4NJCA

Rna polymerase interacting protein ykzg from geobacillus stearothermophilus
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
HHMIFKVFYQEDADEAPVREKTKTMYIEAESERDVRRKLEGRPINIEYIQPLEGAHLEYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geobacillus stearothermophilus YkzG
publication title epsilon, a New Subunit of RNA Polymerase Found in Gram-Positive Bacteria
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transcription
total genus 9
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.730 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4njcA00
4NJCA
chains in the Genus database with same CATH superfamily
2AX5A 4LNFA 4L2YA 2ZNVB 2L0TA 2YEPF 2L3ZA 1WR6E 4P7IA 5D94A 1J0GA 2ZCBA 2ZCCA 4W9GA 1TS4A 1I7HA 1V6EA 4ZHPA 2H88B 2W82A 2ZPNA 4HROA 2MJ3A 3IAM1 3EGRA 5H8YE 2MEKA 1XLQA 3QIJA 2LFIA 3BYTB 4AP4C 4KKIA 3P4RB 1VD2A 3IT4B 1E8YA 2WDQB 1RFAA 3ZXRA 4A3OA 2IO2B 4JPSA 2J0JA 3RNGC 2MBEA 1C4AA 5EE3A 2JWZA 2NMQA 2V1YA 4TV3A 3AEAB 2I1JA 3CIRB 4G3XB 2CS4A 3WAMA 4ZDVA 2KFJA 4RF0A 3NOBA 3ETRA 4FLHA 2JPHA 1PGBA 3GS2A 2DYMA 3NS1A 3L4PA 3SFEB 2KX3A 2PTLA 3MC8A 3DWMA 3TMPB 4MH0E 3ZQ4A 2DAJA 1TZ1A 4GDKA 5AZHA 1R7SA 2RDBC 1OEYJ 1WWTA 2Z0DB 4RM9A 4WAAA 4YL8A 1UH6A 3P1MA 4ZRJA 4LJOB 1NVID 2Z59B 4W9DA 1EUVB 4DHJB 2H89B 4FADA 4L23A 1J7CA 1JRPA 3UINB 4GB9A 3V61A 1WJUA 2GB1A 4JWSC 1OQQA 1C9FA 2DWQA 4XGAB 3KLSX 1WJ6A 4HWIB 3DBLI 3KH0A 2W3SA 1WE6A 3HUIA 2G4DB 4XDCA 2WXNA 2CHXA 1QZEA 1JRUA 1R4NI 2IGHA 1FEHA 2WWZA 3A9KB 1AARA 3APCA 2QCZA 3AN1A 2BPSA 2ZJDA 2IDYA 1D5MC 2GBRA 1EU4A 1QILA 4ZRKA 1FO4A 3WAOA 2DX5B 4K3CA 2KOXA 4W9JA 3QAQA 3LB8C 3V6CB 2HDEA 1HQRD 2K9XA 1LQBA 3U30A 2NR2A 2JZPA 2R61A 3L54A 4NQLB 2IO3B 2C7HA 3MHSD 4C4VB 1YX5B 2KTFA 1GOZA 2MP2A 4WAFA 3L16A 2FBWB 3AEEB 1JWBD 1C76A 4US9A 1V80A 2G4SA 4NPNA 4GMVA 4FHJA 2EKIA 2DBYA 1WM2A 1QOGA 2K1FA 2D2QA 3V3XA 1PUTA 5J17A 1STEA 2FIDA 3QCAA 3RUIB 3DOWA 2V0GA 2KJ6A 1WF9A 3T3NA 5CX3A 4DHJD 2JQRB 2DYOA 1K53A 1SXTA 2FUHB 3IAS1 1V86A 2RSUA 1D3ZA 3IG3A 3TL5A 3UF8A 5AEKB 4RGNA 4MT5A 1E7UA 3H7PB 1SJED 3EA6A 4NAWB 1V1OA 2DZIA 5KHQA 2C7MB 4IWOA 1ZXIA 3A9KA 1SB3C 1M94A 1SF0A 4FN2A 2J7QB 1JWUD 3BIID 2KD0A 3NY5A 4ARCA 2IYDB 4RMAA 4WH4A 4II2B 2DYBA 2NCNA 4NZLB 1TBEA 1KLGD 1YOVB 4I6PA 4PYUA 1ET9A 3QJZA 1MVKA 2AQ3B 2IGGA 2KANA 3RI7C 1TS2A 3AE5B 1S3SG 2KN5A 1NI2A 5D7GA 1B1ZA 1TKEA 1XQQA 2LJIA 1WM3A 2DENB 4C4VA 2C9WB 1UWMA 1L0XB 5IN7A 1KM7A 1FCLA 3Q3MC 4LK0M 4C56C 3UIPB 2ZVNA 3W1SA 3CF6E 2M1MA 3I57A 2ZW0A 1OEYA 3GB1A 4YSXB 3RPFC 5FKAC 2OHFA 4MGKE 3AEGB 4XDDA 1TKGA 2KVZA 3P4SB 1GB4A 4HPPA 1RRBA 4FJZA 4IW0A 1WRDB 5JZEB 2JF5A 1EF5A 4IM3A 4PT5A 2R2QA 3PV1A 1IPGA 2KWCA 2CJNA 2MRPA 3SDLC 2KLGA 1XD3B 1D4BA 4HCPB 2AEHA 1FMAD 2RGFA 4KDIC 4FA6A 1ESFA 2NBVB 3H7PA 1IGDA 4GLSC 4NAWA 1MHXA 4GDLB 2N1VA 4JGHB 2XBBC 1K8RB 1I35A 3R3MA 3R7RA 3W9CB 2GMIC 2PJHA 1HZ5A 1WRIA 3OAWA 1G6JA 3SD5A 2WX1A 4NJ7A 2MW5A 2OEDA 1MI0A 1PGAA 4TUUA 1IP9A 2M8SA 2ZNVC 5E6JA 2KDIA 2C60A 4RM8A 4YTPB 3DVGX 1GC7A 5DPSA 4K3BA 1WGYA 4HRSA 2IO0B 2JT4B 1NYRA 4WQMA 2IO1B 1SIJA 4MSQB 3I5JC 4DXFA 1JQ4A 4E71A 5JHAA 1Q10A 2INCC 2LXAA 2WXRA 2PKOA 3R7QA 5C2TB 2CU3A 3I9V1 3DHHC 4WJOA 1ZW7A 3EC8A 4B9KA 3TEWA 2KZRA 3NVVA 1E8ZA 3C0RB 2VRRB 3FILB 3VR8B 3NHEB 1LM8B 4G0NB 2W9NA 3X0WA 3Q3JA 1GPXA 3KUDB 3DBRB 2N0SB 4IC7B 3ZNGC 4GN1A 1C4PA 3LDZE 3GZNI 1X1MA 3DVGY 4GDLA 1NENB 2KDEB 1E5WA 5AUIA 2KDFB 1WXMA 4MJSB 1E6EB 3ECIA 1RAXA 2LD9A 3AEDB 3SFDB 1UUPA 4Q2JA 3ZJUA 2L7RA 3VR9B 3H1UA 3VVWB 2LGDA 3VXWA 4HXDA 1IYFA 3N1YC 3TEZA 1TY2A 3Q6BA 1ZP0B 4A6QA 4C7ZA 3A33B 1WGGA 4BKSA 4FJVB 4BKSD 3AE2B 3DVNU 3S2AA 4ANUA 4WWMA 4IM2A 4K1RB 1OTRB 4ICVA 2WYQA 1D5XC 1J8CA 4MSMB 3V05A 2KFKB 4KZ0A 1NBFC 4RH6A 3WAPA 1DOYA 2BVCA 1GG3A 2KHWB 1RLFA 5J18A 2MQJA 2QSDA 1C79A 2QJLA 3Q3NC 4M8MA 2JY6A 1XO3A 3E9SA 3R2IA 1ZUD2 3BZDB 3AMZA 1TJEA 4ANWA 3EHVA 2DZJA 3DCGA 2M4NA 4HJKA 3VFKA 1B9RA 2NS5A 3W5VB 1I4QA 1ZE3D 1JALA 2EKEC 3KYDD 1XF5L 2YLMA 1DGJA 3KWVA 2K5PA 3DBHB 3FILA 3T3OA 2KXJA 2WX0A 1WXAA 4YWGG 4DXGA 3TEXA 1HA5A 2I2YA 3HVZA 1CK1A 2Y5BB 4TMAB 2G3QB 1J7AA 2LWPA 2DAFA 3Q69A 2XEWA 1H4RA 3M3JA 2Y5PA 3W1SC 2RDGA 1H8CA 2HTHA 2XNAC 3ONSA 4MJSA 3B0AA 4RGMA 1HXYD 4RCOA 1D5ZC 2FCQA 2G1EA 1YX6B 1DOXA 1SIFA 4JX1C 2GBJA 1XXGA 3TCAA 1KLUD 5DCNA 2KAJA 2FNJB 1FFVA 1TYGB 2D3CA 3N32A 3ZDTA 2FE8A 4A8XC 4EFOA 3EFCA 4P6VF 3QC8B 3PTFC 3DPDA 3IVFA 2V4LA 4PS7A 4ZRIA 2WXFA 3RN9C 2LI5A 2RMMA 3ZO5B 1V97A 2FCMA 2KMMA 4II3B 4ICUA 2D3GA 2JSVX 4ZRQA 1D6EC 1UF0A 2M0XA 4WQOB 2KLCA 1CZPA 3NJTA 4FJYA 1WIAA 2DZKA 1C1YB 5JXVA 4IWPA 1L2NA 4DDID 2D3AA 3ENEA 4HEA1 4KKJA 2E3TA 3VH4B 4IG7B 5I4DA 2ZEQA 1VLBA 2VZKD 4N9F4 2WXOA 3W2DA 4LDTB 4K7UA 4E3CA 2D3BA 4NY0A 3BK2A 3N3KB 1P9DU 1ZXHA 2J52A 1F77A 1T0QC 2WDVB 4YSYB 4RNAA 3OJ3A 1DOIA 1FPYA 3UGBB 2Z8LA 2N9KA 1FIQA 2IGDA 1BMLC 5D3DA 2KK8A 2JU6X 2CJOA 4G50A 3A1QB 4ZYSA 2LGYA 1F0ZA 4ANVA 2INDC 3JSVB 2QEJC 2MWSB 1C3TA 1VRAB 5DPTA 4L1BA 4S0RA 4F7ZA 4LTUA 1XCQL 2MJDA 2ON8A 4BVUC 3AECB 4BBNF 2BS4B 4NNJB 3DHGC 1KTKA 3NS8A 5E6NA 2FCNA 2LGXA 3P63A 4HCNB 2IJ0A 1KOTA 1RFKA 3B08A 3P42A 4F8CB 1T0YA 4KGSA 3I63C 2BB6A 5CHFA 3PS6A 1HZ6A 4NQKE 1T5XD 3X23A 3MC9A 4S17A 1WR1A 2K8HA 1E10A 4WJQA 3PO0A 3WANA 1HTQA 2J42A 4ZOHC 5GXGB 4KSLC 3RYTA 2I1KA 2BBCA 4M8NA 1V2YA 3HK0A 4GSWA 1WZ0A 4LDTD 3ZDMC 1YJIA 1HTOA 4W9FA 1JWMD 2WP9B 2KDBA 5FK9C 3NZUA 3Q8EA 1N63A 4P1CC 1WMHB 1P7FA 2K6QA 1JW9D 3DBHI 1LFDA 3FC4A 4EE2A 4KSKC 2CHWA 1QOFA 3KUCB 2BYVE 4GU2A 4B0EA 3AM9A 4NJCA 2L0FA 3NZ3A 2PIAA 3A1QA 4D2KA 4JIOU 1YN5A 3PSEB 2V4IB 3JSVA 3RNAC 1YN3A 4OZCA 4W9LA 1NYQA 3MTNB 3PPAA 5HI1A 1F2RC 3H9DA 4DWFA 4M00A 5G2NA 1YN4A 2KYWA 4HPLB 3ZIMA 2AQ2B 2GRIA 2BWFA 3RNEC 3NUHB 4WWOA 3P4QB 1ET6A 2ZPYA 4HJGE 2GBMA 2N4FA 4A9AA 2BGFA 1M4VA 4JLCA 1XLOA 3DWGC 3ZLZA 4AOFA 1NDDA 4BOZB 1MPEA 3URYA 2GBKA 3AH7A 3SHQA 5IP4D 1WI0A 2BS3B 2KKCA 5HFYA 4GGQA 5D2MB 3O65B 1E90A 1L5PA 1YD8U 2L05A 2KVRA 4OZAA 3SU8X 1QT9A 1L0YB 3H6NA 1UGJA 3R8BA 4CYEA 1BUIC 2IPKD 2UWQA 3OG5A 5DPWA 2NTSA 3HHMA 3HIZA 2FCSA 3MC0B 3RZFA 4GXBA 4TSSA 4XWWA 1LXDA 1WMHA 2N1WA 1TS3A 3IBEA 2QIEB 1ENFA 4KZCA 2BT6A 4M02A 4MM3B 1FXIA 2M56B 1YJ1A 2INNE 5BYSA 1WJ4A 4K7SA 1YJJA 1WZ3A 3TJPA 4XZ4A 1R4MB 1E8XA 5E6PA 5KHOA 2WS3B 3PRMB 4W9IA 2LJ5A 2ASQA 5BMHA 2N9XA 3B2GA 4LNIA 3DBSA 5T8IA 3CWIA 2NVUI 2JRIB 2KMAA 2Q5WD 4ANXA 2PE9A 3APDA 4A55A 1OFFA 4R3DA 3AV8A 4B95A 1GB1A 4BOSC 2MLBA 5BMIA 2B3AA 5G55A 1JROA 3R2TA 4HDQA 4ARIA 2BYTA 3SEBA 1L0VB 4LJPB 1SGHA 3Q14C 2JX5A 3APFA 2L1AA 3L10B 1FCCC 3V6EB 3QK0A 1TKYA 2FUG1 4B0MA 4P1BC 2KQ7A 5C1ZA 4QAYA 2BB5A 2L76A 3DVNV 1QOAA 1ROEA 3AE4B 2N9PC 2WQYB 4M0WB 2D5GA 5IOIA 5LXHA 2RPQA 1JMLA 3RT3B 1NEKB 1GUAB 2WXKA 3Q8AA 2HE7A 4TQ0A 2VH1A 4M01A 5MPOA 1SSNA 5C3JB 2WXLA 3U4EG 1UGMA 3AB5A 2KQSA 2PPHA 3IT6B 2AL3A 2N7EA 3FAHA 2BQQA 3B9JA 2KTRB 3ML9A 4KGTA 3Q8CA 1GNUA 2PVGC 2K39A 1YQ4B 3GE3C 4MELA 2RR9A 5G5GA 2NPTB 5LNK1 3QARA 2V3SA 3B1LX 4MM3A 2IY1B 5BO4B 3N1XC 2PW9A 1PQSA 2KX0A 1L4ZB 1N6ZA 3LXFA 1WX8A 2D11A 4KV2A 3PLVA 3J9CA 3T8MA 2WDRB 2MBBB 2J0MA 1N60A 1F9JA 2DHZA 2B76B 3ZKJC 1WXQA 5LXIB 3ZNID 1TS5A 1E7VA 3MFGA 4ZRPA 2LMCA 2RDHA 3T9LA 1J7BA 1F52A 2A5UA 4EZJA 5D3IB 4MACA 1LGRA 4FHKA 3TEYA 1E7PB 2LVQA 3VUYA 3EFUA 4LLGM 3RULA 1KF6B 2KC2A 4I6LB 1XLPA 3N1ZC 3HRDD 1I42A 5IKCM 4YT0B 2D10A 1PDXA 1TY0A 1P3QU 1SE4A 2WXJA 1PGXA 1WFYA 2REXA 3L08A 3WIMA 1BT0A 1QF6A 1QOBA 5HG2A 3DBLB 3BVGA 1WYWB 2JRHA 1WGRA 1WXSA 3VTUA 3AXCA 2MJEA 4OZBA 2K22A 3P2BA 1R4NB 4M0WA 5BYQA 3ZNZB 1SE3A 2ZW1A 2RD0A 3RD2A 2QILA 2WXPA 4LNNA 1CMXB 2L8JA 2LEKA 5EE9A 1NI3A 3GP7A 2CKHB 2W55A 4ZYNA 1ZPSA 4CHKA 3NRZA 3PHWB 4W9EA 1RYJA 2KO3A 4MH8A 2R2OA 3PGEA 5AZGA 1IBXB 4O1NA 2NPTA 2VZKB 1AWDA 3HM3A 1KJTA 2L00B 3ZYYX 1J19A 5CTRC 2JWUA 2WU2B 2N9EB 4IUMB 3ZGZA 4IWQA 3V60A 3U7ZA 1EWCA 1FNUA 3VQIA 1PYWD 3H7SA 3QQ8B 3GOEA 2LVPA 1OQRA 2J4XA 3AU4A 1V49A 1VZ6A 4A20A 2EMTA 4E74A 1V1PB 5LLIA 3AI5A 1EM7A 2KWDA 1RWSA 2ICIA 3CSTA 1TGZB 2LHEA 1Y8RC 3JYUA 1A70A 4BAXA 2PEAA 1VJKA 2KDMA 3KWLA 3ZXVA 4DBGA 3AE6B 3BY4B 3LJ3A 3UI3A 2IBIB 4IM0A 3MJ5A 1V81A 4A3PA 3K9OB 3Q2AC 2KNBA 2JZ3B 4NAMA 4OHJA 4AQ7A 3CSFA 1FRDA 1VDVA 2LZ6A 1P7EA 1YMHE 5AUKA 3NVZA 1XCTL 4HPMB 1AN8A 2M19A 5TSSA 2KFKA 2HJ1A 2WXQA 2K6DB 3AE1B 3AE9B 4KDLB 2K25A 1IUEA 5CHVC 5EDSA 3D32A 5HKHA 4AWJA 2BW2A 1ISNA 4P16A 1C77A 4TKNA 3RNCC 3PZ8A 2DLBA 1JCKB 4EUTA 2A4ZA 2V3NA 3OLMD 1FM0D 3JVZX 1WYGA 1IBXA 4XE0A 1SEBD 3IHPC 4W9HA 4PS3A 2KQ4X 4WIPA 1I4PA 2JYEA 2ONQA 2OJWA 4LNKA 3ZUNA 2AYOB 1UBQA 2ZVOA 2OJRA 1F1HA 3A4SC 3ML8A 1F2RI 4HLEA 2ACZB 1TTNA 1WXVA 2NBWB 4REZA 4US8A 2MP2B 1K51A 4BZAA 1UZXB 1V1PA 2L83A 2WU5B 3BK1A 2RPVA 2KT7A 4HDOA 1C78A 3DBRI 1SBBB 3NG0A 3ABVB 1ZDXA 1MFWA 2O6VB 2EELA 1U4AA 3EECA 1QQRA 1Q1OA 1ZDVA 1MHHE 3ZVVA 3ZJVA 2BWES 2VH2A 3C19A 2HJ8A 4LCDE 4WURA 1DYQA 4MGYE 3PZDA 2MA9B 3GE8C 5FR6A 2PVOD 3LYYA 3WA0A 2GOWA 3KYCD 2KN4A 3E56A 2WXGA 2HTME 1I4HA 3PT2B 1CQVA 2KWVB 1ACCA 1FFUA 2KC1A 4KIKB 2Y3AA 2C7NB 3AEBB 2INPE 3V62A 3A4RA 3MP9A 3HVDA 2MBOA 2BYFA 1L6UA 4RF1A 1SJHD 2JVCA 4EZKA 2W3RA 1WGDA 4OW0A 4XX5A 2WLBA 1E8WA 3R66C 4C00A 3FKYA 2DZMA 4WJPA 5GMVA 2UYZB 4W9CA 4HK2A 1EO6A 3U2SC 5BMGA 4IDIA 1XLNA 1UNSA 2O2VB 3UIOB 1RM6C 3DDCB 2N9LA 1YNTE 1SE9A 1Q5WB 4K7WA 4MGZE 3M62B 2WHIA 4F1SA 4DDGD 1FNWA 1VZ7A 1WGKA 2GI9A 3PRPB 1JWSD 2L32A 3BYYB 4I6NB 2JUOA 4K81A 1HEZE 3RMKC 2LHDA 4HVBA 5JH5C 2O6VA 1I4XA 5EE1A 2O6VD 4FBJB 5BYRA 1LO5D 2HD5B 3B2FA 4MDKE 4UDUC 3OJ4B 5E6OA 3ZW3A 4WJNA 1N5WA 4A90A 2WNMA 4XWTA 2K3UA 3BINA 3GZNB 4WWNA 3RZWC 2MBHA 4C7YA 1AW7A 3N30A 4HKQA 3AU5A 2FIFA 3N20C 1ZOYB 3Q8FA 1MG8A 3CMMB 2KJRA 3BVZA 1TZOA 1K50A 4KIKA 4BFRA 5EE0A 5L83A 4JL9A 1E0ZA 2KWUB 5FR3A 4DHZB 4YXDB 1WX7A 3ZRCA 3WCQA 5CHWA 2SAKA 3AEFB 1Y56A 4XC2A 1WGHA 1QKZA 3ZRFA 3UQAA 2OOBB 4MGIE 5IAAC 2MH7A 3VH3B 3VDZA 3K9PB 4MEMA 1EU3A 3U8ZA 1P1AA 4FXCA 1A5RA 3EUB2 1VR9A 3ZNHB 2O2VA 1C4CA 1JWAD 4NJ6A 3SR6A 3VTVA 4HKZE 4BKGA 3N9YC 3M63B 3NVYA 5JHBA 2BKRB 2PLPA 4URKA 3RNFC 3PRZA 3ALBA 2LGSA 3IXSA 2L52A 1XT9B 4ACFA 1WE7A 3TBLD 4GIVA 2I38A 2QC8A 3L0WB 4AJWA 2LRWA 1N5XA 3QHTA 1GAQB 1T0SC 1OQYA 2DNFA 2NTTA 4KGRA 2MSED 1L6VA 4ZHOA 1YIWA 3AULA 5DPRA 1VCBA 2J53A 4KVGB 3ZTCA 1UWXA 1MJDA 2IZVB 3KW5B 4TQ1A 5AZFA 2WDTB 2GLSA 4PS8A 4RGTA 2LXCA 3RNBC 3PZ7A 2AL6A 4USAA 2QDFA 3BVMA 2BF8B 2CHZA 2JXTA 4OVZA 4IKGA 3PHXB 4IOIE 2FAZA 2TSSA 4PYZA 1ZGUB 1T0RC 3U7DA 4ASWC 1YQBA 2N7JA 2YVCA 2SEBD 1FXAA 4CQNA 3A9JB 1HE8A 3QA8A 1Z5SB 2JYTA 4ITKA 1TT5B 2EMSA 3PREA 3TUOA 2D07B 2XN9C 3AE3B 3VUXA 1WH3A 3UQBA 2WXHA 2LRUA 2QMTA 5IA7A 2Z0EB 1FNVA 1FD6A 4AUQC 4AS1A 2KMCA 1FRRA 1S1QB 4W9KA 2BYEA 3AE8B 3TIXA 2XK5B 3NVWA 2V9HA 1V5OA 1FXTB 1P98A 4RGOS 3RFZB 4PK1A 3L17A 1PFDA 1WY8A 1EF1A 5H92C 4J6IA 5C23A 2BS2B 4YSZB 1GC6A 4JWUC 3P4PB 2WXMA 4DQOC 1KH0A 2AWTA 1WJNA 5J2RA 1E9MA 4OVVA 3W1YA 3QX1A 3Q3OC 4BKTA 4CO7A 2LGIA 5TR5A 4EOYA 3H8HA 2ZZPB 2V3PA 4AJYB 1V8CA 1MG4A 3MJWA 3U52E 4KX6B 1T6BX 3QWZB 4FULA 1T3QA 5IO9A 1AYFA 1XEEA 1N61A 2IY0B 4LNOA 3VUWA 1L7YA 2MCNB 4EZLA 2BTEA 4C80A 4J3OD 1VZ8A 4N59A 1TIFA 3HM6X 1BXTA 2NBUA 2PE6B 4BBNC 1YQ3B 3KVFB 1KRHA 3MHZA 1K52A 4YTNB 1GJZA 5HHDG 3M95A 1KFYB 2G45B 2MBQA 1OGWA 3A9JA 3C8YA 2E6XA 3BWUD 2J0KA 3KQ4A 2QHOA 4H2AA 4EEWA 4JE3B 4G11A 4GOCA 3VAWA 4WWPA 1WSPA 2JXXA 1ZKHA 2CU1A 2K8CA 3VHTC 2K0PA 3IFWB 1L4DB 2AQ1B 2KJHB 2XK5A 1CJEA 1KLVA 4DHZE 3KUZA 4B6WA 3PLUA 4X57B 5L95C 4N58A 2KTRA 1N62A 1UD7A 1V5TA 2GBNA 4N6EB 3RCZA 2X8XX 1QLBB 2LASA 5G5HA 1Q0WB 2K8BA 2LUMA 3NZSA 1IGCA 3VRBB 1I4GA 2WGSA 5D6JB 2UU7A 4DXAB 3L13A 3I3TB 2CR5A 1I4RA 1P0RA 1Z2MA 2X38A 1WX9A 1UBIA 2YEPB 3Q8BA 1UELA 2N7DA 1EWYC 3Q3FA 4XYCA 2LUEA 2BKFA 4JQWC 1R4MI 2PMVA 3OWEB 3TSSA 1V9JA 2Y5CA 4RFBA 2MHJA 3DHIC 4DK5A 2M17A 4YTMB 3WALA 3AE7B 3DQVA 1SE2A 3JW0X 3W5UB 3VRAB 3ZJTA 4GDKB 2MX2A 2G9HD 3PVLA 4OVUA 2M0AA 3ZTDA 2WXIA 2JZZA 2C5LC 2LVOA 2W54A 3O13A 4EKUA 3VTWA 2KACA
chains in the Genus database with same CATH topology
3TEWA 1L0YB 2AX5A 3MP9A 4L2YA 1UGJA 3HVDA 2YEPF 3NVVA 3R8BA 1BUIC 3FILB 1L6UA 3VR8B 2IPKD 4RF1A 1SJHD 2NTSA 3MC0B 2W3RA 4TSSA 4OW0A 4XWWA 1TS4A 1GPXA 2WLBA 1I7HA 1TS3A 2N0SB 4ZHPA 2QIEB 2H88B 1ENFA 2W82A 1C4PA 2BT6A 4HROA 1NENB 2MJ3A 3IAM1 4MM3B 1FXIA 3EGRA 2M56B 5H8YE 2MEKA 1XLQA 2LFIA 2INNE 5BYSA 1YJJA 3BYTB 5AUIA 4KKIA 3U2SC 3P4RB 5BMGA 1E6EB 3SFDB 3AEDB 1UUPA 3IT4B 2WS3B 1XLNA 4IDIA 1UNSA 4Q2JA 2WDQB 3ZJUA 1RM6C 2N9LA 4JPSA 5BMHA 1YNTE 3VR9B 3B2GA 5T8IA 1C4AA 3CWIA 3TEZA 5EE3A 1TY2A 2Q5WD 2NMQA 1ZP0B 4A6QA 4C7ZA 4A55A 1FNWA 1VZ7A 1OFFA 4R3DA 1WGKA 2GI9A 3AV8A 1GB1A 3AEAB 1JWSD 2L32A 3CIRB 3BYYB 5BMIA 1JROA 1HEZE 3R2TA 4ARIA 2BYTA 2LHDA 1L0VB 3SEBA 3AE2B 4RF0A 4WWMA 1I4XA 2JX5A 3ETRA 1D5XC 1PGBA 5EE1A 3V05A 4RH6A 3GS2A 2DYMA 1DOYA 2L1AA 3NS1A 3L4PA 3SFEB 1FCCC 5BYRA 1LO5D 2PTLA 3B2FA 1TKYA 2FUG1 4UDUC 3DWMA 1N5WA 4B0MA 2BB5A 2QSDA 3ZQ4A 4A90A 1C79A 2QJLA 1QOAA 1XO3A 1ROEA 2WNMA 3E9SA 4XWTA 3AE4B 2K3UA 1R7SA 2WQYB 1WWTA 3R2IA 2D5GA 4C7YA 1ZUD2 3P1MA 1AW7A 4HKQA 1NVID 3BZDB 3AMZA 1TJEA 1JMLA 2H89B 1ZOYB 1NEKB 3Q8FA 2WXKA 3Q8AA 1B9RA 4TQ0A 4L23A 3BVZA 1J7CA 3W5VB 1JRPA 1K50A 1TZOA 5MPOA 1SSNA 1I4QA 5C3JB 1ZE3D 1JALA 2WXLA 3U4EG 3AB5A 5EE0A 3IT6B 1XF5L 3KWVA 1DGJA 2GB1A 2K5PA 4JWSC 1OQQA 1C9FA 1E0ZA 3FILA 3FAHA 5FR3A 3T3OA 3B9JA 2DWQA 4YXDB 3KLSX 4KGTA 3WCQA 3Q8CA 2PVGC 2SAKA 4YWGG 4DXGA 3TEXA 1HA5A 1Y56A 1YQ4B 2W3SA 3AEFB 2I2YA 3HUIA 3HVZA 1CK1A 5G5GA 4TMAB 1QKZA 1J7AA 4XDCA 2WXNA 5LNK1 2MH7A 3Q69A 2Y5PA 2IGHA 1FEHA 2PW9A 2RDGA 1EU3A 1L4ZB 3LXFA 4FXCA 2XNAC 3J9CA 3AN1A 2WDRB 1VR9A 3EUB2 4RGMA 1HXYD 1N60A 2IDYA 2B76B 4RCOA 1C4CA 1D5ZC 1D5MC 1WXQA 1EU4A 1QILA 1TS5A 2G1EA 1JWAD 3MFGA 4ZRPA 1DOXA 2LMCA 2RDHA 1FO4A 3SR6A 4HKZE 4JX1C 1J7BA 1XXGA 1KLUD 3N9YC 3NVYA 5D3IB 2KAJA 4MACA 3TEYA 1E7PB 2PLPA 4LLGM 1FFVA 3LB8C 1TYGB 1KF6B 2HDEA 1XLPA 3IXSA 1HQRD 2K9XA 2L52A 2FE8A 3HRDD 4A8XC 2JZPA 4YT0B 4P6VF 2R61A 2I38A 1PDXA 1N5XA 1TY0A 1GAQB 2NTTA 1SE4A 2WXJA 2WXFA 4KGRA 1PGXA 1GOZA 2RMMA 4WAFA 1L6VA 1V97A 4ZHOA 2KMMA 2J53A 2JSVX 2FBWB 3AEEB 1QF6A 1JWBD 1QOBA 1UWXA 4ZRQA 1C76A 4US9A 5HG2A 3BVGA 4TQ1A 1D6EC 4RGTA 3PZ7A 2MJEA 4OZBA 4USAA 2K22A 2EKIA 1CZPA 2DBYA 3BVMA 4M0WA 5BYQA 5JXVA 1SE3A 2ZW1A 2JXTA 1QOGA 2QILA 3V3XA 4OVZA 4IKGA 4IOIE 2TSSA 2WXPA 1PUTA 1STEA 2LEKA 4HEA1 2V0GA 4KKJA 2E3TA 3T3NA 5EE9A 5I4DA 2JQRB 1NI3A 2N7JA 2DYOA 1FXAA 1VLBA 2SEBD 2VZKD 3GP7A 2W55A 4CQNA 2WXOA 3W2DA 2JYTA 1K53A 1SXTA 1ZPSA 4ITKA 3TUOA 3NRZA 3BK2A 2XN9C 3AE3B 3IAS1 1RYJA 4MH8A 4RGNA 4MT5A 2WXHA 1ZXHA 2J52A 1IBXB 4O1NA 1SJED 2QMTA 1F77A 2WDVB 3EA6A 4NAWB 4YSYB 4RNAA 2VZKB 1DOIA 1AWDA 1FNVA 1V1OA 2Z8LA 1FD6A 2N9KA 1FIQA 3ZYYX 4AS1A 1FRRA 2IGDA 1BMLC 2JWUA 2WU2B 3AE8B 5D3DA 3ZGZA 1ZXIA 2JU6X 3NVWA 1SB3C 2CJOA 3U7ZA 1SF0A 1EWCA 1JWUD 1FNUA 3BIID 4RGOS 3RFZB 4ARCA 3VQIA 1PYWD 4WH4A 1PFDA 4ZYSA 1F0ZA 5H92C 1OQRA 2J4XA 2QEJC 4NZLB 2BS2B 4YSZB 1VRAB 1VZ6A 1KLGD 4JWUC 4L1BA 1V1PB 2WXMA 3P4PB 4DQOC 4LTUA 1KH0A 1EM7A 2KWDA 1E9MA 1ET9A 1MVKA 1RWSA 1XCQL 2AQ3B 2ICIA 2MJDA 2IGGA 2ON8A 2LHEA 3AECB 2LGIA 2BS4B 1A70A 1TS2A 3H8HA 3AE5B 2V3PA 1KTKA 1VJKA 2KDMA 3KWLA 5D7GA 1B1ZA 1TKEA 3AE6B 1V8CA 2LJIA 3P63A 2IJ0A 1RFKA 3P42A 3U52E 4KX6B 4KGSA 1UWMA 3UI3A 1T6BX 1L0XB 1T3QA 3MJ5A 2BB6A 1AYFA 1XEEA 1FCLA 4LK0M 4C56C 1N61A 1HZ6A 4NAMA 1T5XD 4OHJA 4AQ7A 3W1SA 2BTEA 4C80A 4J3OD 1VZ8A 1FRDA 1VDVA 1E10A 4N59A 3PO0A 3I57A 1P7EA 1YMHE 2ZW0A 1BXTA 3GB1A 5AUKA 4YSXB 3RPFC 1YQ3B 2J42A 1XCTL 1KRHA 3MHZA 3NVZA 5FKAC 4ZOHC 2OHFA 5GXGB 1AN8A 2M19A 3AEGB 4XDDA 5TSSA 2WXQA 1K52A 4YTNB 3AE1B 3AE9B 1TKGA 5HHDG 1IUEA 3P4SB 1GB4A 1KFYB 2BBCA 2BW2A 3C8YA 2E6XA 3BWUD 4P16A 1C77A 4PT5A 3KQ4A 1YJIA 4H2AA 2CJNA 3PZ8A 4JE3B 2DLBA 1JCKB 1JWMD 1D4BA 2WP9B 2V3NA 1WSPA 1FM0D 1FMAD 5FK9C 3Q8EA 1N63A 1WYGA 1ESFA 1IBXA 1IGDA 1P7FA 2K0PA 4GLSC 1SEBD 4XE0A 1JW9D 1L4DB 2AQ1B 3FC4A 4EE2A 1MHXA 4GDLB 2KQ4X 4WIPA 1QOFA 1I4PA 2JYEA 2ONQA 1CJEA 4B0EA 3AM9A 4NJCA 3NZ3A 2PIAA 3W9CB 4N58A 4D2KA 1F2RI 1N62A 1YN5A 2ACZB 1HZ5A 1WRIA 2V4IB 4N6EB 4REZA 1QLBB 4US8A 1K51A 1YN3A 5G5HA 4OZCA 1NYQA 1V1PA 2LUMA 2L83A 1IGCA 5HI1A 1I4GA 1F2RC 2OEDA 3VRBB 1MI0A 1PGAA 2WU5B 1YN4A 3BK1A 2AQ2B 2GRIA 5E6JA 2RPVA 1I4RA 1C78A 3NUHB 1SBBB 3P4QB 2X38A 3ABVB 1ET6A 1ZDXA 4YTPB 2YEPB 3Q8BA 2EELA 4HJGE 1QQRA 1EWYC 1ZDVA 4A9AA 1M4VA 1XLOA 1MHHE 3DWGC 3ZJVA 4HRSA 2PMVA 3OWEB 3TSSA 2Y5CA 1NYRA 4RFBA 4WURA 1DYQA 4YTMB 3AE7B 1SE2A 1MPEA 3W5UB 4WQMA 3URYA 3VRAB 3ZJTA 1SIJA 4DXFA 4GDKB 3AH7A 2PVOD 3LYYA 2G9HD 1JQ4A 2BS3B 2KN4A 1Q10A 5HFYA 3E56A 2WXGA 2M0AA 2WXRA 2HTME 2PKOA 1I4HA 1L5PA 2WXIA 1CQVA 5C2TB 1ACCA 2CU3A 2W54A 3I9V1 4OZAA 3O13A 1FFUA 2Y3AA 2KACA 3AEBB 1QT9A 2INPE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJC A; 
#chains in the Genus database with same CATH topology
 2AX5 A;  4LNF A;  4L2Y A;  2ZNV B;  2L0T A;  2YEP F;  2L3Z A;  1WR6 E;  4P7I A;  5D94 A;  1J0G A;  2ZCB A;  2ZCC A;  4W9G A;  1TS4 A;  1I7H A;  1V6E A;  4ZHP A;  2H88 B;  2W82 A;  2ZPN A;  4HRO A;  2MJ3 A;  3IAM 1;  3EGR A;  5H8Y E;  2MEK A;  1XLQ A;  3QIJ A;  2LFI A;  3BYT B;  4AP4 C;  4KKI A;  3P4R B;  1VD2 A;  3IT4 B;  1E8Y A;  2WDQ B;  1RFA A;  3ZXR A;  4A3O A;  2IO2 B;  4JPS A;  2J0J A;  3RNG C;  2MBE A;  1C4A A;  5EE3 A;  2JWZ A;  2NMQ A;  2V1Y A;  4TV3 A;  3AEA B;  2I1J A;  3CIR B;  4G3X B;  2CS4 A;  3WAM A;  4ZDV A;  2KFJ A;  4RF0 A;  3NOB A;  3ETR A;  4FLH A;  2JPH A;  1PGB A;  3GS2 A;  2DYM A;  3NS1 A;  3L4P A;  3SFE B;  2KX3 A;  2PTL A;  3MC8 A;  3DWM A;  3TMP B;  4MH0 E;  3ZQ4 A;  2DAJ A;  1TZ1 A;  4GDK A;  5AZH A;  1R7S A;  2RDB C;  1OEY J;  1WWT A;  2Z0D B;  4RM9 A;  4WAA A;  4YL8 A;  1UH6 A;  3P1M A;  4ZRJ A;  4LJO B;  1NVI D;  2Z59 B;  4W9D A;  1EUV B;  4DHJ B;  2H89 B;  4FAD A;  4L23 A;  1J7C A;  1JRP A;  3UIN B;  4GB9 A;  3V61 A;  1WJU A;  2GB1 A;  4JWS C;  1OQQ A;  1C9F A;  2DWQ A;  4XGA B;  3KLS X;  1WJ6 A;  4HWI B;  3DBL I;  3KH0 A;  2W3S A;  1WE6 A;  3HUI A;  2G4D B;  4XDC A;  2WXN A;  2CHX A;  1QZE A;  1JRU A;  1R4N I;  2IGH A;  1FEH A;  2WWZ A;  3A9K B;  1AAR A;  3APC A;  2QCZ A;  3AN1 A;  2BPS A;  2ZJD A;  2IDY A;  1D5M C;  2GBR A;  1EU4 A;  1QIL A;  4ZRK A;  1FO4 A;  3WAO A;  2DX5 B;  4K3C A;  2KOX A;  4W9J A;  3QAQ A;  3LB8 C;  3V6C B;  2HDE A;  1HQR D;  2K9X A;  1LQB A;  3U30 A;  2NR2 A;  2JZP A;  2R61 A;  3L54 A;  4NQL B;  2IO3 B;  2C7H A;  3MHS D;  4C4V B;  1YX5 B;  2KTF A;  1GOZ A;  2MP2 A;  4WAF A;  3L16 A;  2FBW B;  3AEE B;  1JWB D;  1C76 A;  4US9 A;  1V80 A;  2G4S A;  4NPN A;  4GMV A;  4FHJ A;  2EKI A;  2DBY A;  1WM2 A;  1QOG A;  2K1F A;  2D2Q A;  3V3X A;  1PUT A;  5J17 A;  1STE A;  2FID A;  3QCA A;  3RUI B;  3DOW A;  2V0G A;  2KJ6 A;  1WF9 A;  3T3N A;  5CX3 A;  4DHJ D;  2JQR B;  2DYO A;  1K53 A;  1SXT A;  2FUH B;  3IAS 1;  1V86 A;  2RSU A;  1D3Z A;  3IG3 A;  3TL5 A;  3UF8 A;  5AEK B;  4RGN A;  4MT5 A;  1E7U A;  3H7P B;  1SJE D;  3EA6 A;  4NAW B;  1V1O A;  2DZI A;  5KHQ A;  2C7M B;  4IWO A;  1ZXI A;  3A9K A;  1SB3 C;  1M94 A;  1SF0 A;  4FN2 A;  2J7Q B;  1JWU D;  3BII D;  2KD0 A;  3NY5 A;  4ARC A;  2IYD B;  4RMA A;  4WH4 A;  4II2 B;  2DYB A;  2NCN A;  4NZL B;  1TBE A;  1KLG D;  1YOV B;  4I6P A;  4PYU A;  1ET9 A;  3QJZ A;  1MVK A;  2AQ3 B;  2IGG A;  2KAN A;  3RI7 C;  1TS2 A;  3AE5 B;  1S3S G;  2KN5 A;  1NI2 A;  5D7G A;  1B1Z A;  1TKE A;  1XQQ A;  2LJI A;  1WM3 A;  2DEN B;  4C4V A;  2C9W B;  1UWM A;  1L0X B;  5IN7 A;  1KM7 A;  1FCL A;  3Q3M C;  4LK0 M;  4C56 C;  3UIP B;  2ZVN A;  3W1S A;  3CF6 E;  2M1M A;  3I57 A;  2ZW0 A;  1OEY A;  3GB1 A;  4YSX B;  3RPF C;  5FKA C;  2OHF A;  4MGK E;  3AEG B;  4XDD A;  1TKG A;  2KVZ A;  3P4S B;  1GB4 A;  4HPP A;  1RRB A;  4FJZ A;  4IW0 A;  1WRD B;  5JZE B;  2JF5 A;  1EF5 A;  4IM3 A;  4PT5 A;  2R2Q A;  3PV1 A;  1IPG A;  2KWC A;  2CJN A;  2MRP A;  3SDL C;  2KLG A;  1XD3 B;  1D4B A;  4HCP B;  2AEH A;  1FMA D;  2RGF A;  4KDI C;  4FA6 A;  1ESF A;  2NBV B;  3H7P A;  1IGD A;  4GLS C;  4NAW A;  1MHX A;  4GDL B;  2N1V A;  4JGH B;  2XBB C;  1K8R B;  1I35 A;  3R3M A;  3R7R A;  3W9C B;  2GMI C;  2PJH A;  1HZ5 A;  1WRI A;  3OAW A;  1G6J A;  3SD5 A;  2WX1 A;  4NJ7 A;  2MW5 A;  2OED A;  1MI0 A;  1PGA A;  4TUU A;  1IP9 A;  2M8S A;  2ZNV C;  5E6J A;  2KDI A;  2C60 A;  4RM8 A;  4YTP B;  3DVG X;  1GC7 A;  5DPS A;  4K3B A;  1WGY A;  4HRS A;  2IO0 B;  2JT4 B;  1NYR A;  4WQM A;  2IO1 B;  1SIJ A;  4MSQ B;  3I5J C;  4DXF A;  1JQ4 A;  4E71 A;  5JHA A;  1Q10 A;  2INC C;  2LXA A;  2WXR A;  2PKO A;  3R7Q A;  5C2T B;  2CU3 A;  3I9V 1;  3DHH C;  4WJO A;  1ZW7 A;  3EC8 A;  4B9K A;  3TEW A;  2KZR A;  3NVV A;  1E8Z A;  3C0R B;  2VRR B;  3FIL B;  3VR8 B;  3NHE B;  1LM8 B;  4G0N B;  2W9N A;  3X0W A;  3Q3J A;  1GPX A;  3KUD B;  3DBR B;  2N0S B;  4IC7 B;  3ZNG C;  4GN1 A;  1C4P A;  3LDZ E;  3GZN I;  1X1M A;  3DVG Y;  4GDL A;  1NEN B;  2KDE B;  1E5W A;  5AUI A;  2KDF B;  1WXM A;  4MJS B;  1E6E B;  3ECI A;  1RAX A;  2LD9 A;  3AED B;  3SFD B;  1UUP A;  4Q2J A;  3ZJU A;  2L7R A;  3VR9 B;  3H1U A;  3VVW B;  2LGD A;  3VXW A;  4HXD A;  1IYF A;  3N1Y C;  3TEZ A;  1TY2 A;  3Q6B A;  1ZP0 B;  4A6Q A;  4C7Z A;  3A33 B;  1WGG A;  4BKS A;  4FJV B;  4BKS D;  3AE2 B;  3DVN U;  3S2A A;  4ANU A;  4WWM A;  4IM2 A;  4K1R B;  1OTR B;  4ICV A;  2WYQ A;  1D5X C;  1J8C A;  4MSM B;  3V05 A;  2KFK B;  4KZ0 A;  1NBF C;  4RH6 A;  3WAP A;  1DOY A;  2BVC A;  1GG3 A;  2KHW B;  1RLF A;  5J18 A;  2MQJ A;  2QSD A;  1C79 A;  2QJL A;  3Q3N C;  4M8M A;  2JY6 A;  1XO3 A;  3E9S A;  3R2I A;  1ZUD 2;  3BZD B;  3AMZ A;  1TJE A;  4ANW A;  3EHV A;  2DZJ A;  3DCG A;  2M4N A;  4HJK A;  3VFK A;  1B9R A;  2NS5 A;  3W5V B;  1I4Q A;  1ZE3 D;  1JAL A;  2EKE C;  3KYD D;  1XF5 L;  2YLM A;  1DGJ A;  3KWV A;  2K5P A;  3DBH B;  3FIL A;  3T3O A;  2KXJ A;  2WX0 A;  1WXA A;  4YWG G;  4DXG A;  3TEX A;  1HA5 A;  2I2Y A;  3HVZ A;  1CK1 A;  2Y5B B;  4TMA B;  2G3Q B;  1J7A A;  2LWP A;  2DAF A;  3Q69 A;  2XEW A;  1H4R A;  3M3J A;  2Y5P A;  3W1S C;  2RDG A;  1H8C A;  2HTH A;  2XNA C;  3ONS A;  4MJS A;  3B0A A;  4RGM A;  1HXY D;  4RCO A;  1D5Z C;  2FCQ A;  2G1E A;  1YX6 B;  1DOX A;  1SIF A;  4JX1 C;  2GBJ A;  1XXG A;  3TCA A;  1KLU D;  5DCN A;  2KAJ A;  2FNJ B;  1FFV A;  1TYG B;  2D3C A;  3N32 A;  3ZDT A;  2FE8 A;  4A8X C;  4EFO A;  3EFC A;  4P6V F;  3QC8 B;  3PTF C;  3DPD A;  3IVF A;  2V4L A;  4PS7 A;  4ZRI A;  2WXF A;  3RN9 C;  2LI5 A;  2RMM A;  3ZO5 B;  1V97 A;  2FCM A;  2KMM A;  4II3 B;  4ICU A;  2D3G A;  2JSV X;  4ZRQ A;  1D6E C;  1UF0 A;  2M0X A;  4WQO B;  2KLC A;  1CZP A;  3NJT A;  4FJY A;  1WIA A;  2DZK A;  1C1Y B;  5JXV A;  4IWP A;  1L2N A;  4DDI D;  2D3A A;  3ENE A;  4HEA 1;  4KKJ A;  2E3T A;  3VH4 B;  4IG7 B;  5I4D A;  2ZEQ A;  1VLB A;  2VZK D;  4N9F 4;  2WXO A;  3W2D A;  4LDT B;  4K7U A;  4E3C A;  2D3B A;  4NY0 A;  3BK2 A;  3N3K B;  1P9D U;  1ZXH A;  2J52 A;  1F77 A;  1T0Q C;  2WDV B;  4YSY B;  4RNA A;  3OJ3 A;  1DOI A;  1FPY A;  3UGB B;  2Z8L A;  2N9K A;  1FIQ A;  2IGD A;  1BML C;  5D3D A;  2KK8 A;  2JU6 X;  2CJO A;  4G50 A;  3A1Q B;  4ZYS A;  2LGY A;  1F0Z A;  4ANV A;  2IND C;  3JSV B;  2QEJ C;  2MWS B;  1C3T A;  1VRA B;  5DPT A;  4L1B A;  4S0R A;  4F7Z A;  4LTU A;  1XCQ L;  2MJD A;  2ON8 A;  4BVU C;  3AEC B;  4BBN F;  2BS4 B;  4NNJ B;  3DHG C;  1KTK A;  3NS8 A;  5E6N A;  2FCN A;  2LGX A;  3P63 A;  4HCN B;  2IJ0 A;  1KOT A;  1RFK A;  3B08 A;  3P42 A;  4F8C B;  1T0Y A;  4KGS A;  3I63 C;  2BB6 A;  5CHF A;  3PS6 A;  1HZ6 A;  4NQK E;  1T5X D;  3X23 A;  3MC9 A;  4S17 A;  1WR1 A;  2K8H A;  1E10 A;  4WJQ A;  3PO0 A;  3WAN A;  1HTQ A;  2J42 A;  4ZOH C;  5GXG B;  4KSL C;  3RYT A;  2I1K A;  2BBC A;  4M8N A;  1V2Y A;  3HK0 A;  4GSW A;  1WZ0 A;  4LDT D;  3ZDM C;  1YJI A;  1HTO A;  4W9F A;  1JWM D;  2WP9 B;  2KDB A;  5FK9 C;  3NZU A;  3Q8E A;  1N63 A;  4P1C C;  1WMH B;  1P7F A;  2K6Q A;  1JW9 D;  3DBH I;  1LFD A;  3FC4 A;  4EE2 A;  4KSK C;  2CHW A;  1QOF A;  3KUC B;  2BYV E;  4GU2 A;  4B0E A;  3AM9 A;  4NJC A;  2L0F A;  3NZ3 A;  2PIA A;  3A1Q A;  4D2K A;  4JIO U;  1YN5 A;  3PSE B;  2V4I B;  3JSV A;  3RNA C;  1YN3 A;  4OZC A;  4W9L A;  1NYQ A;  3MTN B;  3PPA A;  5HI1 A;  1F2R C;  3H9D A;  4DWF A;  4M00 A;  5G2N A;  1YN4 A;  2KYW A;  4HPL B;  3ZIM A;  2AQ2 B;  2GRI A;  2BWF A;  3RNE C;  3NUH B;  4WWO A;  3P4Q B;  1ET6 A;  2ZPY A;  4HJG E;  2GBM A;  2N4F A;  4A9A A;  2BGF A;  1M4V A;  4JLC A;  1XLO A;  3DWG C;  3ZLZ A;  4AOF A;  1NDD A;  4BOZ B;  1MPE A;  3URY A;  2GBK A;  3AH7 A;  3SHQ A;  5IP4 D;  1WI0 A;  2BS3 B;  2KKC A;  5HFY A;  4GGQ A;  5D2M B;  3O65 B;  1E90 A;  1L5P A;  1YD8 U;  2L05 A;  2KVR A;  4OZA A;  3SU8 X;  1QT9 A;  1L0Y B;  3H6N A;  1UGJ A;  3R8B A;  4CYE A;  1BUI C;  2IPK D;  2UWQ A;  3OG5 A;  5DPW A;  2NTS A;  3HHM A;  3HIZ A;  2FCS A;  3MC0 B;  3RZF A;  4GXB A;  4TSS A;  4XWW A;  1LXD A;  1WMH A;  2N1W A;  1TS3 A;  3IBE A;  2QIE B;  1ENF A;  4KZC A;  2BT6 A;  4M02 A;  4MM3 B;  1FXI A;  2M56 B;  1YJ1 A;  2INN E;  5BYS A;  1WJ4 A;  4K7S A;  1YJJ A;  1WZ3 A;  3TJP A;  4XZ4 A;  1R4M B;  1E8X A;  5E6P A;  5KHO A;  2WS3 B;  3PRM B;  4W9I A;  2LJ5 A;  2ASQ A;  5BMH A;  2N9X A;  3B2G A;  4LNI A;  3DBS A;  5T8I A;  3CWI A;  2NVU I;  2JRI B;  2KMA A;  2Q5W D;  4ANX A;  2PE9 A;  3APD A;  4A55 A;  1OFF A;  4R3D A;  3AV8 A;  4B95 A;  1GB1 A;  4BOS C;  2MLB A;  5BMI A;  2B3A A;  5G55 A;  1JRO A;  3R2T A;  4HDQ A;  4ARI A;  2BYT A;  3SEB A;  1L0V B;  4LJP B;  1SGH A;  3Q14 C;  2JX5 A;  3APF A;  2L1A A;  3L10 B;  1FCC C;  3V6E B;  3QK0 A;  1TKY A;  2FUG 1;  4B0M A;  4P1B C;  2KQ7 A;  5C1Z A;  4QAY A;  2BB5 A;  2L76 A;  3DVN V;  1QOA A;  1ROE A;  3AE4 B;  2N9P C;  2WQY B;  4M0W B;  2D5G A;  5IOI A;  5LXH A;  2RPQ A;  1JML A;  3RT3 B;  1NEK B;  1GUA B;  2WXK A;  3Q8A A;  2HE7 A;  4TQ0 A;  2VH1 A;  4M01 A;  5MPO A;  1SSN A;  5C3J B;  2WXL A;  3U4E G;  1UGM A;  3AB5 A;  2KQS A;  2PPH A;  3IT6 B;  2AL3 A;  2N7E A;  3FAH A;  2BQQ A;  3B9J A;  2KTR B;  3ML9 A;  4KGT A;  3Q8C A;  1GNU A;  2PVG C;  2K39 A;  1YQ4 B;  3GE3 C;  4MEL A;  2RR9 A;  5G5G A;  2NPT B;  5LNK 1;  3QAR A;  2V3S A;  3B1L X;  4MM3 A;  2IY1 B;  5BO4 B;  3N1X C;  2PW9 A;  1PQS A;  2KX0 A;  1L4Z B;  1N6Z A;  3LXF A;  1WX8 A;  2D11 A;  4KV2 A;  3PLV A;  3J9C A;  3T8M A;  2WDR B;  2MBB B;  2J0M A;  1N60 A;  1F9J A;  2DHZ A;  2B76 B;  3ZKJ C;  1WXQ A;  5LXI B;  3ZNI D;  1TS5 A;  1E7V A;  3MFG A;  4ZRP A;  2LMC A;  2RDH A;  3T9L A;  1J7B A;  1F52 A;  2A5U A;  4EZJ A;  5D3I B;  4MAC A;  1LGR A;  4FHK A;  3TEY A;  1E7P B;  2LVQ A;  3VUY A;  3EFU A;  4LLG M;  3RUL A;  1KF6 B;  2KC2 A;  4I6L B;  1XLP A;  3N1Z C;  3HRD D;  1I42 A;  5IKC M;  4YT0 B;  2D10 A;  1PDX A;  1TY0 A;  1P3Q U;  1SE4 A;  2WXJ A;  1PGX A;  1WFY A;  2REX A;  3L08 A;  3WIM A;  1BT0 A;  1QF6 A;  1QOB A;  5HG2 A;  3DBL B;  3BVG A;  1WYW B;  2JRH A;  1WGR A;  1WXS A;  3VTU A;  3AXC A;  2MJE A;  4OZB A;  2K22 A;  3P2B A;  1R4N B;  4M0W A;  5BYQ A;  3ZNZ B;  1SE3 A;  2ZW1 A;  2RD0 A;  3RD2 A;  2QIL A;  2WXP A;  4LNN A;  1CMX B;  2L8J A;  2LEK A;  5EE9 A;  1NI3 A;  3GP7 A;  2CKH B;  2W55 A;  4ZYN A;  1ZPS A;  4CHK A;  3NRZ A;  3PHW B;  4W9E A;  1RYJ A;  2KO3 A;  4MH8 A;  2R2O A;  3PGE A;  5AZG A;  1IBX B;  4O1N A;  2NPT A;  2VZK B;  1AWD A;  3HM3 A;  1KJT A;  2L00 B;  3ZYY X;  1J19 A;  5CTR C;  2JWU A;  2WU2 B;  2N9E B;  4IUM B;  3ZGZ A;  4IWQ A;  3V60 A;  3U7Z A;  1EWC A;  1FNU A;  3VQI A;  1PYW D;  3H7S A;  3QQ8 B;  3GOE A;  2LVP A;  1OQR A;  2J4X A;  3AU4 A;  1V49 A;  1VZ6 A;  4A20 A;  2EMT A;  4E74 A;  1V1P B;  5LLI A;  3AI5 A;  1EM7 A;  2KWD A;  1RWS A;  2ICI A;  3CST A;  1TGZ B;  2LHE A;  1Y8R C;  3JYU A;  1A70 A;  4BAX A;  2PEA A;  1VJK A;  2KDM A;  3KWL A;  3ZXV A;  4DBG A;  3AE6 B;  3BY4 B;  3LJ3 A;  3UI3 A;  2IBI B;  4IM0 A;  3MJ5 A;  1V81 A;  4A3P A;  3K9O B;  3Q2A C;  2KNB A;  2JZ3 B;  4NAM A;  4OHJ A;  4AQ7 A;  3CSF A;  1FRD A;  1VDV A;  2LZ6 A;  1P7E A;  1YMH E;  5AUK A;  3NVZ A;  1XCT L;  4HPM B;  1AN8 A;  2M19 A;  5TSS A;  2KFK A;  2HJ1 A;  2WXQ A;  2K6D B;  3AE1 B;  3AE9 B;  4KDL B;  2K25 A;  1IUE A;  5CHV C;  5EDS A;  3D32 A;  5HKH A;  4AWJ A;  2BW2 A;  1ISN A;  4P16 A;  1C77 A;  4TKN A;  3RNC C;  3PZ8 A;  2DLB A;  1JCK B;  4EUT A;  2A4Z A;  2V3N A;  3OLM D;  1FM0 D;  3JVZ X;  1WYG A;  1IBX A;  4XE0 A;  1SEB D;  3IHP C;  4W9H A;  4PS3 A;  2KQ4 X;  4WIP A;  1I4P A;  2JYE A;  2ONQ A;  2OJW A;  4LNK A;  3ZUN A;  2AYO B;  1UBQ A;  2ZVO A;  2OJR A;  1F1H A;  3A4S C;  3ML8 A;  1F2R I;  4HLE A;  2ACZ B;  1TTN A;  1WXV A;  2NBW B;  4REZ A;  4US8 A;  2MP2 B;  1K51 A;  4BZA A;  1UZX B;  1V1P A;  2L83 A;  2WU5 B;  3BK1 A;  2RPV A;  2KT7 A;  4HDO A;  1C78 A;  3DBR I;  1SBB B;  3NG0 A;  3ABV B;  1ZDX A;  1MFW A;  2O6V B;  2EEL A;  1U4A A;  3EEC A;  1QQR A;  1Q1O A;  1ZDV A;  1MHH E;  3ZVV A;  3ZJV A;  2BWE S;  2VH2 A;  3C19 A;  2HJ8 A;  4LCD E;  4WUR A;  1DYQ A;  4MGY E;  3PZD A;  2MA9 B;  3GE8 C;  5FR6 A;  2PVO D;  3LYY A;  3WA0 A;  2GOW A;  3KYC D;  2KN4 A;  3E56 A;  2WXG A;  2HTM E;  1I4H A;  3PT2 B;  1CQV A;  2KWV B;  1ACC A;  1FFU A;  2KC1 A;  4KIK B;  2Y3A A;  2C7N B;  3AEB B;  2INP E;  3V62 A;  3A4R A;  3MP9 A;  3HVD A;  2MBO A;  2BYF A;  1L6U A;  4RF1 A;  1SJH D;  2JVC A;  4EZK A;  2W3R A;  1WGD A;  4OW0 A;  4XX5 A;  2WLB A;  1E8W A;  3R66 C;  4C00 A;  3FKY A;  2DZM A;  4WJP A;  5GMV A;  2UYZ B;  4W9C A;  4HK2 A;  1EO6 A;  3U2S C;  5BMG A;  4IDI A;  1XLN A;  1UNS A;  2O2V B;  3UIO B;  1RM6 C;  3DDC B;  2N9L A;  1YNT E;  1SE9 A;  1Q5W B;  4K7W A;  4MGZ E;  3M62 B;  2WHI A;  4F1S A;  4DDG D;  1FNW A;  1VZ7 A;  1WGK A;  2GI9 A;  3PRP B;  1JWS D;  2L32 A;  3BYY B;  4I6N B;  2JUO A;  4K81 A;  1HEZ E;  3RMK C;  2LHD A;  4HVB A;  5JH5 C;  2O6V A;  1I4X A;  5EE1 A;  2O6V D;  4FBJ B;  5BYR A;  1LO5 D;  2HD5 B;  3B2F A;  4MDK E;  4UDU C;  3OJ4 B;  5E6O A;  3ZW3 A;  4WJN A;  1N5W A;  4A90 A;  2WNM A;  4XWT A;  2K3U A;  3BIN A;  3GZN B;  4WWN A;  3RZW C;  2MBH A;  4C7Y A;  1AW7 A;  3N30 A;  4HKQ A;  3AU5 A;  2FIF A;  3N20 C;  1ZOY B;  3Q8F A;  1MG8 A;  3CMM B;  2KJR A;  3BVZ A;  1TZO A;  1K50 A;  4KIK A;  4BFR A;  5EE0 A;  5L83 A;  4JL9 A;  1E0Z A;  2KWU B;  5FR3 A;  4DHZ B;  4YXD B;  1WX7 A;  3ZRC A;  3WCQ A;  5CHW A;  2SAK A;  3AEF B;  1Y56 A;  4XC2 A;  1WGH A;  1QKZ A;  3ZRF A;  3UQA A;  2OOB B;  4MGI E;  5IAA C;  2MH7 A;  3VH3 B;  3VDZ A;  3K9P B;  4MEM A;  1EU3 A;  3U8Z A;  1P1A A;  4FXC A;  1A5R A;  3EUB 2;  1VR9 A;  3ZNH B;  2O2V A;  1C4C A;  1JWA D;  4NJ6 A;  3SR6 A;  3VTV A;  4HKZ E;  4BKG A;  3N9Y C;  3M63 B;  3NVY A;  5JHB A;  2BKR B;  2PLP A;  4URK A;  3RNF C;  3PRZ A;  3ALB A;  2LGS A;  3IXS A;  2L52 A;  1XT9 B;  4ACF A;  1WE7 A;  3TBL D;  4GIV A;  2I38 A;  2QC8 A;  3L0W B;  4AJW A;  2LRW A;  1N5X A;  3QHT A;  1GAQ B;  1T0S C;  1OQY A;  2DNF A;  2NTT A;  4KGR A;  2MSE D;  1L6V A;  4ZHO A;  1YIW A;  3AUL A;  5DPR A;  1VCB A;  2J53 A;  4KVG B;  3ZTC A;  1UWX A;  1MJD A;  2IZV B;  3KW5 B;  4TQ1 A;  5AZF A;  2WDT B;  2GLS A;  4PS8 A;  4RGT A;  2LXC A;  3RNB C;  3PZ7 A;  2AL6 A;  4USA A;  2QDF A;  3BVM A;  2BF8 B;  2CHZ A;  2JXT A;  4OVZ A;  4IKG A;  3PHX B;  4IOI E;  2FAZ A;  2TSS A;  4PYZ A;  1ZGU B;  1T0R C;  3U7D A;  4ASW C;  1YQB A;  2N7J A;  2YVC A;  2SEB D;  1FXA A;  4CQN A;  3A9J B;  1HE8 A;  3QA8 A;  1Z5S B;  2JYT A;  4ITK A;  1TT5 B;  2EMS A;  3PRE A;  3TUO A;  2D07 B;  2XN9 C;  3AE3 B;  3VUX A;  1WH3 A;  3UQB A;  2WXH A;  2LRU A;  2QMT A;  5IA7 A;  2Z0E B;  1FNV A;  1FD6 A;  4AUQ C;  4AS1 A;  2KMC A;  1FRR A;  1S1Q B;  4W9K A;  2BYE A;  3AE8 B;  3TIX A;  2XK5 B;  3NVW A;  2V9H A;  1V5O A;  1FXT B;  1P98 A;  4RGO S;  3RFZ B;  4PK1 A;  3L17 A;  1PFD A;  1WY8 A;  1EF1 A;  5H92 C;  4J6I A;  5C23 A;  2BS2 B;  4YSZ B;  1GC6 A;  4JWU C;  3P4P B;  2WXM A;  4DQO C;  1KH0 A;  2AWT A;  1WJN A;  5J2R A;  1E9M A;  4OVV A;  3W1Y A;  3QX1 A;  3Q3O C;  4BKT A;  4CO7 A;  2LGI A;  5TR5 A;  4EOY A;  3H8H A;  2ZZP B;  2V3P A;  4AJY B;  1V8C A;  1MG4 A;  3MJW A;  3U52 E;  4KX6 B;  1T6B X;  3QWZ B;  4FUL A;  1T3Q A;  5IO9 A;  1AYF A;  1XEE A;  1N61 A;  2IY0 B;  4LNO A;  3VUW A;  1L7Y A;  2MCN B;  4EZL A;  2BTE A;  4C80 A;  4J3O D;  1VZ8 A;  4N59 A;  1TIF A;  3HM6 X;  1BXT A;  2NBU A;  2PE6 B;  4BBN C;  1YQ3 B;  3KVF B;  1KRH A;  3MHZ A;  1K52 A;  4YTN B;  1GJZ A;  5HHD G;  3M95 A;  1KFY B;  2G45 B;  2MBQ A;  1OGW A;  3A9J A;  3C8Y A;  2E6X A;  3BWU D;  2J0K A;  3KQ4 A;  2QHO A;  4H2A A;  4EEW A;  4JE3 B;  4G11 A;  4GOC A;  3VAW A;  4WWP A;  1WSP A;  2JXX A;  1ZKH A;  2CU1 A;  2K8C A;  3VHT C;  2K0P A;  3IFW B;  1L4D B;  2AQ1 B;  2KJH B;  2XK5 A;  1CJE A;  1KLV A;  4DHZ E;  3KUZ A;  4B6W A;  3PLU A;  4X57 B;  5L95 C;  4N58 A;  2KTR A;  1N62 A;  1UD7 A;  1V5T A;  2GBN A;  4N6E B;  3RCZ A;  2X8X X;  1QLB B;  2LAS A;  5G5H A;  1Q0W B;  2K8B A;  2LUM A;  3NZS A;  1IGC A;  3VRB B;  1I4G A;  2WGS A;  5D6J B;  2UU7 A;  4DXA B;  3L13 A;  3I3T B;  2CR5 A;  1I4R A;  1P0R A;  1Z2M A;  2X38 A;  1WX9 A;  1UBI A;  2YEP B;  3Q8B A;  1UEL A;  2N7D A;  1EWY C;  3Q3F A;  4XYC A;  2LUE A;  2BKF A;  4JQW C;  1R4M I;  2PMV A;  3OWE B;  3TSS A;  1V9J A;  2Y5C A;  4RFB A;  2MHJ A;  3DHI C;  4DK5 A;  2M17 A;  4YTM B;  3WAL A;  3AE7 B;  3DQV A;  1SE2 A;  3JW0 X;  3W5U B;  3VRA B;  3ZJT A;  4GDK B;  2MX2 A;  2G9H D;  3PVL A;  4OVU A;  2M0A A;  3ZTD A;  2WXI A;  2JZZ A;  2C5L C;  2LVO A;  2W54 A;  3O13 A;  4EKU A;  3VTW A;  2KAC A; 
#chains in the Genus database with same CATH homology
 3TEW A;  1L0Y B;  2AX5 A;  3MP9 A;  4L2Y A;  1UGJ A;  3HVD A;  2YEP F;  3NVV A;  3R8B A;  1BUI C;  3FIL B;  1L6U A;  3VR8 B;  2IPK D;  4RF1 A;  1SJH D;  2NTS A;  3MC0 B;  2W3R A;  4TSS A;  4OW0 A;  4XWW A;  1TS4 A;  1GPX A;  2WLB A;  1I7H A;  1TS3 A;  2N0S B;  4ZHP A;  2QIE B;  2H88 B;  1ENF A;  2W82 A;  1C4P A;  2BT6 A;  4HRO A;  1NEN B;  2MJ3 A;  3IAM 1;  4MM3 B;  1FXI A;  3EGR A;  2M56 B;  5H8Y E;  2MEK A;  1XLQ A;  2LFI A;  2INN E;  5BYS A;  1YJJ A;  3BYT B;  5AUI A;  4KKI A;  3U2S C;  3P4R B;  5BMG A;  1E6E B;  3SFD B;  3AED B;  1UUP A;  3IT4 B;  2WS3 B;  1XLN A;  4IDI A;  1UNS A;  4Q2J A;  2WDQ B;  3ZJU A;  1RM6 C;  2N9L A;  4JPS A;  5BMH A;  1YNT E;  3VR9 B;  3B2G A;  5T8I A;  1C4A A;  3CWI A;  3TEZ A;  5EE3 A;  1TY2 A;  2Q5W D;  2NMQ A;  1ZP0 B;  4A6Q A;  4C7Z A;  4A55 A;  1FNW A;  1VZ7 A;  1OFF A;  4R3D A;  1WGK A;  2GI9 A;  3AV8 A;  1GB1 A;  3AEA B;  1JWS D;  2L32 A;  3CIR B;  3BYY B;  5BMI A;  1JRO A;  1HEZ E;  3R2T A;  4ARI A;  2BYT A;  2LHD A;  1L0V B;  3SEB A;  3AE2 B;  4RF0 A;  4WWM A;  1I4X A;  2JX5 A;  3ETR A;  1D5X C;  1PGB A;  5EE1 A;  3V05 A;  4RH6 A;  3GS2 A;  2DYM A;  1DOY A;  2L1A A;  3NS1 A;  3L4P A;  3SFE B;  1FCC C;  5BYR A;  1LO5 D;  2PTL A;  3B2F A;  1TKY A;  2FUG 1;  4UDU C;  3DWM A;  1N5W A;  4B0M A;  2BB5 A;  2QSD A;  3ZQ4 A;  4A90 A;  1C79 A;  2QJL A;  1QOA A;  1XO3 A;  1ROE A;  2WNM A;  3E9S A;  4XWT A;  3AE4 B;  2K3U A;  1R7S A;  2WQY B;  1WWT A;  3R2I A;  2D5G A;  4C7Y A;  1ZUD 2;  3P1M A;  1AW7 A;  4HKQ A;  1NVI D;  3BZD B;  3AMZ A;  1TJE A;  1JML A;  2H89 B;  1ZOY B;  1NEK B;  3Q8F A;  2WXK A;  3Q8A A;  1B9R A;  4TQ0 A;  4L23 A;  3BVZ A;  1J7C A;  3W5V B;  1JRP A;  1K50 A;  1TZO A;  5MPO A;  1SSN A;  1I4Q A;  5C3J B;  1ZE3 D;  1JAL A;  2WXL A;  3U4E G;  3AB5 A;  5EE0 A;  3IT6 B;  1XF5 L;  3KWV A;  1DGJ A;  2GB1 A;  2K5P A;  4JWS C;  1OQQ A;  1C9F A;  1E0Z A;  3FIL A;  3FAH A;  5FR3 A;  3T3O A;  3B9J A;  2DWQ A;  4YXD B;  3KLS X;  4KGT A;  3WCQ A;  3Q8C A;  2PVG C;  2SAK A;  4YWG G;  4DXG A;  3TEX A;  1HA5 A;  1Y56 A;  1YQ4 B;  2W3S A;  3AEF B;  2I2Y A;  3HUI A;  3HVZ A;  1CK1 A;  5G5G A;  4TMA B;  1QKZ A;  1J7A A;  4XDC A;  2WXN A;  5LNK 1;  2MH7 A;  3Q69 A;  2Y5P A;  2IGH A;  1FEH A;  2PW9 A;  2RDG A;  1EU3 A;  1L4Z B;  3LXF A;  4FXC A;  2XNA C;  3J9C A;  3AN1 A;  2WDR B;  1VR9 A;  3EUB 2;  4RGM A;  1HXY D;  1N60 A;  2IDY A;  2B76 B;  4RCO A;  1C4C A;  1D5Z C;  1D5M C;  1WXQ A;  1EU4 A;  1QIL A;  1TS5 A;  2G1E A;  1JWA D;  3MFG A;  4ZRP A;  1DOX A;  2LMC A;  2RDH A;  1FO4 A;  3SR6 A;  4HKZ E;  4JX1 C;  1J7B A;  1XXG A;  1KLU D;  3N9Y C;  3NVY A;  5D3I B;  2KAJ A;  4MAC A;  3TEY A;  1E7P B;  2PLP A;  4LLG M;  1FFV A;  3LB8 C;  1TYG B;  1KF6 B;  2HDE A;  1XLP A;  3IXS A;  1HQR D;  2K9X A;  2L52 A;  2FE8 A;  3HRD D;  4A8X C;  2JZP A;  4YT0 B;  4P6V F;  2R61 A;  2I38 A;  1PDX A;  1N5X A;  1TY0 A;  1GAQ B;  2NTT A;  1SE4 A;  2WXJ A;  2WXF A;  4KGR A;  1PGX A;  1GOZ A;  2RMM A;  4WAF A;  1L6V A;  1V97 A;  4ZHO A;  2KMM A;  2J53 A;  2JSV X;  2FBW B;  3AEE B;  1QF6 A;  1JWB D;  1QOB A;  1UWX A;  4ZRQ A;  1C76 A;  4US9 A;  5HG2 A;  3BVG A;  4TQ1 A;  1D6E C;  4RGT A;  3PZ7 A;  2MJE A;  4OZB A;  4USA A;  2K22 A;  2EKI A;  1CZP A;  2DBY A;  3BVM A;  4M0W A;  5BYQ A;  5JXV A;  1SE3 A;  2ZW1 A;  2JXT A;  1QOG A;  2QIL A;  3V3X A;  4OVZ A;  4IKG A;  4IOI E;  2TSS A;  2WXP A;  1PUT A;  1STE A;  2LEK A;  4HEA 1;  2V0G A;  4KKJ A;  2E3T A;  3T3N A;  5EE9 A;  5I4D A;  2JQR B;  1NI3 A;  2N7J A;  2DYO A;  1FXA A;  1VLB A;  2SEB D;  2VZK D;  3GP7 A;  2W55 A;  4CQN A;  2WXO A;  3W2D A;  2JYT A;  1K53 A;  1SXT A;  1ZPS A;  4ITK A;  3TUO A;  3NRZ A;  3BK2 A;  2XN9 C;  3AE3 B;  3IAS 1;  1RYJ A;  4MH8 A;  4RGN A;  4MT5 A;  2WXH A;  1ZXH A;  2J52 A;  1IBX B;  4O1N A;  1SJE D;  2QMT A;  1F77 A;  2WDV B;  3EA6 A;  4NAW B;  4YSY B;  4RNA A;  2VZK B;  1DOI A;  1AWD A;  1FNV A;  1V1O A;  2Z8L A;  1FD6 A;  2N9K A;  1FIQ A;  3ZYY X;  4AS1 A;  1FRR A;  2IGD A;  1BML C;  2JWU A;  2WU2 B;  3AE8 B;  5D3D A;  3ZGZ A;  1ZXI A;  2JU6 X;  3NVW A;  1SB3 C;  2CJO A;  3U7Z A;  1SF0 A;  1EWC A;  1JWU D;  1FNU A;  3BII D;  4RGO S;  3RFZ B;  4ARC A;  3VQI A;  1PYW D;  4WH4 A;  1PFD A;  4ZYS A;  1F0Z A;  5H92 C;  1OQR A;  2J4X A;  2QEJ C;  4NZL B;  2BS2 B;  4YSZ B;  1VRA B;  1VZ6 A;  1KLG D;  4JWU C;  4L1B A;  1V1P B;  2WXM A;  3P4P B;  4DQO C;  4LTU A;  1KH0 A;  1EM7 A;  2KWD A;  1E9M A;  1ET9 A;  1MVK A;  1RWS A;  1XCQ L;  2AQ3 B;  2ICI A;  2MJD A;  2IGG A;  2ON8 A;  2LHE A;  3AEC B;  2LGI A;  2BS4 B;  1A70 A;  1TS2 A;  3H8H A;  3AE5 B;  2V3P A;  1KTK A;  1VJK A;  2KDM A;  3KWL A;  5D7G A;  1B1Z A;  1TKE A;  3AE6 B;  1V8C A;  2LJI A;  3P63 A;  2IJ0 A;  1RFK A;  3P42 A;  3U52 E;  4KX6 B;  4KGS A;  1UWM A;  3UI3 A;  1T6B X;  1L0X B;  1T3Q A;  3MJ5 A;  2BB6 A;  1AYF A;  1XEE A;  1FCL A;  4LK0 M;  4C56 C;  1N61 A;  1HZ6 A;  4NAM A;  1T5X D;  4OHJ A;  4AQ7 A;  3W1S A;  2BTE A;  4C80 A;  4J3O D;  1VZ8 A;  1FRD A;  1VDV A;  1E10 A;  4N59 A;  3PO0 A;  3I57 A;  1P7E A;  1YMH E;  2ZW0 A;  1BXT A;  3GB1 A;  5AUK A;  4YSX B;  3RPF C;  1YQ3 B;  2J42 A;  1XCT L;  1KRH A;  3MHZ A;  3NVZ A;  5FKA C;  4ZOH C;  2OHF A;  5GXG B;  1AN8 A;  2M19 A;  3AEG B;  4XDD A;  5TSS A;  2WXQ A;  1K52 A;  4YTN B;  3AE1 B;  3AE9 B;  1TKG A;  5HHD G;  1IUE A;  3P4S B;  1GB4 A;  1KFY B;  2BBC A;  2BW2 A;  3C8Y A;  2E6X A;  3BWU D;  4P16 A;  1C77 A;  4PT5 A;  3KQ4 A;  1YJI A;  4H2A A;  2CJN A;  3PZ8 A;  4JE3 B;  2DLB A;  1JCK B;  1JWM D;  1D4B A;  2WP9 B;  2V3N A;  1WSP A;  1FM0 D;  1FMA D;  5FK9 C;  3Q8E A;  1N63 A;  1WYG A;  1ESF A;  1IBX A;  1IGD A;  1P7F A;  2K0P A;  4GLS C;  1SEB D;  4XE0 A;  1JW9 D;  1L4D B;  2AQ1 B;  3FC4 A;  4EE2 A;  1MHX A;  4GDL B;  2KQ4 X;  4WIP A;  1QOF A;  1I4P A;  2JYE A;  2ONQ A;  1CJE A;  4B0E A;  3AM9 A;  4NJC A;  3NZ3 A;  2PIA A;  3W9C B;  4N58 A;  4D2K A;  1F2R I;  1N62 A;  1YN5 A;  2ACZ B;  1HZ5 A;  1WRI A;  2V4I B;  4N6E B;  4REZ A;  1QLB B;  4US8 A;  1K51 A;  1YN3 A;  5G5H A;  4OZC A;  1NYQ A;  1V1P A;  2LUM A;  2L83 A;  1IGC A;  5HI1 A;  1I4G A;  1F2R C;  2OED A;  3VRB B;  1MI0 A;  1PGA A;  2WU5 B;  1YN4 A;  3BK1 A;  2AQ2 B;  2GRI A;  5E6J A;  2RPV A;  1I4R A;  1C78 A;  3NUH B;  1SBB B;  3P4Q B;  2X38 A;  3ABV B;  1ET6 A;  1ZDX A;  4YTP B;  2YEP B;  3Q8B A;  2EEL A;  4HJG E;  1QQR A;  1EWY C;  1ZDV A;  4A9A A;  1M4V A;  1XLO A;  1MHH E;  3DWG C;  3ZJV A;  4HRS A;  2PMV A;  3OWE B;  3TSS A;  2Y5C A;  1NYR A;  4RFB A;  4WUR A;  1DYQ A;  4YTM B;  3AE7 B;  1SE2 A;  1MPE A;  3W5U B;  4WQM A;  3URY A;  3VRA B;  3ZJT A;  1SIJ A;  4DXF A;  4GDK B;  3AH7 A;  2PVO D;  3LYY A;  2G9H D;  1JQ4 A;  2BS3 B;  2KN4 A;  1Q10 A;  5HFY A;  3E56 A;  2WXG A;  2M0A A;  2WXR A;  2HTM E;  2PKO A;  1I4H A;  1L5P A;  2WXI A;  1CQV A;  5C2T B;  1ACC A;  2CU3 A;  2W54 A;  3I9V 1;  4OZA A;  3O13 A;  1FFU A;  2Y3A A;  2KAC A;  3AEB B;  1QT9 A;  2INP E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...