4NJCA

Rna polymerase interacting protein ykzg from geobacillus stearothermophilus
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
60
structure length
60
Chain Sequence
HHMIFKVFYQEDADEAPVREKTKTMYIEAESERDVRRKLEGRPINIEYIQPLEGAHLEYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title epsilon, a New Subunit of RNA Polymerase Found in Gram-Positive Bacteria
pubmed doi rcsb
molecule keywords Geobacillus stearothermophilus YkzG
source organism Geobacillus stearothermophilus
molecule tags Transcription
total genus 9
structure length 60
sequence length 60
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2013-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.730 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4njcA00
4NJCA
chains in the Genus database with same CATH superfamily
2IBIB 3K9OB 2N9XA 4KDLB 3H1UA 4DHZE 4KZCA 5IO9A 1KM7A 4MH0E 2BB5A 5E6JA 1UF0A 4G50A 1E0ZA 1EU4A 2Y3AA 5J18A 2KDIA 3M63B 2BYFA 1CJEA 1G6JA 4GOCA 2FUHB 3BY4B 3TSSA 1OEYJ 1YQ4B 2JYTA 2KXJA 3N9YC 1SE3A 3KW5B 1NVID 4FBJB 2M56B 5FR6A 2WXKA 1JWSD 3PZ7A 2PKOA 3ETRA 1T0SC 2IGHA 4FA6A 3VHTC 3W1SC 1FO4A 1VZ8A 4KSLC 2YLMA 1KJTA 5JHBA 3DHIC 1CMXB 4A6QA 4JWSC 2FCSA 2BBCA 2ZJDA 1C1YB 1EWYC 1TS4A 4W9HA 1TY0A 2GRIA 4US9A 3W5VB 5D7GA 1CQVA 1GB4A 3RMKC 3H7PA 4AQ7A 4NNJB 2K1FA 2N9LA 3EFCA 2WQYB 3DWGC 3SFDB 2MX2A 2M17A 1JWBD 2DLBA 2EELA 4GU2A 3Q6BA 4DXFA 1GG3A 3KYDD 3B0AA 3PZDA 4REZA 1YD8U 4AJWA 1HTOA 2KC2A 3JSVB 3K9PB 3QWZB 4HK2A 1MPEA 2ZW0A 2L32A 4B95A 4HJKA 2LRWA 4HDOA 4NQLB 4M8NA 2PW9A 2PVOD 2D11A 4EE2A 2WXHA 2WXGA 2IGGA 4YSYB 5L95C 1YQ3B 4LNFA 3HVZA 4K7WA 4RF0A 4W9CA 2O2VB 3CSFA 3U52E 1FCLA 3KH0A 3B08A 1K8RB 3VTWA 2FAZA 1MG8A 1DOYA 2DYMA 1IBXA 2INDC 2LXAA 1WX8A 3NUHB 5BYQA 2QMTA 4ACFA 1LQBA 2HTME 3I63C 1WFYA 2BGFA 2PJHA 3IFWB 1WMHB 4RF1A 1FCCC 3VUWA 1FFVA 1WRDB 3VRAB 2D3CA 2IYDB 4WWMA 5TR5A 2XEWA 3IHPC 3R8BA 2K3UA 1V97A 3J9CA 4WAFA 5C2TB 2L0FA 1FD6A 1V1PA 1A70A 4MT5A 5C3JB 4ANUA 1NDDA 5IKCM 1TKEA 1WGDA 3U7DA 1V9JA 5LLIA 2GB1A 3TEZA 4KGSA 1YN4A 4G3XB 1P98A 1E9MA 2AWTA 4GB9A 3WAPA 1GPXA 1E7PB 2K25A 2C60A 1SE9A 1ZE3D 3ZUNA 1MVKA 4AP4C 1WR6E 1I4GA 4LNNA 2LVOA 4D2KA 2QHOA 3GE3C 2KJRA 4W9FA 3ZTCA 5E6NA 3A9KB 2DZMA 4RGTA 2MCNB 4B0EA 1C4CA 3ENEA 4GDLB 4BBNF 2WXRA 3Q8BA 1F77A 4E74A 1UGMA 2VZKD 2WWZA 2WXJA 4K3CA 2B3AA 2NMQA 4A9AA 1EF5A 3URYA 5DPTA 2L52A 1HZ6A 4KDIC 4FXCA 3FKYA 1V6EA 2KLGA 1KFYB 2ICIA 1UH6A 3AE4B 3AXCA 3DVGY 4WJNA 5C23A 4EKUA 1VZ7A 3VFKA 4FADA 4ZOHC 4DHJB 5EDSA 1PDXA 1ACCA 4OVZA 4JPSA 3BK2A 2J0MA 2CHZA 2WYQA 3ZYYX 3X0WA 4G0NB 2RPQA 1ZOYB 2L3ZA 1SE2A 2RDHA 4ITKA 3CMMB 2WDRB 1A5RA 4S17A 2H89B 3DBHI 4RGMA 1F2RI 1M94A 3L10B 3N1ZC 1ROEA 2N9PC 3IVFA 3Q3FA 4YTMB 1FXIA 1UZXB 2RR9A 1F9JA 4H2AA 3AULA 2KMAA 2Z8LA 3RUIB 1J19A 1XF5L 4E71A 1NYQA 5EE1A 4WURA 1C79A 1TIFA 4AUQC 2N0SB 1L0YB 1RLFA 1ZUD2 4WWPA 1L7YA 3R2IA 3FC4A 4K1RB 2GBNA 2JXTA 3QJZA 4XX5A 2WXNA 2XBBC 1KF6B 2N9KA 5BMIA 2QSDA 3W2DA 2MBHA 4WJPA 2WDVB 3Q8EA 3P4RB 1JMLA 1WX7A 3EUB2 4XGAB 2ZW1A 5TSSA 5BYSA 3AE3B 2FIFA 2M19A 1SIFA 1P1AA 1EUVB 2NBVB 1WRIA 5AZHA 3A1QB 2DAFA 4G11A 5AZFA 1D5ZC 2HE7A 3RCZA 1VRAB 2RDBC 2OEDA 3BVGA 3DHGC 2CR5A 4O1NA 2KDEB 2MP2B 1UBIA 1LO5D 2J52A 4IC7B 3QC8B 2K9XA 4F8CB 1JWMD 1J7CA 4K7SA 2WNMA 3AMZA 1WYWB 4FHKA 3PV1A 1FXAA 3VR9B 3Q8CA 3U30A 2DWQA 2XN9C 3MC8A 1V2YA 1JRUA 1XD3B 2MH7A 4X57B 1P0RA 1WF9A 3RN9C 1WGRA 3PPAA 2BYTA 4HPMB 3P2BA 3O13A 3IT6B 5DPSA 4ZDVA 3AE6B 2NBUA 4YT0B 3MHZA 2FBWB 1IYFA 1YIWA 1DYQA 3M3JA 1RWSA 2JRIB 2RPVA 4K7UA 1JWAD 4IM2A 4Q2JA 1AN8A 2KK8A 3PREA 4P16A 3RULA 3AEDB 2KLCA 1NI2A 1HEZE 3Q14C 4NAMA 3A33B 1BXTA 3PRZA 1TBEA 3BK1A 3OWEB 2Q5WD 2WHIA 1KRHA 1FEHA 1WXAA 3Q3NC 2OHFA 1X1MA 4NJ6A 1MG4A 1ISNA 4IKGA 2KTRB 1LXDA 3DVGX 4A3OA 4DK5A 1XXGA 2LGYA 2UU7A 2WP9B 4MH8A 3TL5A 4WJQA 1JALA 2QIEB 3RNAC 2NBWB 3KYCD 2D3BA 1XLQA 4N58A 1TKGA 4LJOB 3NZUA 2LD9A 4FN2A 3NS1A 2MJDA 3B9JA 4M0WB 4IW0A 2KX3A 1YX6B 4MSMB 3OG5A 1Q0WB 2I1JA 1JW9D 1TT5B 1T3QA 4TQ0A 3AE1B 3CSTA 5CHFA 1T5XD 1SEBD 2N9EB 4NAWA 2JPHA 4DDID 1LGRA 4PT5A 1QKZA 3MTNB 2WXFA 3QHTA 2SEBD 1N61A 2JU6X 3NZSA 4GXBA 3FILB 2MBEA 2KMCA 4A8XC 4DHZB 3R2TA 2MHJA 3HRDD 2K22A 4K3BA 4LNKA 2SAKA 1HA5A 2GBRA 3ZQ4A 3RNEC 2FNJB 3PRPB 2N7JA 3Q69A 1PGXA 2ON8A 4ZRPA 3B2GA 2REXA 4EOYA 3WALA 1WSPA 4RMAA 4ICVA 3P4QB 1WGKA 1SJED 2O6VA 4FJZA 1FNWA 2JZZA 3DBRB 2GBMA 2KACA 2L8JA 3BVZA 4HCNB 3SHQA 3BWUD 1YNTE 3V05A 5HFYA 2GBKA 3WA0A 3ZDTA 1NYRA 4EEWA 1ENFA 2M0AA 2X38A 3ECIA 3I9V1 5DPRA 1J7AA 3ZNHB 1U4AA 5I4DA 4C00A 1XCTL 2BF8B 2Z0DB 1T0RC 4HKZE 4KIKA 4E3CA 2LFIA 1KOTA 2C7HA 2LUMA 1ZGUB 3ZJTA 1WZ3A 1MJDA 4GN1A 4RH6A 5DCNA 2IY1B 1ZXIA 4M02A 3L4PA 4IM3A 1M4VA 1DOIA 3AE8B 1EU3A 1IBXB 3TCAA 1FRRA 2RGFA 2O6VD 4HPPA 1E5WA 1L0XB 3HM6X 2W9NA 4WQOB 4RFBA 3ZNGC 1E8XA 4OZCA 2FCNA 4C56C 4M8MA 3HM3A 4I6LB 2IO0B 3P1MA 3U4EG 1UELA 1SXTA 3Q8FA 5FK9C 1GB1A 1SJHD 2KX0A 4BKSA 3L16A 4C4VB 1OQRA 1WGYA 3ZNID 1ET9A 3APFA 5DPWA 2FUG1 1T0YA 1NBFC 2ZVNA 4EZKA 3PHWB 2KWCA 3KQ4A 4B0MA 4MM3B 4WH4A 2HDEA 4LDTB 5JH5C 4YXDB 3AH7A 2BT6A 2KQ4X 3PTFC 1WJ6A 1H4RA 3RYTA 1LFDA 3NHEB 1QF6A 2DYBA 2RDGA 2JSVX 2MW5A 2ZEQA 4GLSC 3PVLA 4GDKB 2AQ1B 2D3AA 1GOZA 3BZDB 1HXYD 1TKYA 1KLVA 4MGYE 2FCQA 1N5WA 4XWWA 1SSNA 1FNUA 5G5HA 1L5PA 2AYOB 2IDYA 3CIRB 2JXXA 1AW7A 4HXDA 3QK0A 3N30A 3I57A 3L54A 2UWQA 3PZ8A 2EKEC 2KVRA 3DBRI 5HI1A 4BKSD 1QOGA 3BVMA 3MHSD 3KUDB 2CHXA 4R3DA 2YEPF 1F2RC 3LB8C 5LNK1 2G9HD 1Z2MA 1JQ4A 4JWUC 4MEMA 1WJNA 5AUKA 1YN3A 2TSSA 2CU1A 4IWPA 4MJSB 3JW0X 1OGWA 2KFJA 4DXGA 2HJ1A 1KLGD 1HE8A 3CF6E 3I3TB 3A9JB 2MEKA 4HJGE 2V0GA 3DDCB 2LHDA 2PEAA 4ZRKA 3TEWA 3SDLC 3PLVA 3UIOB 3SR6A 2KFKB 1KTKA 1QOBA 1ZXHA 1OFFA 4MGZE 3ZRCA 1PYWD 2XK5B 3LDZE 1QILA 1HQRD 3SFEB 2DZKA 3NG0A 1C4PA 4PYZA 3X23A 2V4LA 5E6OA 2BS2B 3KWLA 1XEEA 4XZ4A 3U8ZA 3E56A 2NVUI 2KNBA 1SB3C 2KC1A 4TMAB 4YTNB 1VLBA 3DVNU 4W9IA 2WXPA 1P7FA 2CJOA 3RNBC 2INNE 2LVPA 3JSVA 2MQJA 3R7QA 2MJ3A 3S2AA 3AECB 5H8YE 2DENB 1GC7A 2EMTA 3RZFA 2AQ2B 2BS4B 3BINA 2EKIA 3TUOA 1ZDVA 4W9EA 2KDBA 4GIVA 3UQBA 1V86A 3QCAA 2IY0B 1RAXA 2K5PA 2O2VA 1LM8B 2K8BA 1ET6A 2W3RA 2X8XX 3PO0A 3MC9A 4B6WA 1C3TA 3N3KB 2YEPB 3PS6A 1Q5WB 5G5GA 2RSUA 1J0GA 1YJIA 1WMHA 2PIAA 2C9WB 2RMMA 1FM0D 2CS4A 3NRZA 4P1BC 1WE7A 2MWSB 2G3QB 1TS3A 1IUEA 2NPTB 2AL6A 4FULA 1C9FA 4A55A 4GGQA 3EECA 2N4FA 1EWCA 1I4XA 1E7UA 1B1ZA 1TS2A 2FIDA 2LASA 5J2RA 1K50A 4P7IA 4IWQA 4IWOA 1WY8A 1PGAA 2H88B 2J53A 4TUUA 4AJYB 2ZNVC 1CK1A 3CWIA 2K8CA 2WDQB 1WI0A 3NS8A 1E8WA 3DBLB 3C8YA 2L05A 2KTFA 1GNUA 1QOFA 3A9KA 3ZGZA 3APCA 1XLOA 4KZ0A 4FHJA 4GDLA 2V3PA 1VR9A 2KANA 2IO1B 4KKJA 2Y5CA 2IO3B 2LRUA 4ZRQA 2GBJA 2MLBA 3HHMA 2IO2B 2IGDA 4AOFA 4RGNA 1OTRB 3QAQA 4GMVA 3W9CB 3DHHC 1WXSA 4WJOA 3NZ3A 1K51A 3U2SC 1HZ5A 3NVVA 3PRMB 4US8A 3Q3MC 3LXFA 2DAJA 1E7VA 2A4ZA 1WM2A 4YL8A 4WIPA 1I7HA 4NQKE 1IGDA 4NPNA 4XYCA 4DDGD 3VAWA 1WE6A 2G4DB 3T9LA 3EHVA 5KHOA 3JYUA 1WZ0A 1V80A 2ONQA 2MJEA 2R61A 4QAYA 4UDUC 3VH4B 2PE9A 2JY6A 2KT7A 1V81A 2K6DB 5H92C 5CHVC 2HJ8A 1L6VA 1AWDA 2ASQA 1F0ZA 2AX5A 4KKIA 3L0WB 2BVCA 3H7SA 2QILA 1C77A 3QIJA 1STEA 1OQYA 1KH0A 4XE0A 4ANWA 3BYTB 1NEKB 1WX9A 1L6UA 3M95A 1P3QU 1QOAA 2M8SA 4LLGM 1UWXA 3VR8B 3GOEA 1YJJA 1I4PA 4DHJD 2JRHA 4M01A 2DNFA 3TBLD 4LNIA 3AU4A 2LWPA 3PSEB 2WU5B 3N20C 3LJ3A 3DQVA 3IXSA 2KYWA 2OJWA 3A1QA 5IAAC 2N1VA 4BKTA 4ICUA 2C7MB 1UBQA 5GXGB 3MJ5A 2L0TA 2GI9A 4KV2A 3TMPB 2MP2A 2C5LC 3PHXB 1QT9A 4P6VF 3ZXVA 2IPKD 4YWGG 3L08A 5HKHA 3ZRFA 4BOZB 2D07B 3IG3A 2AEHA 4IM0A 4KGRA 2W82A 3IBEA 3WAMA 2V9HA 3DBLI 1K52A 2QJLA 1Y8RC 1T6BX 3B2FA 3DOWA 5JZEB 1H8CA 1TJEA 1BT0A 4EUTA 5LXIB 3H9DA 2OOBB 3PGEA 4XDCA 3TIXA 4ASWC 2GLSA 1RFKA 1TS5A 5CHWA 2DHZA 1OEYA 4URKA 1UUPA 1FXTB 4N59A 1SIJA 1JRPA 3VVWB 5E6PA 4ZYSA 4B9KA 3QARA 3DWMA 1FFUA 5D2MB 3T8MA 2L7RA 2WGSA 4YTPB 3SD5A 2XNAC 1RFAA 3ZIMA 2JZ3B 1WR1A 2JT4B 2LGSA 2ZCBA 1FPYA 4XC2A 4MACA 3V3XA 2EMSA 4HWIB 2WXMA 3GE8C 2RD0A 2PE6B 3H7PB 4JGHB 4PS8A 4K81A 3R7RA 2QEJC 1VCBA 4XDDA 3Q8AA 1N5XA 4F7ZA 5HG2A 2PLPA 3ALBA 1MI0A 5T8IA 4USAA 4RM8A 4WAAA 4BFRA 4TSSA 4RNAA 4W9GA 4EZLA 5LXHA 4BVUC 2KTRA 3ZJVA 3NVYA 1DOXA 3RT3B 2GMIC 4ARCA 1C4AA 3AE7B 2JWZA 1D6EC 3N1XC 1WJ4A 1PFDA 1I42A 1P7EA 3KLSX 5AUIA 5FR3A 1Z5SB 3LYYA 1SF0A 2L1AA 2FCMA 4OZAA 4JQWC 4EZJA 1MHHE 1BMLC 2JWUA 2R2OA 2KJHB 1C76A 4JE3B 4II2B 2WXOA 4TQ1A 2ZVOA 3P42A 4M0WA 2PTLA 2Y5PA 2W54A 2W3SA 2VZKB 2N7EA 4DBGA 4II3B 3WIMA 2LZ6A 3PLUA 1R4NB 2CJNA 1PQSA 4JLCA 3RNFC 3TEYA 3B1LX 1KLUD 4FJVB 4KGTA 5CX3A 4BOSC 2KVZA 2K8HA 2LEKA 1D5MC 2V3NA 3AN1A 1I4HA 3KWVA 5JXVA 2WLBA 2ZZPB 1RM6C 3FILA 2WX1A 1UD7A 4RCOA 3R3MA 3A4RA 2N7DA 3VTVA 1AYFA 5JHAA 2MBBB 1V1PB 3T3OA 1AARA 4JX1C 4JL9A 3UQAA 3EA6A 5G2NA 3M62B 3RNCC 3AV8A 1TTNA 3IAS1 2PPHA 2GOWA 2D2QA 3MC0B 4TV3A 4ANXA 4IUMB 1E10A 3NY5A 2BB6A 1ZKHA 3PT2B 2HTHA 4BAXA 1D3ZA 3RZWC 3EFUA 3EC8A 2W55A 3ZNZB 1WXMA 1L0VB 3ZLZA 1WXVA 3DBHB 2DYOA 1D5XC 3UGBB 1V5OA 5IP4D 4HCPB 1IP9A 2JF5A 3DVNV 3WANA 3UI3A 4XWTA 1WGHA 1R4MB 3U7ZA 3V6EB 1E8ZA 1IPGA 4ANVA 3QA8A 3BIID 4MELA 1GC6A 4IG7B 4AWJA 2V1YA 1P9DU 2KZRA 4PS7A 3W1YA 5EE0A 3HVDA 2KAJA 3W1SA 3AEEB 1QQRA 2BWFA 2NCNA 2PMVA 1FRDA 4JIOU 2D5GA 3RFZB 3ZDMC 1RRBA 3VXWA 3ABVB 2DZJA 2Y5BB 1Y56A 1V8CA 2FE8A 1EM7A 4DXAB 3UINB 1TZ1A 3OJ4B 5L83A 3UF8A 5IOIA 4N6EB 4C4VA 3MJWA 1IGCA 4RGOS 4WWOA 1D4BA 1UNSA 1XCQL 4I6PA 1QLBB 1YJ1A 4HLEA 5BMHA 1GJZA 4MM3A 1CZPA 3T3NA 3GB1A 2QC8A 2LXCA 4L23A 4ZRIA 3ZVVA 1R4NI 3ZKJC 2NTSA 4HDQA 2HD5B 2Z59B 3H6NA 1WXQA 1NI3A 2M4NA 1YOVB 1SBBB 1WIAA 3WAOA 3V61A 1MHXA 2DZIA 4GDKA 4OHJA 5AZGA 3O65B 2G45B 4CYEA 1L4DB 2B76B 2LJ5A 3V62A 4OVVA 3NJTA 1I4RA 2DBYA 1YN5A 2M1MA 3AEBB 2JUOA 2JYEA 5BO4B 4ZHPA 1GUAB 1XQQA 4KSKC 1I35A 1V49A 5AEKB 5EE9A 2KKCA 5EE3A 2JVCA 3RD2A 2PVGC 4M00A 1F52A 3ZJUA 2J0JA 2L83A 2WXLA 4N9F4 2MA9B 1TGZB 1ESFA 3TEXA 2D3GA 2KDFB 3AU5A 2A5UA 4MJSA 2JQRB 3IAM1 4CHKA 2CHWA 3V6CB 4P1CC 1VD2A 5HHDG 4NJ7A 4LDTD 4PS3A 3ML8A 4S0RA 3KUCB 3A9JA 3P4SB 4MGKE 4W9LA 2BW2A 4A20A 1FMAD 2V3SA 2INCC 2VRRB 1T0QC 2K39A 2VH1A 2ZNVB 4AS1A 1WH3A 1DGJA 2BYEA 4CQNA 4C7ZA 1ZW7A 2KFKA 2KJ6A 2L76A 3Q3OC 4FLHA 1R4MI 1GAQB 1XLNA 2JZPA 2R2QA 3APDA 2WXIA 2XK5A 2D10A 4DQOC 4NZLB 3QX1A 3DCGA 3AM9A 2J42A 2AL3A 2I38A 2MBOA 4BKGA 1V5TA 2MSED 4IDIA 4ZYNA 3D32A 3VH3B 1YX5B 1OQQA 4HVBA 4MSQB 4A3PA 2KN5A 4F1SA 3L13A 2WS3B 4C7YA 1EO6A 1S1QB 1EF1A 5D6JB 3L17A 5IA7A 2CKHB 3IT4B 1N60A 1YMHE 1F1HA 1JWUD 4C80A 3GZNB 3AE9B 2LGDA 3JVZX 1XO3A 3DPDA 4BBNC 3VRBB 2JX5A 4IOIE 4BZAA 1UWMA 4RM9A 2Z0EB 4KVGB 3KUZA 3DBSA 1FNVA 4KX6B 4PK1A 3RPFC 4ZRJA 3TJPA 1VJKA 4J6IA 2MRPA 1L2NA 2VH2A 2I1KA 2LVQA 1PGBA 4L1BA 1WJUA 3N32A 2UYZB 3H8HA 4GSWA 3V60A 2I2YA 4NAWB 4A90A 4MGIE 3NOBA 2KOXA 2KQSA 3ZTDA 4LJPB 2N1WA 3VDZA 5J17A 3OLMD 2J0KA 3BYYB 5CTRC 2NPTA 1VDVA 1PUTA 2BPSA 4ZHOA 5G55A 2KWDA 2LGXA 4HKQA 4LK0M 3QQ8B 2NR2A 3AI5A 2NTTA 4LCDE 2BKFA 2KO3A 3ONSA 1R7SA 1E8YA 3SEBA 2O6VB 1XT9B 1MFWA 3HK0A 3FAHA 4NJCA 2KWVB 3VUXA 2KN4A 4PYUA 4W9KA 3P4PB 4LTUA 2LJIA 3AB5A 2V4IB 3KVFB 1HTQA 3Q3JA 3RNGC 2BTEA 2MBQA 3A4SC 4I6NB 2BWES 3EGRA 1FIQA 1V1OA 1WGGA 2G4SA 3MFGA 3AEAB 4EFOA 3HUIA 3C19A 1Q10A 2E3TA 3W5UB 2BQQA 2J7QB 3NVZA 3VTUA 4KIKB 2ACZB 4OW0A 2WDTB 1L4ZB 3ZW3A 4WWNA 1YQBA 1E6EB 4YSZB 4HEA1 2C7NB 3AE5B 4HROA 1Q1OA 4OVUA 3Q2AC 2KMMA 3RI7C 2L00B 2WXQA 4HRSA 1N6ZA 1WM3A 1JCKB 2YVCA 1SE4A 4MDKE 2K0PA 1JROA 2BKRB 3N1YC 4FJYA 4W9DA 4L2YA 3GP7A 1I4QA 2KHWB 2IJ0A 2LI5A 5MPOA 2KWUB 3MP9A 1XLPA 2CU3A 4YSXB 2WX0A 3P63A 2KDMA 5D3DA 3GS2A 3ZO5B 1VZ6A 2ZCCA 4OZBA 4CO7A 1ZP0B 4WQMA 5BYRA 2LMCA 1QZEA 3ML9A 2WU2B 3GZNI 5FKAC 2BS3B 5KHQA 2QCZA 1E90A 2M0XA 1ZPSA 3AE2B 3OAWA 1K53A 5C1ZA 3OJ3A 5GMVA 2LGIA 2QDFA 4NY0A 2INPE 2ZPNA 3HIZA 3WCQA 2KD0A 2LHEA 1TY2A 5BMGA 1N63A 4W9JA 2K6QA 1C78A 1UGJA 2AQ3B 2IZVB 2J4XA 2E6XA 1TYGB 4HPLB 1S3SG 4J3OD 3VQIA 3UIPB 1WWTA 3NVWA 1J7BA 5D3IB 1TZOA 2LUEA 3AEFB 1NENB 2G1EA 2ZPYA 3AEGB 1BUIC 3VUYA 3I5JC 4DWFA 4ARIA 3E9SA 1WYGA 2DX5B 2OJRA 3SU8X 1J8CA 4LNOA 1RYJA 3ZXRA 1N62A 4TKNA 5D94A 2BYVE 1ZDXA 1B9RA 3R66C 2NS5A 5IN7A 1SGHA 2KQ7A 3C0RB
chains in the Genus database with same CATH topology
2WP9B 4MH8A 1CK1A 3CWIA 1JALA 2QIEB 2WDQB 2BB5A 5E6JA 3C8YA 1XLQA 1E0ZA 1EU4A 2Y3AA 1QOFA 4N6EB 3ZGZA 4N58A 1CJEA 1IGCA 1XLOA 4RGOS 1TKGA 2V3PA 3TSSA 1VR9A 1D4BA 3NS1A 1UNSA 1XCQL 5BMHA 1QLBB 2MJDA 4KKJA 1YQ4B 3B9JA 1CZPA 3T3NA 3GB1A 2JYTA 2Y5CA 3N9YC 1SE3A 1NVID 4ZRQA 2M56B 4L23A 2WXKA 1JWSD 3PZ7A 2PKOA 3ETRA 2NTSA 2IGDA 2IGHA 1JW9D 1FO4A 4RGNA 3W9CB 1T3QA 1WXQA 1NI3A 1VZ8A 3AE1B 4TQ0A 1T5XD 1SEBD 4A6QA 4JWSC 1SBBB 2BBCA 3NZ3A 1K51A 1EWYC 1TS4A 4PT5A 1QKZA 3U2SC 2WXFA 1MHXA 1TY0A 4OHJA 2GRIA 4US9A 3W5VB 5D7GA 1HZ5A 1CQVA 3NVVA 4US8A 2SEBD 1GB4A 1N61A 2JU6X 3LXFA 4AQ7A 3FILB 2N9LA 2WQYB 1L4DB 4A8XC 2B76B 3DWGC 4WIPA 3SFDB 1I7HA 1IGDA 3R2TA 3HRDD 2K22A 1JWBD 2DLBA 2EELA 2SAKA 1I4RA 1HA5A 3ZQ4A 2DBYA 1YN5A 4DXFA 3AEBB 2JYEA 2N7JA 3Q69A 1PGXA 2ON8A 4ZRPA 4REZA 2ONQA 4ZHPA 3B2GA 2MJEA 2R61A 4UDUC 1WSPA 3P4QB 1WGKA 1SJED 5H92C 5EE9A 1FNWA 5EE3A 1MPEA 1L6VA 2PVGC 2ZW0A 1AWDA 3ZJUA 2KACA 2L83A 2WXLA 1F0ZA 3BVZA 2AX5A 2L32A 4KKIA 1ESFA 3TEXA 2PW9A 2QILA 1YNTE 3BWUD 3V05A 2PVOD 5HFYA 4EE2A 1C77A 2WXHA 1STEA 2JQRB 2WXGA 3IAM1 1NYRA 1KH0A 5HHDG 1ENFA 4XE0A 2M0AA 2IGGA 4YSYB 2X38A 3BYTB 1YQ3B 1NEKB 3HVZA 4RF0A 3I9V1 3U52E 1FCLA 3P4SB 1L6UA 2BW2A 1J7AA 1FMAD 5I4DA 4AS1A 1QOAA 1DGJA 1DOYA 1XCTL 4LLGM 1UWXA 3VR8B 1YJJA 4CQNA 2DYMA 1IBXA 4C7ZA 1I4PA 4HKZE 3NUHB 5BYQA 2QMTA 2LFIA 2HTME 2LUMA 1GAQB 1XLNA 3ZJTA 2JZPA 4RF1A 1FCCC 1FFVA 3VRAB 2WXIA 4DQOC 2WU5B 4NZLB 4WWMA 3AM9A 2J42A 3IXSA 4RH6A 2I38A 3R8BA 2K3UA 1ZXIA 1V97A 3J9CA 4WAFA 3L4PA 4IDIA 5C2TB 5GXGB 1M4VA 3MJ5A 1DOIA 2GI9A 3AE8B 1FD6A 1V1PA 1A70A 1OQQA 4MT5A 5C3JB 1EU3A 1IBXB 1TKEA 1FRRA 1QT9A 4P6VF 1L0XB 2IPKD 2GB1A 4YWGG 4RFBA 3TEZA 4KGSA 4OZCA 1YN4A 4C56C 1E9MA 2WS3B 4C7YA 1GPXA 1E7PB 3P1MA 3U4EG 1ZE3D 4KGRA 1SXTA 2W82A 1MVKA 3Q8FA 5FK9C 1I4GA 1K52A 2QJLA 4D2KA 1GB1A 1T6BX 1SJHD 3B2FA 3IT4B 1N60A 1TJEA 1OQRA 1YMHE 4RGTA 1ET9A 1JWUD 4C80A 4B0EA 4XDCA 2FUG1 1C4CA 3AE9B 4GDLB 1RFKA 1XO3A 1TS5A 2WXRA 3Q8BA 1F77A 1UUPA 3KQ4A 4B0MA 4N59A 2VZKD 3VRBB 1SIJA 2JX5A 4MM3B 4IOIE 2WXJA 1UWMA 4WH4A 1JRPA 2HDEA 4ZYSA 1FNVA 4KX6B 2NMQA 4A9AA 3RPFC 3URYA 4YXDB 3DWMA 1FFUA 2L52A 3AH7A 1HZ6A 1VJKA 2BT6A 2KQ4X 4YTPB 4FXCA 2XNAC 1PGBA 1KFYB 2ICIA 4L1BA 3AE4B 4MACA 3V3XA 3H8HA 1QF6A 2I2YA 4NAWB 4A90A 2RDGA 1VZ7A 2WXMA 2JSVX 4GLSC 4ZOHC 4GDKB 1PDXA 2AQ1B 1GOZA 3BZDB 1HXYD 1ACCA 1TKYA 4OVZA 4JPSA 3BK2A 2QEJC 4XDDA 1N5WA 3Q8AA 1N5XA 1SSNA 3BYYB 1FNUA 4XWWA 5HG2A 1VDVA 1PUTA 2PLPA 5G5HA 1L5PA 3ZYYX 1MI0A 5T8IA 4USAA 2IDYA 1ZOYB 3CIRB 1SE2A 4ZHOA 2RDHA 4ITKA 4TSSA 2WDRB 4RNAA 1AW7A 2KWDA 4HKQA 4LK0M 2H89B 4RGMA 1F2RI 3ZJVA 3I57A 3NVYA 2NTTA 1DOXA 1ROEA 4YTMB 1FXIA 3PZ8A 5HI1A 1R7SA 1QOGA 3SEBA 4ARCA 3BVMA 1C4AA 4H2AA 3AE7B 4R3DA 2YEPF 1F2RC 3LB8C 5LNK1 2G9HD 2Z8LA 3FAHA 4NJCA 2KN4A 1XF5L 1D6EC 3P4PB 4LTUA 1JQ4A 4JWUC 1PFDA 2LJIA 1P7EA 3AB5A 2V4IB 3KLSX 5AUIA 1NYQA 5AUKA 1YN3A 2TSSA 5FR3A 5EE1A 4WURA 3LYYA 1SF0A 1C79A 2L1AA 4OZAA 2N0SB 1L0YB 1BMLC 1MHHE 1ZUD2 2JWUA 3R2IA 2BTEA 3FC4A 4DXGA 1C76A 1KLGD 4JE3B 4HJGE 2MEKA 2WXOA 3EGRA 1FIQA 4TQ1A 3P42A 1V1OA 4M0WA 2V0GA 2LHDA 2PTLA 2Y5PA 2W54A 2JXTA 3MFGA 3TEWA 3AEAB 2W3SA 3HUIA 1Q10A 2E3TA 2VZKB 2WXNA 1KF6B 3W5UB 2N9KA 5BMIA 3NVZA 2QSDA 3W2DA 3SR6A 2CJNA 2WDVB 3Q8EA 3P4RB 1KTKA 1JMLA 1QOBA 1ZXHA 1OFFA 2ACZB 3EUB2 4OW0A 1L4ZB 2ZW1A 5TSSA 3TEYA 5BYSA 1PYWD 1KLUD 3AE3B 2M19A 4KGTA 1E6EB 4YSZB 4HEA1 3AE5B 1QILA 4HROA 2LEKA 1D5MC 1HQRD 2KMMA 2V3NA 3SFEB 1C4PA 1WRIA 3AN1A 1I4HA 3KWVA 5JXVA 2WLBA 2WXQA 4HRSA 1RM6C 3FILA 1JCKB 4RCOA 1D5ZC 1SE4A 1VRAB 2BS2B 2K0PA 1JROA 3KWLA 2OEDA 1AYFA 3BVGA 4O1NA 4L2YA 3GP7A 1I4QA 1XEEA 1V1PB 1LO5D 3E56A 2IJ0A 3T3OA 2J52A 4JX1C 5MPOA 1SB3C 3EA6A 2K9XA 3MP9A 4TMAB 1XLPA 4YTNB 1JWMD 1VLBA 2CU3A 1J7CA 4YSXB 2WXPA 2WNMA 3P63A 2KDMA 1P7FA 2CJOA 3AMZA 2INNE 3AV8A 1FXAA 3VR9B 2MJ3A 3IAS1 3AECB 5D3DA 3Q8CA 3GS2A 5H8YE 2DWQA 2XN9C 1VZ6A 4OZBA 3MC0B 1ZP0B 4WQMA 5BYRA 2LMCA 1E10A 2MH7A 2AQ2B 2WU2B 2BB6A 2BS4B 5FKAC 2EKIA 3TUOA 1ZDVA 2BS3B 2BYTA 2W55A 3O13A 2K5PA 1ZPSA 3AE2B 3IT6B 1L0VB 1K53A 3AE6B 1ET6A 2W3RA 4YT0B 2LGIA 3MHZA 2FBWB 2INPE 3WCQA 2DYOA 1D5XC 3PO0A 2LHEA 1DYQA 2YEPB 1RWSA 2RPVA 1TY2A 5BMGA 1N63A 5G5GA 1JWAD 4Q2JA 1C78A 1UGJA 2AQ3B 1AN8A 2J4XA 3UI3A 2E6XA 4XWTA 4P16A 1YJIA 1TYGB 3AEDB 3U7ZA 4NAMA 1HEZE 2PIAA 2RMMA 1FM0D 1BXTA 3BIID 3NRZA 4J3OD 3VQIA 3BK1A 1WWTA 3OWEB 3NVWA 1J7BA 1IUEA 1TS3A 2Q5WD 1TZOA 5D3IB 1KRHA 3AEFB 1FEHA 1NENB 2G1EA 3AEGB 5EE0A 1C9FA 1BUIC 4A55A 3HVDA 4ARIA 1WYGA 3E9SA 1EWCA 1I4XA 2OHFA 2KAJA 3W1SA 1QQRA 3AEEB 1B1ZA 1RYJA 2PMVA 1TS2A 1N62A 1FRDA 1K50A 2D5GA 3RFZB 1ZDXA 1B9RA 4IKGA 3ABVB 1PGAA 2H88B 2J53A 1XXGA 1Y56A 1V8CA 2FE8A 1EM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NJC A; 
#chains in the Genus database with same CATH topology
 2IBI B;  3K9O B;  2N9X A;  4KDL B;  3H1U A;  4DHZ E;  4KZC A;  5IO9 A;  1KM7 A;  4MH0 E;  2BB5 A;  5E6J A;  1UF0 A;  4G50 A;  1E0Z A;  1EU4 A;  2Y3A A;  5J18 A;  2KDI A;  3M63 B;  2BYF A;  1CJE A;  1G6J A;  4GOC A;  2FUH B;  3BY4 B;  3TSS A;  1OEY J;  1YQ4 B;  2JYT A;  2KXJ A;  3N9Y C;  1SE3 A;  3KW5 B;  1NVI D;  4FBJ B;  2M56 B;  5FR6 A;  2WXK A;  1JWS D;  3PZ7 A;  2PKO A;  3ETR A;  1T0S C;  2IGH A;  4FA6 A;  3VHT C;  3W1S C;  1FO4 A;  1VZ8 A;  4KSL C;  2YLM A;  1KJT A;  5JHB A;  3DHI C;  1CMX B;  4A6Q A;  4JWS C;  2FCS A;  2BBC A;  2ZJD A;  1C1Y B;  1EWY C;  1TS4 A;  4W9H A;  1TY0 A;  2GRI A;  4US9 A;  3W5V B;  5D7G A;  1CQV A;  1GB4 A;  3RMK C;  3H7P A;  4AQ7 A;  4NNJ B;  2K1F A;  2N9L A;  3EFC A;  2WQY B;  3DWG C;  3SFD B;  2MX2 A;  2M17 A;  1JWB D;  2DLB A;  2EEL A;  4GU2 A;  3Q6B A;  4DXF A;  1GG3 A;  3KYD D;  3B0A A;  3PZD A;  4REZ A;  1YD8 U;  4AJW A;  1HTO A;  2KC2 A;  3JSV B;  3K9P B;  3QWZ B;  4HK2 A;  1MPE A;  2ZW0 A;  2L32 A;  4B95 A;  4HJK A;  2LRW A;  4HDO A;  4NQL B;  4M8N A;  2PW9 A;  2PVO D;  2D11 A;  4EE2 A;  2WXH A;  2WXG A;  2IGG A;  4YSY B;  5L95 C;  1YQ3 B;  4LNF A;  3HVZ A;  4K7W A;  4RF0 A;  4W9C A;  2O2V B;  3CSF A;  3U52 E;  1FCL A;  3KH0 A;  3B08 A;  1K8R B;  3VTW A;  2FAZ A;  1MG8 A;  1DOY A;  2DYM A;  1IBX A;  2IND C;  2LXA A;  1WX8 A;  3NUH B;  5BYQ A;  2QMT A;  4ACF A;  1LQB A;  2HTM E;  3I63 C;  1WFY A;  2BGF A;  2PJH A;  3IFW B;  1WMH B;  4RF1 A;  1FCC C;  3VUW A;  1FFV A;  1WRD B;  3VRA B;  2D3C A;  2IYD B;  4WWM A;  5TR5 A;  2XEW A;  3IHP C;  3R8B A;  2K3U A;  1V97 A;  3J9C A;  4WAF A;  5C2T B;  2L0F A;  1FD6 A;  1V1P A;  1A70 A;  4MT5 A;  5C3J B;  4ANU A;  1NDD A;  5IKC M;  1TKE A;  1WGD A;  3U7D A;  1V9J A;  5LLI A;  2GB1 A;  3TEZ A;  4KGS A;  1YN4 A;  4G3X B;  1P98 A;  1E9M A;  2AWT A;  4GB9 A;  3WAP A;  1GPX A;  1E7P B;  2K25 A;  2C60 A;  1SE9 A;  1ZE3 D;  3ZUN A;  1MVK A;  4AP4 C;  1WR6 E;  1I4G A;  4LNN A;  2LVO A;  4D2K A;  2QHO A;  3GE3 C;  2KJR A;  4W9F A;  3ZTC A;  5E6N A;  3A9K B;  2DZM A;  4RGT A;  2MCN B;  4B0E A;  1C4C A;  3ENE A;  4GDL B;  4BBN F;  2WXR A;  3Q8B A;  1F77 A;  4E74 A;  1UGM A;  2VZK D;  2WWZ A;  2WXJ A;  4K3C A;  2B3A A;  2NMQ A;  4A9A A;  1EF5 A;  3URY A;  5DPT A;  2L52 A;  1HZ6 A;  4KDI C;  4FXC A;  3FKY A;  1V6E A;  2KLG A;  1KFY B;  2ICI A;  1UH6 A;  3AE4 B;  3AXC A;  3DVG Y;  4WJN A;  5C23 A;  4EKU A;  1VZ7 A;  3VFK A;  4FAD A;  4ZOH C;  4DHJ B;  5EDS A;  1PDX A;  1ACC A;  4OVZ A;  4JPS A;  3BK2 A;  2J0M A;  2CHZ A;  2WYQ A;  3ZYY X;  3X0W A;  4G0N B;  2RPQ A;  1ZOY B;  2L3Z A;  1SE2 A;  2RDH A;  4ITK A;  3CMM B;  2WDR B;  1A5R A;  4S17 A;  2H89 B;  3DBH I;  4RGM A;  1F2R I;  1M94 A;  3L10 B;  3N1Z C;  1ROE A;  2N9P C;  3IVF A;  3Q3F A;  4YTM B;  1FXI A;  1UZX B;  2RR9 A;  1F9J A;  4H2A A;  3AUL A;  2KMA A;  2Z8L A;  3RUI B;  1J19 A;  1XF5 L;  4E71 A;  1NYQ A;  5EE1 A;  4WUR A;  1C79 A;  1TIF A;  4AUQ C;  2N0S B;  1L0Y B;  1RLF A;  1ZUD 2;  4WWP A;  1L7Y A;  3R2I A;  3FC4 A;  4K1R B;  2GBN A;  2JXT A;  3QJZ A;  4XX5 A;  2WXN A;  2XBB C;  1KF6 B;  2N9K A;  5BMI A;  2QSD A;  3W2D A;  2MBH A;  4WJP A;  2WDV B;  3Q8E A;  3P4R B;  1JML A;  1WX7 A;  3EUB 2;  4XGA B;  2ZW1 A;  5TSS A;  5BYS A;  3AE3 B;  2FIF A;  2M19 A;  1SIF A;  1P1A A;  1EUV B;  2NBV B;  1WRI A;  5AZH A;  3A1Q B;  2DAF A;  4G11 A;  5AZF A;  1D5Z C;  2HE7 A;  3RCZ A;  1VRA B;  2RDB C;  2OED A;  3BVG A;  3DHG C;  2CR5 A;  4O1N A;  2KDE B;  2MP2 B;  1UBI A;  1LO5 D;  2J52 A;  4IC7 B;  3QC8 B;  2K9X A;  4F8C B;  1JWM D;  1J7C A;  4K7S A;  2WNM A;  3AMZ A;  1WYW B;  4FHK A;  3PV1 A;  1FXA A;  3VR9 B;  3Q8C A;  3U30 A;  2DWQ A;  2XN9 C;  3MC8 A;  1V2Y A;  1JRU A;  1XD3 B;  2MH7 A;  4X57 B;  1P0R A;  1WF9 A;  3RN9 C;  1WGR A;  3PPA A;  2BYT A;  4HPM B;  3P2B A;  3O13 A;  3IT6 B;  5DPS A;  4ZDV A;  3AE6 B;  2NBU A;  4YT0 B;  3MHZ A;  2FBW B;  1IYF A;  1YIW A;  1DYQ A;  3M3J A;  1RWS A;  2JRI B;  2RPV A;  4K7U A;  1JWA D;  4IM2 A;  4Q2J A;  1AN8 A;  2KK8 A;  3PRE A;  4P16 A;  3RUL A;  3AED B;  2KLC A;  1NI2 A;  1HEZ E;  3Q14 C;  4NAM A;  3A33 B;  1BXT A;  3PRZ A;  1TBE A;  3BK1 A;  3OWE B;  2Q5W D;  2WHI A;  1KRH A;  1FEH A;  1WXA A;  3Q3N C;  2OHF A;  1X1M A;  4NJ6 A;  1MG4 A;  1ISN A;  4IKG A;  2KTR B;  1LXD A;  3DVG X;  4A3O A;  4DK5 A;  1XXG A;  2LGY A;  2UU7 A;  2WP9 B;  4MH8 A;  3TL5 A;  4WJQ A;  1JAL A;  2QIE B;  3RNA C;  2NBW B;  3KYC D;  2D3B A;  1XLQ A;  4N58 A;  1TKG A;  4LJO B;  3NZU A;  2LD9 A;  4FN2 A;  3NS1 A;  2MJD A;  3B9J A;  4M0W B;  4IW0 A;  2KX3 A;  1YX6 B;  4MSM B;  3OG5 A;  1Q0W B;  2I1J A;  1JW9 D;  1TT5 B;  1T3Q A;  4TQ0 A;  3AE1 B;  3CST A;  5CHF A;  1T5X D;  1SEB D;  2N9E B;  4NAW A;  2JPH A;  4DDI D;  1LGR A;  4PT5 A;  1QKZ A;  3MTN B;  2WXF A;  3QHT A;  2SEB D;  1N61 A;  2JU6 X;  3NZS A;  4GXB A;  3FIL B;  2MBE A;  2KMC A;  4A8X C;  4DHZ B;  3R2T A;  2MHJ A;  3HRD D;  2K22 A;  4K3B A;  4LNK A;  2SAK A;  1HA5 A;  2GBR A;  3ZQ4 A;  3RNE C;  2FNJ B;  3PRP B;  2N7J A;  3Q69 A;  1PGX A;  2ON8 A;  4ZRP A;  3B2G A;  2REX A;  4EOY A;  3WAL A;  1WSP A;  4RMA A;  4ICV A;  3P4Q B;  1WGK A;  1SJE D;  2O6V A;  4FJZ A;  1FNW A;  2JZZ A;  3DBR B;  2GBM A;  2KAC A;  2L8J A;  3BVZ A;  4HCN B;  3SHQ A;  3BWU D;  1YNT E;  3V05 A;  5HFY A;  2GBK A;  3WA0 A;  3ZDT A;  1NYR A;  4EEW A;  1ENF A;  2M0A A;  2X38 A;  3ECI A;  3I9V 1;  5DPR A;  1J7A A;  3ZNH B;  1U4A A;  5I4D A;  4C00 A;  1XCT L;  2BF8 B;  2Z0D B;  1T0R C;  4HKZ E;  4KIK A;  4E3C A;  2LFI A;  1KOT A;  2C7H A;  2LUM A;  1ZGU B;  3ZJT A;  1WZ3 A;  1MJD A;  4GN1 A;  4RH6 A;  5DCN A;  2IY1 B;  1ZXI A;  4M02 A;  3L4P A;  4IM3 A;  1M4V A;  1DOI A;  3AE8 B;  1EU3 A;  1IBX B;  3TCA A;  1FRR A;  2RGF A;  2O6V D;  4HPP A;  1E5W A;  1L0X B;  3HM6 X;  2W9N A;  4WQO B;  4RFB A;  3ZNG C;  1E8X A;  4OZC A;  2FCN A;  4C56 C;  4M8M A;  3HM3 A;  4I6L B;  2IO0 B;  3P1M A;  3U4E G;  1UEL A;  1SXT A;  3Q8F A;  5FK9 C;  1GB1 A;  1SJH D;  2KX0 A;  4BKS A;  3L16 A;  4C4V B;  1OQR A;  1WGY A;  3ZNI D;  1ET9 A;  3APF A;  5DPW A;  2FUG 1;  1T0Y A;  1NBF C;  2ZVN A;  4EZK A;  3PHW B;  2KWC A;  3KQ4 A;  4B0M A;  4MM3 B;  4WH4 A;  2HDE A;  4LDT B;  5JH5 C;  4YXD B;  3AH7 A;  2BT6 A;  2KQ4 X;  3PTF C;  1WJ6 A;  1H4R A;  3RYT A;  1LFD A;  3NHE B;  1QF6 A;  2DYB A;  2RDG A;  2JSV X;  2MW5 A;  2ZEQ A;  4GLS C;  3PVL A;  4GDK B;  2AQ1 B;  2D3A A;  1GOZ A;  3BZD B;  1HXY D;  1TKY A;  1KLV A;  4MGY E;  2FCQ A;  1N5W A;  4XWW A;  1SSN A;  1FNU A;  5G5H A;  1L5P A;  2AYO B;  2IDY A;  3CIR B;  2JXX A;  1AW7 A;  4HXD A;  3QK0 A;  3N30 A;  3I57 A;  3L54 A;  2UWQ A;  3PZ8 A;  2EKE C;  2KVR A;  3DBR I;  5HI1 A;  4BKS D;  1QOG A;  3BVM A;  3MHS D;  3KUD B;  2CHX A;  4R3D A;  2YEP F;  1F2R C;  3LB8 C;  5LNK 1;  2G9H D;  1Z2M A;  1JQ4 A;  4JWU C;  4MEM A;  1WJN A;  5AUK A;  1YN3 A;  2TSS A;  2CU1 A;  4IWP A;  4MJS B;  3JW0 X;  1OGW A;  2KFJ A;  4DXG A;  2HJ1 A;  1KLG D;  1HE8 A;  3CF6 E;  3I3T B;  3A9J B;  2MEK A;  4HJG E;  2V0G A;  3DDC B;  2LHD A;  2PEA A;  4ZRK A;  3TEW A;  3SDL C;  3PLV A;  3UIO B;  3SR6 A;  2KFK B;  1KTK A;  1QOB A;  1ZXH A;  1OFF A;  4MGZ E;  3ZRC A;  1PYW D;  2XK5 B;  3LDZ E;  1QIL A;  1HQR D;  3SFE B;  2DZK A;  3NG0 A;  1C4P A;  4PYZ A;  3X23 A;  2V4L A;  5E6O A;  2BS2 B;  3KWL A;  1XEE A;  4XZ4 A;  3U8Z A;  3E56 A;  2NVU I;  2KNB A;  1SB3 C;  2KC1 A;  4TMA B;  4YTN B;  1VLB A;  3DVN U;  4W9I A;  2WXP A;  1P7F A;  2CJO A;  3RNB C;  2INN E;  2LVP A;  3JSV A;  2MQJ A;  3R7Q A;  2MJ3 A;  3S2A A;  3AEC B;  5H8Y E;  2DEN B;  1GC7 A;  2EMT A;  3RZF A;  2AQ2 B;  2BS4 B;  3BIN A;  2EKI A;  3TUO A;  1ZDV A;  4W9E A;  2KDB A;  4GIV A;  3UQB A;  1V86 A;  3QCA A;  2IY0 B;  1RAX A;  2K5P A;  2O2V A;  1LM8 B;  2K8B A;  1ET6 A;  2W3R A;  2X8X X;  3PO0 A;  3MC9 A;  4B6W A;  1C3T A;  3N3K B;  2YEP B;  3PS6 A;  1Q5W B;  5G5G A;  2RSU A;  1J0G A;  1YJI A;  1WMH A;  2PIA A;  2C9W B;  2RMM A;  1FM0 D;  2CS4 A;  3NRZ A;  4P1B C;  1WE7 A;  2MWS B;  2G3Q B;  1TS3 A;  1IUE A;  2NPT B;  2AL6 A;  4FUL A;  1C9F A;  4A55 A;  4GGQ A;  3EEC A;  2N4F A;  1EWC A;  1I4X A;  1E7U A;  1B1Z A;  1TS2 A;  2FID A;  2LAS A;  5J2R A;  1K50 A;  4P7I A;  4IWQ A;  4IWO A;  1WY8 A;  1PGA A;  2H88 B;  2J53 A;  4TUU A;  4AJY B;  2ZNV C;  1CK1 A;  3CWI A;  2K8C A;  2WDQ B;  1WI0 A;  3NS8 A;  1E8W A;  3DBL B;  3C8Y A;  2L05 A;  2KTF A;  1GNU A;  1QOF A;  3A9K A;  3ZGZ A;  3APC A;  1XLO A;  4KZ0 A;  4FHJ A;  4GDL A;  2V3P A;  1VR9 A;  2KAN A;  2IO1 B;  4KKJ A;  2Y5C A;  2IO3 B;  2LRU A;  4ZRQ A;  2GBJ A;  2MLB A;  3HHM A;  2IO2 B;  2IGD A;  4AOF A;  4RGN A;  1OTR B;  3QAQ A;  4GMV A;  3W9C B;  3DHH C;  1WXS A;  4WJO A;  3NZ3 A;  1K51 A;  3U2S C;  1HZ5 A;  3NVV A;  3PRM B;  4US8 A;  3Q3M C;  3LXF A;  2DAJ A;  1E7V A;  2A4Z A;  1WM2 A;  4YL8 A;  4WIP A;  1I7H A;  4NQK E;  1IGD A;  4NPN A;  4XYC A;  4DDG D;  3VAW A;  1WE6 A;  2G4D B;  3T9L A;  3EHV A;  5KHO A;  3JYU A;  1WZ0 A;  1V80 A;  2ONQ A;  2MJE A;  2R61 A;  4QAY A;  4UDU C;  3VH4 B;  2PE9 A;  2JY6 A;  2KT7 A;  1V81 A;  2K6D B;  5H92 C;  5CHV C;  2HJ8 A;  1L6V A;  1AWD A;  2ASQ A;  1F0Z A;  2AX5 A;  4KKI A;  3L0W B;  2BVC A;  3H7S A;  2QIL A;  1C77 A;  3QIJ A;  1STE A;  1OQY A;  1KH0 A;  4XE0 A;  4ANW A;  3BYT B;  1NEK B;  1WX9 A;  1L6U A;  3M95 A;  1P3Q U;  1QOA A;  2M8S A;  4LLG M;  1UWX A;  3VR8 B;  3GOE A;  1YJJ A;  1I4P A;  4DHJ D;  2JRH A;  4M01 A;  2DNF A;  3TBL D;  4LNI A;  3AU4 A;  2LWP A;  3PSE B;  2WU5 B;  3N20 C;  3LJ3 A;  3DQV A;  3IXS A;  2KYW A;  2OJW A;  3A1Q A;  5IAA C;  2N1V A;  4BKT A;  4ICU A;  2C7M B;  1UBQ A;  5GXG B;  3MJ5 A;  2L0T A;  2GI9 A;  4KV2 A;  3TMP B;  2MP2 A;  2C5L C;  3PHX B;  1QT9 A;  4P6V F;  3ZXV A;  2IPK D;  4YWG G;  3L08 A;  5HKH A;  3ZRF A;  4BOZ B;  2D07 B;  3IG3 A;  2AEH A;  4IM0 A;  4KGR A;  2W82 A;  3IBE A;  3WAM A;  2V9H A;  3DBL I;  1K52 A;  2QJL A;  1Y8R C;  1T6B X;  3B2F A;  3DOW A;  5JZE B;  1H8C A;  1TJE A;  1BT0 A;  4EUT A;  5LXI B;  3H9D A;  2OOB B;  3PGE A;  4XDC A;  3TIX A;  4ASW C;  2GLS A;  1RFK A;  1TS5 A;  5CHW A;  2DHZ A;  1OEY A;  4URK A;  1UUP A;  1FXT B;  4N59 A;  1SIJ A;  1JRP A;  3VVW B;  5E6P A;  4ZYS A;  4B9K A;  3QAR A;  3DWM A;  1FFU A;  5D2M B;  3T8M A;  2L7R A;  2WGS A;  4YTP B;  3SD5 A;  2XNA C;  1RFA A;  3ZIM A;  2JZ3 B;  1WR1 A;  2JT4 B;  2LGS A;  2ZCB A;  1FPY A;  4XC2 A;  4MAC A;  3V3X A;  2EMS A;  4HWI B;  2WXM A;  3GE8 C;  2RD0 A;  2PE6 B;  3H7P B;  4JGH B;  4PS8 A;  4K81 A;  3R7R A;  2QEJ C;  1VCB A;  4XDD A;  3Q8A A;  1N5X A;  4F7Z A;  5HG2 A;  2PLP A;  3ALB A;  1MI0 A;  5T8I A;  4USA A;  4RM8 A;  4WAA A;  4BFR A;  4TSS A;  4RNA A;  4W9G A;  4EZL A;  5LXH A;  4BVU C;  2KTR A;  3ZJV A;  3NVY A;  1DOX A;  3RT3 B;  2GMI C;  4ARC A;  1C4A A;  3AE7 B;  2JWZ A;  1D6E C;  3N1X C;  1WJ4 A;  1PFD A;  1I42 A;  1P7E A;  3KLS X;  5AUI A;  5FR3 A;  1Z5S B;  3LYY A;  1SF0 A;  2L1A A;  2FCM A;  4OZA A;  4JQW C;  4EZJ A;  1MHH E;  1BML C;  2JWU A;  2R2O A;  2KJH B;  1C76 A;  4JE3 B;  4II2 B;  2WXO A;  4TQ1 A;  2ZVO A;  3P42 A;  4M0W A;  2PTL A;  2Y5P A;  2W54 A;  2W3S A;  2VZK B;  2N7E A;  4DBG A;  4II3 B;  3WIM A;  2LZ6 A;  3PLU A;  1R4N B;  2CJN A;  1PQS A;  4JLC A;  3RNF C;  3TEY A;  3B1L X;  1KLU D;  4FJV B;  4KGT A;  5CX3 A;  4BOS C;  2KVZ A;  2K8H A;  2LEK A;  1D5M C;  2V3N A;  3AN1 A;  1I4H A;  3KWV A;  5JXV A;  2WLB A;  2ZZP B;  1RM6 C;  3FIL A;  2WX1 A;  1UD7 A;  4RCO A;  3R3M A;  3A4R A;  2N7D A;  3VTV A;  1AYF A;  5JHA A;  2MBB B;  1V1P B;  3T3O A;  1AAR A;  4JX1 C;  4JL9 A;  3UQA A;  3EA6 A;  5G2N A;  3M62 B;  3RNC C;  3AV8 A;  1TTN A;  3IAS 1;  2PPH A;  2GOW A;  2D2Q A;  3MC0 B;  4TV3 A;  4ANX A;  4IUM B;  1E10 A;  3NY5 A;  2BB6 A;  1ZKH A;  3PT2 B;  2HTH A;  4BAX A;  1D3Z A;  3RZW C;  3EFU A;  3EC8 A;  2W55 A;  3ZNZ B;  1WXM A;  1L0V B;  3ZLZ A;  1WXV A;  3DBH B;  2DYO A;  1D5X C;  3UGB B;  1V5O A;  5IP4 D;  4HCP B;  1IP9 A;  2JF5 A;  3DVN V;  3WAN A;  3UI3 A;  4XWT A;  1WGH A;  1R4M B;  3U7Z A;  3V6E B;  1E8Z A;  1IPG A;  4ANV A;  3QA8 A;  3BII D;  4MEL A;  1GC6 A;  4IG7 B;  4AWJ A;  2V1Y A;  1P9D U;  2KZR A;  4PS7 A;  3W1Y A;  5EE0 A;  3HVD A;  2KAJ A;  3W1S A;  3AEE B;  1QQR A;  2BWF A;  2NCN A;  2PMV A;  1FRD A;  4JIO U;  2D5G A;  3RFZ B;  3ZDM C;  1RRB A;  3VXW A;  3ABV B;  2DZJ A;  2Y5B B;  1Y56 A;  1V8C A;  2FE8 A;  1EM7 A;  4DXA B;  3UIN B;  1TZ1 A;  3OJ4 B;  5L83 A;  3UF8 A;  5IOI A;  4N6E B;  4C4V A;  3MJW A;  1IGC A;  4RGO S;  4WWO A;  1D4B A;  1UNS A;  1XCQ L;  4I6P A;  1QLB B;  1YJ1 A;  4HLE A;  5BMH A;  1GJZ A;  4MM3 A;  1CZP A;  3T3N A;  3GB1 A;  2QC8 A;  2LXC A;  4L23 A;  4ZRI A;  3ZVV A;  1R4N I;  3ZKJ C;  2NTS A;  4HDQ A;  2HD5 B;  2Z59 B;  3H6N A;  1WXQ A;  1NI3 A;  2M4N A;  1YOV B;  1SBB B;  1WIA A;  3WAO A;  3V61 A;  1MHX A;  2DZI A;  4GDK A;  4OHJ A;  5AZG A;  3O65 B;  2G45 B;  4CYE A;  1L4D B;  2B76 B;  2LJ5 A;  3V62 A;  4OVV A;  3NJT A;  1I4R A;  2DBY A;  1YN5 A;  2M1M A;  3AEB B;  2JUO A;  2JYE A;  5BO4 B;  4ZHP A;  1GUA B;  1XQQ A;  4KSK C;  1I35 A;  1V49 A;  5AEK B;  5EE9 A;  2KKC A;  5EE3 A;  2JVC A;  3RD2 A;  2PVG C;  4M00 A;  1F52 A;  3ZJU A;  2J0J A;  2L83 A;  2WXL A;  4N9F 4;  2MA9 B;  1TGZ B;  1ESF A;  3TEX A;  2D3G A;  2KDF B;  3AU5 A;  2A5U A;  4MJS A;  2JQR B;  3IAM 1;  4CHK A;  2CHW A;  3V6C B;  4P1C C;  1VD2 A;  5HHD G;  4NJ7 A;  4LDT D;  4PS3 A;  3ML8 A;  4S0R A;  3KUC B;  3A9J A;  3P4S B;  4MGK E;  4W9L A;  2BW2 A;  4A20 A;  1FMA D;  2V3S A;  2INC C;  2VRR B;  1T0Q C;  2K39 A;  2VH1 A;  2ZNV B;  4AS1 A;  1WH3 A;  1DGJ A;  2BYE A;  4CQN A;  4C7Z A;  1ZW7 A;  2KFK A;  2KJ6 A;  2L76 A;  3Q3O C;  4FLH A;  1R4M I;  1GAQ B;  1XLN A;  2JZP A;  2R2Q A;  3APD A;  2WXI A;  2XK5 A;  2D10 A;  4DQO C;  4NZL B;  3QX1 A;  3DCG A;  3AM9 A;  2J42 A;  2AL3 A;  2I38 A;  2MBO A;  4BKG A;  1V5T A;  2MSE D;  4IDI A;  4ZYN A;  3D32 A;  3VH3 B;  1YX5 B;  1OQQ A;  4HVB A;  4MSQ B;  4A3P A;  2KN5 A;  4F1S A;  3L13 A;  2WS3 B;  4C7Y A;  1EO6 A;  1S1Q B;  1EF1 A;  5D6J B;  3L17 A;  5IA7 A;  2CKH B;  3IT4 B;  1N60 A;  1YMH E;  1F1H A;  1JWU D;  4C80 A;  3GZN B;  3AE9 B;  2LGD A;  3JVZ X;  1XO3 A;  3DPD A;  4BBN C;  3VRB B;  2JX5 A;  4IOI E;  4BZA A;  1UWM A;  4RM9 A;  2Z0E B;  4KVG B;  3KUZ A;  3DBS A;  1FNV A;  4KX6 B;  4PK1 A;  3RPF C;  4ZRJ A;  3TJP A;  1VJK A;  4J6I A;  2MRP A;  1L2N A;  2VH2 A;  2I1K A;  2LVQ A;  1PGB A;  4L1B A;  1WJU A;  3N32 A;  2UYZ B;  3H8H A;  4GSW A;  3V60 A;  2I2Y A;  4NAW B;  4A90 A;  4MGI E;  3NOB A;  2KOX A;  2KQS A;  3ZTD A;  4LJP B;  2N1W A;  3VDZ A;  5J17 A;  3OLM D;  2J0K A;  3BYY B;  5CTR C;  2NPT A;  1VDV A;  1PUT A;  2BPS A;  4ZHO A;  5G55 A;  2KWD A;  2LGX A;  4HKQ A;  4LK0 M;  3QQ8 B;  2NR2 A;  3AI5 A;  2NTT A;  4LCD E;  2BKF A;  2KO3 A;  3ONS A;  1R7S A;  1E8Y A;  3SEB A;  2O6V B;  1XT9 B;  1MFW A;  3HK0 A;  3FAH A;  4NJC A;  2KWV B;  3VUX A;  2KN4 A;  4PYU A;  4W9K A;  3P4P B;  4LTU A;  2LJI A;  3AB5 A;  2V4I B;  3KVF B;  1HTQ A;  3Q3J A;  3RNG C;  2BTE A;  2MBQ A;  3A4S C;  4I6N B;  2BWE S;  3EGR A;  1FIQ A;  1V1O A;  1WGG A;  2G4S A;  3MFG A;  3AEA B;  4EFO A;  3HUI A;  3C19 A;  1Q10 A;  2E3T A;  3W5U B;  2BQQ A;  2J7Q B;  3NVZ A;  3VTU A;  4KIK B;  2ACZ B;  4OW0 A;  2WDT B;  1L4Z B;  3ZW3 A;  4WWN A;  1YQB A;  1E6E B;  4YSZ B;  4HEA 1;  2C7N B;  3AE5 B;  4HRO A;  1Q1O A;  4OVU A;  3Q2A C;  2KMM A;  3RI7 C;  2L00 B;  2WXQ A;  4HRS A;  1N6Z A;  1WM3 A;  1JCK B;  2YVC A;  1SE4 A;  4MDK E;  2K0P A;  1JRO A;  2BKR B;  3N1Y C;  4FJY A;  4W9D A;  4L2Y A;  3GP7 A;  1I4Q A;  2KHW B;  2IJ0 A;  2LI5 A;  5MPO A;  2KWU B;  3MP9 A;  1XLP A;  2CU3 A;  4YSX B;  2WX0 A;  3P63 A;  2KDM A;  5D3D A;  3GS2 A;  3ZO5 B;  1VZ6 A;  2ZCC A;  4OZB A;  4CO7 A;  1ZP0 B;  4WQM A;  5BYR A;  2LMC A;  1QZE A;  3ML9 A;  2WU2 B;  3GZN I;  5FKA C;  2BS3 B;  5KHQ A;  2QCZ A;  1E90 A;  2M0X A;  1ZPS A;  3AE2 B;  3OAW A;  1K53 A;  5C1Z A;  3OJ3 A;  5GMV A;  2LGI A;  2QDF A;  4NY0 A;  2INP E;  2ZPN A;  3HIZ A;  3WCQ A;  2KD0 A;  2LHE A;  1TY2 A;  5BMG A;  1N63 A;  4W9J A;  2K6Q A;  1C78 A;  1UGJ A;  2AQ3 B;  2IZV B;  2J4X A;  2E6X A;  1TYG B;  4HPL B;  1S3S G;  4J3O D;  3VQI A;  3UIP B;  1WWT A;  3NVW A;  1J7B A;  5D3I B;  1TZO A;  2LUE A;  3AEF B;  1NEN B;  2G1E A;  2ZPY A;  3AEG B;  1BUI C;  3VUY A;  3I5J C;  4DWF A;  4ARI A;  3E9S A;  1WYG A;  2DX5 B;  2OJR A;  3SU8 X;  1J8C A;  4LNO A;  1RYJ A;  3ZXR A;  1N62 A;  4TKN A;  5D94 A;  2BYV E;  1ZDX A;  1B9R A;  3R66 C;  2NS5 A;  5IN7 A;  1SGH A;  2KQ7 A;  3C0R B; 
#chains in the Genus database with same CATH homology
 2WP9 B;  4MH8 A;  1CK1 A;  3CWI A;  1JAL A;  2QIE B;  2WDQ B;  2BB5 A;  5E6J A;  3C8Y A;  1XLQ A;  1E0Z A;  1EU4 A;  2Y3A A;  1QOF A;  4N6E B;  3ZGZ A;  4N58 A;  1CJE A;  1IGC A;  1XLO A;  4RGO S;  1TKG A;  2V3P A;  3TSS A;  1VR9 A;  1D4B A;  3NS1 A;  1UNS A;  1XCQ L;  5BMH A;  1QLB B;  2MJD A;  4KKJ A;  1YQ4 B;  3B9J A;  1CZP A;  3T3N A;  3GB1 A;  2JYT A;  2Y5C A;  3N9Y C;  1SE3 A;  1NVI D;  4ZRQ A;  2M56 B;  4L23 A;  2WXK A;  1JWS D;  3PZ7 A;  2PKO A;  3ETR A;  2NTS A;  2IGD A;  2IGH A;  1JW9 D;  1FO4 A;  4RGN A;  3W9C B;  1T3Q A;  1WXQ A;  1NI3 A;  1VZ8 A;  3AE1 B;  4TQ0 A;  1T5X D;  1SEB D;  4A6Q A;  4JWS C;  1SBB B;  2BBC A;  3NZ3 A;  1K51 A;  1EWY C;  1TS4 A;  4PT5 A;  1QKZ A;  3U2S C;  2WXF A;  1MHX A;  1TY0 A;  4OHJ A;  2GRI A;  4US9 A;  3W5V B;  5D7G A;  1HZ5 A;  1CQV A;  3NVV A;  4US8 A;  2SEB D;  1GB4 A;  1N61 A;  2JU6 X;  3LXF A;  4AQ7 A;  3FIL B;  2N9L A;  2WQY B;  1L4D B;  4A8X C;  2B76 B;  3DWG C;  4WIP A;  3SFD B;  1I7H A;  1IGD A;  3R2T A;  3HRD D;  2K22 A;  1JWB D;  2DLB A;  2EEL A;  2SAK A;  1I4R A;  1HA5 A;  3ZQ4 A;  2DBY A;  1YN5 A;  4DXF A;  3AEB B;  2JYE A;  2N7J A;  3Q69 A;  1PGX A;  2ON8 A;  4ZRP A;  4REZ A;  2ONQ A;  4ZHP A;  3B2G A;  2MJE A;  2R61 A;  4UDU C;  1WSP A;  3P4Q B;  1WGK A;  1SJE D;  5H92 C;  5EE9 A;  1FNW A;  5EE3 A;  1MPE A;  1L6V A;  2PVG C;  2ZW0 A;  1AWD A;  3ZJU A;  2KAC A;  2L83 A;  2WXL A;  1F0Z A;  3BVZ A;  2AX5 A;  2L32 A;  4KKI A;  1ESF A;  3TEX A;  2PW9 A;  2QIL A;  1YNT E;  3BWU D;  3V05 A;  2PVO D;  5HFY A;  4EE2 A;  1C77 A;  2WXH A;  1STE A;  2JQR B;  2WXG A;  3IAM 1;  1NYR A;  1KH0 A;  5HHD G;  1ENF A;  4XE0 A;  2M0A A;  2IGG A;  4YSY B;  2X38 A;  3BYT B;  1YQ3 B;  1NEK B;  3HVZ A;  4RF0 A;  3I9V 1;  3U52 E;  1FCL A;  3P4S B;  1L6U A;  2BW2 A;  1J7A A;  1FMA D;  5I4D A;  4AS1 A;  1QOA A;  1DGJ A;  1DOY A;  1XCT L;  4LLG M;  1UWX A;  3VR8 B;  1YJJ A;  4CQN A;  2DYM A;  1IBX A;  4C7Z A;  1I4P A;  4HKZ E;  3NUH B;  5BYQ A;  2QMT A;  2LFI A;  2HTM E;  2LUM A;  1GAQ B;  1XLN A;  3ZJT A;  2JZP A;  4RF1 A;  1FCC C;  1FFV A;  3VRA B;  2WXI A;  4DQO C;  2WU5 B;  4NZL B;  4WWM A;  3AM9 A;  2J42 A;  3IXS A;  4RH6 A;  2I38 A;  3R8B A;  2K3U A;  1ZXI A;  1V97 A;  3J9C A;  4WAF A;  3L4P A;  4IDI A;  5C2T B;  5GXG B;  1M4V A;  3MJ5 A;  1DOI A;  2GI9 A;  3AE8 B;  1FD6 A;  1V1P A;  1A70 A;  1OQQ A;  4MT5 A;  5C3J B;  1EU3 A;  1IBX B;  1TKE A;  1FRR A;  1QT9 A;  4P6V F;  1L0X B;  2IPK D;  2GB1 A;  4YWG G;  4RFB A;  3TEZ A;  4KGS A;  4OZC A;  1YN4 A;  4C56 C;  1E9M A;  2WS3 B;  4C7Y A;  1GPX A;  1E7P B;  3P1M A;  3U4E G;  1ZE3 D;  4KGR A;  1SXT A;  2W82 A;  1MVK A;  3Q8F A;  5FK9 C;  1I4G A;  1K52 A;  2QJL A;  4D2K A;  1GB1 A;  1T6B X;  1SJH D;  3B2F A;  3IT4 B;  1N60 A;  1TJE A;  1OQR A;  1YMH E;  4RGT A;  1ET9 A;  1JWU D;  4C80 A;  4B0E A;  4XDC A;  2FUG 1;  1C4C A;  3AE9 B;  4GDL B;  1RFK A;  1XO3 A;  1TS5 A;  2WXR A;  3Q8B A;  1F77 A;  1UUP A;  3KQ4 A;  4B0M A;  4N59 A;  2VZK D;  3VRB B;  1SIJ A;  2JX5 A;  4MM3 B;  4IOI E;  2WXJ A;  1UWM A;  4WH4 A;  1JRP A;  2HDE A;  4ZYS A;  1FNV A;  4KX6 B;  2NMQ A;  4A9A A;  3RPF C;  3URY A;  4YXD B;  3DWM A;  1FFU A;  2L52 A;  3AH7 A;  1HZ6 A;  1VJK A;  2BT6 A;  2KQ4 X;  4YTP B;  4FXC A;  2XNA C;  1PGB A;  1KFY B;  2ICI A;  4L1B A;  3AE4 B;  4MAC A;  3V3X A;  3H8H A;  1QF6 A;  2I2Y A;  4NAW B;  4A90 A;  2RDG A;  1VZ7 A;  2WXM A;  2JSV X;  4GLS C;  4ZOH C;  4GDK B;  1PDX A;  2AQ1 B;  1GOZ A;  3BZD B;  1HXY D;  1ACC A;  1TKY A;  4OVZ A;  4JPS A;  3BK2 A;  2QEJ C;  4XDD A;  1N5W A;  3Q8A A;  1N5X A;  1SSN A;  3BYY B;  1FNU A;  4XWW A;  5HG2 A;  1VDV A;  1PUT A;  2PLP A;  5G5H A;  1L5P A;  3ZYY X;  1MI0 A;  5T8I A;  4USA A;  2IDY A;  1ZOY B;  3CIR B;  1SE2 A;  4ZHO A;  2RDH A;  4ITK A;  4TSS A;  2WDR B;  4RNA A;  1AW7 A;  2KWD A;  4HKQ A;  4LK0 M;  2H89 B;  4RGM A;  1F2R I;  3ZJV A;  3I57 A;  3NVY A;  2NTT A;  1DOX A;  1ROE A;  4YTM B;  1FXI A;  3PZ8 A;  5HI1 A;  1R7S A;  1QOG A;  3SEB A;  4ARC A;  3BVM A;  1C4A A;  4H2A A;  3AE7 B;  4R3D A;  2YEP F;  1F2R C;  3LB8 C;  5LNK 1;  2G9H D;  2Z8L A;  3FAH A;  4NJC A;  2KN4 A;  1XF5 L;  1D6E C;  3P4P B;  4LTU A;  1JQ4 A;  4JWU C;  1PFD A;  2LJI A;  1P7E A;  3AB5 A;  2V4I B;  3KLS X;  5AUI A;  1NYQ A;  5AUK A;  1YN3 A;  2TSS A;  5FR3 A;  5EE1 A;  4WUR A;  3LYY A;  1SF0 A;  1C79 A;  2L1A A;  4OZA A;  2N0S B;  1L0Y B;  1BML C;  1MHH E;  1ZUD 2;  2JWU A;  3R2I A;  2BTE A;  3FC4 A;  4DXG A;  1C76 A;  1KLG D;  4JE3 B;  4HJG E;  2MEK A;  2WXO A;  3EGR A;  1FIQ A;  4TQ1 A;  3P42 A;  1V1O A;  4M0W A;  2V0G A;  2LHD A;  2PTL A;  2Y5P A;  2W54 A;  2JXT A;  3MFG A;  3TEW A;  3AEA B;  2W3S A;  3HUI A;  1Q10 A;  2E3T A;  2VZK B;  2WXN A;  1KF6 B;  3W5U B;  2N9K A;  5BMI A;  3NVZ A;  2QSD A;  3W2D A;  3SR6 A;  2CJN A;  2WDV B;  3Q8E A;  3P4R B;  1KTK A;  1JML A;  1QOB A;  1ZXH A;  1OFF A;  2ACZ B;  3EUB 2;  4OW0 A;  1L4Z B;  2ZW1 A;  5TSS A;  3TEY A;  5BYS A;  1PYW D;  1KLU D;  3AE3 B;  2M19 A;  4KGT A;  1E6E B;  4YSZ B;  4HEA 1;  3AE5 B;  1QIL A;  4HRO A;  2LEK A;  1D5M C;  1HQR D;  2KMM A;  2V3N A;  3SFE B;  1C4P A;  1WRI A;  3AN1 A;  1I4H A;  3KWV A;  5JXV A;  2WLB A;  2WXQ A;  4HRS A;  1RM6 C;  3FIL A;  1JCK B;  4RCO A;  1D5Z C;  1SE4 A;  1VRA B;  2BS2 B;  2K0P A;  1JRO A;  3KWL A;  2OED A;  1AYF A;  3BVG A;  4O1N A;  4L2Y A;  3GP7 A;  1I4Q A;  1XEE A;  1V1P B;  1LO5 D;  3E56 A;  2IJ0 A;  3T3O A;  2J52 A;  4JX1 C;  5MPO A;  1SB3 C;  3EA6 A;  2K9X A;  3MP9 A;  4TMA B;  1XLP A;  4YTN B;  1JWM D;  1VLB A;  2CU3 A;  1J7C A;  4YSX B;  2WXP A;  2WNM A;  3P63 A;  2KDM A;  1P7F A;  2CJO A;  3AMZ A;  2INN E;  3AV8 A;  1FXA A;  3VR9 B;  2MJ3 A;  3IAS 1;  3AEC B;  5D3D A;  3Q8C A;  3GS2 A;  5H8Y E;  2DWQ A;  2XN9 C;  1VZ6 A;  4OZB A;  3MC0 B;  1ZP0 B;  4WQM A;  5BYR A;  2LMC A;  1E10 A;  2MH7 A;  2AQ2 B;  2WU2 B;  2BB6 A;  2BS4 B;  5FKA C;  2EKI A;  3TUO A;  1ZDV A;  2BS3 B;  2BYT A;  2W55 A;  3O13 A;  2K5P A;  1ZPS A;  3AE2 B;  3IT6 B;  1L0V B;  1K53 A;  3AE6 B;  1ET6 A;  2W3R A;  4YT0 B;  2LGI A;  3MHZ A;  2FBW B;  2INP E;  3WCQ A;  2DYO A;  1D5X C;  3PO0 A;  2LHE A;  1DYQ A;  2YEP B;  1RWS A;  2RPV A;  1TY2 A;  5BMG A;  1N63 A;  5G5G A;  1JWA D;  4Q2J A;  1C78 A;  1UGJ A;  2AQ3 B;  1AN8 A;  2J4X A;  3UI3 A;  2E6X A;  4XWT A;  4P16 A;  1YJI A;  1TYG B;  3AED B;  3U7Z A;  4NAM A;  1HEZ E;  2PIA A;  2RMM A;  1FM0 D;  1BXT A;  3BII D;  3NRZ A;  4J3O D;  3VQI A;  3BK1 A;  1WWT A;  3OWE B;  3NVW A;  1J7B A;  1IUE A;  1TS3 A;  2Q5W D;  1TZO A;  5D3I B;  1KRH A;  3AEF B;  1FEH A;  1NEN B;  2G1E A;  3AEG B;  5EE0 A;  1C9F A;  1BUI C;  4A55 A;  3HVD A;  4ARI A;  1WYG A;  3E9S A;  1EWC A;  1I4X A;  2OHF A;  2KAJ A;  3W1S A;  1QQR A;  3AEE B;  1B1Z A;  1RYJ A;  2PMV A;  1TS2 A;  1N62 A;  1FRD A;  1K50 A;  2D5G A;  3RFZ B;  1ZDX A;  1B9R A;  4IKG A;  3ABV B;  1PGA A;  2H88 B;  2J53 A;  1XXG A;  1Y56 A;  1V8C A;  2FE8 A;  1EM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...