4NJAH

Crystal structure of fab 6c8 in complex with mpts
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
221
structure length
221
Chain Sequence
EVQLQQSGPELVKPGASVKMSCKASGYTFTDYYMHWVKQSHGKSLEWIGYIYPNNGGNGYNQKFKGKATLTVDKSSSTAYMELRSLTSDDSAVYYCARRGGYGIRGYFDVWGTGTTVTVSSAKTTPPSVYPLAPGCGDTTGSSVTSGCLVKGYFPEPVTVTWNSGSLSSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 6C8 light chain
publication title Adaptive Mutations Alter Antibody Structure and Dynamics during Affinity Maturation.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2013-11-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4njaH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4njaH02
1GOHA 4PJXF 5GS1B 5IQ7L 4R4ND 5CJOH 4JRXE 2BOCA 3SOBL 1UM4L 4XBGA 3NA9H 1AR1C 3D69B 5B39A 3BMVA 5JW4Q 1RURH 3WSQH 2P5WD 1A4KA 2JK5B 3MUZ1 4NCC1 1G6RH 4X5LA 3ZT7A 5D1XD 1WZLA 5I1IL 3QPXH 4L3EA 1D5XA 5L7XH 3RBGA 3DI3B 1FE8H 4KH2A 3L5WA 3HE7B 2JCCA 4UINL 4ZUWA 3IB4A 4XCEA 4KMQA 5KSUB 4PJXA 2Y5EA 1LP9F 5A2LH 4RMRA 3TIDA 1J05B 4X4ZA 4I5BB 3VFRB 4AY0A 4U6VL 4KHTL 4NN5B 4XPAL 4UV4L 4WWKD 3QIUD 3MYZA 3P0GB 2NXYD 1FO0A 1MNUH 4J1UB 1NKOA 3QCUL 4QY8B 4P57A 2HFGL 3O11A 3H7BA 4HZAA 3UTZA 3UMTA 4PGDB 4ODTL 4MAYC 4NC1E 3QWOB 4M8QB 3KPSE 1LP9A 1U2HA 4P9HC 3O3AA 3MRBB 2GKIA 4FTVA 1KCVL 4NQED 2ICCA 3V5HA 1SVZA 5A40E 1EZVX 4YBLC 3BWAB 1FNEB 4KK6D 3N1PC 5KSVB 1GRWA 2VZUA 1DQQA 5D2LE 1MJ8L 4OZIB 4NKDB 2AABL 2MKLC 3ILQC 4YEEA 3VXUB 4L8BB 4Z7UB 5IBUB 3ARXA 3Q6GH 4MD4B 4JPIA 5DDHA 5KVDH 3QUXD 4U7MA 5IW3A 4QRQB 1MFAH 1FJ1A 3FOMB 4P49A 5JQHC 1KJVB 4HPYL 1QFWM 4IDJL 5KTEH 2WBJD 3CPLA 1KCSL 3DGCR 5F3BB 2BVTA 3MRQA 4WHYH 2DRUA 3E2HB 2EO1A 5EUKB 4HKBB 5DD1H 2P5ED 4WO4B 4HEME 5LAXA 2GAZA 1T4KB 4OD2A 5D1ZB 4NDMA 1RZJC 4ALAH 3CMOL 4U1LB 3MV7E 4B7IA 3WIIH 5BRZD 2QR0B 3ETBF 5IK3A 4FQXD 2XWTA 2VLMD 4BFGA 4K23H 5HPMA 5BOZG 5D7JB 2K7QA 5FKPA 1OP3H 5DS8B 5FB8B 3D0VB 4HCRH 5DUPL 4MYWB 5CBAB 5A43C 3Q5TA 4YPGB 4FQLH 1G9MH 4M1DH 3A6BH 5DWUH 3U36B 3RZWA 3QG6B 3ZTJH 3TLRA 5IBTL 3HNVL 3ARWA 5C70A 1UC6A 5L88L 1PJ9A 3OMZA 4EBQH 1UA6H 5JMOC 5BZDB 1AO7B 4AG4L 3NGBC 2P8PB 1QPPA 3KYOB 1D9KC 1XGYH 1F4YH 3FO0L 2VR5A 3LN9A 5E08L 2LVCA 3GMNA 1H3VA 3EYOA 3DV4B 1INDH 1XEDA 3KPOB 1SJEA 2FD6L 5EUOE 1EJOH 4QXTA 4NOBA 1D6VL 3FO1B 4PJAE 2I9TB 4J3VA 5E00A 1P53A 5F8RC 4MVBC 4K9EL 3LHPL 4TPRH 1IVLA 1R24B 2J1KA 5DD0H 2YUWA 4KQ4H 4MAYA 5I30H 1BM3L 3ZDXF 3TM6A 4LSUL 4DUVA 3O6FC 3S3JA 3INUH 4EDXA 3VGFA 2X4PB 5IG7A 3S88L 1EO5A 1JGDB 3QULB 5ALCH 1CTOA 4PB0L 4H1LA 2ZUYA 5L2JB 3T8XB 4CU7A 1NEZB 2NZ9D 5INCA 3L3GB 3O9WA 1FGVH 2Y23A 1FAKT 3RL2B 5BVPH 3PP4L 4JQIL 1FNSH 3QIWC 1U8MB 2DJSA 2WUCH 1LEKB 4DVBA 4U3CA 4P2YA 5CEZH 1X5YA 4AL8H 3QO0A 1CE6A 3SY0A 1FVCB 1G7HB 5IB3B 5L8JB 3W0WB 4ZMAT 3VXOB 1LILA 4R9HA 3WFBL 3RVTD 1QLEH 1KXTB 5F7YC 5HYSA 1IE5A 4NJAH 4POZD 5CP7A 3L6FB 1FL6A 2DF3A 5I66B 2VLLB 3O41A 1LO5A 3I75A 4PJIB 5C0RH 4PY8I 3G5ZB 3ARVA 3NZHL 5E94B 5DHYB 1XF4A 1OP3K 3HNSH 3GSWA 1AI1L 3U0TB 1CD9B 2HTLD 1E4JA 4OQTL 1DQLH 1R3HA 1IZKA 3JV0A 5I1HL 3DETC 2P44B 4L3AA 2GK0B 1Q0XH 4F33A 4DN4H 5J3HC 1S7WA 4XBEL 4LGSB 1YQVH 4M7JH 4YDVB 1SYSA 5HPOA 5C0GA 5HI3D 1W2KT 4NUGL 1I8KA 3QFDA 3IJHA 3KPRB 2R0ZL 1IKFL 1FV1B 4GKNB 1S9WA 4HWBL 5DRWB 3S5LA 1NGXA 2N7AA 4C56B 1HHGA 3NCEB 1UWGH 2I27N 1KPVB 2R1WA 3VA6A 1BZQK 3ZKMD 3RVWD 2HWZH 2YPVL 3MLUH 1A6WL 1A5FH 3HC3H 4LCIL 5D7KD 4EI6B 1RIUH 1F11A 1D9KA 3MLTA 2YUVA 5EU5A 2EDNA 3N9GH 3OXSB 2VDQH 4ZFFA 3ZTNL 4I48B 5IBLD 3VXNA 4M5ZL 2VDOH 2ESVA 4CMHB 5E7BA 5CILL 5E9DB 1YEJH 1VACA 3NZ8A 5D1ZD 1M6OB 3BPLC 1WICA 3SDAC 3MSPA 3V2AR 3IAGC 1FAIH 3GSUB 5FUCC 1A6TB 1JBJA 2EE3A 4S1SH 3ZSTA 5IQ9A 1CG9A 2BJMH 1EH9A 1RULH 4UTAL 1R5IA 2FIKA 3GMPA 5D7JD 5T3XH 1JGEA 5ISZA 4MQ7A 1B0GB 1QA9B 5CJXC 3BP6A 1MFCL 1TNMA 4JDVB 4J3XA 4UV7H 4MSWB 5T5FH 5C2BL 1KCUL 5DMKA 1U3YA 3RX5A 3BKMH 1ES0A 1CVRA 1MY5A 3D39E 3FZUD 5I18L 4PJHA 3WXWH 5K9OB 5GS0C 4JZJA 2A6KA 1Q9LA 4BFEA 4XNMA 1C1EH 5E2VL 4PY8J 2IADB 3HUJE 3MOAL 3V4VL 3NN8A 4K8RL 4OFVA 3HZKB 1OPGL 5L8KB 4NNYB 1CFVL 2LAAA 1KXVC 3RIFF 3LCYA 5KANG 1B6UA 4LEXL 3EHBC 4PG2A 4S11A 3DSNA 4QHUA 1LDPH 4IIQB 4RFOL 4FOMA 3TA3B 4S10A 3WLWC 4GQ9L 1OTTC 1I9EA 1PKOA 4H26A 4OF7A 3VA2C 4GW5A 3G6DH 3G5VB 2XN9A 2FECL 2P5WE 4HJ0C 5FYKH 3IFOB 1ZTXL 4JPWL 1C08B 2P8LA 1FFRA 3LS4L 3KS0H 3K2MC 3L3IA 2Q76A 3RHWK 2Z8RA 4GSDL 3L1OL 1ADQA 1UADC 5SV3A 4HUNB 4IS6A 1A9EB 4F2MA 4G8IA 1JWMA 5DR5H 4HIHA 1MCOL 3ZDZF 3PP3K 3SE4C 2GIYA 3D3VB 4XAKE 5HHNA 1CDJA 4PREA 1FNLA 5GRJH 3UJJL 3RU8H 1ZXQA 1U8IA 5D7IA 3HZYB 2RHEA 3FQRA 1XR8B 2E8ZA 4DTGL 3W0WD 2FO4B 2FECI 4X6EB 3IAPA 4ONOA 1VHPA 3AREB 5TPWH 2AGJH 4N0FA 1QBAA 4W68A 3MRNB 5I16A 3T2NL 4JKPL 1UH2A 2BNQB 2Q3ZA 4HW6A 1ZV5A 1WBXB 4LLDB 1B2WH 2PR4L 4OUUB 4DUXA 3D87B 2X41A 2VLRB 1BQHB 1CQYA 2X4NB 1OM3L 1YYLL 4CU8A 4Q97A 5SX5H 5I2IB 3O2VL 3FAWA 3WFEL 1UZ6F 5EU3A 4XPFL 4HWZA 4R8WH 4X8JA 2DJ4A 3ISWA 4UU9B 3V6OC 3PHQA 1WIPA 1WZ1L 4NHCL 2O5ZL 3HAEA 5EU6A 4AMKL 2VL5A 5KVGL 5J4MA 3IYLW 3QZWA 3QRGL 5C0FA 5CJXA 3HC4L 4C59B 3KPRD 1SY6A 1NQBA 3MRFA 4MJ5A 2D4FA 25C8L 3VGAB 5DTFB 3AMKA 2FATH 4ZODA 1FZMB 5E1AA 5AWNH 4C56D 4Q6YA 3SO5A 1OVZA 5DJAB 2VAJA 2YPKA 2GUOA 2Y6SD 5F1NA 2VIRB 4MGXA 1BVLB 4O2FB 1IBGL 5BRZE 1HKFA 1GPOH 3EJZD 1ZHNB 1H8OA 3QXAA 3FT4B 3SGDH 2K9UA 1A14H 1IC7H 2CDGB 3IJSB 4X6CF 3UDWC 3I50L 3H8NA 5FA4B 5E9DD 5MHSD 5LXGL 2Z35A 3ARFB 4N8CL 3TBWB 4XH2A 3QUYA 4FN0A 5F9WB 4BQ6A 4LSQH 3ARUA 3I3DA 4HQQL 3S36H 2E6JA 3P11L 5E99H 4KXZI 2W07A 2AEPH 1BVKA 4WUUA 2XY1A 2X70B 1AIFB 4LAQH 1E4XH 4JKWA 2D4DA 4QRPB 5KANI 3MNVA 2CRMA 4X4MA 4WFGD 2QKIA 5MERB 5LGHL 1XGUB 4UI2A 3MXVH 4YFEA 1B0RB 4YBQC 1FYTB 3SE4A 5E56A 3ZYOA 2EH8L 3LD8B 2Y07L 3P0YH 1UT9A 5H37H 4YHLL 3ZYIA 1X5JA 3IU3A 2DQCL 3F7PC 1PX3A 4QRTB 5IMMA 4NNPH 3PL6C 4XZUB 2G5BB 4I9WE 1JWUA 3JSSA 1CU4H 4MD5A 4ZNEA 3CDFA 1T1ZB 4U1MB 4YXLL 3S7GA 3SDYH 4NZUL 5I1DB 5SX5K 3TA3D 4IRJC 3NIGF 1TJHH 2EEDA 3I3BA 5TDPB 3CX2A 3HTLX 2F74A 4R4FH 3L7FA 1MLBA 5IEKB 1LO4L 2NYYD 4UBDC 2R23B 1NGQH 1U3HC 1LEIA 3U83A 5E2TH 12E8H 2IBZX 4YH6A 5DJXA 3UJTH 1UVQA 5FDWA 2D7PA 3U7WH 3ZHKA 1ZLUH 5DJ8B 4WEBL 4OZFH 4QYOA 2EXYD 3SE9H 3V6OA 1A9BB 1BJMA 3D25B 3IRPX 5D72L 3KYAA 3D3VD 1UQSA 3HPJB 3C8DA 2F8OA 1I9RH 3VXTB 5GJSL 4RGNC 2EDRA 4HD9A 1CCZA 1Q38A 2JE8A 3PQYB 1QBML 4RIRB 2WZPD 5DQDH 2IF7A 3ZYJA 3B9KC 1WIUA 3ARED 1D3CA 1U6AH 4Z7OF 4DW2L 2BFVH 4HT1L 2VQ1A 1WJ3A 1QR4A 3QDHA 2BNQD 3W9EB 4DK3A 5CD5C 3C2AL 2X1PA 1QPXA 5HGHB 2EYRA 4XMKL 1N8ZA 3VGHA 1MSPA 2X4TA 4JDTH 4NZRH 5JNYB 3PWJA 1MIEL 3ULVC 1A3RH 1KENH 4JHAH 3MCKB 1P7QB 3BRGC 4RISH 4ZO9A 4JZNB 3ZE2F 1OAYL 3VMPA 3P40A 4FQ1L 4OZIE 4OGXL 5KS9F 1ZT4A 5MENB 1VESA 4GUPB 1U92B 3LKRB 4KKLD 2Q3AA 1IT9H 3Q0HA 3N1FC 1RY7B 2A6IB 5FCSH 4R0LA 1A1MB 1SMOA 3QXTA 3BSZH 2C7UB 4ODWA 4OGYL 5KSAB 4JQXA 1JL8A 1XGQB 2AXFA 4FA8A 1FCCA 1TTGA 3QQ9D 1Z2KA 2C3XA 5GGTH 2YEZA 4KY1L 1RHHA 4R96A 1KACB 4X7TB 3BKCL 4L4TA 3GMRB 3ZE0F 2EDBA 1YEHH 1MCQA 1GOGA 5C1MB 5KS9A 5DVOA 5FK9B 5B4MD 2VXQL 3HS0A 5T1MB 3ARRA 1YEGL 4A6YA 5K9KA 3L3KA 1FIEA 3PL6A 1Q9KB 1ED3B 5CKGA 4EQ3A 4K8RD 4KUZH 3VJ6A 1M05A 3OKNA 1ZT7B 5L2KB 4IRJA 1ZLUK 3NPSC 1MFBL 1XGTB 1WAAE 4LSPH 4MNQA 1S9VB 4DGYH 1U8QB 3ARFD 3WL9A 3BRFA 3TBSB 4LLVA 4YK4C 4UQ2B 4OLYH 1TMCB 1BPVA 5ESAB 2B4CC 1PVHA 3QHZH 1ACYL 4TQEH 1GH7A 3OGCB 3PIQB 1EEZB 1U3HA 3V4UH 4HUMB 4OCRL 4LOUC 2BVEA 4GS7C 1RIVH 1NFDE 2ATPB 4QRPD 3TPUA 1NANI 4UOW1 5A3IC 5D70H 3IDMA 5CZVH 2ADJB 1NC4B 1XF5B 4D0BB 3RWHB 1J88A 1UJ3B 2CXGA 4WI6A 1UH3A 4NGHH 5E6IC 1FYTD 3G9VA 4MXVE 5L0QC 4KK5D 3RDTA 1F42A 3ULVF 3BPOB 4XMPL 1MI5A 3FKUS 2R2EB 4J8RA 5DC9B 3TBVA 5JHDA 1JHLH 3AMLA 4V2BA 4X5WA 2EXWD 5HYEA 1IM3A 4NQUA 5FF6A 1YJDL 3B9KA 1P4BH 2R1YA 2YC1B 2AI0H 1QFPA 1YNTA 4CVZA 1T0NB 4O5LL 1MHCB 3K4DA 3ZKXB 1FPTL 4U1KB 2DQHH 3LN4A 1YN6B 3TN0C 4K3EL 1A8JH 2O5YL 4UILH 2NLJA 2W0LA 4O58H 1JZ2A 1AD0A 1S78D 1C5BH 2UUDK 4LSRH 4HXAH 4LKXB 5DK0B 2IPTL 4KKAD 4JFXB 3QDJA 3LEYH 4NC1C 3FT2B 2QQLH 1W8NA 3MREA 2Z31C 4BZ1L 3BEVB 2CGRH 1NGZB 2JJUA 5HD8D 3MRGA 2QBWA 3VW3H 3MLRH 5I8EA 3ALPA 3AU1B 2H2PC 4HJGA 2F5AH 3W0WE 3K80A 1MIML 1S9XA 4HZLA 3MA9L 5DFWH 5IB5B 4GG6B 4Q9QH 1NJ9A 3FTGB 2ERJB 1GXEA 5DXWA 1CBVH 4MQXD 1AGCB 3VD7A 1ORQB 3H3BC 3PQYD 4V2CB 5IB2A 1T04B 1ETZB 4LARH 3S96B 4TN9A 2JELH 1RJYB 4Z77B 3O4LB 3WFZA 1FLRL 3QQ4B 3CH8A 3GRWL 4Q0XL 4ODUB 1DBAL 3J8F7 3MV9E 1I7TA 2Y5TB 4EVNB 1MFEH 1MJUH 5I9QC 1MAJA 1YEKL 2Q7NA 3OG4B 4BK4A 3GJEB 1P7QD 2CK0L 3FFCA 3C9NB 3MRLA 1BZ7B 1JHKL 2AQ1A 2F53A 4R4BB 4N0UA 5DRZB 2AJYL 1FZOA 3VXRE 5IVOA 3ZKND 4OLUH 5I15H 1RZIA 3KPRE 1X5HA 3FN0L 3FQWA 3QJHA 4XP5L 4C56E 1INQA 3C08L 1QSZA 2VJXA 3VG0L 2X09A 1MUJB 5KSAD 1NC2B 4XX1G 3PG2A 3V6ZB 3HE6D 4NO3A 3QI9B 4PJDB 5DO2C 2UZIH 5E6IA 4FFVC 1QSVA 1ONQA 4KMTH 4BZ2L 4PG9B 3B9AA 2OL3A 4GKSA 1HHIB 5E4EB 2WINA 1OTUC 3F62A 4Y19B 2OR8A 5E9DE 2PYFA 5MHSE 1BD2E 2BNRB 5FUZL 3KPPA 5HVFB 2VB5A 1DDHA 1NLBL 4JM4L 4M7KH 5L2KD 4PD4J 4QOKD 1REIA 1QBLL 3MV8A 3VXPA 2HT3D 5HVWA 4NT6A 4QTIH 3PV6B 5J57B 2QSQA 3QEUB 3VD9A 1KB5L 1TXKA 4LU5H 1ZANH 1A7BA 2XRAH 3TN0A 1P69B 3QCVH 5BZWB 3VFNA 1UXSB 2Q6WB 4WFGE 3MUJA 2CLZB 2OTUB 4PIRF 3MLYH 4B7LA 4MJ6A 1GZPA 1DBKH 4XXCC 4AIOA 3FAXA 3H2WA 3OKOA 2I5YL 4WCYH 4YHNB 1YEFL 2ZKHL 4EN3D 3JTSB 1U91A 4X80H 3SPVB 3P4MA 4JG0H 5D2LF 1T89C 5EIIA 1FL3A 4RFNB 5DJDA 5IB1B 2CDFB 3DRQA 1NC4D 4LBEB 2Z31A 2APVA 3M07A 4M62H 1GSMA 1VADA 3OHXA 4OZGB 2B1AH 3DURA 1OSZA 43C9B 2XA3A 2F19H 5ICXB 3S36X 3UPCA 5EU7C 3RTQC 4N0CD 3V9FA 4JFPA 1AP2B 5J13C 2FYYA 1EHAA 3PABB 4JFEA 1HIML 1T6VN 1V5JA 1D5ZB 1L0YA 4F3FA 1LNUA 1ORSA 1X5GA 5BJTB 4PRPE 1LK2A 4W4NA 3ARBB 1UXWA 1JTTA 1S7VA 3T04D 1JPSH 4WV1C 1JK8A 4TYUA 2R8SL 5TF1L 1OAZL 5ETUA 3VH8A 4PGBA 2H45A 4NM8H 3RWFB 4LF3B 1A7PL 1FVDA 3D3VE 2H8PB 1N5YH 1R3KB 1J1PH 4LLAA 3CUPB 1IFHH 4HX1A 5EOQL 3VFTB 4BZYA 1MHPH 4JDZA 4PRHE 2AJUH 1ZLVH 3VMNA 5CJ8A 1RUPL 3P9MA 3BN9D 1I1AB 1LK3H 3QEGL 4GOSA 4P23B 4UT6L 2XFXB 2H9GA 3MO1A 2FBJH 2I07A 3W5MA 1HSBB 5DD6B 4JANB 2C4XA 2HKFL 2VKXA 1YEEH 1NKRA 5F7DB 1JNLL 1TJGH 4PY7A 4HUUA 2VN4A 4JO2H 1I4FA 4LRNL 3BYYA 5IQ7H 1RZKL 3U7AA 1A02N 3BP7A 1S9YB 1P84K 4G8FB 2NNAB 4HXBH 4CU6A 1UM4H 4PJAF 1P5UA 4G42A 2VWEE 1HK6A 1H0DB 3F12B 1BFTA 4IRSC 1MVUA 1BBJB 4X99A 1BGXL 1X9QA 4KTEH 1QSEA 4NCDA 3O2WH 1EIBA 4LMQI 3RWGA 3GO1H 5E2UL 5EZOH 4TULL 1AC6A 1JRHL 5HI5D 3Q3GB 1I3GH 3QQ3A 4AQ1B 2H26A 3NIDF 3IDUA 2VITB 3TV3L 1RUKH 3P4OA 3TH4T 4ELMF 4JO1L 4WGWB 5I71C 3ZDYE 1CFTA 3LQAL 3QNZA 1KB5B 4U6VH 1J86A 3BW9A 3BO8A 1VFOA 2WM0A 3BH8A 1CLCA 1KT2A 2EDFA 2ILLA 1NMBL 3CVHA 1T89A 3QCUH 1QRNA 2CO6B 1NC2D 2VLJE 3O6MH 4KVCL 4OV5A 2OMNA 3QI9D 4JO4L 1G7MA 5IHBA 1QFUH 1UWEL 1AC0A 2OXGA 3LKQA 2WWMC 1OSPL 5I76B 2V5RA 1UM6H 3VFUA 5MEQB 5ACZA 4R90L 4D0CB 4ELMA 3V6FB 3VE0A 2VXSH 4S1DC 4QF1A 2CKBL 5DYOA 1RIHL 3TJEL 3NA4A 1HEZA 4Y19D 1BX2A 3KHOA 2BNRD 2J6EA 3PWPA 3B43A 4IMKC 3RTQA 2XI9A 4KK9C 4N5ED 3MA7A 1I8LC 3M45A 2WAHA 4XNYH 2YWZA 1TVHB 3NABH 2BERA 3VI4E 5CIPH 1ZLVK 4I3SL 1M1SA 2YZ8A 3AAZB 4WV1A 5EPMB 4OCXL 4G9FA 4R4NC 3WCYA 3WNLA 5E24E 1BOGA 1SYVB 3WN5C 3T3PE 1U9KA 1QLRB 4M6OL 1CK0H 1J5OL 3DRTA 4XC3L 2HRPH 4KU1A 4YAQA 1KCSH 3WIHA 3NFNB 1ZGLM 3FQTB 2BOBA 1S5IH 4C54A 3F5WA 1GCFA 2CK2A 3EOTH 3LKNB 1DANU 4XPHH 5BMFL 3MOQA 4I0CC 2IBGA 4Z95H 5F1IB 2NY7L 3C5JB 3RZCC 1SHMA 5K9JL 1AQKH 3EO0B 1DLFL 3MLSL 3TBTB 3GM0A 4IBLT 5LBSL 4H0GA 4WWKC 3QIUC 5DHVA 2NXYC 4ZUVB 2EECA 4AEHL 1N4XH 3TEUA 4GBXB 1YMMA 3ARBD 4JY4A 3MMEA 3CC5B 1KJ3H 1P4IL 3CXHK 4FP8L 1K4CA 5BO1H 3H7LA 5IBTH 3U0WH 5DJ6A 3QUMA 1FH5L 3KLAA 4W70A 3WXVH 3G04B 5MI0B 3U1SL 4QRUB 4HFWA 4OT1H 4E42A 3ET9F 2ADGB 1S3KH 5DFVD 2ZCLL 4P23D 2IAMB 2PCPA 5I73C 1OT1A 4KK6C 4BELD 4WY7H 4ZFOA 5F9OL 3CDGB 2OBGA 3S8WA 4XT1C 3K0WA 1VEOA 2ZSWA 3HUJF 2ARJA 4X7DC 1A6AA 3OR7B 2UWEB 4XGZB 3LHPH 1Y0LB 4U6HB 4R3SA 2RFXA 3QUXC 1BM3H 4JJHA 4XCCH 1NCDL 4ERSL 4DKAA 2V17L 2AXGB 2KUTA 4AENB 4OLXH 2BVPB 1YMHA 4U1JA 1NSNL 4K71C 5ICZA 3DMMB 5CZXD 2BRQA 2WBJC 5B3NA 3DVGB 4IMKA 2F54A 3V5KB 2FJFB 3VFVB 2CKBB 5EZIL 1AKJA 5CGYD 4JFFA 3ARDB 1BLNA 4HH9A 1MJ7H 1U3ZA 1I8LA 4LCCA 4M61B 4M7LT 4NWUH 2R2BB 3HG1A 3VFPA 2EDTA 1YY9D 1U8OA 2XZQL 1FG9C 1ZWIA 3GSOA 5IV2B 1K2DB 5BW7C 3VG9C 5CHNB 3L95B 3O6KL 3D2UD 3LSOA 2D03H 5HHOE 5J1AA 2FL5B 4OCSL 4U0RC 1NAMA 3WN5A 3IKKA 4J4PD 1FORH 5D5MB 4CL7A 4GAGL 2R1XB 4IOIA 3VRLE 3PF2A 4O9HH 4YDKL 3NZHH 1P4LB 4HF5L 5J6GA 5ANMA 4GMSL 3SDXB 4MX7A 4XNZB 3GI8H 1FN4A 5L2KE 4QOKE 4XVSH 4YHOL 1AI1H 3IXAB 3DX7B 2GT9A 3EOYG 5D93C 1TQBB 5BV7C 5FO8A 4FMKA 4L3CA 3RZCA 3SKMB 3H0TB 2RJMA 3IJYA 5I1HH 4UIMA 3ZKQD 3KJ4C 5MEOA 2FWOA 3IKCA 4WWKA 1MWAL 2OLDA 1IAIM 1NH6A 3TGXA 3LRHA 1X4ZA 3SO3B 3R8QA 4CJ0A 2AK4A 4Z7VE 3BP4B 3NCCB 4R2GB 4N1CA 5E8OB 1CFSA 1GL4B 4HLZG 5GS1C 3UC0L 2H2SD 1D5XB 5F88B 1G0YR 5JIKA 1F90H 3O81A 5LG1A 5HDQL 3L5WB 4Q2ZA 4U1SB 4YO0A 2DAVA 3S5LG 2JCCB 2QL1A 4XCEB 3Q1SL 4Z7NF 1JGLH 5JIPA 2NZ9C 4NQEA 5ADPL 4JFDB 5TGBA 4NJ9H 2ICWA 1N3NB 1I85A 1NCAH 2CMRL 3QCTL 4JHWL 4XVUD 5DRNB 2YSSB 1L7TL 5KSBA 3Q2CA 3HE7C 1U58A 3N50A 5CAYB 5CILH 1HZHL 2ZCHH 1L9NA 3DUSA 1XZ0A 2YBRB 3SHSA 3RNKA 3MJ7B 3RWEB 1M7XA 1XR9A 3K4ZA 3QDMB 5F7WC 3CLEL 4F15B 2YPLE 5DK2B 1A6VL 1IC5L 5I1KL 4NN5C 3QUXA 3RVTC 2DBLH 4Y5XB 4LCYB 5JA8B 1UKTA 2VABB 5LWYL 4POZC 5T5NF 1Q1JL 2OTWA 4RWYL 2IBBA 4NP4H 3WMSA 4GBXD 1RMFL 2H1PH 5GZOD 2D7OA 4FTVB 1T7YA 4P2CG 1YN7A 2WBJA 3A67H 4ZPVA 3RGVB 2YZ1A 1FFQA 3P0VH 4LLMB 5I8KH 4DKEH 1F6FB 2FLRT 5H8DA 5C2UB 1AJ7L 2P5EA 3FRUA 3FN9A 5E2VH 2FH6A 1A7QL 3ZHDA 4HBCH 4LSDA 1HYSD 1NGPH 1U8NA 1T1YB 1FFNB 4OKDA 1A47A 1CFVH 3B5TA 3HC0A 5ECJE 5C0JB 3V4PH 1CF8L 2GTZA 5DDHB 4KJYA 4RFOH 4G6KL 2IAMD 5E6YA 4M6AA 3MRPB 1OAUH 2C1PA 2GJ6E 4RDQG 4C57C 4LRIC 5FM5M 2HJFA 4HHAB 5HI3C 4NIKB 4JY5H 5EOCL 3FFDB 3UXFA 1A0QL 1NUDA 3MRQB 2V2TB 2IH3B 3MLVL 1QQDA 1ZTXH 2BSRB 2JIXA 4JPWH 3TNNA 5T3ZH 3ZKMC 4ZUSA 3RVWC 1RZFH 3BXNB 4AM0B 4GSDH 1HHJA 5GGQL 4OD2B 3DMMD 1WZKA 2IANB 4HDIA 1ZE3C 3X13A 2XXCB 3E2HC 5IBLC 2XZAL 5D7LA 3ARDD 5GS2D 5AD0A 1XH3B 1CFBA 1E4WL 3H9SE 5HGGS 4WO4C 3NMEA 4ZOEA 4OGAD 2PNDA 1G7IA 1MFDL 3D18B 2CIKA 1KLUA 5D1ZC 3RWJB 5HPMB 5ENWA 3UJJH 5FKPB 1MWAB 5F93C 2R2CA 5GS1A 5L9DH 1UG9A 1J0IA 5ITFB 4DTGH 3MLPA 2D7NA 4PJDE 4LCWB 2NY5L 2IPKB 2VDPH 5D7JC 4BK5A 3D69A 3M8OL 1SJHB 4M48H 2YD2A 3T2NH 3QYCA 5DJYB 2JK5A 2IQ9L 3OJDA 4X7SL 2JB5H 1PG7W 3L3HB 4KPHL 1MPAH 2BNRE 3QNXA 3MFFA 3QG7L 3EYOB 1WIOA 4UTBH 1TIUA 3HE7A 5F7NC 4QXTB 4HFUL 3O8XB 1AGDA 4LGRB 2FGZA 5E00B 5FGCB 2QSCL 5GRUL 3TNMA 1BEYH 1GIGL 5CSGA 5IHUH 3GMLB 3ABZA 3RI5K 4I5BA 5DD3L 5HHXL 5EC2B 3VFRA 4ORZC 3DX9A 3GMQB 4RAUB 1R5VB 2X6MA 1VGEH 4NHCH 4AMKH 5KVGH 3FQUB 4NKIH 4JN2B 1GJIA 3DROB 1ZEAL 1R3JB 1ZS8B 4J1UA 1EHLH 4AEFA 5KAQF 5IG7B 4QY8A 1J0YA 3UTOA 3CDCA 4I0PA 4LFHG 4R2GD 4OZIF 3QZWG 1RU9H 3BDYL 1BJ8A 3QR2A 3O9WB 4PBVC 1UACH 4LPTA 5C92A 3VCLA 4Z7UF 3CFCL 1MF2H 2MCPH 4L3ED 4M8QA 5EZLB 1PYWA 3CX5J 1TVBB 2KPNA 3ARQA 2G2RA 3MRBA 4DVBB 4OZGE 1O7VA 1OGAB 1KJ2H 1T7WA 1WWBX 3KPLB 4WU7A 3QO0B 4JEGB 3VWJA 1CE6B 4OLZL 3BI9X 5IMLA 5KSVA 4LRIA 3LPFA 5C8JA 4NKDA 4TSCL 3MLXL 5CP7B 3STLB 5LXGH 2E8YA 3VXUA 3O41B 5EZJB 1FFOA 4Z7UA 3I75B 3THMH 1T0PB 3IF1A 4MD4A 3BESR 3JBG7 4HMCA 4UT9H 3KYNB 1MREL 4ISVA 3OX8B 2N56A 3CVIH 4YR6A 5EN2B 4QXGL 1IGCH 4QRQA 3T77B 3P11H 4HUXB 1CDCA 3FOMA 3RP1A 2X5PA 4EEEA 2PYEE 3V5DB 3IDYB 5EOCJ 4FTVD 2APWA 3GHBL 5IOPB 5JW3L 4PJ8A 5JW5A 4L4VE 2VDMH 2I24N 4ZXBB 4HKBA 3DECA 3ZHLA 4WO4A 2EH8H 4TSBL 1S7WB 2W9LA 4ONFL 4PJ5E 4YHLH 3CFIC 1SYSB 4U1LA 5DVKA 5C0GB 5E6ZA 1I8KB 3FQXA 3IJHB 5GGRY 4TNWF 3WFCH 1TQCB 1S9WB 3OQ3B 4NZUH 2D0GA 1WCBB 3S5LB 4KDWA 4URTB 5D7JA 2FR4A 4LNRB 3MRIA 2DQJH 2R1WB 5FB8A 2CRIA 3D0VA 4NC0B 3B2UD 1F11B 4GKZB 1X3DA 1HQRB 3KPMB 3PE9A 3MLTB 3LKSB 4YC2B 5I74B 3HFML 1U2CA 4XCYB 4Q58C 3S6CA 3HZMA 4Y1AE 4LQFL 1AO7A 2ESVB 5EC1B 2P8PA 3CZFA 1GGIL 2VXUL 2IAND 1CE1L 3IDXH 4U6YB 1UEYA 1A7OH 2IPUG 5JOFB 4OD1H 5JDJA 3DV4A 3KPOA 5EH1A 1JJUA 3EJZC 1DSFH 4LNVA 5D72H 3FO1A 5EO9B 2I9TA 1DL7L 4CMHC 5IEHB 1OARH 3QUKB 4KROB 1IEBB 4DKFL 1R5IB 3GMPB 1SY6L 2VUYA 4ZO7A 1JGEB 4MQ7B 5DMYA 4P5KA 1QBMH 4K9EC 1ES0B 4LCWD 3RA7H 4Z7WE 5GSRB 1YC8A 3X3FL 3MACH 4XC1L 1LO2H 2X4PA 3RY6C 2W38A 3AROA 4PJHB 4DW2H 4JZJB 2A6KB 5I19L 3QULA 4XNMB 4PR5B 1KELL 3DTXB 2CXKA 3FT3A 5L2JA 3T8XA 5IFJB 1KTKE 1NEZA 5JQ6H 3RL2A 5T1LA 3VFOB 1S7QB 4PJIF 3KYKL 2MMXA 1U8MA 4JO3H 1MIEH 4MXWL 1LEKA 3T0EB 1J18A 4EDWH 4ACPA 3O8XD 1S8DA 4H0HB 5HHVL 3C6LB 3ALXA 3WS6C 1FVCA 1G7HA 5IB3A 4FFWD 1EFXB 1CL7L 5IFAH 4IIQC 3TA3C 4MAYD 4N1EA 4YHMH 2J7LA 4OZHB 2P8LB 5SX4I 4QGYA 5I66A 2Q76B 2VLLA 3RWDB 3CD4A 4H5SA 4PJIA 5ILTH 2GK2A 3WKNA 5I1GL 2NYYC 4G9DA 4IS6B 1FQ9C 4XPGL 5E94A 3O9WD 5DHYA 2NY2B 1RVFL 2AJSH 1NANH 4LMQE 3C6SA 3U0TA 4K94L 2IC2A 4G7YL 5C6WH 1OGAD 1G1YA 3LMJH 1G7PB 1DZBA 2EXYC 3DJ9A 4JFOB 4KKNA 5D7IB 1IQDB 5DMJB 3GBML 2GK0A 4B50A 4KVNL 3C5SB 4RZCA 4TRPL 2ORBH 3AS1A 1CL7I 3OZ9H 4QTHA 5JW4R 1MEXH 1UFUA 2A1WL 4QHLB 2HRLA 2CH8A 3G08B 3JWOL 2AQ2A 3O3EB 2W60B 1FV1A 2ZUQB 4GKNA 5DRWA 3BJ91 4EJ1C 4C56A 3AREC 1KPVA 4OLVL 4PJBE 4WGVB 4G3YL 2RCSL 4OI9A 3B5GA 5FYLH 4HC1L 1J0JA 3EIFA 4TTGA 1KCKA 4MA3B 2VERN 5EU3B 2OK0L 3OXSA 4W81A 4I48A 2PXYA 4TUKL 2A6DB 5JR1L 4X8JB 3REWA 4ZXBD 4K7PY 4P2QE 2R9HD 5CSZB 4NBYB 5DUBB 5E9DA 1NBYB 1UKSA 1M6OA 1MVFA 3QZWB 5C0FB 4XPTL 1K3ZA 4YX2H 4EOWH 4F57H 4WFHD 5CS7A 3BIKB 3U7YH 4KKLC 1SVCP 2X2YA 1DBBH 2DQEL 3ELAT 4NQDB 5I1JH 2VYRE 3RY6A 2VC2H 2R56L 1QNZH 1B0GA 1QA9A 3PGFH 4JDVA 4E41B 3QA3A 4MSWA 1IGTA 2F5BH 3DHJA 3QQ9C 4KFZC 3VGAC 5F1NB 2O5YH 4I3RH 2BSTB 3R0MA 1CDIA 4HCRA 1OCWL 4EKXA 5K9OA 3T3ME 4X6BA 3SGJA 2IADA 2ESVD 1TJIL 4OUOA 3L5XH 3KR3H 4NNYA 4GJTB 1E0OB 4MVBD 1FFPA 1GOFA 4K8RC 3QUYB 4RAVB 2DLGA 2L7UA 4IIQA 1BF8A 3TA3A 1LE5B 1H8SA 1K8IB 4KROD 1MIMH 1KB9K 4AYFA 5D5ME 2OQJB 1OY3B 3ARFC 3RWCA 4YHZL 1CFQA 3MNVB 4OAWA 5F9WC 3UTTA 2QKIB 3IFOA 5FECB 3ARGA 1P2CB 4XI5D 4GW1B 4CN1A 2H6PB 4A6YL 2R0KL 4WI2A 3MCLL 2RB8A 2A0LD 3U9UB 2JJWA 1A9EA 4KAQH 4FABL 5IMMB 4LHUA 2A77L 2GITB 1CDBA 4OQTA 4MD5B 4DKDC 4LLYB 4S1QL 3DARA 3GKZA 4PGCB 1WBYB 3RRQA 1F4XH 2CK0H 3LD8C 3T0ED 3BZ4B 3UTPD 3IDGB 4NYLB 1JHKH 3C6LD 1CLOL 1UJTA 3EYSL 4DUWA 2EXWC 2F74B 1HKLL 4QT5A 1EFXD 3MJ8B 4XNXH 1DQML 1DVFB 2GEEA 3AREA 2HG5B 3QWQB 3GSNL 4GRWB 4CN6A 4HWBA 5BXFB 1LEIB 3WJJA 1FNFA 3MRNA 4L3EE 2BNQA 3LRSB 3QO1B 3VG0H 5DJXB 4PRIB 3W81A 1NLDL 2AEIT 1WBXA 2JCCE 4EUPH 4J3OC 5IWLC 1D5BB 5CD3B 3KNBB 5GGRA 4QYOB 4PJXE 2VLRA 1BQHA 3BQUB 3DETD 2E6PA 2NY2D 2AW2A 4S0SD 2X4NA 4H8WC 2LFGA 5HGDB 1Z0MA 3D5OF 1S78C 4OM0H 5SWSB 1EUUA 5I2IA 1M7DA 4M43L 4KKAC 4E0RB 3HI6H 1VFBA 1R3IL 3BKYH 4FQCL 4YXKL 1XGRB 1TCRB 2EC9U 5TE4L 4UU9A 5HD8C 5IB4B 4YIQA 3QEHB 3DV6A 1WEJL 5F96L 4BJLA 4FQQA 5IUSA 5AYUL 4WHCA 5FM4A 2JJTC 2BHYA 4FQ2H 1NAKH 2VQ1B 4OF6A 2D31B 1MQKL 4MQXC 4EZMA 3GK8L 3STZB 4D3CL 1LP9E 5EOTA 2EYRB 3U82B 4LSSH 4FTVE 5DTFA 3N1QC 4OV6F 1FZMA 3AVEA 4LLQB 2ATKA 1JZ6A 1RFDL 4P3CH 2UYLB 5HYIA 3EDDA 3K2UL 3PWJB 1Q72L 2I5YH 2F8VA 2ZKHH 5DJAA 2OR9L 5AZ2L 2DL2A 3MODL 1HH9B 1W8OA 4JPKL 2VIRA 2AXHA 4O2FA 4YZFF 3WD5L 1ZHNA 4PLKD 3FT4A 2CDGA 3IJSA 2BVUA 3T3PF 3CXDH 4LFHD 5FAAA 4RBPH 4R0LB 4BQ8A 3TBWA 1JPGB 3BUTA 3GNML 1NBZA 2XZZA 5EU4B 3KPNB 3ZKNC 1BHGA 4QXUL 2GYSA 2H32H 4YHPB 4R96B 5J89A 2HT4D 4NQDD 5ESVB 4ZFGH 2X70A 4XPBL 1AIFA 4QRPA 2BNUB 4MQTB 2R29L 5KSAC 4ODHH 5MERA 1XGUA 3HS0B 1OP5H 5ESQB 2ED7A 4A6YB 4XBPB 5TF1H 3G6JF 1B0RA 1FYTA 3VJ6B 1OAQL 1M7IB 2DWDA 1JYXA 4M00A 3MV11 3S3SA 4DEPB 4QRTA 5C0AB 4F37K 2VZ1A 1EGJH 1E4KC 4MNQB 4ZUUA 4X9BA 4M6NL 3I3EA 2EE9A 3QUYD 4HPOH 4HJ0D 4BQ9A 5HJ3B 3U4BH 5I1DA 4UT6H 5CGMA 2HT3C 1U3HB 3J7HA 2XKUA 2DKSA 4HAGA 4LIQE 5DMIH 3B2VL 2XZCL 4LCWE 5TE6H 1JF5A 1N0LA 5K59F 3GSNB 3G6JA 5CMAA 2HN7B 5GZND 5IEKA 2DLFL 5IWLA 3BD4A 1D6EB 2Z0BA 4WUKL 4YWGL 1BFOB 2OL3L 3HKFA 5JXAL 5LQBL 2CRZA 4JM2A 2CR3A 3RDTB 1K5NB 1IKNA 4XWGL 3DYOA 4MDJA 3U46B 3D1MC 2VZVA 1FP5A 2FX9L 1UJ3C 1EVUA 2VZ3A 1A9BA 1EJ6A 2D0FA 3D25A 5JIHA 5FF6B 4NWTH 3QNYB 4X4XB 1XAUA 3HPJA 1K6QH 1YNTB 3BPOC 4OSUH 1IGFL 1AFVL 2OP4L 3C8KB 3TV3H 4KGLA 3VXTA 3BJLA 1H3GA 4N0CC 3PQYA 4RIRA 4OB5H 4RNRA 2VQTA 1DVFD 5TFSH 4L8SA 1JPTH 1T83C 4RBPK 4ZTOL 4HUVA 1AD0B 1A7RH 3ZKXC 1K8DB 3W9EA 1NMBH 5ITBH 5HGHA 3RJDA 2VDNL 3GSQB 3MREB 4ELKA 5JNYA 3BQUD 3ZDXE 1MCWW 3MCKA 3CFKB 4LPVA 4N8VG 5I8EB 4F7EA 1MRDL 3TYFA 5JUEL 1D5MB 1OP5K 5SWSD 4HZLB 3BZEB 2VDRH 1CICB 2B1HH 3RX7A 1NJ9B 2Q87A 3F8UB 3B8YA 1LO3H 3VRLF 1Q9OB 5MENA 4GUPA 2Z92A 3LKRA 3TO4B 1T80A 5IB2B 2A9ML 4Y4FA 3KVQA 1KN2L 4X5XB 2ERJC 1A1MA 2C7UA 3NFPB 5KSAA 1XGQA 4I3SH 2O5XL 4M3JA 2E7HA 1YEDA 4HK3J 1QFHA 4Y16B 4X7TA 1P1ZB 5GGVH 1FHGA 1MRCH 3GMRA 4L8CB 2X10A 3IDNB 4Y89A 1RK1B 5FK9A 4M6OH 3SDCA 5T1MA 4TOYH 2F53B 3D48R 4IRZL 1E4KA 1Q9KA 5AZEL 8CGTA 4NRYB 4YDJB 2XPGB 4MXQD 1ZT7A 3O2DA 2B5IB 5M95B 4MMXC 4CAGA 5HI5C 4HIEB 1G7JB 1T1WB 2HJLA 3SGEI 4YHKH 3QRFM 1XGTA 1INQB 1YPZA 3ULUL 5BMFH 3MGOB 1G84A 3TBSA 1N6QL 5JPMB 4UQ2A 1HHHA 1TVDA 5TQ0L 4D8PB 1FRGL 3OGCA 3PIQA 1EEZA 3L5HA 1WZMA 1DLFH 4G5ZH 2EYTB 5LBSH 5H94B 2V5TA 4PS4H 2XQYG 1ONQB 2ATPA 2BC4A 4AEHH 1RUAL 2Y1VA 1JF1B 2ESVE 5IFHH 3QIBA 3GBNL 2ADJA 3OAUL 1MCPH 1NC4A 1OD9A 4U1HB 1XF5A 2PYFB 1UJ3A 2P43B 3QI9C 1P4IH 1TETH 3KPPB 3TF7C 1DDHB 4Y4KA 1UM5L 3CCHB 3QEQA 5F44A 2VQUA 3F65A 4M8VA 4XVJH 5E4EC 2R2EA 1L6XA 3HRZA 4MNQD 1KPRB 5ISZE 3P73B 3ROOB 3K81A 3T0VA 3WDIA 4DVRL 4N5EC 2YC1A 4PGEB 2AP2A 1T83A 2QQKL 3PGDB 1U3HD 1FO0H 2APBA 3CVHL 1T0NA 1MHCA 2Q86A 5C3LD 2DQUH 1RQ5A 1U91B 4PJHE 2GI7A 4BSJA 1KYOJ 3BAEL 4WFED 5D6CB 1YN6A 4GG6F 4R26L 3DRQB 2RGSA 1YZZA 2OJZL 3H9HA 2A9NL 3QB7C 3TIEB 1J11A 2BSSA 2F15A 1VADB 1NCDH 4LSVL 5DC0A 1JZ8A 3OHXB 1X7QB 3TH3T 4HG4J 4LKXA 3RDTD 2A2QT 4RFNC 1NSNH 2D2OA 2GY5A 4JFXA 2W0PA 4D9LL 1OSZB 1MOEA 3UTPE 3V52L 4MD0A 4YE4H 4WENB 1JZ3A 1NGZA 1JI1A 3OJMB 3TYGL 3R06A 2WLYA 1DR9A 4LVHB 3HR5A 2XN9E 1DEEB 4JFPB 5ABDE 2FYYB 5DURB 1PDKA 4JFEB 4GG6A 4RGOH 2ED9A 1F8TH 4OZHE 4TNVK 5D8JH 1IMHC 1UB5A 5EWIL 4KJPD 2Y06H 1AGCA 3WUWG 3VDBA 1CS6A 1ORQA 1T04A 1ETZA 1JK8B 3MR9B 1KN4H 5ETUB 1RJYA 4OCWH 4Z77A 3O4LA 5CBEB 5CJ5A 4HGKC 3QQ4A 1I3UA 3ARBC 4ODUA 1FVDB 5A2JH 2WK2A 5BS0B 1NEUA 2Y5TA 3S4SG 4TUJB 3LH2L 3HMXH 3VRIA 4YDKH 5DGQA 1JGVL 3RGHA 1CXHA 3GJEA 1HINH 3C8HA 5D7IE 1F3DJ 1A3LL 1I8MB 3P9MB 1SJXA 4PJDF 1VEPA 4U2ZA 3MO1B 4OTXL 3C9NA 1BZ7A 1XCTB 1B0WA 4R4BA 1CICD 1F97A 4RCAA 3MC0A 1L0XA 2EH7H 2UVEA 2YA0A 1KNOA 5DFVC 3TO4D 1I1AC 4P23C 4HWEL 3ZDZE 5INDB 2HVJB 1WITA 4WI8A 5TDOB 2GW5A 2UZYB 1A4JB 1Q9WB 3V7AG 5F9AC 4NQCB 1MUJA 2Q8BL 5LKNA 4YFLI 1TPXB 4LIQH 1SM3L 1YNLH 4NBXB 4FFZH 2I26N 3ZLQC 3V6ZA 1W0VB 3QI9A 4FQHB 2BY2A 4M4PA 3QUML 4R6UA 3PV7A 4Y16D 1IGML 5FUCE 5E2WL 3NFSH 1LQSR 4MZ2A 4GH7B 2J4WL 3QQ3B 4HGWB 5MEPA 1HHIA 1BBDH 3BKJL 1IILE 4LSTH 4Y19A 5EU6E 2F53D 2Y36H 5I0ZA 5CZXC 1RJCA 5ADPH 3VGBA 4ZFOL 4TVPE 3FONB 1KLGB 1L7TH 4DAGL 3NH7H 4NM4H 5E70A 3T08A 5HYQB 3DO7B 3MBEA 1IARB 4LOUD 3BH8B 5AAWA 2ADFL 1YY9C 4MJIB 4OZGF 1OTSD 1UZ6E 1YYMH 2YD1A 3CVHB 3ZSSA 3PHOB 1QRNB 1KCRH 5GGUA 1YEIH 3CFDA 5BZWA 1UXSA 2EIZB 2CLZA 3CLEH 3QHTC 4N8VB 32C2B 1ZT1B 4NN6B 1F3RB 1IC5H 1MCBA 4XAWL 4OIIL 4P9HH 3LKQB 4J4PC 1HYRC 4BFIB 3JTSA 3VFUB 2N4IA 4H1LH 4NZTL 3SPVA 3HMWH 1RMFH 4QF1B 1FDLL 2YD7A 2CDFA 4ODBD 5DQ9B 3BZFB 2PW2B 4JKMA 1BX2B 4LBEA 3LEVH 3X3GL 1IGIH 2DQTL 2FGWL 3PWPB 4LAJH 1C5CH 3QFJB 3V0VB 2OXHA 1I1CA 2V2XB 4LVOB 3W11D 3MV8D 4PPTA 5EBMA 4LDLB 3LPWA 1WCQA 1NUNB 43C9A 3F6IA 5ICXA 3TVMB 4WUUE 3AY4C 5J9PB 2MHAB 1AP2A 1JZ4A 4GAFB 4X4ME 1NAML 3U9PH 4G9FB 1TDQA 4XP6H 1D5ZA 4GAJH 4TSAL 2BRRH 3ZO0A 2E7LC 1CT8B 3ARBA 5IMOB 2CPCA 3VFMB 3KDMB 3MZTA 1SQ2N 4TVSa 1MQ8A 2Z31D 2H2SC 3OKYA 1IAKA 4LGPB 4ZNEE 2J12B 4MB3A 3RWFA 1RZJH 2H2PD 3DNKA 3F5WB 2H8PA 1T22B 4WW2B 1B4JH 5FO7B 1X4XA 3CLFH 3K46A 3DI2B 3VFTA 1WISA 5JA9A 5FCUH 1S7TB 1CDHA 4XVUC 2XZAH 5CINL 1I1AA 4P23A 5KJRL 1N7ML 5ID0B 2XFXA 1E4WH 5DURD 1LE9B 4JFED 1MCLA 4AEEA 2UY6A 2FX7H 4GRWE 3IU4H 5DHVB 4G6JL 4ZQKB 5IJVB 2J8UB 1JP5A 3MMEB 2CRYA 4XP1L 1K4CB 1MJJB 1WTGT 5FDYA 3MROA 2DBJA 5KBNC 1RZKC 3V6OE 4MDIB 4GBXC 4DGIL 5GZOC 1H0DA 3F12A 5SWSE 5BS0D 1AD9B 1CGSL 4X7SH 3CU7A 5HYJB 1BBJA 3HNTL 1RJLA 3FOLB 4OFDA 4KPHH 1A7NL 2PCPB 2Y7QB 6CGTA 1F4WH 3F7YB 4M4RA 1H15B 4YXHL 2VITA 2YMXL 1JGUL 1HYSC 5MI0C 1VSCA 5D71L 2EDHA 5GJTH 1CXIA 1QVOA 2NY6B 5GRUH 1GGBH 2YK1L 1PFCA 1A6AB 1GIGH 1FIGH 1KB5A 1S5HA 3ULUD 4FZ8L 4JZOB 3QHFL 2IAMC 3X14B 1CGUA 3S9DB 3LQAC 3T0WA 4J4PA 4FFVD 2Q7YB 5LVEA 5HI4C 5C08B 5IIEB 5GSVB 1ZEAH 3FQNB 5J11B 4UT7H 1O5DT 4NQCD 4U1JB 1LO0H 4AEIH 1HQ4A 1UENA 2ICWI 4DZ8A 4J2XA 4FFYL 3LRGA 2LV4A 5I76A 3W39A 5MEQA 4D0CA 1VPOL 1KC5L 2FH8A 3V6FA 4LCCB 4Z8FH 3WUWB 2R39A 4RFEB 4YUEH 3MRJB 1KBGL 3HG1B 3DMMC 5JMRA 3AY4A 1U8OB 2LVEA 1ZWIB 2K1MA 4PJ9A 3D9AH 3AC0A 3WLBB 2OR7A 3ARDC 2DTMH 1EDQA 2X42A 3LSOB 5D2NB 4K7FB 2P1YA 4KTDL 4OGAC 5C0ND 3WFDL 3IDIA 4HK0A 2PO6B 4MB5A 3S4SB 3ZE2E 2E7LA 1TVHA 4L4TE 3ARYA 3DXAB 3EYVB 4MJID 5CEXB 5CZKA 1QRND 2VAAB 1MAMH 5KS9E 3AAZA 1GGUA 5BQ7B 1N0XH 3ZL4L 2ZOLA 1SYVA 5GGSB 5ANMB 4L9DA 1QLRA 1ADQH 2XTJB 4JRYA 4ODXB 3QSKB 1DBMH 1IEHA 1FC2D 2GT9B 1CLZH 1CWVA 3BHBB 3PWPD 3STBA 5JW3H 3TO2B 3FQTA 4MNQE 2PF6A 3QFJD 2MPAL 5CKAA 4XNZC 1J10A 2DM7A 1JNNH 2Z8WC 3ZE0E 1BAFH 3LKNA 1SBSL 4ONFH 1TQBC 3LZFL 3TVMD 3Q5YA 5F1IA 3T0XA 3C5JA 2AK4B 3PNWA 5C7XL 2YD9A 3EO0A 4LLUA 3GMMA 3GI9L 5F9DC 1RUQL 3TBTA 4G9FD 5T1KA 2PTVA 4KZEL 2I60L 4GMTH 4XP4L 2E5EA 4ZUVA 1C8PA 4OD3H 3SO3C 3SDDA 4GBXA 4Q2ZB 4YO0B 4KZDL 1I3RB 1Z9SA 3CC5A 4R2GC 3G6AB 1MI5E 2ZNWA 3O3UN 2ICWB 2UWEF 4RGNE 4Z18A 5JHDE 2YD8A 2XA8H 3GKWL 5I73B 5KSBB 2R0WL 4LQFH 5DRXA 3RPKA 1CFNA 1M4KA 2AJVH 3G04A 4RMVA 3NACL 4EI5B 4QRUA 2ICWJ 2MTPA 1XZ0B 3P30H 3RNKB 2VXUH 2ZG2A 4MA8H 4F7PB 3VGGA 4M93B 3E1F1 3HAEH 1BQUA 1QHOA 3X11B 3CDGA 1DL7H 3RAJL 4O4YL 1WWWX 2WP3T 4NO5B 4DKFH 1SY6H 4TVPH 1I9IH 4F58L 3OR7A 2UWEA 1EO7A 4XGZA 3EKCA 4F15C 2NMSA 4IMLB 1YN7B 1Y0LA 4RA3A 5JZ7D 4WTZG 4U6HA 4QRSB 5GS0H 1ZOXA 5FYJU 4Y5XC 5CUSL 1AGFB 5MP6H 3BE1H 4AENA 4E5XA 2BVPA 3S35L 4PYHA 3EUUA 5I19H 5D5MF 1KELH 3DMMA 3DVGA 5HYJD 3RGVC 3V5KA 2FJFA 3K3QA 3VFVA 3RIFK 3TJHC 4XHJD 3HC0B 3ARDA 2ZUUA 3EFFB 4MXWH 4X4YA 2GTZB 1SEQL 4M61A 4PJCB 4Z0BL 2DI7A 2C1PB 3HI5L 2R2BA 3SDXF 3ZT5A 4K3GA 4FNLH 5IV2A 1K2DA 2NY6D 2P42B 4UB0H 4PJ7A 3BYTA 4CNIB 3KLSA 2FL5A 4UIKH 1JTOA 4YDIH 4R97B 5ALBH 2WSKA 4NSKB 2JIXB 5C08D 1P9MC 1W72L 1I1YB 2R1XA 1O0VA 3B2UC 3FFCE 2VTFA 4HK3N 4OF5A 3EO1A 4X6DB 1GC1L 2QQNH 3P9LB 1P4LA 2F53E 4N0UE 4F9PC 2C5DC 1RUMH 3C60B 3X13B 3SDXA 3GSXB 2VXVH 3RKDD 5D7LB 3EO9L 1S7UA 4FZEH 1CXEA 4XHQA 5JHLH 2B39A 2VXTH 3CDYA 4GAYB 1RAMA 3AFLA 1G7IB 3DX7A 4XMLL 2CIKB 5ADOL 4G7YH 3HG1D 2X89A 4Q6IA 2OI9B 5ENWB 2JCCF 3SKMA 1UCTA 5JOPE 4NRXB 1FBIH 3GBMH 3ALWA 1URLA 2W9EL 1T2XA 4TRPH 4WFFD 5F8QC 3WHXA 1PG7H 2PO6D 4IOFD 2DKMA 4WDIA 3DXAD 3DUUA 3L5JA 1INEL 3L3OB 3BP4A 5E8OA 3OJDB 1N5AB 4PUBL 2EDJA 2P49B 1JE6A 1QKZL 2C4FU 2JB6B 2VDLH 2XOTA 1KF9B 3QNXB 3MFFB 5F88A 1H3WM 4P9MH 4DQOL 3WIFB 4P59L 3V0WH 3QDAA 2XTJD 1AGBB 4U1SA 4Y2DB 2RCSH 5DMGD 1AGDB 3CSPA 3MV8E 4PJFB 3VMOA 5IGXL 1MCWM 1L7IL 4H25A 1MCJA 3HPLB 4JFDA 3TNMB 4JR9L 1N3NA 4RMSA 3RZCD 5DRNA 3MX0A 2YSSA 4OLWH 1YNKL 1QD0A 3DX9B 4L5FH 3EYQD 3LS5L 5EORL 2Z4QA 3O8XC 1MHEB 3HRPA 2YBRA 4X7FC 5I1EL 3T0DA 3MJ7A 5IJKC 4M6MH 3RWEA 2IQAB 3QDMA 5SWZA 2AK4D 4I0PB 4FFWC 5KVFL 4WHYG 5DK2A 5LJYH 1NBVH 3I6GA 4LPUA 1HILA 2WUBH 3KWWB 4Y5XA 4LCYA 1AHWB 2VABA 3VCLB 1X5LA 4U6TA 2Q20A 1PYWB 5CJOL 2Y25A 5GHWH 1R0AH 2G2RB 2V5YA 3NA9L 3RNQA 4ORGB 4KQ3L 1RURL 3UTQB 4OCNC 3RGVA 4LLMA 3O9WC 4OLEA 4WU7B 1QSFB 1G6RL 2VISB 3VWJB 5JXED 3JWDC 2AJXH 4JN1H 3QPXL 5IMLB 1FE8L 3ECBA 1VFUA 4Y8DC 4EI5D 4JFEE 5C8JB 3MOBH 1T1YA 4LPYA 1FFNA 5A16B 4NNXB 3ZT6A 1CLYH 5C0JA 4Y5VB 3IDJB 1FFOB 4ZSOB 1PZUB 3ZTJG 3IF1B 4ISVB 3MRPA 2XKNB 15C8H 4YR6B 1EMTH 1V3LA 3AS0A 4HHAA 1P9MA 3TCLB 3MJ9A 3FFDA 1MNUL 2YA1A 3ZYZA 2F58H 1T20B 3TT3H 5C0BB 1W72B 2DD8H 4QRRB 4F9PA 2EDEA 4PJ8B 2IH3A 2V2TA 2BSRA 3RY4A 3RIAK 5HVGB 3BXNA 4AM0A 3S37H 4HIXH 1DFBL 1FG2B 3IDYC 3UZVB 5FV2A 3W2DH 3O6LH 2IANA 2HTKD 2IPUK 3HCVA 3P4LA 4FABH 4J7RA 3REVA 2A77H 3FQXB 4MHHG 1XH3A 4ZXBC 2BSED 2R9HC 4FQIL 2DI9A 4S1QH 2BY1A 3FHAA 3ULUE 2VDKH 2OM5A 4LHUG 5EA0H 3RWJA 3D18A 1OLLA 2FR4B 3MRIB 3I02B 5A2KH 1CGVA 1MWAA 3UPRA 3CIQA 2QADB 3EDEA 4UOJA 5ITFA 1TQCC 1DQMH 3Q6GL 4LCWA 2IPKA 1QSEE 4KI1A 2JIXD 4QCIB 5KVDL 1SJHA 3HZMB 5DJYA 1MFAL 2NY5C 4R7NB 2BHUA 3CZFB 5KTEL 3L3HA 2RR3A 1V7MH 4YC2C 5I74C 4O2CA 3C60D 4JY6B 5D7LD 3K8MA 2HKHH 3O8XA 3ILPA 1NCWH 5HGAA 4YDLB 1BQHG 5DD1L 3K7UA 3FMGL 1R3LB 5IJKA 1CYGA 3T4YA 2MJWA 4OKVB 3OF6A 4ALAL 2V6HA 3GMLA 4FQCH 4P5KB 5EC2A 1QRNE 1TZHB 3GMQA 4RAUA 4ONGH 5JORB 1R5VA 1WEJH 3FQUA 4FS0A 4KROC 4JN2A 3DROA 1R3JA 1IL1A 1DUYB 2R4SH 1ZS8A 4K23L 3VXSA 3NIDE 5GRYA 3NCBB 3BIBX 4ELME 4D3CH 2YXFA 3FT3B 3VFGH 3ULVH 2BMKA 4HCRL 1BJ1H 4RGMB 3VDCA 4DN3H 5KZCB 3MXWH 1FCGA 1CR9H 3EZ8A 4UNTA 5T1LB 2OZ4H 2HJKB 2DDQH 4FQLL 3PWPE 5EZLA 1G9ML 5EU7E 4M1DL 3A6BL 4XI5C 5DWUL 1TVBA 1Q72H 4I18A 3GIZH 4YGVB 3HE7D 4Y2DD 4OI8A 4JZJC 1G6RB 4EBQL 1KGCD 1UA6L 1OGAA 1S8DB 2A0LC 5DJZB 2NY4B 3FO9B 1DBJH 4PV8B 3KPLA 5E8DH 2QQQA 3WO4B 3I6LD 5KVEH 1F4YL 2Y72A 5DSCA 4PG2C 1UB6B 4OBSA 1INDL 3T0EC 5AG9A 4G9FE 4S1RH 1EJOL 1K85A 2IWGA 2WIMA 3STLA 3T09A 3C6LC 2IEPA 5EG6C 5EZJA 4H5SB 4I0PD 3QXVA 3KYNA 4TPRL 4XNUH 1EAJA 4G9DB 3OX8A 4KJWD 5EN2A 3T77A 5DD0L 3NCFB 4KQ4L 4C55A 5I30L 2OX5A 4P2RA 4LL9A 4HUXA 3A0OA 4XPBH 3DX6A 1KTLA 1XIWA 4QHKI 3V5DA 3C6SB 5IOPA 1L9MA 3FB8A 1QSFD 2ZSVA 3PWNB 2NY2C 3VWJD 4ZXBA 1F2QA 1FGVL 2ZJSH 5BVPL 4UAOB 2XYCA 3KG5A 4AK1A 4RZCB 2E7CA 1CIDA 1FNSL 1JMZA 1NUGA 4QTHB 2WUCL 5A2IH 1U8KA 2NX5B 5T33H 4BUGA 5CEZL 2B4CH 3VXUD 1TCMA 4PB9H 3RUGB 4JHBA 1YMME 3SCMB 1BQLL 4AL8L 3UBXG 1GGCH 1WCBA 5FHAL 2X4SB 5F7MC 2RIKA 1F5WA 4LNRA 1QLEL 3B2VH 3L5IA 3B9DA 4MHHI 3PP3H 3BPCA 4GKZA 1W0WA 2DS4A 1HQRA 3KPMA 5C0BD 2VMFA 2ZUQC 3LKSA 4GG8A 4QRRD 5C0RL 3LKOB 2YUZA 4PJ8D 2IGFH 3PXHA 2PXYB 4XCYA 3REWB 4ZG1A 2OL3H 4N0YH 4WO4D 5EC1A 5F89B 3BD3A 4XP9H 2R0LH 4PJHF 4Z78A 4U6YA 1T5XA 1KIPA 4I8DA 5JOFA 3E6FA 4WI5A 2Z8VC 2AKRB 4PLKC 4JKLA 4O2EA 2QHRH 5EO9A 3B83A 3QUZA 5IEHA 4B0MM 4RDQF 3QUKA 1IEBA 3K1KC 1Q0XL 1OW0A 2R69H 1NL0H 2GJZB 5CLWA 3FHQA 4DN4L 1AFVH 4NQVA 4M7JL 3QA3B 3SBWA 2QADD 1IGTB 1GGTA 4WVRA 5CSBA 4K3DH 3TFKD 2HT4C 4P48A 5GSRA 2F54E 4J6RH 4ZTOH 1ITCA 5FFLA 3K8LA 3L7EA 1UWGL 2XNAB 4JFFE 4X6BB 1FSKB 1AO7D 4PR5A 3DTXA 3QXDA 1ULVA 4OZHF 2HWZL 5DZNA 4X6FB 3MLUL 5IFJA 1A5FL 4Z7QE 1N2RB 2Z8SA 1RIUL 3VFOA 3HG1E 2XACC 1S7QA 1FFPB 1Y18A 3N9GL 3KAAA 2VDQL 4QHKJ 3OKKA 4WNQB 3T0EA 2VZSA 4APQB 4M1GL 4ODSH 4WFFE 1WFTA 3C6LA 1JVKA 5AEAA 1YEJL 1KEMH 1NUFA 3OKEA 3RWCB 1CFQB 3SQOH 1EFXA 3QUYC 4OAWB 3UTTB 1FAIL 2ZNXA 3ARGB 4DK6A 2DQIH 5D7IF 4HLJA 4OZHA 5TQ2H 1T1XB 2HAZA 2BJML 3TPKA 5HVHC 3I9GH 1RULL 5ANME 4MMZC 4YBHA 1FGNL 3RWDA 4OGZA 3WE6A 5T3XL 2OMBA 2XTJE 5GZNC 1E28A 4UV7L 2DM3A 1JNHB 5KZCD 2LABA 5T5FL 5T1LD 4LHUB 1U8HA 3M1BB 2WV3A 1I7RB 3RQ3A 4XCFL 1IGJB 3BKML 4RWHA 3WXWL 2DTSA 5DA4A 1H3PL 2Z93A 2MWCA 4DFIA 1G7PA 4JFOA 4K94C 1IQDA 1QFOA 3DOSA 35C8H 4QT5B 3UYOD 3C5SA 2AK4E 1PG7X 4X7CC 1DQJA 3LIZL 4QHLA 3G08A 2CJUH 1TZGH 2AJ3B 3VXMB 2BX5A 3CNKA 3O3EA 2W60A 4Y7MA 3IFLH 3JWOC 1U8JB 4HKZB 3QXWA 1FRGH 5DUMH 1DVFC 4H8WL 5GGRB 3ZE1F 5FYKL 4NQEE 4UQ3B 4M3KB 4HWUA 1UZ8B 4E9LA 4I4WA 1B88A 5KSBE 1M7DB 3UBXI 3U4EB 4MA3A 1VFBB 4NCC2 4PV9B 4QEGA 2A6DA 3BQUC 3VFWA 5HBBA 5CSZA 4YIQB 5DR5L 3DV6B 5DUBA 3T2OA 4FQQB 1NBYA 1UM5H 4MNGA 3ME0A 4U0QB 5GRJL 5C09B 4Z7NE 3MLZH 4P5TB 4GLRH 3RU8L 3T0BA 4K7PL 3BIKA 5EOTB 1RZGA 2J5LB 4J23A 2DQGH 5EBLA 4NQDA 4IDLA 2QQKH 2ATKB 2IH1A 5H37G 5TPWL 1RZ7H 2AGJL 4E41A 9CGTA 2P5EE 1GGYA 1S9KC 1BIIA 1Q8MA 3T1FA 1OAKH 4R26H 2BSTA 1B2WL 4GT7A 3UEZA 2NTSP 2PXYD 2EDYA 4JRXB 4CVUA 3KHQA 1Z5LB 4ZYKB 2BP3A 1D5IH 2VLME 3E6HB 2DICA 2J6EH 4OCYH 1NBZB 4NKMA 4MXQC 4RAVA 5FOBA 3F7RA 1ZLSL 1PLGL 3TYGH 2A73B 3C5ZC 4P4RB 4R8WL 4UMGA 3RVUD 1LE5A 1K8IA 4JFQB 3GBLA 2OSLB 3FB7B 5F97E 2OQJA 4R0LC 3D0LA 1HH6B 3FCTB 4P2OB 2CO7B 3KPQA 4NFBA 2V7NB 1ZGLP 4JQXC 4KWUA 3CU1A 3A6CH 5CP3A 5FECA 4CMMA 4QHMB 3BGAA 2XG4A 1YA5A 1P2CA 3S37X 2AEWA 4GW1A 2D9CA 2FATL 4LEOB 5AWNL 3RIAF 1MH5B 2H6PA 5D7LE 3DWTA 2BXYA 4GRWF 1EBAA 2DWDB 3U9UA 3VWKB 3WIHH 3UBXB 1O7SA 5EIVA 3O2DL 4WRLA 2IG2H 2GITA 2X4RB 4RMTA 4ZUUB 3EJYD 4LLYA 4KHXL 5H2BA 3U0PB 4PGCA 1WBYA 3SJVA 2YKLL 3KPSB 3BZ4A 1C7TA 3H3PH 4APQD 2FX8L 4JG1H 4OTXH 2DMCA 1IC7L 3IDGA 4NYLA 4WW1A 1G6VK 4DEPC 1LEGB 3IFNH 4HS3A 2A6JB 3G6JB 5CMAB 3UTTD 3MJ8A 1MCRA 1DVFA 1SJVA 4F7CB 3DIFB 4LSQL 3ARGD 3P77B 2HG5A 5BXFA 1PY4A 5E99L 5TE7H 2AEPL 2NW3A 1OAXH 3LRSA 4JM2B 3QO1A 2WNGA 2GJJA 4PRIA 4LAQL 1EFQA 1E4XL 4L29B 4MDJB 1D5BA 5CD3A 3KNBA 4HC1A 8FABB 4M7LH 1EHXA 1EO8L 3BQUA 4LHUD 3QUMH 2EIDA 2CLRB 2K3TA 3I6LE 3MXVL 3GJFH 3VFSB 5HGDA 3KS0J 5SWSA 2J4WH 3RDTC 1LHZA 4E0RA 3LOWA 3ES6A 4IJ3B 3P0YL 1NCBH 3SGDI 2HFEA 1XGRA 1TCRA 2L7JA 4YLQT 5DD5L 4NNPL 5IB4A 3QEHA 1AQDB 5D1QB 4BM7A 1CU4L 3LQZB 4RNRB 5CEZD 4L8SB 1Q0YH 4HUVB 1TJHL 3LDBB 5GQBA 3VXMD 2D31A 4KJPC 3STZA 3MV7B 4AT6B 5FO9A 1QACA 4FXKB 4H88H 4R4FL 3O45B 5HGBB 4LLQA 1WWAX 5JPNA 2UYLA 1KFAH 2VLRD 2LTQB 4ELKB 2HMID 4WU5B 4I77L 1FZKB 1NGQL 3CZJA 2LQRA 1Z9LA 4FRWA 1DLHA 4GXVH 4F7EB 5E2TL 12E8L 3TYFB 3OKLB 1ZGLA 2EEBA 2FB4H 1JI2A 1HH9A 2X9WA 3UJTL 1WLHA 4BSWB 3L9RB 2K7PA 3VXUE 4HV8A 2BCKA 3ULSA 4LHQB 3JV6A 3BH9A 3C5ZA 2Z92B 4Z7UE 3SE9L 2BVYA 5E95B 4HBQA 4GRMB 4Y4FB 1CICC 4OJFL 1JPGA 5C09D 5EU4A 3KPNA 1I9RL 4P5TD 3M17B 2M8XA 5D7KE 2UUDH 2UVFA 1X6LA 3TO4C 5C0BE 1NAMH 4YHPA 1YEDB 3PJSB 4Q9RL 5ESVA 5DQDL 5EUOB 1LMKA 2ITCB 2HLAB 2C3WA 2G60H 1T66D 5DZLA 1ZHBB 1VDGA 1U6AL 2BNUA 2D7MA 2BFVL 5GRVL 3SDCB 5ESQA 4XBPA 2E27H 2X4QB 4Y16C 4JRXD 2IFFH 1FNAA 4NZRL 1E6OL 3GB7B 2NY1B 1A3RL 1KENL 5GIRB 1M7IA 3WEXA 5DJ0A 2HJLB 2DLIA 1HWHB 4RISL 5C0AA 2XQBH 1DUZB 4KI5D 4S0TD 1YPZB 3DBXB 3PDOB 1JYVA 3GJFK 4NZDA 1HHHB 2RAMA 5HJ3A 1AXTL 2B5IC 2R4RH 2EO9A 3VXQB 1YDPA 4KDTA 5A1AA 1HXMB 5FIEA 1IT9L 4M7ZB 3S34L 4D0DB 1OTSC 2BC4B 3GSNA 2HN7A 2ZUVA 4P2OD 2DOCA 1GAFL 2BXZA 5IHZB 1AO7E 1X5FA 3QIBB 1CXKA 3CH1B 5T3XD 1D6EA 3B6SA 1BFOA 3MRKB 4Y4HA 5GGTL 1KTDA 3GM8A 4XVTH 5DEZA 4Y4KB 1MCKA 3K4AA 4X9FA 1K5NA 1YEHL 3QEQB 5D7SL 3LKPA 4Y5YA 1ZK9A 1RD6A 3U46A 4KRLB 3HRZB 4EQ2A 1BREA 3MBXH 4UOW0 3QNYA 4G43B 4X4XA 4KUZL 1YQ2A 3W11C 3MUGB 1EXUA 4TTDC 2NXZB 4YPJA 4EIGB 3C8KA 1RV6X 2ICES 2Q86B 3SN6N 5D71H 5DLMH 2JF1A 4RQQB 1QFWL 4DGYL 3VGEA 4M9PA 5BCAA 1N59B 4FZ8H 3CK0H 3QHFH 4JPVH 4OLYL 4XCNB 3H9HB 5HTSA 2ICEA 3BFOA 4OZ4B 3QHZL 4OF0A 4LVNB 2NPLX 2BSSB 3V4UL 1VGKB 3LV3A 4ZTPL 1K8DA 2XXMB 5FYKD 5C3TA 1A6PA 4JM2D 5IVZA 4CBPA 1RIVL 3TT1H 3ROLB 3GSQA 2B0SL 5D70L 1EA9C 5DEFB 4MD0B 5CZVL 3CFKA 3R06B 1HNGA 4A2LA 3HR5B 4NGHL 3UYRH 1D5MA 1I7UB 4OZFB 3BZEA 1CICA 3S98A 4U7SA 1UB5B 2WIIB 3H3KA 4S2SA 1Q9OA 5CCKL 1UEMA 5ID1B 4LVHC 4PJIE 3TO4A 4NUJA 1DJSA 1SEBB 1QFWI 4U49A 4KTDH 4YQXH 3GHEH 4X5XA 4XNQB 2AI0L 3LAFA 1E6JH 4HMEA 3NFPA 3MV7D 4LASH 1BECA 2DQHL 4F7MB 1UCBH 3VRIB 1JZ7A 4Y16A 1P1ZA 1NMAH 3ZL4H 3E8UL 2WWKT 4L8CA 4R7DB 4U33A 3IDNA 1JZ5A 1M71A 4NPYA 1RK1A 2KZ1B 1XF1A 5BV7H 1C5BL 1KUMA 4LSRL 4HXAL 3UTSA 4JAMB 4NRYA 4YDJA 1NDGB 3WNPA 3MLWH 1L6ZA 2XPGA 4IM8A 3LEYL 2QQLL 5MEND 2YD3A 1KNOB 4MCYB 1AY1L 2CGRL 3D39B 4D9QD 4HIEA 5IESH 1G7JA 1S7XB 1T1WA 4Y4FD 5T1DH 3MLRL 2F5AL 1SBSH 3MGOA 1WFUA 4Z6AT 4Q9QL 3LZFH 5ACLA 5JPMA 1CBVL 1DN0A 4D8PA 3ULUC 3O0RH 5C7XH 2EYTA 1OWRM 5H94A 4LARL 3TWCH 4H20H 4O51B 2YHGA 2H32A 3EDJA 4P3DB 5I8OL 1JF1A 4Q7DA 5MEPB 3SDCD 1TPXC 5GISH 4U1HA 4G6MH 4G6FB 4W6XB 2W91A 1WFNA 1MFEL 1MJUL 1QYGL 4OM1L 5D1XB 3GKWH 4PFEA 2NY1D 3CCHA 1NCCH 3HI1B 1IM9A 3MBEB 4NFDA 3L3JB 3I2CH 2EDWA 1KPRA 3P73A 3ROOA 5JLZB 4NRZB 5GGUB 5J56B 3CFDB 3I6KB 4PGEA 3PGDA 5C0NC 3HA0A 4PGZA 4O4YH 1UYWH 4KDVA 2QJDA 4LDEB 4BA8A 4PJGA 5D6CA 5C9KA 1PKQB 3QIBD 3IETB 4G7VH 1EX0A 4GRLB 4NN6C 3TIEA 4D9RD 4PLJC 4N9GB 4JJ5B 2A83A 3TESA 2UZIL 1X7QA 3U6RA 4YHIB 2B2XH 4Y4KD 4NQSB 5EBMB 2E9BA 3QEQD 1JN6B 2DQDH 4KMTL 4OFYD 3S35H 1I8IB 1UGNA 2FHFA 3N85H 3T65A 5F7EH 1DEEA 3UTTE 5GGSY 4LVOC 3QBTB 4PP1C 5AAMA 4M7KL 2DIAA 4MAUH 4KRMB 3EGSB 2NXZD 3HI5H 5E2JA 4HIIA 3UO1H 3TVMC 4QTIL 3H42H 4ENED 4OCLC 4LU5L 1ZANL 3MR9A 1XMWA 2Q8AH 4HS8H 4ZNCD 1OL0A 4WHDA 3MLYL 1QLFB 5CBEA 3ULUF 1IAKB 1DQTA 3NCJH 4CW1B 1UWXK 5LCVL 3HLAA 5BS0A 4JG0L 4TUJA 3ORJA 1EZVY 3GSRB 4UNVA 1F58H 5CGTA 2ZCKH 1I8MA 5C86A 4MB4A 4M62L 5CEZE 1XCTA 2NY3B 4WW2C 1JF6A 3VXME 1BZ9B 1KV3A 1B90A 2BNQE 3CFEB 1XF3B 5BRZB 4L9LA 5INDA 2HVJA 5TDOA 4FG6C 4FQXB 4RRPA 1A4JA 1Q9WA 2HYMA 2VLRE 3G5XB 3MROB 3SOBH 4MLIA 3O4LD 1ACZA 4RX4D 1AH1A 4NQCA 3BP5A 2XWJB 4JFHD 2WQRA 2W59A 5JZ7C 1W0VA 4FQHA 4JVPA 1RJLB 1JPSL 2PKDA 5I1IH 2X1XR 1T7VA 5FGRA 4DQOH 1WBZB 4P59H 4HGWA 2X4OA 4NM8L 5KVMC 4UINH 5IVXA 1A2YA 1OQOA 1QVOB 1N5YL 1J1PL 4XHJC 1N26A 1IFHL 5ACMA 5EO1A 1S5HB 1MHPL 1GZQB 3FONA 1KLGA 3D39D 1LGVA 2ZOKB 2DB8A 4KHTH 4XPAH 1MHHB 5HYQA 3DO7A 3LS5H 4UV4H 4PBWD 1LK3L 3H9ZA 2CUHA 5B38G 2FBJL 5E4IA 4MJIA 2O61B 1DP0A 2BK8A 2NY6C 3PHOA 1VCAA 2EIZA 2HFGH 1YEEL 3OJ2C 5FM8A 4N8VA 32C2A 1ZT1A 1HQ4B 1TJGL 5DHXB 4DZ8B 4ODTH 2HFFB 4JO2L 5IKCB 3D85B 4BFIA 3W39B 1DEDA 5J11C 1C12A 3SE8L 4HXBL 1HOCA 4JHZA 2E3VA 1JRHI 5F7KC 5DQ9A 1TNNA 2PW2A 2CLVB 3BZFA 4G6FD 4KQ3H 4KI5E 1KCVH 2X4UB 4OI7A 3QFJA 4PJ9B 5DA0B 3V0VA 3RKDC 4KTEL 2V2XA 4YFLF 2W65B 3KJ6L 1EEUA 3RVVD 3O2WL 2EDKA 3UCRA 4JVUA 3GO1L 4LCCC 4M1CC 5EZOL 3MBED 1I3GL 3IDIB 4HK0B 3KLDA 1MJ8H 4UNUA 3TVMA 1J0ZA 2AABH 2AK1L 1KPUB 4N1HB 5FYKU 1RUKL 5IMKB 4QRPE 2FJGB 2MHAA 5J9PA 4WW2F 4YZFE 1NMCB 5D2NC 2V7HB 2ZOLB 2Z91A 5T3XE 3T2QA 4XAKD 2PO6C 1HDMB 4HWNA 4C4KO 4IOFC 1CT8A 1FYTE 4JRYB 5IP4A 4HPYH 1WC7B 2WQ8A 4IDJH 1P84J 3HHRB 5IMOA 3VFMA 3KDMA 1WV7T 4GRLD 2J8UF 3O6ML 7FABL 1QFUL 4GQPH 4MCZB 2XTJC 3VI3E 1IEAB 5C0IA 5DMGC 1UM6L 1T22A 3CJJA 1DFBH 4WW2A 5FO7A 5B3JE 2VXSL 3CMOH 1BP3B 1PEZA 4L4JA 4OF3A 3NVQA 1S7TA 3G6JE 4TNWK 1HI6A 3PNWB 5LGJA 4LLUB 4FQIH 5ID0A 3GMMB 3EYQC 1LE9A 5T1KB 1B9ZA 4ZQKA 1PY9A 5IJVA 1TZIB 3BD5A 2J8UA 3SDDB 4XNYL 5FYKE 2GFBB 3CGTA 3NABL 5DUPH 5HDLA 1MJJA 4HUKB 3HNVH 5L88H 4MDIA 3VGDA 1AE6L 4G80B 5DRXB 1X6NA 4AG4H 5K59E 1CFNB 4YEFA 1AD9A 3PGCB 5HYJA 1CK0L 1KIUA 3FO0H 3FOLA 5E08H 2HRPL 5JXEC 1I85C 2DLTA 2DKUA 2M1KA 1I1AD 3PQYE 4PRAA 4LLWA 2Y7QA 3RL1B 2FD6H 3HMXA 3F7YA 1AXSB 1D6VH 1H15A 4IHOB 1S5IL 2NY3D 4EI5C 1F3JB 3W9DB 3FMGH 3EOTL 3R4DA 4XPHL 4M93C 4Z7QF 4K9EH 4JZOA 4Z95L 2NY0B 3ARSA 3X14A 4CVXA 4X0KB 1AQKL 5BVJB 2Q7YA 1BQSA 4LSUH 5C08A 5IIEA 5GSVA 4ZOCA 3FQNA 4U3HA 1T2QL 3WJLC 3KXFA 4E5XB 3S88H 4Q9BA 1N4XL 4PB0H 1ITBB 4JRWA 3RJQB 3DVIA 4YHYB 3R1GL 1KJ3L 4CKVX 3PP4H 2AEQL 4JQIH 5BO1L 5MENE 4X4YB 3WUWA 4RFEA 4NO0A 5E0QA 3U0WL 4D9QE 1NFDB 4AJ0A 3MRJA 5FA3B 1PEWA 1P7HL 1KJMA 2HTKC 2EKJA 1U41A 3WXVL 1ND0A 2AAVA 3WLBA 4PJ7B 1EHNA 4OT1L 2XWBA 1P6AB 5D2NA 3NTCL 4K7FA 4XRCA 2KQNA 1S3KL 3MJ9L 3WFBH 2PO6A 4WY7L 3S4SA 3DXAA 3EYVA 5CEXA 1J1OL 3FO2B 1VKXA 2VAAA 1TENA 4I9WD 5BQ7A 2C3VA 3EO1B 1A21A 5HHQA 4R97C 3WDHA 5GGSA 3IFPA 1SMAA 3D85D 1U95B 1S7UB 3V6BR 4OQ1A 4ODXA 4XCCL 2P46B 3NCMA 4X9HA 3CXHJ 2VO5A 2BVOB 4OLXL 4PBXA 4MJ4A 5SV4A 4OQTH 1CI5A 4Q6IB 2LAGB 3BHBA 4FXGB 1YPZE 3TO2A 3C60C 5C0DB 5M7QA 4PJ9D 5I17B 4ZFZA 1IGYB 1MJ7L 3WHXB 1CZ8L 4XBEH 3U48A 1F6AB 2MFNA 3BPNB 3OKMB 4NWUL 3S97C 2OI9C 3EOBB 4WDIB 5KSBF 4NUGH 3DUUB 4HUWB 2R0ZH 2VH5L 1NGWB 1IKFH 1ZVSA 1BQLH 4HWBH 4BFBD 2D03L 5CIPB 5FHAH 4D9RE 1FORL 4JRYD 1TITA 2YPVH 1I3RA 1A6WH 4LCIH 3MNWB 1I9JL 3B9VA 3G6AA 3AB0B 3QEQE 2Q1EA 4H25B 3RWIB 2XT1B 5JXEA 4O9HL 5B38B 3ZTNH 3UJIL 2KBGA 4M5ZH 2XICA 43CAA 1Q94A 1HHKB 4Y2DC 2Z4QB 3GI8L 4EI5A 4XVSL 2F9BT 5F3HA 3MV9B 3BEWB 4F7PA 4KUCD 5SWZB 1CGXA 3I6GB 1HILB 3X11A 2VNCA 4C83A 5T1KD 2VSCA 2UV3A 4UTAH 4NO5A 3WJLA 3EFDL 4PJCF 4PJEB 3SDDD 4UDUA 1T0MB 3RNQB 1MFCH 3VXRB 2X44D 4I0PC 4IMLA 3C87A 3MJGX 3JWDL 5C2BH 1KCUH 4KJWC 4QRSA 1AHWC 2ADIB 1AGFA 3QT2A 3S35X 5JDSA 1QTYT 5D96B 5I18H 1PZ5B 1F90L 4WHTB 1NFIB 3ECBB 3HZVB 3MOAH 2HA1A 3V4VH 3RX8A 4K8RH 2IJ0C 4GG6E 4ZAKB 2EYSB 1JGLL 1OPGH 2YWYA 3KGRA 5M94B 2H3NB 3VWJC 2I9LA 4X6DF 3EFFA 4LEXH 4NJ9L 1NCAL 4PJCA 3W5NA 3JTTB 4GQ9H 4KKCD 3WFHB 1I1FB 5HI4D 4M1GH 1YY8A 1DE4A 2ZCHL 3O4LE 2MQ3A 1BD2B 4Y5VC 2NY0D 4CNIA 1ZKAA 1TTFA 4JFHE 5DQJA 4NSKA 2B8OT 3LS4H 4PRNB 2DBLL 1I1YA 2C3HA 2VR9A 3O6FA 1LD9B 1FGNH 4JGMA 3S3PA 3L1OH 4X6DA 2AV7B 1P6FA 3MRMB 4NP4L 2GQHA 2H1PL 1FLTX 3P9LA 3C60A 3HCVB 4PJ8C 2ZUWA 3A67L 3REVB 3GSXA 1GC1C 1H9VA 3P0VL 5I8KL 2W0FB 2IFGA 1MCOH 2YS4A 4XCFH 4U05A 3F7VA 4DKEL 3QIWA 4GAYA 5SWQA 1KIRB 1JV5B 1WWCA 2ID5A 1A6UL 1QR1B 1H3PH 4HBCL 3DLQR 1NGPL 1G9NC 4PJFF 3UPRB 4NRXA 3BVNB 1MELA 1ZSDB 1D7FA 3V4PL 3MRDA 4YGAB 4N9OB 3LIZH 1OAUL 1Z0NA 2JJVA 3L3OA 4HSQA 3EYFB 4JKPH 2NR6D 5I6XB 2QADC 3GGWB 1N5AA 4JY5L 5EFIA 1PX4A 2JB6A 2PR4H 4Y19E 3TFKC 4H8WH 2DQFB 4O2CB 4JB9L 3WIFA 1AGBA 4Y2DA 1OM3H 5T3ZL 4M5YL 4PJFA 3ILPB 4PRPB 1YYLH 5HGAB 5GRWA 1RZFL 5FGSA 3O2VH 3WFEH 2X89D 3HPLA 1A1NA 4XPFH 3T4YB 3V8CA 2MOVA 1ZHKB 1JNJA 4AIXA 4Y8AA 1MHEA 1WZ1H 2O5ZH 4YDLC 2MQ0A 1IL1B 3QRGH 4J3TA 3VXSB 1DCLA 2IQAA 3MQIA 3HC4H 1A6ZB 4MNHB 2E9JA 5EO0B 5I1CL 4K7PH 1EAPB 2ZPKL 3IS1X 4PRHB 2BMKB 3VDAA 3KWWA 4KXZH 1PKQE 25C8H 3GMOB 1AHWA 3JV5A 5HHMB 5L9DL 3TZVB