA 2WUBL 3BP7A 4QTIL 3MRFB 5IK3B 5C0BA 4XP9H 1WBYB 4RSVA 3JV4A 1FJ1A 2FX8L 2UWEB 1SBBA 3BZFB 3IFOB 5MHSE 1UXSA 3F8UB 1CGYA 4UAOB 5FYLL 5EIIB 2QQQA 4I2XB 1RIVH 5DS8B 1YC7A 3GRWL 1LE9A 5C6PB 4RAVB 3OKNA 2Z35B 2R29H 2XG4A 1RQ5A 5HGHB 1KJMB 3FFCA 5HYSB 5E7FA 4PJHA 4Y4FD 5E5MA 2X2YA 1FFNA 1FL3B 1UYWH 3KXFD 5CZVH 2CD0A 4P46B 1CU4H 1MCIA 3VFOB 2FHFA 4F8TA 4DUXA 1ZHKA 1NC4A 4NWUL 5J06A 3SCMA 2XZAH 1FVCB 1ZLWK 3SGEI 4RRPG 5I73C 3A6CL 4L1DA 1VGEH 4PLKC 3X3GH 5JPNA 3FB6A 2Z31A 3DSFL 4AM0B 4O58H 2K7QA 5CBEA 5IESH 4IOIB 3ARTA 3RTQB 2AEQL 1RI8A 3VFVA 5D7SH 1K2DB 4JKMA 3GMMB 1UT9A 3NAAL 3LS4L 2HTLC 1BD2A 4HWZA 4WIQA 1RK0B 5GISL 1AXIB 3ROOA 5KN5A 2NY0B 3PV6A 3CSBA 1J1XL 4LPYA 4XWOC 1A0QL 4FQXC 1Z3GH 3GRWH 2C7UA 3SDAB 2QQLL 3QAZC 1ZMYA 5GGRA 5BW7C 2YPKB 3BEVB 2YK1H 4NQDA 2BOBA 4ZODA 5HI4D 4FRWA 5AUMB 4HIJA 2ZUUA 2ZCKH 1TDQA 2DBJA 1GGYA 1RZ8A 4X5WB 3QYCA 2CLRB 1KC5L 3HI6H 1BZ9A 4X98B 2R15A 3MGAA 4KXZH 5DTFA 3FRPA 4J2XA 5B3JF 2XZAL 4ELKA 2X4QB 3VFSB 4YR6A 1R3KB 1T7VA 4MJ6B 1GGTA 2AABH 1NFIA 1UJTA 3GI8L 1JRHI 4PJDF 4WO4A 3CX2A 4KKAC 4FN0A 4Q7DA 3TYFA 2XFXA 4ZO8A 2JB6A 2OMNA 2CH8A 3N1FC 5EIVA 3HE7C 1A9EB 3UROR 5DUPL 3S36H 2IALA 3LB6C 3MLYH 4W6XB 4HGWA 1B4JL 1CR9L 1KPUA 1S7UA 1EEQA 4GH7B 3BAEL 5CHNA 1NCDL 3QUKB 2HWZL 2AXFA 2X1WL 3FQXA 2NY6C 4ZNCD 3BP5A 4IRJC 4JJ5B 1DQML 2EDNA 1NKRA 4LPWA 3I3DA 4OFDA 4WWKC 2X4TB 4WY7L 2YSSA 1F97A 4NJ9L 3VFNA 4HLZG 2IJ0C 4XMLH 5FIEA 1OAZH 5FGRA 3DI2B 3GHEH 5KVDL 3ISWA 3CSYA 4H5SB 4C83A 5ICZA 5FYJD 2VR4A 3QFDA 1AO7A 3LQZB 1Z3GL 4U1GB 3DXAD 1CD1B 3HTLX 4JHZA 3O8XD 1MEXL 2IBZX 1FAKT 4J23A 4XCYA 1T0PB 2F19H 2QBWA 3BH8A 4J3WA 3U7AA 2VZVA 4M61B 1CLCA 2HH0H 1GVIA 1UXWA 3TWCL 2ZUSA 1F4XL 4ZFGL 2MJWA 1L0XA 2YSSB 2L7UA 4DTGL 4WRLA 1EZVX 4OIAA 4HUWB 5JXAH 4D9QD 1G7LA 3BDXA 1RJZB 5C0ND 1Z9MA 2EDQA 3E2HB 3VXSA 2RIKA 1OM3H 1EO8H 2AQ2A 4IMLA 2E9IA 5ITFA 5HI4C 1B0RA 4NO5A 4U6XB 5GGQL 2BC4B 2K7PA 2ZCLH 5I1LA 4JFYA 4Z76A 1LO2L 5L2KE 5I66B 4NZDA 5F7LB 3VA2C 4G5ZH 1C5CL 3QNYA 1N4XL 5GGRY 4Y16A 1ITCA 2LU4A 4N5EC 5IP4A 1K8DB 1A2YA 1QFWL 3AM8A 4NNXB 1IT9L 3G08B 3HG1A 1T2JA 5K93A 3RVTD 1CFNA 4UTAL 2RQ8A 4JKLA 2ED8A 4X6FA 1TPXB 5DJYA 5T1DH 3OMZA 4LL9A 1SYSB 4E41A 4RISH 1CGUA 4J6RH 1G9MH 5EORH 2HKHH 2NXYB 2CR3A 3WUWA 4PV9A 4NZTL 4X7TB 1IGMH 1DQQA 2ORBH 3U2SA 1IAIH 1BF2A 2VDQH 5EOTB 3I75B 4QRUB 4PLOB 3V2AR 3PDOA 3GHEL 3IU4L 4L9LB 5GZND 3MRMA 5IM7A 1LO0L 4Z0BH 3EOAA 2JB6B 4H1LG 2EH8H 3KJ6H 3OL2A 1GYAA 1YEJL 1NCCH 4Y4KD 3UO1H 1J8HD 3NGBC 5DR5H 5F7EL 4ODHH 4YHOH 1S5HA 35C8L 1BFVL 5I1KH 5E08L 4K9EC 3NZ8A 3GO1L 3QUYC 4YDKL 5FGCE 3BUYA 3BMWA 4HGWB 3HNSL 4Y0GA 5CJOL 4WHTA 5KVFL 4HD9A 2B1HH 1N3NA 3O2DH 1MCSA 3GJFK 3QIWC 4XPBH 4IMKA 5CZXC 4WU7A 1S8DB 1S5IL 2I9LA 4Z76B 3OX8B 1GOHA 1OLZA 1F4HA 2AAVA 3P4OB 4WI8A 1UM6H 1RZ8B 1G0YR 1RUKH 3PWUA 4U05A 3EOBA 3IKCA 3ARUA 4FOMA 4PRHB 4XAWH 2F53E 3BUTA 4C56D 1A6AA 1XT5A 3QDMA 4ZXBA 3QRGH 1MJ8H 1QHOA 2ICCA 1A1OB 4XH2B 4Y8DC 4OLYL 5EU7C 4EI5B 2GFBB 1J7VR 3MLSH 4DCQB 4ZS6D 1ZT4A 3K8KA 3BPLB 3UBXA 1P4BL 2M2DA 3BH9A 1E4JA 4HS6B 4JFPB 5BV7B 1I9IH 5BMFL 2OCFD 2NW3B 1BWMA 1GGCL 4Z7UA 2I25N 4WWID 4BQ6A 2VKWA 4Y4HD 2NXYD 1NMBH 1TCMA 4PUBL 1GGBL 3VD3A 4LLUB 3MFGB 1ADQA 2W0PA 1Q38A 4UIKH 4QXUH 1NGXA 3VRLF 4P2RE 2Z31B 5DZLA 3U82B 1WZLA 4JRYB 1DLFL 1PY4A 2AP2A 4OTXH 2EIZA 4OZFG 3HC4H 3X13B 4NQEA 2FZ3B 1FCGA 2KL6A 4EI6A 1DEEA 5DJDB 1S7SA 4I77L 2DQJL 3BPCA 3S6CA 2DF3A 4V1DA 1NL0H 2CKBH 3MRFA 4LLMA 2IAMB 1DN0A 3MLXL 4PG9A 3GIVB 2V2XA 1I8KB 4WTZG 3TVMB 2V5YA 5I71C 4KV5F 4FQHA 2IPUG 5JNYA 4WI2A 1E4WL 2NY4B 3QCVH 1BJ8A 1IGFH 4L8SB 1F4YL 3SDXF 3GO1H 3IF1A 3LN5B 3VGBA 1MLBB 3NZHH 1JE6A 5ETUB 3MRKA 2FATH 4U2YA 2Q8AL 4XPGH 1CE6A 3BXNA 2R0LH 3N1QC 5GGSA 4MD0B 1LE9B 5TQ0H 4KMTH 3EYVA 4Z8FH 3GSUA 4GLRI 1H3WM 1U58A 4CADB 3FFCB 4ELMF 4JM4L 2G60H 4LVNB 1MOEA 4U1IA 4I8DA 5HYFA 4NWUH 2IPUK 1BQHB 2B5IC 1MJUH 1YEGH 4TUJA 1XR8B 3QRGL 2AKRA 3JWNC 3EYOA 4OLUH 4E42A 5JW4Q 2O61B 4X5WA 3FRUB 3AU1B 1U8NB 1L6ZA 2C1PA 5HI5D 3ZL4L 1GGIL 1XGRB 5IHUH 3Q5TA 1MJJB 3JTSB 1FC2D 4MNHA 2P42B 4LKCB 1FV1B 1XCQA 3QDME 1JWUB 5A3ID 4K71C 5HDBF 3VXUA 1MHPH 2Y6SD 3ZMRA 1A6VH 5DQJA 3WFHB 4JM2D 1JMXA 2OR8A 4XP1H 4MNHB 1MRDH 4DGIH 3SE3A 4JQVC 4JFEE 4QHLB 4CKVX 3T3PE 2IAMD 4PJ8C 1MFDL 1KENL 3BESR 1U8NA 3BGMA 3GMLA 3RZCC 4YE4L 2BVPA 4ZO9A 5I76A 1I1RA 1D6VL 3BISA 3HUJF 1XR9A 2J2ZA 1TPXC 4WW2B 1KBGL 2R0ZH 2BHZA 4QHNA 3MBED 1DANU 4TSCL 2H6PA 1IEBB 3BI9X 2QQKL 4KWUA 1H5BB 3H3PL 1F4AA 3FQUB 4PYGA 1ZAGA 1KSRA 2A6JB 3LS4H 3BGMB 3GMLB 3U6RB 2D7OA 2A38A 3ZT7A 3BDYL 1DVFB 4D0DB 1MVUA 3ROOB 5KN5B 3AREB 5SV3A 2R2BA 3L95B 3D18B 4J4PC 3VA6A 1E27A 4OZHE 4P23C 3MNZA 3TT3H 4OT1L 4YUEH 5FB8A 3RWFB 5TH2A 2UWEE 4JO4H 3PP4L 4YHOL 2WNGA 5DMIL 2BSRA 5E2TH 1EPFA 4ZNEE 2ED9A 1AR2A 4PJ7F 1VACA 3LZFH 4QNPF 1J87A 5JORA 5E9DD 4P5KA 5C0EA 1ORQB 1UJ3B 3MBEC 1CIDA 1A5FL 2HN7B 1MAMH 3V6OE 3FMGL 5LGHL 4EQ3A 4JO2H 3Q5YA 2MFNA 2FDBP 1I3GH 1FO0A 1LEKB 1M1SA 1VHPA 3GKWL 2MSPA 4URTB 1BM3L 2OL3H 4HKZB 3RX7A 2Q3AA 4WFFE 3MNWB 5C07E 5FB8B 4PRBA 1U58B 3MRLA 3Q6GL 5E24E 3V0VB 4YFLI 1NC2D 4G9DB 1JI1A 2NY7L 3HLAB 4PJ5E 3ALXA 3IYLW 2VDRL 3H9YA 3AMKA 4GKZB 1NFDB 3M1BB 4UMGA 1UKTA 1QSEE 4H26B 4CN6A 5BZWA 4YHIB 1IL1B 1YEFH 1Q0YH 3X3FH 4NGHH 3U36A 4ZO6A 5CD5C 4ETYA 1RJYB 4WWKA 1KCSH 2D0HA 4P23A 5D7IA 5EC2B 1WAAE 2XY2A 4OTXL 4JLRB 1FORL 2VJXA 4OD2B 5DK0A 5K33A 5KS9A 5DEFA 1ZVYA 2OTPA 3WNLA 4OCRH 4U7MA 3TBSA 2EC9U 1L7IH 5IFJA 4JCMA 3HE6D 4L3EE 1TNNA 3RBGA 1N59B 3W2DH 3AROA 3ZDXF 3F7PC 1MFAH 2AV1A 3W5NA 2YD4A 4D0CA 4KJQC 2JK5A 4YFLF 4MVBC 3GSXA 5T1KB 4LPXA 4WHTB 3EAKA 3MRIB 2LAAA 5LBSL 3ZSTA 3ARFD 3PL6A 3V0WH 3BFOA 4MB3A 5JIPA 3MLUL 2YD7A 2HFGL 3DXAB 4ODSH 3TPKA 1IAMA 3D87B 5FUOH 5J8OA 4OV5A 2BERA 5E9DB 4NKDA 5HTSA 3QDGE 4L8DA 4B5EA 3QUML 1FFPB 3CIQA 1WZMA 3SQOH 4E0RB 4DKEL 1YEFL 1JZ8A 3ARBA 4UV4L 1PG7L 4R4BA 2WM0A 4XH2A 2BNRD 4WI4A 3MLXH 3B9VA 4ETQA 1INQB 4WUUB 1KPRB 3RI5K 4YDVB 3REVA 1K5NA 5E5RB 2XT1B 4Z0XA 3LS5H 3SEPA 2HT3D 1CICA 4PJEA 3P30L 4LMQE 3GM0A 1T20B 2MCG1 4NZTH 2X89A 4M1CC 4X7TA 2WBWB 3QEQA 2BVYA 3D2UD 2GY7B 1OP3H 4LSPL 2C3VB 3KPPB 1A21A 2IQ9L 3F7QA 4HIHB 3W11D 3BKML 3ZE1E 3DTXA 3E8UH 4RA3A 5DQ9A 4X8JA 4FABH 3MLTA 1KB5L 4F7TA 4HKJA 1A2YB 3UBXI 4OCLC 2A9NH 1AKJD 1CGSL 1P7QD 4NRZA 3QT2A 3S35X 4GXUM 3WS6C 3C9NA 5C07A 2MNUA 2VLJB 4O02L 1PSKL 5LXGH 1ZA3A 1T7XA 4HUUB 1CXLA 4MJID 1PY9A 1A1NA 5E6IA 3WO4C 4PJFE 1WCBB 4PJ5D 3JWOC 1TENA 3WFCH 2R4RH 3ARBC 4J3SA 3MJ9L 1P7KB 4LSRL 1IKFH 2WINB 5EZJB 5HYQB 1Q94B 1QRND 1S9YA 2MHAA 3EYVB 3P0VH 1O7VA 4JM2C 1U91B 2GT9A 5HHOA 2OLDA 4KKNA 2XG5A 1G6RH 2EYRA 1DUYB 2NX5D 2ITDA 1IE5A 4Y4KC 1SEQL 1EEUA 3GJEA 3R0NA 1T0MA 3MRDB 2IPTL 3KPNA 3C5JB 4NO3B 3SKUD 2G5BB 4CNIA 1LO4H 3UTTA 3ULUC 2E5EA 3K46A 3G6JE 4JDTL 5DEGA 4PJCB 4N1EA 3E1F1 3ULVC 5F7NC 1ZT1A 2HH0L 2UZIH 1CFTB 3VRLE 3DTXB 3DSFH 5D7IF 1HHJB 5T1MA 1NCNA 4OGYL 2YXFA 5CWSA 5IVXF 3VWJB 2JCCA 2VN4A 2D31B 2HJKA 3U4EA 3TZVD 2LVCA 3OR6A 1MAML 3VXRE 5HHQA 3KLAB 1NDGB 5EWIH 1CD1A 3IAGC 3S3JA 4YDJA 4HLZH 4RFNB 2A77L 2XFXB 1F90H 1AHWC 3H9SA 3KPRE 3WLWD 4HCRA 4UIMB 1IKFL 3SDXE 4XBGB 2VXVH 1NGWA 3O3BB 4WW2C 5IQ7L 3PHSA 1EAPA 4LHUG 4PRNB 5T1DL 4UBDC 2OXGA 4M4PA 1CK0L 5DRWA 1EAJA 4UQ2B 1F11A 5IJKA 1IC4H 2P48B 5TQ0L 4MD4A 4F37F 1T20A 5SWSA 4U1NB 1U3HB 1MCRA 2X1PA 1GL4B 2W59A 4QYOA 1BVLB 3EYSL 3IKCB 1X5XA 4PV9B 3QUKA 5GS1A 1SJEA 2VXSH 1IAIL 2VH5H 5T5FH 3RWCA 3SDXB 2JJTA 5EBLA 5H37H 4CMHB 4UT6H 5FHAH 1EVUA 5AD0B 3HR5A 2LTQB 3DV6B 2NR6D 1RJLA 3LKPA 1WC7A 1H8SA 1VEPA 2AEPL 4YK4B 3RP1A 4ODVL 3MUJA 3VI3E 3CFDB 3HZVB 5EU3B 3VGHA 1U3YA 3QPQC 3LRSB 3V6FB 4Q58C 2VZ1A 1VCAA 3QNYB 2WAHA 4L4TB 3G6DL 4XP5L 4R7NB 4JHAL 5JIKA 3PV6B 4NQCE 4YDKH 2VLRD 3V4PH 4D9LL 3ZYZA 3TNNA 2O5YH 3ILPA 2V9TA 3LD8B 1JUFB 2HJFB 5EOQL 3CPLA 1DUYA 1V5JA 2CSPA 4JPKH 4YXHL 4ISVB 3AY4A 4X9BA 4X99B 5DK0B 4K7FB 1H8OA 1AR1D 3WEXB 3QZWA 1QLEH 1Q1JH 4PRHD 1PJ9A 1S7VB 25C8L 4Z18A 3QWOA 3T0ED 5ICYB 1OB1A 3QIWD 4FMKA 1PLGH 1T0MB 3U0TB 3U83A 3SCMB 4Z7WB 1U6AH 4ZFZB 4TVPD 2NYYD 1BBDH 3OQ3B 5EO1A 4GQ9H 3N1MC 4P9HC 5D7KE 5C71A 4KK8D 3KJ4C 4Y1AD 4DK6A 3SE9L 4R8WH 5I9QB 5C08D 1KJMA 2EIDA 4F57H 2IANB 2MQ0A 4L4VB 4APQA 1LEKA 5DYOB 4Z7UE 3DRQA 1VGKB 4ZAKD 1KF9B 3MV9E 4LLQB 4MHHI 1A4JB 3S37H 3VWKB 3B5TA 1BAFL 2C9AA 3HR6A 3QIBB 3LN9A 3EYQC 3IETB 4GAYB 5JTWA 4U7KA 5DD3H 3KPSE 4ZS7H 2QADB 1JHLL 1ONQB 3GSQA 4PD4J 1QQDA 4U1LB 1WQVT 5IVXA 1MCQA 3E8UL 3VW3H 4M9PA 3E6FA 2J8HA 4HEPG 2LV4A 2YKLH 4V1DE 1T5WA 4XCCL 1IQWH 2VXTL 2ESVA 5DHYB 3Q6GH 2J8UA 4RDQF 4PJGB 3M8OL 4ZD3H 4O51A 1AGEA 5DQDL 3TGXA 3ME0A 4KDTA 4Q9QL 2W0LA 1S7QB 4HC1A 1QLEL 2NY0D 3SCMD 1J0IA 4WUUA 4LP5A 4OFPA 3N0PB 4N8VA 1JMZA 4EDXB 3CC5B 2MMXA 2NYYC 5I0DA 3RL1B 1W0VA 2HFEB 2NTSP 1WGOA 4ZUUB 5C9JA 2ERJC 4MNGA 2BNUB 3O45B 2AK4A 4PJIB 2BRRH 3AM8C 4QNPE 4Z7VB 4EKXA 5IFJB 3DI3B 5JW4M 4NQUA 2VLRE 2JELL 4H88L 2H2PD 2YHGA 5I17B 2VRAA 3CDGA 3THML 4LIQL 4MJ6A 1UG9A 1L7TL 4FXGA 5H35A 4IOIA 3UAJD 4IDLA 4LSTL 4NJAL 5H2BB 4XCFH 1ZGLA 5GRZA 4P2QD 4DFIA 3GBNH 5IEKB 5ITBL 4JO1L 3IJYB 3ZTJG 1FYTD 3QUZB 5AAMA 5C0IB 1DLHB 1KGCE 4O51B 2VB5A 2C3GA 4QO1A 1P6AB 5SWZD 4O4YH 4DUWA 3MODH 4MD5B 3HRZB 4GS7C 4P5TB 3T1FA 4IS6B 4OF3A 2O5ZH 3VFOA 1T7ZA 3VXMB 3EZJB 1P4BH 1DQMH 1SYVB 5B39B 5KSBA 5JNYB 4M62L 2R23A 3RDTA 1DBAL 1BP3B 4YHZL 2OI9C 1WAAF 4YXKH 4UAOC 2NLJA 4DN4L 3BDYH 4NC1E 2OI9B 1KN2L 2ADIB 2X41A 3ARZA 3IU3A 3JBG7 4KQ4H 4JVUA 3MRJB 3RVVC 4RWHA 1J0KA 2J1KA 2V2TB 1FO0H 1QBMH 3G6DH 2MOVA 3QJHA 4NYLA 4BFBD 4OI9A 1S7RB 2NY2C 3HC4L 5BS0A 2BNRB 2ICES 3HI5H 2ATKB 3PHQA 3KPSD 5D2LB 3HMXA 5HHNB 1I3RB 3HI1A 1S78C 1YEEH 1CWVA 1G7JB 3D85D 1DEEB 5DJDA 3MC0A 2DBLH 3C2AL 4WHCA 1I8LC 5E94B 2WWMC 2G60L 1MFNA 1TJIL 3C5SB 5KTEL 1SVZA 4ZNEA 1JRHH 1XH3B 1IAIM 2VXQL 4Q0XH 1WISA 3GNML 1KJ3L 1FDLL 2D03H 3IXTB 1KC5H 4ERSH 1RJLB 5C0JA 4P2QB 3STBA 3TA3B 4N8VB 5DUMH 3HAEB 1X4YA 2HTLD 3ULVH 3F12A 1ZGLB 2NY7H 2VO5A 3QNXB 2NW3A 4WW1B 1GPOH 5DDHA 2CDGB 3QUZA 1QZ1A 3FOMA 1HCFX 4FQXA 4TTGA 1UZ8B 2YUXA 3PGDB 3U9UB 5F3BB 2BY1A 3ULUD 2C5DC 3BN9D 2CJUH 4GRWB 5DRWB 3SDAC 4WHYG 1DBBL 3IDXL 4FZ8L 4KK8C 4TNVK 5EN2B 4QRRE 1F3JA 4G9FA 2Y36L 1RZFH 1NUDA 5IVOA 32C2A 3DX6B 1YNTA 2YMXL 1XF3A 1Z0MA 2OTWA 2BY3A 3DVNB 4HIXL 3IDJB 2IPKA 2HP4A 2O26U 3LKQA 4YDJB 5BW7A 3D25A 4H25A 5J89A 3BGFC 2CGRH 2YPLA 4R97B 1KB5A 4KKCC 4YHKH 5D96C 4KTDL 3W9EA 3TCXA 1HHGB 4AT6A 1MFBL 2DLTA 4MS8C 1HINL 2CXKA 1EFXB 1JPGA 3K1DA 2FL5B 4YHPB 4HGKC 4JANA 5HHPB 3ARSA 5EPMB 4X6DB 3LDBB 2BK8A 5I75B 4PJCA 5GS0D 2E9JA 3KHOA 4MD4B 3VG9B 4K9EH 1EHAA 5DJXB 5F7UA 1ZT7B 2QQKH 1CT8B 1G9EA 3WFDH 4RX4D 5KOMC 1SY6L 4OZ4B 5MEOA 2VH5L 4F15B 1OAUL 3QPQD 1ZLVH 1AGFA 1A6UH 4TSBL 5T3XE 2F5BH 3HZKA 3OKYA 4K07A 2IBGA 4GAYA 5MENE 1ADQH 3GJFH 3V8CA 5IHZA 1IAOA 3S5LB 5B22A 1GHFH 4YIQA 3VXME 2D0GA 2F74B 5FHAL 5A16A 3EDKA 2QHLA 3QISA 4Y19A 1G9MC 2AI0H 5J1AA 1S7SB 3B2UC 1WAAA 3BP4B 4NN6B 2AXGB 5JOFB 4LLWB 5HYJE 3DURA 4RWYH 1A7QL 4Y5YC 3PWJB 1R5WB 4KUZH 1KB9J 5F88A 4MAUH 4YPGA 1OTSD 1AXTH 3EDDA 5IF0A 2ED7A 2IGFL 3F58H 4GMSH 3GIVA 2JE8A 2G75A 5FUCE 4EN3A 3PWNA 1CLYH 5IB4A 4KTYA 2VLJD 5AYUH 4X0KB 4GW5A 1JHKH 2YRLA 2NY3D 2P47B 3TIEB 1ZA6B 4NRYA 1CLZL 2Z8WC 5E4EB 3VXNA 3RNKB 4Q2ZB 4OJFL 5F9WC 3MJ9H 5LGHH 1T2XA 4OQTA 2BCKB 3NIDF 4PTTB 3N50A 4AEIL 4UNTA 4KJYB 4DOHB 3HE6C 4Y16C 3RKPA 3KYOB 3RWIA 1ES0A 1PVHA 3REWB 3QDJB 3CFCH 1CG9A 1HI6B 1C08B 4DVBB 3MLZL 2J6EA 4GXUN 1ZHBB 1DUZA 3C6LA 3P77B 3HZMA 3VE0A 4B53A 1TZHA 1J18A 2XA8H 4UUJA 2EKJA 1KPUB 2R9HC 4G6KH 3VFNB 5EOCL 1BREA 3OKKB 3MYJB 4NHUA 4R4BB 1LVEA 3MLUH 4J6RL 2P44B 4L8CA 3KR3H 1JJUA 5D9SA 4K3JH 4GMSL 4EIGB 4YFEA 1XF2A 3TIDA 1I4FA 2VLKD 2QV2A 3QUXC 1KT2A 1S5IH 3EKCA 2P1YA 2IBZY 3OGOE 2HLFD 3BOVA 4QRPA 3NA4A 4L4TE 1NMAL 2ADFL 5HYIA 1MY5A 1OGTB 2E9WA 3U9PL 1KN2H 2RGSA 4WU7B 4PJIF 2GI7A 5TDNB 3D39E 2N56A 3LMJH 4XP9L 4ELKB 1ZXQA 3ZO0A 4TTDC 3L3KB 4DFHA 4F33B 1LWRA 3UO1L 4M7JH 1Q72L 3Q48A 1KCVH 3P9LB 3QDHA 4Q97A 2F54A 2XQBH 4K94C 4HX1B 1U8QB 1WFOA 3TIDB 5JHDA 1U0QA 3QDJA 1UKQA 5J0BA 5HDBE 5AEAA 1ZHBA 4LSQL 2I27N 2G5RA 1GJIA 3DUUA 2X9XA 4BK5A 1QSFB 3TV3H 5DRXB 1QD0A 4WI7A 4IRZH 4FABL 4PV8A 5B38A 1IGIL 1TVHB 4KK5D 1NFDA 3M1BA 2BY2A 4GLRH 1JYXA 1CXIA 2BVUA 3BHBB 3MV8D 1RZJL 5GGVH 5GISH 1QSEA 4OIBA 4XNYH 2VQ1A 2OP4H 2ZUVA 1FNSH 5IFAL 1Q94A 2XPGA 1RHFA 3GMQB 4YZFE 2XWBA 3QAZB 5FDYA 4LLYA 5CCKL 4GW5B 1CXHA 5ID0A 1MFBH 5D9SB 1HSBA 5E95B 3PWJA 1F3JB 4JRXD 4MJ2A 1MREH 4EDWL 3VXUD 1IRAY 4KRNA 1YNLL 3MUHL 3WFCL 3ARDB 3ES6A 4L3CA 3CD4A 5DJ6A 5D7LE 5IJVA 1RSFA 4I3SH 4R9HA 4YUEL 1B6DA 2XQBL 3OJDA 5IMMB 1KPVB 1MCPH 3TBWA 5FKPB 4BA8A 5F21B 2CDGA 4JQVA 5LXGL 3VH8B 1JNLH 2ADJA 4G3YL 1MIEL 4NIKB 1T1XA 1MAJA 3H7BA 5C6TL 2NZ9C 3S3PA 2P5EA 4E5XB 3MLRH 1NAKL 4KJYA 1J5OH 4NQVB 4M7LL 4XPTH 1T0NB 1CFSA 1FZKA 2Y6SC 4M3KB 4N0UB 4JR9H 3IU3B 2E7MA 5EU7E 3VG9C 3GKWH 4G8GA 4F3FB 2IEPA 2D7NA 3D0VA 4KZDH 1MLCB 1E6JL 4JVPA 3QWQB 2H8PB 2DLEA 3U30C 3KDMB 4PJDE 1MRFH 1ZSDA 4X6EB 3C5ZC 4PP2A 1HHIA 1ORQA 2ZUTA 1HHKA 3W81A 1SM3L 1VA9A 1YNLH 4FTVA 5K9OA 3QIUD 4NYLB 3VGGA 1V05A 4X8JB 1LD9B 5E8PA 4G7VH 4IHOB 2UZXB 3V6OA 5ICXB 2VLLA 1P69B 3V4UH 2ZOKB 4HS8L 1FSKB 1KB9K 4HUKB 2PNDA 5GHWH 3MUGB 1SEBB 4ZSOB 1U8OA 1I7ZB 4PP1C 1KJVB 4L5FH 4UV7H 4HFWA 1CDUA 4LCWD 4ONOA 3MROB 4AG4H 2JJUA 2IMNA 3VXUB 3CX5K 4IIQB 4LEOA 1ED3B 5HPMB 4J8RA 5FK9A 4BH7B 1INQA 4EVNB 4MNGB 1F8TH 4P9HL 1D9KD 1P84J 3G5YA 5T5FL 1LK2B 3ET9F 1YUHA 3FRUA 1K5NB 3ARWA 1JGDA 3QNXA 1F6FB 3DHMA 1NDMB 2DTMH 3HNVH 1M6OB 2WLZA 4K7PY 1UKSA 4PJAF 4KK6C 4R90H 1KXQE 3FOMB 1RK1B 3ZHDA 4NQDB 1I9EA 4JPWH 4PGZA 3SKNB 1IILE 4FP8L 5DVLA 5HDQH 2X05A 3O9WC 2X4NB 4P23D 5CZVL 4XP5H 4PGBA 2Z8SA 3B3IB 3IJSB 1IGTB 3QZWG 1IGCH 4NRXB 1GGUA 1G7JA 4PJFF 3S97C 1FV1A 1F4XH 1ZKAA 3O6ML 5EC1A 3T4YA 1JTPA 3ULUE 3VRJB 5IR1A 4Y5YB 3QIUB 5F1KC 3OJ2C 5ESQA 4IRJA 4JZNB 3PIQB 5D4QA 3LEVL 4M8VA 3CLFH 2BRRL 1SEBA 4ZSOA 1J11A 4XP4L 2DICA 1X6LA 2UY6A 3EJZC 5ICXA 4BSWB 1WIUA 1VACB 4DGYL 1QLRB 4LDOB 1IT9H 2DJ4A 3IT8D 1J1OH 1XGYH 4JZNA 5TPWH 4PRDA 3DSNA 5DJZA 3H9ZA 4LHQB 4WJ5B 1A14H 4HV8B 1FZKB 2YD6A 3KXFB 4W68A 5DHYA 1G6RB 5TF0A 5EIQA 2HT4D 3MQIA 43C9A 1GZQA 2BXZA 4XXDB 1IZJA 5C3TA 3DPBA 5A3IC 3ARGD 4Z7UB 4M43L 1MLCA 3VXMA 1RV6X 3FO0H 4EUPG 2Y25A 2ENSA 2PO6A 4MA1B 3QULB 3KPRD 1EVTC 4N1CA 3D2UA 5HGAA 4U1KB 2HT2C 4G6MH 4C57C 3D3VA 2H6PB 2DWEA 1BBDL 5ANME 4LNVA 4WFGD 5EZIH 4P5KB 5IBLD 1WSST 4R2GD 2ILLA 5EUOA 5JDSB 4OZIA 3P4OA 3ZKNC 1KCUH 1HYSD 3QEGH 1MJ8L 4ODSL 1AKJA 1P7QA 3FB8B 3GHBH 5JW5A 4POYA 1YQVL 1ZEAL 3L95A 2AXJA 4PJGE 1BOGB 3V0WL 2VDNL 3W39A 4HXBL 4IIQA 5IFHL 4X9GA 3U7WH 3UTQB 1F6AA 5DT1H 2F54E 3S37X 2DBLL 3TJHC 1U8LB 2FR4B 1XGUA 4NO2B 3VXPB 5IKCA 1QSEB 3WEXA 1NCDH 2WWMD 1HHHA 3T4AB 2BY0A 1N8ZA 1NEUA 3LS5L 1IJ9A 1OGAD 2VAAA 1MI5B 5HJ3A 4RAHA 1Q9LA 1A3LL 2P7TB 1U8HB 4HFUL 5HHOD 4NQCD 3ETBF 4CVZB 3QXTA 5C09B 4ZQKA 2KDGA 2R2HB 3EIFA 5EA0H 3MRNB 1EGJL 3SE8H 4NZRH 2I26N 1QA9A 4N9GB 2V7HB 3LKRA 3P9MB 2G9HA 4DKEH 4EUPB 3RUGF 2H1PH 2R1YB 1HILB 1P9MC 1NUNB 1KCUL 4P4RB 2WLYA 3O41B 2V9RA 3C60C 43CAB 2DAVA 5HVHC 3SDDA 1CFNB 4XB7A 3JWOH 3MJ7A 2NMSA 5I1DB 1EAPB 2GITA 1E4XI 5C09E 1E6JH 2GUOB 1EXUA 4NQVA 3BT2L 4EI5D 2R39A 3LH2L 1B9ZA 1JPSH 5FEBA 1AY1L 5DA4A 1AD9B 1OSZA 2QSTA 3ARDC 3BIBX 3PXHA 3T2QA 5IMOB 2EDYA 3O3DA 3RWCB 2P5WB 1I8KA 1QQDB 1VEMA 3OXRB 4MDJA 5ITFB 4WDIA 3L5XH 1RUAL 2E6QA 2P46B 4XCEA 1PW3A 1RUQL 2FX9H 1C5CH 1CGXA 4NN5B 3REWA 3VFRA 1HH9A 3UTSE 3PG2A 4OF0A 2EIZB 3WSQH 3L7EA 4LCIL 4DAGH 5MENB 5CZXD 5BS0E 1TVDA 2J8UB 3I85A 3V52L 4D3CL 4QWWD 5F9WB 2DTML 3HNVL 4XPGL 4G6JH 4CADA 4GXVH 2L7JA 4GBXC 4LEXL 1IVLA 4ODBD 4M6OL 1WEJH 4P3CH 3S88L 2OX5A 5D2NC 3QFJA 4RBPH 5GSRA 3RNQA 4XNXH 3WIIH 4LSQH 2HMID 1JN6A 2WUCH 2X1QA 4P99A 3H9HB 4OZGB 4PTUA 4XNYL 2J8UE 1GHFL 3ULSB 5F7HA 2YRPA 1P4IL 4ZFOA 1YEDA 1C1EL 4FG6C 5DJ6B 2D7PA 1G7MB 5I1LB 4BZYA 3UYRL 2PW1B 2L4OA 3I02A 2NW2B 4FFVC 5L2JA 1KLGB 1U8PB 5ACLA 1INDH 4CJ1A 1FVDA 5D5MA 3WDHA 2HJFA 5CLTA 3SOBL 4OUUB 3QIUC 4GQ9L 1C5BH 1R3IL 2CIIA 4JFQA 3DROA 5F96L 3P9LA 4WV1B 2G2RB 1C12A 4HJJL 4M6MH 1WTGT 3F7RA 1EJOH 5DR5L 5F7EH 5EUOF 3ZZ1A 3BGAA 3VFUB 2BHUA 3M45A 4PJ5B 4GQPH 2XI9A 3OJVC 1KXTB 4JFZH 1I1AB 4N5ED 1DQJA 4GXVL 3EO0B 4OIIH 3ZKXC 3P3YA 1E4XH 3F7VA 1DANT 1OB1B 5DRZB 2YPLE 1HILA 1HYSC 2EDWA 1CLZH 1NBZB 1IKNC 1LMKA 4PRHA 1FH5L 1JV5B 3QDAA 2IADB 5CJ5A 3DX7B 2OQJA 3NGBB 4X80L 4HH9A 2B1AL 5L7XL 2E7HA 4F7CB 4KVCH 3MJGX 3I50H 2VXUL 2WIIB 5GS2D 2RCSL 4DTGH 4OFYA 4DKFL 3TESA 5ACZA 4LAQL 4M93C 3G5VA 3M8OH 3RKDD 2HJLA 5JHDB 4C59B 2JELH 3RL2A 4AZ8A 4XC1H 1TLKA 1S5HB 4UTBH 3ARGC 1ND0A 2EE2A 4X6DF 5E2JA 2GSIA 4QHKI 1EXUB 2C7UB 3B8SA 4CVUA 5I1EH 4G6FB 4LCCB 1I1YA 2ID5A 5F93C 3U7YH 1LP9E 2FECL 3QO1A 4JRWA 1ZA6A 4K55A 1I8IA 5TF1L 8CGTA 1ZOXA 1RIHL 4JPKL 2WANA 5IM7B 3O0RL 1IM3A 5JIIA 3PDOB 4ORZC 1P2CB 3C5JA 5B8CB 3PJSB 5MEPB 1U9KA 4G9FB 2B0SH 4PJHE 3ZTNL 5D7SL 2V2WA 5FM4A 2ESVD 4LSUH 3UTTB 3MYJA 4FNLH 4NHCH 1DBAH 3B5GA 1QACA 4LSRH 3SY0A 1S3KL 3CZFB 1YPZA 4NO2A 1QFWH 2VQUA 1F3DH 4W4OC 2BXYA 3JUZA 2UYLB 3UJIL 1UM5L 1C08A 5ISZE 4KK9C 5DC4B 2AJUH 4PJHB 1M7XA 4KUCF 4V2BA 2FB4H 1WBXA 3G5ZA 4ODTL 4YHYC 1IC1A 3U4AA 1UM4H 4WFEE 3T77B 5HGHA 3CMOL 1MWAL 1RJZA 3K4ZA 1S7RA 5TQ2L 2HVKA 5J11C 4JFFB 3FQNA 3O3EA 5KSAC 5IWLA 5CEZD 4C55A 1QP1A 5D7JD 2AK4D 2PKDA 4GMTH 4DGVH 2QSCL 3TVMD 5J1AB 1HXMA 2FEEI 5IHBA 2R9HD 3WKML 3BSZL 5GIRA 1F42A 4IOFC 3B4NA 3SE9H 5D5MF 1QEWB 2DL2A 2EECA 3UBXG 3CLEH 4IRJB 1HZHL 1T2QL 4ODWA 1FZMB 2CDEA 3ZT5A 1FIGL 2O93L 4UQ3B 4CN4A 3RTQD 3U46B 4MDIB 2W07A 4LRNH 1PZ5B 1UCTA 1H3PH 4NRXA 1HWGB 1FG2A 3ELAT 3T0EB 4ZO7A 1TETL 1J8KA 1GGCH 3I6LE 3V95A 2WQ8A 4XNZC 4Z7WE 3QCTH 5IMLA 1AO7B 3LQZA 4G8FB 2R1XB 5JHLH 5EU6B 1JHLH 1H3GA 3D39A 1FAIH 3Q1SL 4XVJH 3L3GB 4K8RC 2WP3O 3PE9A 4OJFH 1J0HA 4JZJB 4NUGH 3MRNA 4WGWB 4FQLH 4LARL 4UB0L 3X14B 5J7CC 4PLKD 2Z0BA 4ODTH 5TFSH 5LKNA 3K2UH 1I7RA 3C5ZD 1X5IA 1UZ8A 3PGDA 5F3BA 2HT2D 1ZT7A 4OUOA 3DVFA 3MR9A 3UPRA 1R24B 1CYGA 5IJKC 1I75A 4R26L 1O5DT 1YMME 5AUMA 3W0WA 5TJWK 1UCBH 3VXQA 1ROWA 3FMGH 3O45A 4LSPH 3PL6B 4HF5L 3TA3A 2DQUL 1PKOA 3TH2T 1XGQB 2XKNB 3DVNA 4P4KD 1CU4L 1C5BL 1R3IH 1FBIL 3PWVB 2EDXA 3TBTA 3FN3A 3MRBA 3KPSA 2HRLA 4YX2L 3NCFB 3O2VH 2X44D 3QEUB 3VD4A 4QCIB 4DZ8A 4W70A 3QWRD 5FUZL 5JW5B 4PJGF 3J8F7 3EOYG 4KMTL 4Z8FL 2ZPKL 1OPGL 3ARVA 1Q0YL 3KPMA 1AGEB 5D2LA 5HHNA 3KPRB 3A6BH 4YC2B 4D8PA 4NUGL 5HHVH 1JGUL 5BRZE 3CJJA 4XHJD 4KJPC 3ROLB 5DI8B 3VFMA 3RY6C 4XVJL 4U1KA 4OI7A 2ZJSL 5IGXH 1RHHA 1FFPA 2E8YA 2OP4L 5DVNA 2PTTA 5DUBB 1I7RB 1RULH 1CBVL 5I1JH 3GSNB 4YDIL 3D0VB 3EHBD 4GRLD 3KYKH 4JZJA 1R0AL 5E4EC 1JGLL 3WFHA 2QADC 2P8MB 4R0LA 1CICC 4GUPA 4MA1C 4RWYL 1FO0B 4KKCD 5K9QG 43C9B 2Y07L 1FBIH 1MHCB 2YS4A 4MD0A 3OKOA