4NJEB

Crystal structure of pyrococcus furiosus l-asparaginase with ligand
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
b'MAVLVIKLIPGLSGDIFRAAVELGYRGIVIEGYGAGGIPYRGSDLLQTIEELSKEIPIVMTTQAMYDGVDLTRYKVGRLALRAGVIPAGDMTKEATVTKLMWILGHTNNVEEIKVLMRKNLVGELRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-asparaginase
molecule tags Hydrolase
source organism Pyrococcus furiosus
publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
total genus 40
structure length 127
sequence length 127
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2013-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4njeB00
4NJEB 1DJPA 2OCDA 5I4BA 4ECAA 4Q0MA 5DNEA 3ECAA 1JJAA 5K45A 2D6FA 3NXKA 1HO3A 5DNDA 2WLTA 1WSAA 4RA6B 1WLSA 1HG0A 5HW0A 4R8KA 5K4GA 1ZCFA 5K4HA 1DJOA 1ZQ1A 4RA9B 1O7JA 3NTXA 1WNFA 2P2DA 2P2NA 5DNCA 1HFKA 1JSLA 4R8LA 3PGA1 1HG1A 5K3OA 5I3ZA 1IHDA 1HFWA 1AGXA 5F52A 5CBPB 5I48A 2HLNA 1NNSA 4PGAA 1HFJA 1JSRA 2GVNA 1JAZA 2WT4A 2JK0A 2HIMA
chains in the Genus database with same CATH superfamily
2K6GA 4PAOA 5LN1A 4BNFA 5AO9A 5KQMA 2BEKA 4MIEA 4RMJA 1QCYA 4Z0HO 2R84A 5G4KA 1VZ3A 3GT0A 3GGDA 3AJ8A 4YV2A 1PZEA 2J30A 5CVEA 3P32A 3D1VA 1FQJA 4AP6A 3AM3A 5I7WA 4AWAA 5EJ9A 2BFFA 3JYOA 4MARA 4PNPA 4ML3A 3UHOA 1LV7A 1JVNA 2A1UA 2GASA 1ISJA 1PG0A 1MXHA 1G9SA 4D8WA 2B4RO 4CPDA 1VKNA 1X1DA 1C1HA 3FPFA 3PT5A 3BGDA 1HEYA 4RTLA 1TT5B 1T5TA 3JQPA 3QYPA 1DOAA 2LDXA 1PG2A 4BVFA 2AQIA 4K1XA 4ZIRA 2VTVA 5IEJA 4RVGA 1CJMA 2XZDA 2XUHA 1UZUA 3B12A 3Q7TA 4FNMA 1Y1SA 2P67A 3T3HA 3DFKA 4B4VA 2DUMA 4PTLA 1XYYA 4PZYA 4HDQB 2PO5A 3NM6B 1LLCA 1QFJA 1ADGA 1MP0A 4IS2A 3TRFA 3B13B 3V00A 3S1SA 2QSUA 1PQUA 2DBRA 4UOEA 2ZBDA 3ADDA 3VJRA 3RSFA 2HWUA 1Y8RA 3OTQA 4MB2A 3C7KA 1D07A 4N1AA 1D03A 3BULA 4PO3X 4BKMA 5I9LA 1GUDA 2QYSA 2UZ0A 4MQFA 1RLUA 1YBMA 2XQFA 1IEVA 2AJCA 1U5CA 4ZOCA 3NYRA 3EDYA 3PEVA 4B2LA 2R85A 4OJQA 2WBLC 2ZGVA 1USKA 3ESYA 3I0MA 3ZU6A 1CDZA 2WV7A 3UB2A 4LY6A 4MUJA 4PG8A 4QU8A 2QRUA 1AMUA 4NOLA 3IX7A 3P9IA 3VBCA 4BWGA 3C5WP 1DQSA 2AN9A 1XTTA 4O33A 1SIBE 1KJYA 2R4TA 1SUAA 3JD4A 1CF4A 1TM2A 4XAQA 4XWYA 3AJEA 4BX9A 4BP1A 1KEZA 1ZUWA 1JDPA 2W2LD 2F1JA 3KYCA 2GTPA 3PEEA 4FGJA 1JH9A 4G37A 4RC9A 3ZHVA 1WUIS 3LT1A 4ATNA 4F2DA 1BROA 4CKWA 3KOMA 4NDAA 1GSOA 4QHTA 2BEJA 5A4KA 4Q05A 2EEPA 4GGMX 5KPDA 3N2NA 1TAUA 3QU2A 4FC7A 2IOFK 5K0GA 1CNMA 3N7AA 4TTQA 4X1YB 2B1GA 1HFWA 1G5RA 4PYJA 1MDFA 3EXHA 1C9JA 3SF0A 3MB5A 1IU9A 4BUCA 3V4ZA 4F3YA 1DI0A 2VLIA 2ZP1A 3LSTA 4KBFA 1L7MA 3DBVO 1ZJJA 3H18A 3EXHC 4NAUA 4PRLA 4QPPA 2QZPA 2YWBA 3ZY5A 3NDBB 1YJCA 1Q7RA 4Z86A 2MT9A 3K15A 3VXKA 5GIPE 4AN1A 2MJLA 1CJSA 1EK5A 1X1QA 3MVEA 4RYDA 5CXQA 5K45A 5KC9A 2QTHA 1PFUA 3FSRA 4PSDA 5L9AA 4ZDWA 3H42B 3EMBA 4E0BA 1F2TB 4G1BA 2WB2A 2B94A 2BMFA 2IUFA 1ZOSA 1T25A 1Y8RB 3GJ5A 4KQFA 3SAJA 4KO3S 2EFJA 3EXEB 3ZE7A 2PCLA 1U0OC 4OL9A 1RJGA 4RY9A 2JFHA 1AKEA 4UZEA 1IJKA 4BO1A 4LXQA 5JAZA 3C3KA 1KEEA 5BMVA 5EJIA 3L6DA 5HZKA 4DY4A 5ESDA 1PFGA 1FNCA 1XTIA 1YZLA 4X84A 2G5TA 2O07A 3DBLB 4P35A 1UKAA 3AY6A 2FSVC 3KIPA 4FFSA 1R4MB 5GJVC 1A8UA 1QHXA 2EDCA 2XBLA 4XM2A 5CK4A 4D45A 2ZM6B 2CDAA 5EP3A 3TL2A 4OCZA 4LYAA 2ORYA 4ZT6A 1IUPA 4G5YA 2AYYA 4H3VA 4TKUB 1AKRA 1UQRA 2EDAA 2CXPA 3ABZA 3KE8A 4ARCA 1CXZA 1NNLA 3SSNA 4M1WA 4RL6A 4Q9LA 4UASA 4DWOA 3UWPA 1QB8A 2B2XA 1WV1A 2FP3A 4URXR 1NQAO 5CX1A 1TZBA 2M1ZA 4XYMA 1X1EA 5AI9A 3ZQUA 2E4ZA 4B2IA 1YRLA 1IM8A 4K1LA 4F5ZA 3HM2A 5J2TA 4A7PA 1PR6A 2DCMA 2KBFA 2P4HX 4HWGA 3BRQA 4X1IA 3WNBA 1XB2A 2JFYA 4DEXA 3ASUA 3QX3A 3IDFA 4K9KA 4YACA 4B7ZA 3AEZA 1OA0A 3WLEA 1QHFA 1L4LA 2D0IA 3R0JA 4QARA 5HFAA 5C4GB 2O8BB 4U5QA 5M29A 4XW2A 4NNOA 1QVRA 1WSAA 1I32A 1PFYA 1T0HB 1QH1B 2IXEA 1YO6A 2DT5A 2R47A 2X9NA 2BE7A 4KMSA 1HOXA 4M36A 3ZE1B 1KEWA 1KFCB 4Q3BA 1PFKA 1CU1A 4XUCA 2Z2KA 3CZRA 1LI4A 2WD8A 3UCEA 2I54A 2F8TA 1KU0A 1CJBA 1WDKA 4NC9A 4GBMA 5K0CA 2O8EA 3BA1A 1NW6A 4TS3A 2ZYHA 5JU6A 3NQ41 1DFHA 4PWYA 3RVOA 2GYWA 5JYCA 3NORA 1SCAA 1SU6A 2GI4A 5EZYB 4D0RA 1U0BB 1VJGA 4MYRA 4D4JA 5IU6A 2DFDA 3ETJA 5BN1A 4XSVA 2OA0A 3SSMA 5E1MA 1XCGB 1F8UA 4WCFC 2W93A 4QO7A 3QPUA 1GZ5A 5CTJA 3LHSA 3QKTA 4K3VA 1TFRA 1Z36A 4NFHA 4AK9A 1KBQA 5I6DA 4U3JA 2B8JA 5CX1B 2YFHA 3N2ZB 5JDCC 3KB2A 3I4LA 3PP8A 5L3VA 2QK4A 2BEWA 4WWHA 3DCJA 5ER9A 3LI2A 2I6FA 4RD3A 1RXVA 4LZNA 3M9WA 4MS1A 1XJQA 3OE4A 3HO6A 3ET4A 3CRVA 4XM1A 3GI1A 5A5EA 3EGDA 3K5IA 4GP6A 4RDHA 3CJTA 1FXWA 4GR5A 3CV3A 2I4MA 4D97A 3STVA 2EQ5A 4MW6A 2B7LA 1C14A 2UYGA 3UHJA 1HE1C 3NHUA 3DCNA 3FI0A 2FQWA 2CHVA 2WSLA 3VPAA 1BJRE 1JVBA 1YOVA 1UEIA 1W4RA 2PRKA 5CMLA 1LJLA 1T8SA 4ENUA 3FRIA 4ZICA 2GEFA 2H65A 2BBSA 4KFRA 1RYNA 3KKMA 5KOJB 1QOQB 2W6NA 2I22A 2IHUA 2JJ1A 2XEXA 3HEBA 4LRXA 4QT0A 2JAPA 3K1AB 4HAXA 3DOFA 5F9FA 5CK5A 1VMEA 4AECA 5KO2A 1PZFA 3BGVA 1J0DA 1ZC3A 3PF9A 5SZJA 3R7AA 2EL9A 4K28A 4UTRA 1J70A 3W3AD 4P4GA 3GLSA 2C4NA 3ELWA 4BV9A 3MERA 2RAPA 4YLGA 1H6AA 1FQOA 3E7DA 3GJRA 2BEWB 2R6GA 1NLYA 3G1UA 3G9ZA 4RKQA 5D3ZA 4KXYA 4XLZA 4WAUA 2VL7A 3BD6A 4MS1B 4IV0A 4YBRA 4NFYA 1T3TA 4L85A 3SN6A 4DWWA 3ORQA 1PUIA 2RB5A 2B3TA 5FYQA 2Q07A 3EQZA 1GQRA 4F6RB 3PWZA 4INOA 1MC1A 5A5VA 1G20B 4MVWA 1QG0A 2P35A 3TVYA 1W4AA 3UWMA 3F5SA 1WD5A 4NK5A 4YAWA 4PRKA 4CU2A 4LJ7A 3FVRA 1HK7A 1YU9A 3H5WA 1XEWY 1JGTA 2VT2A 1ZK0A 4UATA 3LRTA 4MB0A 5DGXA 4JYAB 1S2OA 2ZUSA 3FYSA 3LK6A 2Y77A 2BDTA 1M3SA 4O2BF 4FYMA 3SFVA 3JQ9A 5HA5A 4Y6SA 5J43A 3HV2A 1J0EA 1VBNA 4UPVA 5KOJA 4BNTA 1M2HA 5KWJA 5COAA 4PYLA 1LJ8A 3R9XA 1V8PA 1CWUA 4IGAA 4EL5A 5IDYA 3B7WA 3Q8LA 3O9MA 4I1PA 4R2HA 2YYYA 4C7OB 3L40A 3SR0A 1W4ZA 1W6UA 3R6WA 3LL4A 1JI0A 2H48A 5IDVA 1SY7A 1KS2A 3JATB 5IX8A 3M82A 4NPHA 4TV9F 4NBWA 3UOAB 3WKCA 3IEIA 3ZPXA 2OILA 4CKBB 4DBLE 3AR2A 4RKWA 3ZR4B 4YJ2A 3BFVA 4HB3A 3PNBA 3P45A 5KVCA 4WOCA 4MVCA 1O5OA 4FYVA 1FSZA 4BNZA 5GZ3A 2OHXA 5BR8B 1JHMA 1WCXA 3P5BA 3KTFA 1A7AA 2G83A 3W6NA 5HKBA 1LS1A 4G5QA 3JWIA 4PIVA 2W8ZA 2XB9A 1D0IA 1GQ2A 2PVCA 3EMKA 4RV9A 4X7MA 4BFCA 2AHRA 3EHEA 4Q48A 5WRFA 4DWJA 2ZRHA 3QELB 1ELOA 2REQA 3LUCA 1ZMRA 1NF3A 2B9VA 3RQIA 3GUVA 1GRNA 2V3VA 1ODFA 3QLJA 5H02A 4LDNA 4ND6A 4P84A 4CODB 1V6AA 1GV1A 1Y5NA 2Z0MA 4TSFA 1KAQA 3KYIB 4MEJA 4PPFA 2DLCX 1NYTA 3G2MA 1AS3A 4EHLA 4C2BA 4EABA 1O87A 2JHGA 4MWTA 1XRMA 3E3OA 4IVPA 1SD1A 3OE7D 4MGKR 5A9SA 3AF6A 3UJNA 1NN5A 4HGQA 5CCDA 5HQJA 5EJ6A 1ZM4A 4ZVOA 2X1LA 4HNQA 3AVVA 3E9NA 5A1JA 1AD2A 2G0TA 1N34B 3THRA 4W9RA 2OZPA 3DTVA 3FB1A 4YO8A 2Q3EA 1KOFA 4YP1A 3K6JA 2QTBA 3IPLA 2YRXA 2C58A 4NWIA 4IHAA 4JWTA 1NY5A 4RD4A 2XGJA 3OPYA 5H1YA 3V6MA 4D82A 3INGA 4F04A 3CRMA 3F6CA 2UV8A 3FHTA 2GFIA 2Z4RA 3PXGA 3QF4B 4K6FA 2YHAA 3SWWA 3PRJA 5HR5A 2QN9A 5G41A 1GR0A 3DEJA 3ZCXA 5J4YA 4TOIA 2HNBA 2OYCA 3JVEA 5JXJA 2OCXA 4BRSA 1OLUB 1UPFA 2V9PA 1O95C 2GN8A 3A3YA 1W29A 3SS7X 2GMWA 5JS6A 1IUKA 1YQGA 5IBRA 2CXRA 1CJTC 2JI4A 2OOKA 4H4DA 5C1DA 1U1FA 2PWPA 2FETA 1T3ZA 4I9FA 4B34A 3QWFA 1J2TA 2DWPA 3STYA 3C15C 1Z38A 1R9MA 1U2RA 1UPAA 2ZUWA 1RP1A 2PX8A 3WO1A 5IABA 4OJMX 4C05A 5KU1A 3TLAA 1ZN2A 1RAEA 3IVAA 4LISA 4ZT5A 3OPVA 1MU0A 1Y4SA 3G2KA 5SZHB 1AQIA 1E5LA 2GSWA 2ZIAA 2D54A 2PD6A 1OAOA 3L0OA 4CQMB 5CG2A 3RYTC 1R0RE 3Q7EA 1P3JA 1K66A 3KD3A 4IL5A 5DHUA 5DT9A 2BGMA 3VTKA 1COZA 1PGOA 3WLRA 2AFIB 5FLXA 4FMBB 3AIIA 4KYVA 4DCJA 1QX4A 2XNCA 3ZE6A 2IUEA 4PS1A 1LDGA 1QNLA 1BZYA 3MINA 3GUYA 2NAPA 3DYBA 4GXNA 4PANA 1OJLA 3R5HA 5D51S 1M75A 3U7IA 2PT9A 4AZSA 4QEKA 5TGTA 5JAIA 4J0GA 4RD0A 5ICCA 2EKQA 2H7YA 3C6KA 4UBKA 5EXDA 2QKYA 1EFKA 4OB7A 3SXUB 3N2IA 4YRCA 2E5FA 2WOOA 3D6NB 1AK1A 3S4YA 1N2SA 3MJFA 4FINA 4WBXC 3F6BX 1VBFA 3A1NA 1PS0A 3K0HA 3DZFA 2JK1A 2XXAB 3HPQA 1MABB 4YCLA 2J3JA 3DLCA 3ZVRA 3NATA 1XZHA 2Y0DA 3JQFA 2QMEA 2ZB2A 5KVSA 3PFBA 3PK0A 1OFHA 1RRPA 2FFAA 4TM7A 4UM7A 3RIEA 1OWOA 4O5AA 4UTNA 2Z58A 3NVAA 2ZJ8A 2I6UA 3RBZA 1V8FA 2C8LA 1JHYA 4UHHA 3WDMA 1GPBA 2KQUA 3LXMA 5KOHB 3GVXA 1VLLA 1MKYA 3CX4A 4FGZA 4LQCA 1H5NA 4QBKA 1WB6A 4R2LA 2EW8A 1XZDA 2NU6A 1TYEB 4X00A 2QZZA 1I6KA 4EA6A 1VJRA 1MO5A 3BICA 1NG9A 1EVIA 2R6HA 3NOXA 5G0WA 5HKLA 3HB9A 2HJ9A 4TZ0A 2P9BA 1DQZA 1ZESA 4XD7D 2QRNA 3IP6A 4D4HA 5HGXA 3ZYZA 2AH5A 3TGPA 3KVVA 1Z4PX 4MWBA 3MWGA 4Q1AA 4OQQA 5AR1A 5MFZA 4KR2A 1C0KA 4YJFB 5IF9A 4F91B 2NZ8A 3ZV6A 4M1YA 1XHFA 3G0BA 1S1MA 4CTKA 2JAUA 2RK3A 1GL3A 1Y98A 3WGGA 3IBGA 3OF5A 4NESA 3KQKA 1KZ9A 3PUJA 2P11A 1A5TA 2QNIA 4JDPA 2XXJA 2CFTA 1FF9A 3JQ9C 4JIGA 2JLWA 4CL3A 5GONB 3LFHA 3Q3CA 2D5LA 4Z9BA 4WNCA 3QE3A 4G8BA 4PLCA 1DHRA 4KWEA 3LCUA 3OPQA 3OQOA 4JL5A 3DS8A 2IGBA 3E7FA 3NHSA 4U63A 5LSAA 2IIQA 1SBQA 5E7MA 3O83A 2IKQA 5EP1A 5LQNA 3W05A 3WGQA 3ONWA 5ED4A 1VYTA 1XMXA 3EPRA 2EYUA 2JLAA 1P1RA 2J07A 2DFLA 2HQ1A 1T3LA 3IAEA 3IFSA 3ZYCA 4DIKA 1CB0A 3BX1A 3SQOA 2IU0A 1MQ9A 4HR7A 1UBKS 5HZHA 1FK8A 1JFFA 1CQIB 1M8GA 2E4UA 4YAKA 3HCBA 5FOTA 2JH8A 2VRBA 3R7NA 3SYLA 1NYQA 2I80A 5DHSA 2OFXA 4FOSA 1A5SB 4KQKA 4MV6A 3WYGA 4UE3S 1XMIA 1WXDA 5HX7A 4NXMB 3SDSA 4A10A 1SXJD 3RE1A 1UT6A 1M6NA 1HLGA 4QUEA 3PC7A 1NJSA 2QRPA 1UM8A 2JBWA 2WSYB 1NJFA 2P5TB 3FUWA 2V1XA 1QWSA 3P2KA 1QIKA 1WPRA 1CY1A 2EJUA 4YJFA 3S2GA 4V2IA 1OH6A 1HTBA 4U6NA 4ZV4A 1OMOA 3P20A 4HAVA 4MOWA 3QY9A 1U6KA 1QVWA 2V4MA 4TN5A 4MTLA 3HJFA 2GM9A 2J87A 4N9WA 2PX5A 4M1SA 2LWIA 2OQ2A 2HCBA 1N3YA 1HXHA 2ESRA 1XZBA 4AMYA 4KXXA 3NVKI 2I4LA 1A98A 5IC5A 1VA5A 2BFDB 1C7RA 1I5OA 2OENG 3L01A 2JEZA 3ELBA 4P7FA 4C20A 5CEFA 3AF4A 1K7YA 1ORVA 2R6CA 2AJDA 4D96A 5E6SA 4ECEA 1P74A 1JHAA 2D3TA 1LDEA 2LV8A 2ON6A 3U44B 1L7AA 1UJ6A 5FPYA 5KSOA 1GV0A 4TLMB 3BC1A 3OF3A 4BZXA 2I4NA 3IP7A 5GQSA 1QP4A 1RPAA 3TTYA 3VYWA 1Y5LA 4IGFA 2GN0A 2XI4A 3HMKA 3JTMA 1JFFB 3JZMA 1NN1A 5IARA 1ATZA 3FKQA 3X2SA 3I45A 1T1JA 3ZGYA 5CD1A 1CDEA 5FEMA 2CHQA 3ZLVA 3G3EA 1TPYA 3HLKA 4MA0A 1XCJA 4CKYA 5JDCA 2P2ZA 4D26A 1PNQA 2RONA 6GPBA 4GPTA 4QUHA 3SSAA 3HXLA 2RGGA 5KI6A 4YREA 1NRJB 1JS1X 4FFLA 4M46A 1E0KA 1MRNA 1PJZA 5FKJA 5KMGA 1H0HA 2XMQA 2H51A 5K3AA 1JBKA 3WLLA 3CIFA 1Y1LA 5IFKA 5JNSA 1EWQA 4EMSA 3H1PA 4TYQA 3FOZA 1M34A 3L7BA 2RKBA 4A5OA 2PXCA 1E1YA 1MB4A 2I2FA 1HYHA 1CUFA 1EA5A 3TX6A 2UYYA 3QE4A 1A9XA 1DPFA 1BVUA 2BJHA 2AZDA 2DR3A 3CUYA 3D6VA 2VK1A 3SMVA 3AXTA 5LMUB 4L74A 4DDKA 2A5DA 3TNYA 2IBTA 4OXYA 1XGKA 2RGDA 2OG2A 2NW6A 4Y6PA 5AHXA 3WLJA 2ODEA 1SBIA 2B8WA 1PX0A 1P0IA 3VOAA 5FL3A 4I1IA 1WMDA 1W76A 4HQ0A 4V1CB 4HDNA 2Q5LA 2QRVA 2JHAA 3CPSA 3BH7A 2IUUA 1AE1A 4A8JB 2VUIB 4FM9A 1P4SA 2Q1YA 2J5BA 1Z0KA 3IIKA 3EXFB 1ZJ6A 1Z0UA 3HYTA 3COJA 1WMSA 3FR8A 3FLEA 2OGSA 3A3KA 2WVJA 1A4XA 1QYIA 3BMNA 4HQRA 3WLNA 2OHVA 3PQ4A 4MULA 1AO0A 4MRMB 3DVLA 3W9BA 1D1PA 5AK5A 1QRRA 3KWJA 2GA9A 4RHTA 3MTIA 3S81A 4P1ZA 3V2IA 4UD6A 4GR9A 4C4RA 2BM0A 3F97A 2ZAYA 4HDKB 3B5IA 3L4EA 1SXJB 3BILA 3IERA 1FW8A 1KI4A 3ZK7A 4IUDS 5ITSA 1PYDA 4A8TA 1TE2A 3THOA 4IF4A 2QRLA 3ZHQA 2MSDB 3GDHA 4L9RA 5AQ1A 2HSWA 5BV7A 3I53A 5LQSA 1IZYA 3ACCA 4MKZA 1BMFD 1WM1A 2WZQA 1IHDA 1OVMA 3AUKA 4HO1X 1UXHA 4I55B 1MDBA 2HOQA 2JIMA 3CUUA 4O4IF 1QMGA 5DBGA 3UY4A 3WICA 2HFKA 2VAXA 5DGDA 1ZK4A 3M6LA 3CZAA 1WQ4A 5CXXA 4E94A 2Q62A 1PGPA 5TRTA 5AW8A 5EPEA 1QSGA 2XMBA 1GTRA 5DBHX 1QIIA 2EFYA 2J45A 1B0AA 1FJGB 1DBIA 4ZU3A 4KQIA 3NWOA 4ZHQF 1VBMA 1T13A 5CEJA 2CVOA 1XYGA 4M83A 3EAQA 3LYLA 2IYQA 5LU9A 2I9PA 3KVRA 5L3SB 4QM7A 4GE3A 4DG9A 4KWHA 1KETA 3T5PA 4V1CA 2Z9DA 4GG1A 2YWRA 3O8QA 1L4KA 3CF4A 4IDDA 4CUZA 5MFPA 2C1ZA 4AUKA 3V46A 1T1RA 1TYBE 3ND6A 4QDKA 2O14A 1JHQA 3C6BA 4QULA 2I7TA 3LD9A 3LP8A 1Y1KE 2GZ1A 3A1SA 2BKUA 2R1ZA 3B3AA 4EO7A 2HMSA 1I24A 1T5BA 3UA4A 2ZRPA 1YF3A 3N05A 3DZDA 3TQQA 1PT5A 3F2IA 2W0SA 2PR7A 4TTRA 3TL6A 5F7XA 3WL3A 5CB4F 3PDIB 4DPMA 4TVSA 4DJAA 4QWWA 1O97C 2NG1A 2W71A 4I4LA 1QYRA 3LWBA 4M60A 4XQGA 1J5XA 3O26A 1C1XA 2X3YA 4HKTA 4LHZA 4JVLA 1ODSA 4N8EA 4Q03A 4UFOA 3W1VA 1OGIA 5EIOA 3L7IA 3KYDA 1KI6B 1GSIA 2FFRA 3NUQA 2HL6A 4FGLA 5TY0A 1YK1A 4M7PA 2QUAA 3BS4A 3NRBA 5JXHA 1NR7A 1U90A 2FFJA 1GITA 4IJ6A 3WQBA 3W6PA 1FFGA 4M4SA 4QOGA 4QXPA 4GWGA 1XQ1A 5I48A 4RY2A 5F78A 3FYTA 3QXHA 3K32A 2ISQA 5FPSA 4DRYA 2OCLA 4DR5B 4IKPA 1W0CA 2D1QA 4PPNA 2GH1A 3EODA 4YJHA 2FWJA 3QFRA 3A6FA 4ZQBA 1MTZA 1HL3A 3DMDA 2Z6VA 3GLFB 2TMGA 4IMPA 5JFGA 4XRRA 3IAHA 3WP0A 1Q0LA 4OYLA 1YZVA 3SIWA 3TIFA 1YQDA 1KP3A 3ON5A 2FUG1 4BQFA 3PCTA 4Q9NA 2AN1A 3FCCA 4PZZA 5LZ5A 1DCFA 3UXMA 4RZHA 3T1TA 2Z8YM 3D5EA 4GI3A 4JJ4A 4KIJA 3RT1A 4URYR 1IZ0A 1ZMOA 4D0GA 5LFAA 4W5QA 1N9KA 1TJPB 3E61A 1XMOB 1TU0A 3IPAA 3BL8A 1X8LA 5TEWA 1RXCA 4XI9A 3DZKA 4V3CA 5HCIA 2IOFA 1I2ZA 4ARUA 4CR7A 1UXIA 5J58A 1FJ2A 5TQVA 3HXMA 1R2QA 4RQBA 1NRIA 1AV7A 1UT8A 3CSSA 5LQJA 1Z6XA 2NO9A 3EZ7A 3QFHA 2RFLA 5F9MA 4LTMA 4YP9A 3VVCA 3DZCA 2LP4Y 3LC2O 4DL9A 1C29B 1N75A 1OIVA 3UFBA 5L4SA 4X41A 2AOTA 3GT3A 4AO6A 4X1IB 2CNBA 1OXSC 1CS0A 2UVPA 4ZKEA 2FY8A 5A3VA 2X8JA 4WKNA 1CD5A 1EINA 2NQ8A 3I1JA 3H8VA 3VR6D 2AJTA 1N78A 4FYHA 4RIGA 2BV3A 1EG7A 4MQLA 4CI9A 2AE2A 2HZ7A 3TJRA 1PEKE 1HQCA 5I7FA 1ZH2A 2EP8A 2AMFA 2P4UA 4ZGGA 3SVTA 5C8YA 3A6LA 5CNMA 4GZ3A 1JQLB 3G89A 2PDAA 3H4TA 1DELA 4NRDA 1X7XA 5EWJA 4G5OA 2HA0A 1C3VA 2YV4A 4UTOA 5INTA 4K03A 1RZ3A 2CNWA 2IU6A 5EE1A 4KPUA 2O8EB 1GAQA 4N5NA 1QQ7A 2HA6A 3NIGB 1S3IA 1U1CA 1XZPA 3EIEA 2DJIA 3H86A 2MR6A 3OMWA 2O8VA 2VP4A 1V5WA 2IDKA 5JMWA 1EM6A 3FWPA 4RA6B 1RVV1 4J7AA 3Q0EA 3ZVKA 1Y3AA 1GZ3A 2DFKB 2NSLA 2V59A 3JAKB 5EZ6B 4D3YA 4I1UA 2B5WA 5EHNA 5D00A 4BIMA 3GGOA 3AESA 1KDPA 4GD3Q 5JSKA 2P9ZA 3DEZA 1SKMA 1AU9A 1OSNA 4QVKA 5B1HA 4X8OA 4YLYA 2GBCA 4EFKA 1J1ZA 3LYUA 1G5PA 3WZ2A 5JAOA 2IOHA 4D0SA 1H2FA 2XMCA 6CHYA 3LPCA 4KSBA 2BKAA 4UHBA 1UXGA 2BHLA 5IXYA 5KYWB 3KC2A 1Q11A 4EUEA 2Q2NA 3IIEA 2PSFA 1YH3A 2HA3A 4F4FA 1AKNA 5LQDA 2DWCA 1DADA 1KAHA 4R7ZA 5BNIA 1GPKA 3V1LA 4BP3A 3ZCPA 3AHFA 3QGMA 3NHAA 1ZUHA 3DVQX 4JC4A 1FDRA 3NC0C 1CB7A 1SCUA 5DNVA 4KIGA 4BNDA 4EX7A 821PA 4BLRA 5EA2A 2PM8A 5A6VA 1YFJA 1NXSA 4JA0A 3T3OA 2DZDA 3I9JA 4G5SA 4MV0A 4F11A 2WVAA 4MW5A 5TPZA 4E2XA 1KO7A 1N7IA 3PXEA 4DGSA 2CJXA 2C07A 2G3YA 2XZPA 3BD8A 1C8BA 4BNIA 4DSZA 5T4HA 3BTSA 5JIBA 2VQEB 4H3SA 1A27A 5HKKA 1F14A 4ZANA 3VV2A 5BWBA 4OA8A 2OT3B 4QOSA 1JXOA 2ZIEA 4UMVA 2XYRA 5E0KB 3VHXA 3KLMX 3BT7A 2F3QA 2AK2A 2O6LA 1Y89A 4BO3A 1N5DA 1ZRNA 2OSVA 3K30A 2FRVA 1L9XA 3HCNA 4CM4A 3UXEA 2TRSB 4HQKA 4ZQIA 2J9XB 2A59A 1A8HA 1NJ2A 3CX8A 4IHQA 1UBTS 3L2OB 5AJTA 5BV0A 3EMVA 5DNYB 1OZ0A 1KO1A 2PUFA 1MR3F 3Q6MA 1H8ED 5EE3A 5JJ5A 1UJMA 3FY4A 3IUYA 2PT5A 3OUTA 1Q50A 3WAKA 4B6RA 1S2NA 2IF2A 1VXOA 2ZIZA 3HSSA 4E88A 2XGGA 3DDUA 3PYMA 3WGIA 2PA0A 2VJLA 2WT4A 4M9SA 4P53A 4QQKA 4B0PA 2DG2A 4YJ3A 3RIMA 3ZWKA 4JJ6A 4LQLA 2EP5A 3TO5A 2FMXA 2XVAA 2LUOA 2PWYA 2P3LA 3RS3A 4D9HA 1USVA 2Y1DA 1B1AA 1YDHA 5BPFA 1IRIA 2JJ2D 4ETWA 1TJNA 3BHNA 4DLUA 1BX1A 2E4YA 3NKLA 2EQBA 3GJYA 5JWHA 2C5BA 1LRJA 4MS4A 4H4CA 4ENSA 4NDNE 4RCVA 1T15A 3AGPA 2BFOA 5LXTF 2X0FA 2E89A 1SUDA 1HLPA 3OF2A 2PZLA 2OTCA 3IUEA 3V4PB 1T9CA 3PZRA 1SVIA 5FUBA 2GWRA 3LIPA 1Q7BA 1ZCAA 3IQFA 3QVUA 3QQPA 1PNOA 3WSTA 2GD2A 4X64B 3BF8A 2OBYA 2PRZA 4IW3B 1GTZA 3NZEA 3EIWA 4MQMA 5FOUA 4H3KB 3U09A 4H7IA 3H1FA 1NMYA 4F5WA 3LMKA 4Q0MA 4CKCB 3LPLA 1EVZA 1ZM7A 1ZSNA 1E96A 4FTWA 4JBWA 5JS7A 4XWWA 3AUFA 3V1MA 1N92A 3WMGA 4WLOA 5JWRA 1TX4B 3ODPA 1LPNA 4F5EA 5CDGA 5AM3A 1X7DA 2CB0A 4CG3A 4JSRA 3TW8B 3RR2A 4V38A 4AT1A 3O47A 4FMCB 2C2MA 3SS9X 2H0AA 3RYCB 1NNUA 1CFZA 1GCIA 2V4ZA 4JQZA 3N1UA 4XQ0A 3D2BA 1TMYA 4QSMA 1SA0B 3RODA 2A57A 3VPCA 1JG4A 1KJIA 2J3EA 4UDYX 2AN3A 1V48A 1JPUA 3PUWA 2NU9A 5CYFA 3DEHA 1YB7A 3BRWA 3OJFA 3PD1A 3HPRA 2ZSAA 2FI1A 3AG5A 4OI2A 1SKQA 3L1JA 2IOQA 2HY7A 5E6UB 5HK8A 2V3WA 3TMYA 1ZR2A 3AB7A 1NLMA 1EB9A 4ID3A 4XDZA 4OHRA 2VJOA 1Z73A 5DM2A 2IZOA 4JQYA 4P3PA 4RD1A 3RB8A 2B7BA 1N8NA 2C2XA 4JC5A 4B43A 4AZVA 3D3JA 5T8KC 4EA9A 2WFLB 2JDIA 1FFXA 5B1YA 2GS9A 5AM2A 1T35A 3EUWA 4ZXPA 4X3OA 2ZB3A 1J33A 4NH0A 4RTQA 3BK2A 1YAJA 2HSDA 3RYIB 4ALNA 3V55A 3BAZA 3V9AA 4K9MA 1FX0B 2M6KA 3WK5A 3KQYA 1Z88A 3GNSA 4UM9D 4AFNA 4O4LA 4CI0B 4BMVA 4MH0R 5E4JA 3W78A 3EIOA 4JMPA 3WY9A 1F4LA 1HE8B 1A0OA 1T1SA 3G7SA 3I2IA 4I4IA 5HFNA 3T1VA 5KYUB 1MCZA 1E9CA 3D8TA 5FTJA 4Z7QB 3QPCA 1XTVA 3OTWA 5JV5A 1BRMA 1FS6A 1XBTA 3IMCA 1J0AA 1YZGA 4JLMA 1TQDA 3IUJA 4CTNA 1X1CA 1ZNXA 4C7XA 4OOEA 1HEUA 1RXYA 3DE7X 4JZKA 4Z0TA 5BNFA 3RHFA 2XSZD 5KOIA 4TTTS 3AERA 1IK6A 1S2DA 1TDJA 2I1WA 4B45A 1Y5MA 4HLQB 3U17A 4TTIA 1ZIXA 3LLMA 4OAOA 3RS2A 1HQKA 3W04A 4C01A 1USWA 5ALUA 2O2HA 4B6OA 2WR8A 2V5AA 4ZT2A 3U7EB 3PS9A 3TSZA 1T8WA 2E48A 1VSUA 1QUEA 2O1WA 1G9TA 2R8XA 2W6OA 3OUZA 4J76A 3PQ8A 4S0ZA 1L5GB 1QTRA 3S27A 1FL9A 1J24A 2OV8A 5CT6A 2ZSHA 4IOLA 1M5TA 3R20A 4NNPA 3VYTB 3KZNA 1MVNA 2H1OA 3PJDA 2AD5A 1OXTA 5DOZA 5H70A 1FLAA 5LL6P 5CT9A 1M1YB 3I01A 1QIGA 1QDUA 1UBOS 3HZHA 3JU3A 4NOKA 1ODJA 1O0SA 1DT5A 5GIOE 2WWGA 1MB9A 2BT4A 3OQIB 1N2IA 1L2TA 2PKWA 3TQCA 3OA2A 2XRMA 3UMYA 3CTMA 1G55A 5B4VA 1QQAA 3DHYA 2XCQA 3OZCA 4MWSA 3T1QA 2A7QA 2OQRA 5E4FA 1MRZA 3GVIA 1GU0A 3E9DA 1IBSA 1KXJA 1TYCA 4FYKA 2GBLC 3LIIA 3T5DA 1I14A 3BE6A 1HYEA 4RK1A 4DUZB 1TCUA 1VJCA 3TH5A 3IDSA 4I8DA 5T57A 5C5IA 1N25A 4YT2A 1FUIA 1UANA 2BHRA 2O5EA 1CRPA 3KETA 3AERB 3P2IA 1X7YB 2VDOB 1ZRSA 3P9XA 5TARA 4D9MA 5IVPA 3IP8A 2IZ5A 1U11A 2ZKLA 3NHBA 1J0CA 3B85A 5A6SA 5ALVA 5A4FS 1SUPA 3UC5A 5KX5F 4BQIA 3D5TA 4OTZA 5AKEA 1K86A 5J2UA 3FFAA 5JPCA 3K4QA 3L77A 3D3KA 4LJ4A 3TOVA 4D9CA 3GJTA 1N9GB 1UBFA 5FULA 5HS6A 4RXUA 3PKIA 4CTMA 2ZJBA 3ENWA 2J08A 4KNWA 4L27A 2RHOA 2DY1A 1QKKA 3JWPA 1ZCZA 3N58A 2JHFA 5BN3A 3MGKA 1P62B 4QEDA 1RM4A 3TLJA 3H5OA 4LHWA 3O82A 1VYHA 4FFMA 2OQIA 1F6DA 1TQ8A 2GK3A 3DR3A 3OC6A 1XZ8A 2B8NA 2R44A 3ETCA 3T7TA 4EPWA 3RKSA 3DP7A 3GGSA 5ALRA 3E9QA 3DF9A 3GU3A 3HYRA 3PE6A 4GH5A 4K3UA 4B74A 5F5LA 2B36A 3Q7PA 1R88A 1J8DA 3P96A 4CEHA 1TC2A 2KE5A 3SHQA 4ZOBA 2PMBA 4NJMB 3OAAA 3TSAA 1ADJA 4KHZA 5FBRB 1YC2A 1IWOA 2R48A 2R6FA 4WW0A 1R8JA 2ZU6A 3KL4A 3UB3A 1ZG3A 2RGNC 2A14A 3SE0A 3I62A 4BNNA 1AS2A 1JSRA 4KUGA 4WFIA 2G6TA 3FW1A 4UZSA 4B9AA 1N33B 3AFMA 1RWMA 3N8DA 1DRJA 3IP1A 1EVLA 1ZEJA 3AG6A 1L7NA 3AF3A 4J0JA 3FTCA 2O2JA 1D8AA 1E9DA 1G64A 1NDQA 1O94A 1BA3A 3SM9A 1O77A 2ZANA 4YCBA 3WIEA 1DBQA 3ZW7A 2IY7A 3V4RA 4Y2JA 5CXUA 3EH2A 4TZ6A 1D5CA 1DJLA 1SRQA 1LC0A 3P27A 1B23P 5AVRA 5BORA 3EBPA 3Q8KA 1RRGA 5EQFA 4LBZA 4RZSA 4Y18A 4LJ5A 2P9YA 3H1AA 3EMDA 1TQHA 5FUQA 2GCEA 4LRSB 4ZAVA 4DR7B 4US2R 4EGFA 3B1KA 1H2WA 2C5HA 4FN4A 5AKZA 5TXGA 2PMCA 3CBGA 2C96A 3QU5A 1JHVA 1XNHA 3DYIA 1G8JA 2IXAA 1EGMB 4BMYA 2F1OA 2ATIA 4ND5A 3OMLA 4Q6WA 3CZ9A 1G5QA 2ZVPX 2FPIA 2QR5A 4MCJA 4C08A 1R00A 1U2SA 2H07A 2P0YA 2RIRA 2YMMA 2OO3A 4UE6A 3OU6A 1ZC4A 4BL5A 2ZIXA 2DFPA 1R64A 2OV4A 4UOQA 1CQIA 2IHVA 2LVBA 5HDQA 3RRNA 1BDIA 1Z5PA 1D2AA 2BEUA 1H4VB 3ONFA 4QAQA 3OT5A 4TQGA 2I34A 4CMAA 5LP6B 3VC7A 3AHDA 2I2DA 4ND1A 4HGRA 4UTXA 4DCSA 1WTCA 4QUKA 2JVKA 4JGBA 3K20A 1GZ6A 4MVJH 1ACMA 3R7BA 4BO4A 4OKNA 1TIBA 2HX1A 3NTVA 2QVCA 3L07A 5ALQA 1E0AA 1MFPA 3GIWA 4IIJA 4CMIA 2QQ5A 3HL0A 3KKZA 3PRKE 3U26A 5BPHA 1JYFA 3C7TA 3IAS6 4M9XA 1R8SA 5ALLA 3SP1A 4B3MB 1V11B 4DDTA 4BZPA 4YV1A 1DX4A 1I1NA 5HBGA 1NMQA 3HEAA 4AZ0A 5ICSA 2F4NA 3K72B 1PWXA 1JNXX 3PLRA 2X0DA 4N6NA 1B93A 3AHGA 2JGJA 3CEHA 3ONNA 1U1DA 2G36A 5KHOC 4BVBA 1BXZA 1X8XA 3QBVA 5E2BA 4O2BA 2DKFA 1PHPA 3PICA 3IOEA 2WMOB 3ZZNA 4ZMBA 2A9PA 5ARBA 3ZGZA 3JD0A 2M98A 1W19A 2Y1OA 3W5UA 5ENVA 1PJSA 4AU1A 1A9ZA 1QX3A 1QS0B 1TM7E 2BFDA 3KO8A 3L8HA 5AVOA 2GX6A 4BQEA 2PQ2A 1Q0UA 2VZ0A 2WP8J 2IC5A 5HS4A 1E3EA 3QEMA 1CY2A 2PWAA 3CKKA 5JXIA 3Q5GA 4GBGA 2XDYA 2MU1A 2E0IA 4LSWA 2I6QA 3AR5A 1NOKA 2AN4A 4PSCA 5DWDA 4OAPA 3L92A 4BB5A 2VO1A 1ZW6A 1ULHA 1FA9A 2JFGA 1TO2E 3HHPA 3LGXA 1LBQA 4MAFA 4NKRA 3W4KA 2WQZA 3USCS 3T9FA 3VH1A 3ZCSA 1P4HA 3INNA 1XPRA 4UHJA 4W9NC 2AV6A 1E94E 3OTHA 5LQMA 4OM8A 1YTLA 2G8NA 4NK4A 2PH7A 1T1EA 1V43A 1LF5A 3EVTA 1UQUA 1QQTA 1Z39A 2EFGA 4F4DA 4RM3A 2IYTA 2OPBA 1Q1BA 1ZXXA 3BN3A 2QTAA 3EIFA 4FZRA 4GUAA 3A4YA 2R0QC 3E7XA 3LT4A 1Q83A 3PL1A 4Y1FA 1COWA 3N3AC 5M04A 3LUGA 3JPYA 2VLBA 1CQZA 1XA4A 1XRNA 2GCPA 3IAFA 4PPYA 2H5LA 3ZHCA 1RHJA 1QRAA 1JFTA 2IXDA 3OEHD 4A1OA 1EE9A 1HYQA 5E4TA 5LXTB 2K2QB 2WQ7A 2ONJA 1L5WA 1FW6A 1BX0A 1AKYA 1X1SA 1ZNZA 2W6IA 1JLMA 2I55A 2AXNA 4FZVA 1ZJ5A 1CQPA 5IM4A 5M2QA 4F4IA 5JS1A 4HLDA 5I9SA 1WEHA 1R6UA 4O3MA 1IBCA 3HNRA 3HZZA 3DZGA 4FYPA 1VLZA 4L8WB 1VPWA 1J8FA 1BDMA 4WINA 4HGNA 1JW9B 2HWKA 1AT1A 3MS7A 5I7RA 5L51A 5ICEA 2VXBA 3Q7SA 3F90A 4A27A 2PY6A 4JLPA 3I0NA 4A8JA 4C03A 3DE0X 4E46A 1A1SA 4KQ2A 2BH2A 4I55F 5IAAA 1BGVA 2CMDA 3GUUA 1KH2A 3RO7A 1MVOA 3UATA 3FJOA 4DJDC 1MX5A 3FWKA 4DTIA 2AUTA 3IVRA 3I6MA 2PSEA 3SCZA 2IPAB 4YHHB 1TM4E 5AUPB 1KP9A 1PR9A 1T5SA 2I3BA 2LXNA 3KZKA 4P4SB 5IAEA 4EG0A 1U02A 1YBHA 1PTJA 1YBFA 4I9NA 3LUKA 3U49A 1DGQA 2KSQA 4MA4A 3NHJA 2JI7A 1NBMD 2WLSA 4L8LA 4K6HA 4E3WA 3C6YA 4N0DA 1QFXA 4CLOB 1WLYA 4IIGA 5J23A 4BJ3A 2YZ7A 3BWMA 2FLWA 4L4XA 3M4YA 5FV7A 4PC6A 3U7GA 3P52A 3WV4A 3GPCA 3HCEA 4TQ9A 5HRCA 4HEA6 4UHKA 4CBVA 2VK2A 1LNSA 1E1QD 1NF8A 2DTEA 2JGLA 4PLWA 4TXJA 1F2UB 3VR5H 4Q7MB 2LCFA 4PYRA 4Z8XA 3PNKA 1X7WA 4X8HA 4TWZA 3SNKA 2JAHA 2GEDA 4JB8A 1Y8CA 2VH2A 2LIVA 2NV6A 3NG1A 4KEAA 4ZALA 1A76A 3RV3A 4IDAA 4W82A 5EXXA 5DM60 3F9RA 2QYTA 3BXEA 1QNFA 5ILOA 1GDHA 1U3TA 1VTKA 1CHDA 3M3PA 4IIEA 1Y7HA 3K9WA 4MW1A 4QX6A 1Z0SA 1WSBA 2HPVA 5FI5A 3UNXA 3VKUA 3T99A 3ICPA 2VT6A 2OCIA 2AC7A 3IDZA 4N49A 4FLFA 4AMBA 4C04A 9LDTA 3A2KA 4KHPB 3LCCA 1T34A 1VSTA 1B7GO 3PWKA 2DBVO 2BFNA 1Y34E 3UT5B 1SKAA 4IGKA 4EJ6A 2XB2A 2ZE8A 3OHSX 3AINA 1UM9B 3TNDA 2PE5A 1J8VA 1I3CA 1ONOA 3B38A 5LZ8A 1UFVA 1NVTA 4Q1EA 3TRKA 5L6LB 3AB8A 2Y1WA 2YZKA 4M89A 1JXAA 2GN6A 1ZRHA 5H83A 3FYUA 1OYYA 4AVYA 4YRKA 1PUXA 2AMJA 4LYEA 2OB2A 4URWR 2IYZA 2PL3A 4Y7DA 5E7IA 4AS2A 4JLKA 1KEKA 2OO5A 2QJFA 3KSMA 3T52A 1PJLA 1QC5B 4FMPA 1XHLA 1A3CA 1L5HB 1RRFA 2C2WA 2J5RA 2WHEA 1RYFA 3RTAA 4H7JA 3OHPA 4XYLA 1J06A 2ZREA 4LDZA 4LG1A 1NVVR 2A5LA 3D0KA 1GGEA 3O75A 5JQGF 2XJ9A 3G49A 1XJWA 3LUDA 3W5JA 5LP6C 2B37A 1HORA 2OZEA 1DX9A 3PYXA 3FCAA 1A8PA 2AOXA 3OLYA 4N7MA 5LNK1 2CJFA 2GILA 4MVJE 1Q21A 1EAYA 5TQJA 4MDFA 3I5MA 1C1YA 2WINI 1A9YA 3L1VA 3EZYA 2M32A 5AI5A 1ULBA 1QGAA 4R1LA 2JFUA 3JXEA 3WMEA 2O54A 1P18A 4BN5A 4JI3B 4ZU1X 4AY5A 1FTGA 1L7PA 2FLVA 2XUGA 3HBMA 1NP3A 2C2GA 1NJ1A 3DZHA 2DPLA 2XTJA 1E1DA 2X0IA 3UT5A 2RD2A 1VE5A 4PHGA 3KWMA 3T9CA 4ARZA 5BSFA 3HN7A 1Z33A 3M6WA 1WVGA 4ZCQA 2ZULA 1FVXA 4D46A 1EU1A 5C4IA 3L7OA 4HL6A 4OHWA 3S7TA 2MYPA 3QMMA 1KJJA 1RIFA 4PQRA 1LBEA 2CVFA 2OHJA 3UENA 2E6KA 1L7BA 3TJMA 2P4EA 3O92A 4PLVA 4DW8A 3CNOA 3KUCA 1CE8B 3RNLA 1U9YA 2RC5A 1HSZA 4IVQA 3ND8A 3T34A 1RP7A 1T9GR 2XCLA 1DINA 1J8YF 2VF4X 1Z4IA 3I1FA 4KXFB 3UTDA 1WW8A 2BR5A 2VRCA 3NANA 3TLKA 1G5IA 3AL2A 3F47A 3DE3X 4O29A 1HLFA 2YXEA 2Z04A 3AMVA 3B5EA 3LPNA 2O0LA 3U3RA 3WGJA 3ZGVA 5E8JA 2M6LA 1UDRA 2GZ3A 4GSKA 1Q6ZA 4QRIA 2QX4A 1J1IA 3KX2A 2JGEA 4U7JA 4QLBA 5HJ5A 1WW2A 3V8NA 1OZAA 3VR5A 3AU9A 4J03A 4P4UA 3NP7A 4YASA 3TD9A 1GQSA 4EW3A 1VCMA 3A6GA 4TYPA 5B7PA 2L18A 4P2GA 3AC0A 4AJKA 2IOYA 1VZ2A 3LT2A 1CQWA 3IO5A 4DN6A 1KOGA 4LS3A 4CF4A 1G60A 3O9VA 1Y4ZA 5IWAB 3PDUA 5EOVA 1E7WA 2XUAA 1C3LA 3PA6A 4QNRA 1H5UA 5I4BA 3NBQA 2WQ6A 3JQAB 3QG1A 3CWZA 3FPEA 2CVHA 2ZYAA 1N2EA 2L82A 1II0A 1NMEA 3K9HA 4YDQA 1NHWA 4V3BA 2OC4A 4U4AA 1OH8A 2QVXX 5LBUA 3Q8MA 2FZ5A 2FUKA 3KPVA 1N5KA 2LRHA 1V8BA 4PR0A 1CUWA 2BBWA 3SEFA 1NVDA 4RIFA 5IS2A 4WLFA 3NUZA 1TW3A 2RCYA 3A8TA 3PFKA 4EY4A 5IJ0A 5KBYA 2AB0A 1RS0A 3HXQA 2OM2A 2XQJA 2YS7A 4P54A 4MWEA 4PQEA 3L6BA 1U81A 1P5RA 2IXBA 4LOJA 7REQA 2JHCA 1LQTA 1M1ZA 1SKYB 2B61A 4G0XA 4JP8A 4ZVMA 4PN3A 5L53A 3P0IA 1ABFA 3WLFA 2DPXA 3GAMA 4H59A 4UFNA 1JWAB 3IL2A 4EKIA 3AQ4A 3H11B 4O59O 4WQMA 1KJWA 1BWRA 1IZZA 1ZN7A 5EESA 1GT91 1XMJA 1A04A 4KK4A 3WNDA 3K9FC 4FHZA 2VDRB 4HNGA 3MWDB 4H1VA 5ALDA 2C9BA 1XDBA 5DP2A 1NLFA 3F3YA 4ACAA 9ABPA 5F4ZA 3WYDA 3N6VA 4D6XA 1RE0A 4BNDB 3NHKA 2QAIA 3G17A 2I3AA 1X7HA 2W37A 3ADBA 5LA6A 1H4SA 4OBXA 4XWGA 1KBZA 1WBBA 3DMRA 3F49S 1QZ3A 2DECA 3VNUA 3S7ZA 3L4KA 4X1OA 1BXGB 3BXPA 1KMHB 2JLQA 2H1RA 4IGEA 3L7MA 5TS3A 3R5TA 1GCAA 1WDMA 4TZKA 1ULZA 2ORWA 1K06A 1E9EA 2ZRKA 3EZ2A 3NBYC 4GSYA 3PUVA 4OG2A 3MRXA 1GNQA 1KK3A 4EI9A 3NHLA 4MTCA 4PZLA 5E9AA 5A3JA 1W48A 1PDOA 3PVCA 1CIJA 2GDJA 2XTAA 2Q6VA 1JLLB 1I1HA 1M2FA 2VCHA 5BW8A 4BNKA 1M0WA 2G06A 1B6TA 4BE4A 3A1TA 3QIAA 4S1VA 5JSQA 1FYWA 4M1EA 4OLFA 4WLUA 1M6VB 2ZPAA 3H97A 4PFKA 2DP4E 3R9WA 4BFWA 4F60A 4B9EA 2PKXA 1ISFA 4GI7A 2JB9A 5KYXB 1S8NA 2GHQA 4KXNA 3F46A 3RYFA 4BXOB 1XNGA 2GVZC 3RKUA 2IEZA 3VI3B 2FUCA 2XVMA 5IT5A 4K6OA 1LDYA 1DIOB 1U0FA 5FO0A 4DJ5X 4GX0A 1IXRC 3UJHA 4DRXA 1PGJA 1V9SA 1T9AA 2F1IA 4M1KA 5AJYA 5P21A 1GO2A 2EARA 2J0UA 2WI8A 4E5MA 1GTSA 3Q1LA 4Q3LA 4B5LA 1RJEA 3WXBA 4DMKA 3DB1A 1PS9A 1PT9A 1F5NA 3KKKA 1XPOA 2XTNA 2EBHX 4BPRA 1PHRA 2V9ZA 2XMSA 4TRMA 4TL8A 2XTZA 1G6OA 1FJHA 1ECCA 1SEVA 2R00A 3BDIA 4OP1A 4AY3A 3BRCA 3P5SA 1QPZA 1JFSA 1RPTA 3VR4D 2G5PA 4Q3NA 5MDHA 1XTSA 2GKOA 2WIBA 3O9ZA 2VZEA 3L5KA 1W94A 1ISHA 1F4VA 1OW3B 1FTSA 1W88A 2ZJYA 3DLAA 4GSLA 1IC6A 3ROGA 4F3NA 4EK9A 2QDXA 5A4JA 3GJ7A 4KITB 1M5RA 5D84A 2F3PA 4HYQA 2G5CA 3CZPA 3X0DA 5K8VA 1FDVA 3WL4A 3QTTA 3H16A 4A0FA 2IP4A 5THQA 4WHMA 3W9UA 3VH3A 5C5EA 1MO3A 3THYA 3BWDD 3LW8A 4HS9A 1UJ4A 3LO5A 3NLLA 4G1MB 5AW4A 2E1PA 5DTQA 3L0SA 3K7EA 5IDQA 1MC8A 4C4ZA 4FLEA 1IEXA 4TSKA 1DTEA 3LK7A 4Q6BA 4DREA 4HLNA 1KU6A 2O57A 1KS9A 2Q8QA 4OMDA 2DPMA 2RI6A 1DXHA 2W22A 2YXLA 4IEFB 1MF7A 2EFEB 1JBEA 3EQ2A 3LX4A 3L41A 4RMGA 3VU0A 4U2BA 1J00A 4BBZA 4EHDA 4AJ4A 3PWSA 1VIDA 4OK3A 5H7XA 2NSJA 5DNDA 5H82A 4IYRA 3W5HA 2C4HA 3DM9B 4UNQA 2IBMA 1PK7A 2OLJA 1SIWA 2JIZD 5FWDA 3TLCA 5F3WB 2IHZA 1SAYA 1UZMA 4GI1A 4I5IA 4XJXA 4LDQA 1JF8A 4RS3A 1YJXA 4L0MA 2J9FA 3E8SA 2RGYA 4JX9A 3COYA 4Y67A 5IM5A 4ZT4A 3UW1A 3VZSA 5I8PA 2O19A 4EVIA 5CA0F 3AUUA 4M1MA 3FN4A 3PTAA 2CWDA 2IYEA 3GL9A 3TBFA 3FKSA 3LE8A 5G0UA 3H2JA 2H31A 2W2MA 4YP7A 5FJIA 2IHJA 4BWFB 5LJIA 3IAM6 1KWKA 1D1TA 4O4LB 7YASA 1JEYA 3T5AA 1U7WA 3BSYA 3Q2KA 1DC7A 2A3NA 2VPQA 4J3FA 1LXCA 3AGQA 2FN4A 2VUTA 3QXGA 4QXMA 2HR1A 2YY6A 4OQMA 4KVGA 3HYNA 2O7QA 2V55B 5B1DA 1BVHA 4KGZA 1QVVA 2R66A 1E89A 1WV0A 2GR9A 1BU8A 3ZY4A 5LM3A 2VATA 5KTKA 4C3OB 3OJOA 3PLNA 3PQ5A 1F8XA 1REQB 2R25B 1EX9A 4RGYA 5L40A 2CFRA 4FN5A 4RFSB 3RSCA 2CNKA 3TXXA 3V8QA 2PGIA 5F33A 2DFVA 3KHTA 4GOOD 4K5QA 1CKEA 2AIRA 1OQAA 2Q5FA 3NOVA 4C22A 3SOZA 4QQNA 3WTBA 3ZWWA 1PJRA 2ZWIA 4PXAA 4FXOA 2WJIA 4JOSA 4RTSA 2JK0A 2PBLA 3I76A 3M33A 4I1RA 3KB1A 4LE2A 1HEIA 4I1VA 3N0TA 5LYJA 2P77A 4QODA 1PV4A 1RI2A 3IJEB 3RJ5A 2G9ZA 5L95A 3KOXA 2P79A 4MP3A 1UP4A 1XIVA 5AM5A 3ZLTA 5DXJA 2VP0A 3AV3A 5I7OA 3WZMA 4LF6B 4NE7A 4FMDF 4ALJA 3Q15C 3VR3A 4FQ8A 3Q3EA 4TX1A 1IB6A 1L5MA 4UAUA 4MRNA 3PL5A 5FLYA 2RB4A 4KV9A 5KQSA 2OYRA 2G72A 2QM3A 4QPJC 2A9OA 2AG6A 2JF0A 2Z1NA 1YQEA 4J2HA 1JEYB 3T94A 4OB8A 4F9FA 2JKVA 2PZEA 1E2FA 1NJ5A 3ZUPA 2QLJA 1FVHA 1D4ZA 4BU0A 3RUEA 5EIEA 1DDOA 1V1RB 1HT1E 2HMVA 2K87A 1YRAA 1U0EA 2H4FA 2ZZKA 3GCZA 4KYTA 2NTNA 2PAAA 1GHTA 4DG8A 4DOMA 1CY4A 2MINA 4TWIA 2EX1A 4IMRA 4UM5A 4WXYB 4XUGB 3B2QA 5I9MA 4B85A 4FOOA 1I30A 1L8LA 3AVXA 1VCHA 4NJOA 2VDQB 3HB4X 1P33A 1XCLA 3S8MA 3X44A 3BIOA 2QR3A 4EZIA 1K98A 5EKDA 4ZT7A 2Q1WA 4LC0A 3T6KA 1E2UA 5FFMA 4BQQA 2A5YB 4Z8YA 3HB5X 2ISSD 3MS4A 2EERA 2NAFA 3IA7A 5I51A 2QRZA 4N5MA 3TZ6A 3AVUA 1NVXQ 4KX5A 4LGYA 2Z5LA 3T1OA 3MCAA 4D1YA 3VA7A 2GEBA 2XA9A 3PGLA 4CM7A 1U1GA 3G68A 3SK0A 3CJQA 4U7PB 2NN3C 5B3AA 5FBQB 4Q82A 2XWBF 4OSEA 2Z9CA 4WPGA 2R3SA 1HZZA 2DAPA 1LPAB 1NVGA 2YWJA 3O95A 4REQA 5L3QB 2SCUB 2GZAA 1JXMA 3C43A 4KR7A 4DG5A 1HG1A 3AUAA 5C1OA 3OPYI 4POOA 1MD9A 3N39C 3OSZA 4K9DA 5B6PA 2ZYWX 3VR6H 4CEHB 3SBDA 4HQ6A 4EITA 1AF4A 4D7AA 1W4LA 1YZKA 1VLVA 4L7VA 2BSAA 2YWDA 1M33A 3ZJ4A 3H5LA 3OFSA 1P73A 5JT1A 3G23A 5EMMA 3U62A 5JQGA 3KSRA 2BEVB 1WUHS 2EKBA 4JJIA 3QW4B 2BFMA 1U8CB 5ALSA 4WESA 2C94A 2W4MA 4J07A 2UVQA 4MVJM 2PSDA 2C7VA 3KQMA 3VC1A 5CDHA 3CRNA 3CN7A 4PHHA 1NTOA 4HADA 4EJSC 5AUQA 5B2ZA 2AD1A 4RD2A 2YWGA 5EWLA 4Z6KA 4M37A 1F0PA 4DUPA 3U4QB 3AIKA 4B3TB 5T7BA 4OM7A 4XDGA 3CRW1 3TCXB 4FW8A 3D8RA 4CCYB 1QWOA 4Q9DA 4B7CA 3D54D 4GRIA 1ISRA 3ENQA 4JR0A 3SC3A 1A8QA 3TLZA 3ZXXA 1XQVA 2Y76A 4DBLC 4W8OA 5DYYA 1H2RS 4DVJA 1UFQA 1C30B 3LP5A 4J75A 4DUGA 3P9CA 1IZ8A 4J4BA 4TVKA 4TLBA 1GPJA 1FRZA 1U2GA 1KK1A 3M6MD 5DI3A 4W5NA 3IESA 4DA7A 4LFBB 1B41A 3V8EA 3ZH2A 4ZYYA 5B7GA 5CDUA 1WA5A 3QBEA 2WWHA 3D02A 3DMHA 1N6OA 4G5HA 4NH4A 5K6AC 2F3UA 1EJ0A 2H8GA 5IC6A 5TEVA 1G8AA 4ZVQA 1UDAA 2FJUA 5HJ7A 4JI0B 3E2PA 4JYMA 2O9JA 4QOIA 3BMQB 5CVJA 3TSCA 1KC1A 2WJ6A 1ORIA 4PWZA 1QZXA 5FA8A 1NVEA 2ZETA 3PD7A 4J1QA 4DDWA 2Y1LA 5CBPB 4CFZA 4EUHA 1UK6A 3A3PA 3SI7A 5DYNA 2NYAA 1SWWA 1KY2A 3UO8B 3AR8A 3NEAA 5JBNA 1Y6QA 1SPBS 4I1SA 1LLUA 1HYBA 1V4BA 2YRFA 4V0MA 3W5VA 5BV8A 3EXAA 4JOBA 2HA4A 3J80A 3T9BA 1QXSA 3H9GA 1DZ3A 2HREA 3UAZA 2IK8A 1FXSA 4RKEA 3OEWA 5JD3A 2VBIA 3D2CA 5ERXA 2PK3A 2IHYA 2Z1MA 4OU4A 3N28A 1PK8A 1KIAA 1SHTX 2X7JA 2ZAMA 3R3YA 3LY8A 2OXTA 2JFVA 4UBMA 1GPAA 1B6GA 1XCOA 3O4HA 4QREA 1JQKA 3QUQA 4CLHA 1LBSA 5EJMA 3O8NA 3LG2A 1A96A 4YYZA 4A6PA 2WYIA 5CAEA 2I6GA 4N0MA 1AH2A 1WG8A 3MWLA 1IOZA 1B4DA 1IHPA 3H99A 4LTDA 4MRAA 2EV9A 3VYVA 1R37A 3B6KA 3PPYA 4NZ9A 5FBVB 4B3GA 1L4GA 3RIGA 4AKHA 3H5NA 2ZE7A 5DHTA 4DYVA 1XD2B 5E2IA 2YZGA 1T2NA 4QKQA 4EZBA 2GLXA 5JAQA 5ENDA 5F7OA 1BAPA 2Z4TA 1EDOA 1FFWA 3T7SA 2G0AA 3BSSA 3LYAA 5F21A 1E64A 4OHOA 3U9LA 3PHCA 1F06A 2AOVA 2R5FA 3BJIC 3IT1A 3BVPA 1ZGCA 5MN5A 2ZYDA 1E2MA 1QHGA 4GS5A 4D9KA 2BWJA 2AX3A 2UYHA 4HYEA 4XGRA 5M7EA 1U2QA 2RHGB 2WF9A 3IUQA 4R6WA 4RVCA 3NHZA 4ZAGA 1RI5A 4M22A 2X2EA 3BXHA 3O8OA 4C6HA 1FMFA 4WCDA 4C0HA 4ZJYA 1T29A 3WNQA 1CX9B 3MBIA 3QX8A 3ZUGA 1B8UA 3A28A 3N8IA 1OAAA 4ZCIA 3EVDA 4HAOA 2R68A 4TMVA 4R2JA 5F35A 5FI3A 4C0XA 1P2GA 4YJGB 3NCTA 1NAHA 1YQUA 2A1IA 1E3JA 3L4SO 3HVRA 1Q0TA 3S44A 3GLIA 1I6MA 2CMHA 2CLSA 1YVUA 3AF0A 3N2KA 4OK6A 3VBEA 4AJLA 4AN4A 4OH7A 4ZCSA 2O4UX 4E2FA 5TT0A 1N5LA 4ETMA 4L3OA 3REGA 2PS0A 4LDJA 4NMLA 2HC9A 4RY8A 3O8RA 2NVBA 2ONZA 2YNMC 4BBAA 4FX5A 1WXGA 3MOSA 5ECGC 4M8SA 4WZAB 2YOHA 5D01A 3D2AA 5BRJA 3PCXA 3T4EA 3L82B 1OX6A 1G21B 1B6RA 5EMLA 3RSHA 1EFVA 2W6JD 3GARA 4HQOA 2BGIA 5HW0A 5KWEA 3T12A 4RJJA 1YRWA 3KHKA 4I6GA 1WSWA 1N0VC 2QI9F 3CH4B 3HJUA 3HVHA 3THWA 2PUGA 5BT9A 4ZI7A 2Q41A 1XQWA 4Q02A 1E98A 5TV2A 1PUJA 3ZV3A 4EY7A 5I4CA 5DNUA 2EFDB 2J0SA 5LOVA 4WFKA 2JEOA 1JEQB 3KEMA 5KNCA 3CUSA 3MSXA 4YCSA 2QJRA 5G3YA 4BRZA 4OHKA 2CNNA 3A1FA 1B3BA 4ND7A 5AVWA 1Y8ZA 4F5DA 2WWRA 1D6SA 2GF0A 3HWX1 4Q1CA 3S8YA 3OQNA 1Q84A 1G7RA 4NU8X 2FWMX 1BOFA 2X2FA 1EE2A 3MD0A 2D8MA 4RZQA 4YJGA 3GD5A 3IQEA 2R6DA 4PCLA 2QIOA 4EY8A 5AW6A 1J8MF 3UAVA 1HRDA 2IY9A 1DT3A 4Y6LA 5LQKA 2HHAA 4RSGA 3IYLW 3MMZA 2X9VA 1K5DA 1T8TA 4GPIB 4KPEC 1X1RA 4YJ2F 2VP5A 3JQQA 3HDHA 9GPBA 4YRBA 3FZGA 3PPXA 5G0TA 3K35A 2X1MA 4G0YA 1FUYB 3VFDA 3G59A 4ILEA 5K0BA 4HH0A 1G16A 4WASA 5J63A 1E1MA 1Z45A 4ZA2A 3TK1A 4ZJPA 2ZXEA 5HTKA 3UMGA 3WRYA 2P1RA 3MUOA 1W85A 1JSCA 2OHFA 1G17A 2GYVA 1A7JA 1K7EB 1EK6A 4AZWA 4Z53A 3ZQKA 1NMXA 5HNKA 3VR0A 4QO8A 1IQUA 1PJ2A 4B7UA 5JROA 2HXSA 3LX5A 4XVQA 2BCJQ 1T2EA 5CXSA 4A0HA 3CTPA 1KR5A 1TVMA 2BM1A 4P5EA 4RX1A 3ZE9A 5NLLA 3OQ1A 4JB3A 2AMYA 4FOPA 2FUEA 4JY7A 1L5LA 4H31A 2Q0HA 5CA0A 1FVOA 3B36A 1ZKDA 1NZFA 4MO2A 5BYBA 4EHHA 2BKXA 1PNRA 1JG7A 1YNOA 2PRSA 4PBTA 3IMGA 2PUDA 3WHIA 1LBHA 1GZDA 3JARB 5AHRA 3SE7A 2ZUCA 3SM3A 3EC1A 2GNOA 3ROKA 1I7PA 4AMGA 2FPGA 5U1PA 4FWTA 1NXXA 4HWSA 4OQYA 4PZDA 5KNCH 3TRJA 4ZCPA 4QDUA 1DOHA 1IUOA 2M6SA 1Q7TA 3BHMA 3UN1A 3NI2A 3ZHRA 2DHRA 2B4TO 2H9YA 2QLLA 3LVBA 3K9GA 4Q4HB 1KORA 1OFIA 1L5NA 3UHFA 4DWVA 4M54A 3F7TA 1W44A 5HF6A 1HGXA 4KN8A 4EPXA 3EFEA 1IFXA 3HWSA 3QUAA 1WABA 2CNOA 1OTHA 3UF0A 5CFNA 5CFOA 5JNTA 3RAEC 1JUDA 1XTQA 3AF5A 3QELA 4TT3D 2J6BA 3L1KA 2G40A 3FDXA 1G6HA 1Z3CA 3IQZA 2BMEA 1ZI8A 2OGTA 4QJ3A 3L9WA 2E5LB 5JHHB 5AUNB 4YUAA 4QBFA 5B3JC 2R2AA 3KOOA 2QOEA 3DEKA 4QDTA 1CZLA 3EQ7A 3ZDAA 5DMHA 2J1LA 4LC1A 5LZ2A 1Q7CA 3OP4A 4EELA 3E81A 3CUVA 2WU3A 3C1TA 3KLBA 3GLQA 4UZFA 3BG5A 1EFRA 4PG5A 3L7CA 4MUHA 3TKLA 4LXIA 4PONA 3O1LA 1BFDA 3DQZA 2H7CA 4YV7A 4HQLA 1NXQA 2CFSA 4B09A 3OZ7A 3WNCA 3DULA 3QEJA 5EZ5A 3Q6IA 1YQTA 2HSZA 4OLHA 1R74A 3FCOA 3ZY2A 5CVTA 4DC9A 1TMOA 3PHHA 4QZVA 5LP1A 2CEAA 2GAIA 3T9EA 3ECCA 4V0LA 4URVR 2JBAB 1NUSA 4BO7A 4M6WA 3TDKA 3BB3A 1U7DA 1GG5A 4YGXB 1FPQA 1ZUNA 4FFWA 4M0UA 3HXTA 3JRWA 4EATA 1KOJA 3TTUA 4CNQA 5BQFA 2FCRA 2PD3A 4R01A 5B6JA 3HA3A 1E2DA 3E1GA 5KKAA 3VNBA 4F86A 2FB9A 1ZI9A 4F06A 4GX1A 3IDQA 4QFMA 1JVSA 3ST7A 2WHPB 3DE1X 3LGSA 5B1IA 4KRYA 4AP5A 4PLGA 3BGWA 3KSUA 3VZRA 3TOXA 2R8YA 1SUWA 1OH5A 4E5SA 2FSGA 1CSEE 5LBTA 3VJMA 4Q7QA 1I2MA 3FXAA 2CJPA 4NVRA 4D41A 3BPSA 3ISVA 5SZKB 3SZMA 4RBNA 1E9SA 5GV7A 4ZI5A 2OLKA 4O2AF 1A7UA 1EM8A 3O03A 1Z4MA 3EASA 4X66B 4LI0A 3IELA 1ZD4A 2EWMA 3EUFA 3VSEA 1K08A 1WXIA 1OA1A 2JFZA 3Q2OA 3SEZA 3VNQA 3P2OA 4CQMA 2ZT6A 4OJYA 2Q4RA 3LSYA 1ODIA 3P4YA 4ANFA 4CM6A 4JXZA 4IHJB 1DAKA 4IIFA 3U60B 1PL8A 3R4VA 4WDRA 2FEMA 2I0FA 3LC1O 4XWKA 1GPMA 4Y3UA 5B2EA 3GLTA 4XOIA 5I5EA 4JI8B 2P5YA 4A4DA 5JH7A 2FR0A 2C4WA 5FWNA 2W83A 3VSAA 2E4WA 5FOVA 1G66A 3CVUA 1U7TA 3QOFA 2H3HA 1YR9A 2WFMA 3OQVA 3NTUA 1EZZA 3DFFA 1NONA 2HT6A 4NULA 4YA6A 2CDCA 4QNMA 1J99A 4YC7A 1P0QA 5D5QA 1Q74A 1YV9A 5CLHA 3C2QA 1MC4A 3HNPA 3BE8A 1TYAE 5C8ZA 4JAVC 5KEIA 5CH5A 2XCUA 2ID4A 1I9CA 2FR8A 2UXCB 3C3EA 3SZRA 1H1TA 1YASA 1KA9H 4JKYA 4WLEA 1UC8A 1A9OA 4X1KB 5BMOA 1W1WA 3MRTA 1WMBA 2EZUA 2AR9A 1EI9A 3L0DA 2XDAA 3FMGA 2X4GA 4X45A 4JB2A 2NM0A 2EBFX 4DARA 4G0WA 4I50A 1VHDA 2FUNB 3H1EA 1XDDA 3UOWA 1XVLA 3ILYA 2PJUA 4H08A 2JKZA 2O0HA 3GGPA 4LZWA 4UMFA 3R7LA 3AUXA 4GM1A 4BTLA 4JI6B 2F3TA 5KOHA 3G2JA 2H7XA 1S8FA 1Y7IA 1OBFO 4IXMA 4KC0A 2W48A 3RVNA 1W35A 4LJYA 2G82A 1JDNA 1YDMA 3ELUA 3M7IA 1NVAA 1RKUA 2R7MA 3DL2A 2CE7A 2VYND 4OGKA 3VHQA 1A9QA 3L8FA 2QMZA 4NL4H 5KWSA 1C0EA 1M83A 2KS6A 4YRTA 2VF5X 3K4HA 2EU8A 2JA2A 3MK31 3R5JA 4FYJA 1GARA 1OU0A 4G1EB 4R2MA 2IHBA 3I83A 5PGMA 2H1SA 4L76A 1L4UA 2I3DA 1TGYA 3RLIA 1DV2A 3FIUA 1FMCA 5K0LA 4K86A 3R4CA 4YRJA 2IS1A 3FHCB 4J0FA 2QVLA 1ZOPA 5EQJB 2FZLA 3CN9A 2DT8A 5HG0A 4DRXB 1H1LB 1IXYA 1G4UR 1GAJA 2YJTD 3OIWA 1QP7A 1RRKA 4H1UA 4E07A 1K3TA 2ETVA 2IZ7A 2O52A 1SUIA 1BG6A 2PV7A 3IH5A 5IM4F 2XZLA 3WLIA 3VHRA 1NW9B 3T9DA 2QSJA 4RHUA 2WW8A 2GJAA 5BNWA 4BZZA 4YQFA 1NI5A 2WTMA 1M66A 3LQRA 1LSSA 1PZNA 4P34A 4N65A 5ELMA 3V8PA 3WWPA 4UEQA 1SRRA 3V8RA 1DKOA 2GXSA 4CF6A 4QFDA 1XLTA 4DV0B 4JVSB 2YHIA 5T41A 3KR0A 1KKUA 1A4RA 1CK4A 4I50B 3WYAA 1P9LA 4A2CA 3CLTC 3ZIAD 4BNMA 2O2GA 2Z1DA 5IVKA 2QR2A 2VI5A 3O38A 3KUUA 4J49A 4IIVA 3HJTA 4WOPA 5DN9A 1E8NA 1HI9A 1RU3A 5AKKA 4MMYB 5IEBA 3GBPA 4P98A 3SQDA 1W0JA 2X9LA 3QKRB 3UOGA 4E2YA 1JSLA 2H2AA 2H1IA 1AUOA 2B2CA 2CKDA 5BSGA 4L5BA 5CB4B 1LKZA 4FEAA 1C7FA 2IT1A 3WLQA 4D42A 3SFTA 4L51A 5TGZA 5A4IS 4Q5IA 5JAUA 1M6HA 1YZFA 5FD8A 3L18A 5FPQA 1Q3KA 2PL5A 4NPAA 4RKRA 4DLWA 2BRUC 2WKRA 2ZVJA 4YRFA 4ZMSA 5F2OA 2QRMA 1RKBA 4BQSA 3NEYA 5EUCA 3QVJA 4IIYA 4L78A 4J0EA 2IH5A 1UP6A 2IYNA 5ALIA 1AK2A 3IJPA 1V0JA 4YN3A 1BCSB 1UFKA 4XR4A 4E33A 1N6PA 1RXEA 4O8ZA 1FOEB 3PYLA 2RJNA 4LGCA 2HDWA 1BEUB 1KK2A 1Z16A 1LFAA 1EK2A 1I51A 3EZFA 3USZA 3IKJA 1YGYA 1Y80A 2HGSA 5DW3A 5EPOA 5K20A 4PTYA 4BMXA 1SXPA 1GKLA 3R8XA 5CVUA 2C03A 2QTGA 2ODAA 1UPCA 1MVLA 3G1TA 4D3ZA 3M5PA 4BJHB 2G9VA 4DUYB 5IK2D 4LHYA 4CG0A 2GYYA 4G5XA 4UU7A 1KZGB 4KR3A 2IKSA 4PGHA 1RCFA 1R6BX 2VNHA 1LJUA 1Y6JA 1SOUA 1L7EA 3GZNB 2O0KA 4FFPA 2Q6OA 4YLEA 2QIPA 4YQEA 1OH7A 3IAXA 4B2YA 3ORRA 3EGXB 4RLHA 1M2OA 4FIDA 4TT8A 1YHZA 3I9V1 3D4LA 4X5OA 1O5IA 5DTRA 1PR2A 2OEPA 3TE7A 4CGYA 3G88A 1EVYA 1TVCA 1QAQA 1YULA 3AETA 5DE3A 3WMFA 1H8HA 1SKBA 2R8BA 2FW6A 1OE0A 1PJ8A 2Z09A 3TINA 4WEQA 3BGOS 1DKUA 1WPGA 3IOYA 4TMZA 1GGJA 3C5CA 2XOXA 4QG7A 3T38A 3WWCA 3SYRA 5JH7F 4V0RA 3GJ6A 1NQVA 3B6MA 1MJGM 1FP1D 2PKYX 4IMIB 1N1GA 5E1BA 1V7CA 2L69A 2O2SA 4YB8A 2IPLA 2X1HA 2ZEJA 4JBXA 4M38A 3PIDA 5K8LA 5FPPA 4QOJA 3RS7A 1RT9A 1C9NA 4EGCB 3ZHSA 2FDCA 1OWLA 2GK4A 1NSYA 3FFXA 3LXUX 3T5BA 4HDMA 4V02A 5I9IA 3GOHA 4S1NA 1DAEA 2N0SA 3N8KA 3K0EA 1WF3A 2PKQP 3IGFA 3U31A 2JCSA 4N4AA 4YO7A 4DXHA 3HKDA 4DQUA 4IDQA 1V16A 2GXQA 3FNRA 1FBTA 4KREA 3E82A 1GG8A 1TD1A 2DERA 4R68A 1DE0A 1N6NA 2RGEA 1JYSA 2YMLA 3GDFA 1TUGA 4M49A 4CE6A 2VP2A 4XFKA 1U0HC 1ECFA 1EXNA 2XUPA 4P83A 5TF4A 2Z43A 4XDHA 1UDXA 3TZKA 1E2HA 2Y2VA 1Z0IA 1AS0A 3WA7A 2EJTA 2FK7A 1VDMA 4C2AA 1FDTA 4RGBA 2BGTA 2WWIA 4MMZB 4UJ5A 3DL7A 1TZCA 2VS1A 3M3HA 2N75A 2X7HA 4JK3A 2ECPA 5EINA 1SHKA 4XX0A 3HGMA 1ENZA 1FSPA 1EA7A 2Q5JA 5T64A 3EQ8A 2JZCA 1ACLA 1AQYA 2I2AA 4FK8A 4PNZA 2J3LA 4LJRA 1E3DA 1XL0A 2GBGA 5CBKA 6REQA 4RULA 1JQJC 1T6XA 3R6TA 3STWA 4QOEA 1TA0A 4PZ9A 1Z29A 3FPLA 4JJGA 3MAAC 1CUSA 2R1TB 4KLAA 4NENB 1THTA 4LI3X 2KLHA 3DZJA 3A1CA 4A26A 2GK6A 3KLOA 4HNVA 2EG9A 1E2NA 2W5UA 3TM4A 4PV7A 2E7ZA 3TZLA 3ZE0B 3L6OO 4Q9HA 3QE9Y 2PTGA 2Q2OA 1ZSYA 5AHKA 1GRVA 3UAGA 4KXMA 1I6WA 1S2GA 1MOZA 2XR1A 3CIOA 5BMVF 3H9JA 1BA2A 3AXSA 3PQ3A 1KAEA 4KGVA 4N3BA 3C8DA 4DQ0A 2V6JA 5CFZA 4WLVA 1HT2E 2XT9A 4DIOA 4IZIA 2B8EA 2PGLA 3C85A 4Z1MA 5HYVA 3G5MA 4C0KA 5KYGA 4XVHA 4ZYZA 1NLZA 2BFFB 2Y66A 2Z83A 4JLDA 4QGFA 3UJAA 4MUEA 4ZZIA 5FDFA 4QJIA 2A1UB 1E1NA 5IUKC 3PJFA 4LOLA 4KE8A 1YL6A 5BSRA 4B6EA 5GZ1A 1AQJA 4HZUB 4LSMA 1N57A 1H93A 1E79D 2VUSA 5C53B 2H3EA 4MK4A 4NIMA 4CKZA 3UWSA 2E37A 3GRYA 4RCZA 3Q9UA 3Q3JB 1BFUA 1X14A 4LRTB 3PG5A 3DOCA 5SYMA 2A9VA 1D6MA 4YRDA 3VNAA 1JRLA 4EA8A 4F8JA 2XKJE 5HF9A 5KKCA 2A0XA 3VVMA 1T9ZA 2B92A 2QVGA 2ZWOA 4LXXA 4LWPA 4WBNA 2REBA 4K9QA 3HR8A 3KS9A 3MEQA 5JDIC 4UUMA 4NS1A 1XALA 4BNUA 3LGAA 1KARA 3OIVA 4CM5A 3DVRX 3DQPA 2FMHA 4BC1A 1U3GA 3KAJA 3VZDA 1JPJA 2GHRA 3GWZA 5LP6F 1QH1A 2GT1A 4GFDA 2C3UA 5CLQA 3SC2B 5EJFA 4EEKA 1O6ZA 3S5UA 1C3OB 1GUYA 2Z95A 2GD1O 3E03A 4I66A 3G5AA 3K0BA 1HFEL 1K4YA 1S7CA 2Y92A 3GRVA 3N0RA 1E1RA 4B33A 3I9KA 1RYZA 4A9AA 1U3VA 1PW5A 2YC4C 2VCYA 4DVGA 4FBGA 3B82A 5A0VA 1R3UA 3GHHA 1KNQA 1GRQA 1UOOA 3DGEC 3GWGA 1GUFA 3HQ4O 2UU9B 3EUEA 1NI3A 5EGNA 5HZMA 1KIFA 1BWQA 3ED5A 1OXBB 1QHNA 2OFPA 5ECDA 4G86A 4N8SA 5K8TA 1OLSB 2WF5A 2QY9A 1GN8A 1UDBA 2P4QA 4KDFA 5K3BA 2P3SA 1NULA 2QMQA 3MWYW 3P9SA 4UM8B 4E1AA 3LQ1A 1SB9A 4Q66C 1FFBA 1HSOA 4MXDA 1W2GA 4X1YA 3E5HA 4OBEA 1TB4A 4JKIA 3OVMA 3RDPA 3MJTA 5IFLA 2BCEA 1Q7GA 2P41A 1P80A 2WIAA 2BUCA 2VHCA 3EGDB 3ZN2A 4BHTA 3M1LA 4TV8F 4KI7A 1RJ9A 4C4XA 1SZCA 3OO1A 3GPDG 4IO0A 1BJTA 3SLRA 3V1TC 2HU7A 2JGIA 5JJIA 1E7MA 1QG2A 3CONA 3U3OA 4UCXA 4I4CA 1MEJA 3GELA 3OT1A 4RTRA 2VSNA 1R8QA 2AF3C 2HUPA 3FNIA 4CT5A 1FYXA 3GLFE 3U5ZB 4QOHA 1NU6A 1P7WA 2GJ9A 1S0UA 1N2JA 1KQNA 1GPDG 1U5AA 3EGIA 4JODA 3F3SA 1JJ7A 1M1NA 1UCFA 4B4OA 2BJWA 1DWUA 5CM8B 5EEGA 3VNRA 3RIXA 3D59A 3GPBA 3NAGA 4RTOA 4CF5A 3ERCA 1FS4A 1IN6A 1Q0QA 2BGLA 2VJQA 3DBLA 2V7GA 1I0LA 3C3CA 5BN4A 3HI6A 4MKFA 2CCGA 1YZHA 4M98A 2C4KA 5BR7A 2GNPA 3DLHA 2BF4A 1X80B 5ARDA 1IN1A 3NO4A 4FKMA 2CLIB 1EQ2A 4ETNA 1JNYA 1GL9B 2WMNB 4V03A 4AJ1A 4OHVA 2AG0A 2J5KA 4TV8B 4WN3A 1ISSA 1UPUA 2EFHB 2PKEA 3HR4A 4IMJB 1JR6A 1I4WA 1BGXT 2EQAA 3GUZA 4RZ2A 4LKRA 5CITA 5JYEA 3OOWA 1XU4A 4AS3A 2JLUA 4ZOLB 4JENA 4M7OA 2PR2A 2F8LA 3AF1A 3QPVA 5C37A 2IH2A 4C6RA 1QAMA 2I2CA 1L5QA 4WFJA 3VPSA 2A0FA 1L5YA 3A4MA 3E53A 1T43A 3FPAA 3O4VA 3OOYA 4B82A 1IBRA 3HR7A 3NDRA 4N8DA 4ARVA 2VF2A 1Z5VA 2WRZA 1BXRA 2GDZA 2DFNA 3R5KA 1KI2A 4F6RA 2CUKA 3AOEC 2ZBPA 3N7TA 4G63A 4I4NA 4D9FA 3RAGA 1Z9BA 3CH5A 4O0MA 4J7XA 4YP0A 2BFBB 4Z7JA 5B36A 3GA0A 1ZIPA 4FUTA 2WF7A 4NECA 3ICOA 4OXNA 2V7TA 3QBDA 1W7AA 5CM9C 1J5EB 1O9BA 3D1JA 4OA5A 3ED1A 3LDUA 4Q24A 2ZRAA 3GJQA 4ME6A 1CQXA 4OYHA 4A0QA 4JDUA 3ZCUA 1T6YA 2OCBA 1BXKA 1DBRA 1ADYA 1F38A 4F1JA 3LYHA 1VFNA 3KT3A 7AT1A 2VTEA 3ZWOA 2B4KA 2Z08A 3DDSA 2VT7A 3ONEA 3R9XB 2W42A 4KPGA 3DO6A 1N3BA 3H6HA 1PBTA 4OX9Y 2RH5A 3PGKA 3ZDDA 3KPUA 3VOTA 2V3CC 2VWPA 4WRRA 1IMOA 1WXWA 3HBJA 3DV0A 3EFOB 1ZH0A 3THWB 2IS4A 3DTNA 1ZH4A 3SMQA 3ENKA 1OFVA 2ETXA 4IIHA 4LCJA 1CZNA 1WU7A 1WE2A 3F71A 3GX1A 3ZXYA 4EG3A 4BMCA 1MUUA 1DBPA 2FSFA 4XVUA 3MCVA 3C98A 3O4IA 5FNVB 5C9ZA 1MQ8B 4OMFG 5FR2A 1NFQA 3DO8A 4MA5A 5FAXA 1U8ZA 4YI5A 4ERXA 4Z3KA 2LD4A 3I5UA 5EIBC 4BVGA 4F2PA 4BLWA 3ENVA 2CV0A 4DNFA 1LTQA 1R0LA 4MUXA 4JBHA 2NSDA 2BVNA 5E1OA 3S2YA 3BB1A 3IHKA 4JI7B 4P9NA 3RIYA 3WFZA 4P81A 1Z7YA 3LCJA 4BNYA 4YT8A 3FBGA 3S1AB 3GLVA 1DDIA 1E59A 1P7VA 1TZMA 1Z3IX 2Z2JA 4IUBS 5EIFA 4YUVA 3MZ0A 4XDYA 3D8HA 3U3KA 5HKAA 3VNVA 2HKIA 4EKGA 2Y2UA 1QQ5A 2OORC 3Q98A 5EYPA 4GU5A 5FUVA 3LKVA 2X13A 3TXAA 4AYTA 1QF9A 1E7YA 1I80A 4OB6A 2V98A 2XDQA 2DMRA 2DHCA 1NM5C 2PS9A 3BMCB 4DXDA 3RUCA 4L4SA 4KBGA 3RRXA 1TCVA 1G291 5IT4A 4G1CA 4NBKA 3THXB 1BCRA 1JJVA 1LQ2A 1XZMA 3VQTA 1LV8A 5A9SB 1R7RA 4RJIA 5C5DA 2BL4A 3W79A 1YZUA 3IAS1 1DO0A 3HDVA 2NT4A 3TLXA 2IYSA 3VZBA 4E5KA 1BFKA 1Y4UA 1Z0DA 3R0XA 4YJDA 2C78A 1EHIA 2ZQ5A 2QSZA 1JIQA 3EFOA 2NWQA 4PCAA 4Y6OA 1UQTA 2WSIA 4NICA 3DD5A 1YJAA 3NFYA 4PG4A 4ER3A 1FRVA 1E62A 2QF7A 2OVBA 3FGNA 4BV8A 1WHTB 2Y3IA 4BKOA 5HSGA 2C31A 4H1HA 2IA5A 2BLNA 3JARA 4ASUD 5CCBA 1JTVA 1NF9A 1AO3A 1E1KA 4INPA 3TRDA 2FPUA 1VECA 1O89A 2DQYA 2AG1A 2GUWA 2WAAA 3K09A 3QF4A 4FR2A 4K9OA 1A77A 1XAGA 4LCBA 4YPFA 1M0EA 1Y0BA 1NI4A 2GN4A 2J48A 2XIJA 2QMUA 4ZYTA 1KDTA 3IVMA 1VHWA 1OZFA 1GGVA 2XRYA 2A6PA 2A1TR 1S8OA 1F8YA 4U0JA 4BUJA 1PLJA 2YHBA 2OE2A 4Z9AA 2DQKA 1E0DA 5T4FA 1QGDA 2O0MA 3ZZUA 3CPJB 3W8RA 3TTTA 1Q3TA 1NVWQ 1KSGA 1I4OA 2EJCA 2O7NA 3IQXA 4LZJA