4NJEB

Crystal structure of pyrococcus furiosus l-asparaginase with ligand
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
MAVLVIKLIPGLSGDIFRAAVELGYRGIVIEGYGAGGIPYRGSDLLQTIEELSKEIPIVMTTQAMYDGVDLTRYKVGRLALRAGVIPAGDMTKEATVTKLMWILGHTNNVEEIKVLMRKNLVGELRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-asparaginase
publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 40
structure length 127
sequence length 127
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2013-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4njeB00
2OCDA 1HG0A 1AGXA 1JSRA 2GVNA 1WLSA 3NTXA 3PGA1 1NNSA 2HIMA 1IHDA 5CBPB 5K45A 1WSAA 5K4GA 5DNCA 4Q0MA 1HO3A 2WLTA 3ECAA 4RA9B 2WT4A 4NJEB 4R8LA 1JAZA 1JJAA 1DJPA 2P2NA 5K4HA 3NXKA 1JSLA 1HFWA 1HFJA 2D6FA 2P2DA 5DNEA 5K3OA 1ZQ1A 1HG1A 4RA6B 4R8KA 5F52A 1ZCFA 1WNFA 2HLNA 1DJOA 5I48A 5DNDA 1HFKA 1O7JA 5I4BA 4PGAA 5I3ZA 4ECAA 2JK0A 5HW0A
chains in the Genus database with same CATH superfamily
1BYIA 2ZP1A 3E7PA 2ORYA 3QU5A 4FDMA 1L4GA 5IKXA 2YZMA 5K0JA 5KDOA 2QP3A 3KQTA 3DLBA 2J3HA 3UAVA 4CEJA 3HB9A 3W4IA 1SUDA 2ZT6A 4MICA 4MRMA 3ROGA 5CEFA 3X1ZA 3OX1A 1ITZA 2QTRA 2QLJA 2I54A 3OEHA 3ZD9A 4F5EA 2WINI 2HL6A 1IAVA 2VA9A 3MLBA 5GZ3A 2R1TB 5LU9A 3DXXA 4LHZA 1QZUA 3AEQA 4J8PA 2XNCA 3JQAD 3PSAA 5DN6A 5KREA 1ISMA 3IH5A 2HBRA 1R4MB 4FSHA 1FSFA 4GLBA 4AJ1A 4BYGA 4V0OA 3JYOA 2W11A 1R8SA 2YC2C 5DK6A 4ZEXA 3TLCA 4ZVKA 3MT7A 4KZKA 4ZEVA 2ZTUA 1W0JA 4H59A 2XCOA 2BELA 2VPIA 3L0IB 1CIVA 1NUAA 1A9RA 1I6MA 4KBFA 3G0HA 4MIEA 1EESA 4PCLA 2R65A 2IUEA 2WIKA 5SYNA 4GZMA 2YV5A 4MW5A 1QJCA 2LKDA 4OQDA 3TLBA 5BUSA 5M3BA 3C3CA 4TXJA 1UMCB 3VHRA 3V1TC 5C8YB 2AE1A 2CDCA 1ADCA 4FCTA 5JS8A 4D9KA 4PZYA 4ETWA 1KP2A 3IULA 3K2QA 4LJ6A 4B3GA 4BV9A 4DQKA 4XVUA 3PQ5A 2A67A 4IMJB 5BN4A 1KC3A 2BDUA 1T8WA 4RPLA 3U13A 2AX4A 2QX8A 3MINA 5AXCA 4N7BA 3HYNA 5CK5A 3B38A 2E4ZA 4Z99A 4ZQBA 3TLZA 4M22A 5I01A 4BJ6A 4E4TA 2JCXA 1LZLA 1THTA 1C9NA 3V3KA 3AF2A 3QU2A 5EMHA 4XW2A 3NM6B 4WK4B 3HXTA 4MRPA 4D82A 1ZIOA 4RPHA 3STYA 3SXUB 4EEKA 3HCBA 3OP1A 4WLVA 5H3CA 3GFVA 2GBLA 2GH1A 2OBNA 1EBBA 4UTZA 2X13A 3K70C 2P69A 4LOLA 5K0LA 2OE2A 1R9JA 2YIMA 3ORHA 4CCYA 3MUFA 1UDXA 3H2KA 4UATA 1UFQA 3E3LA 1R9MA 2GHIA 4BZWA 3I39X 2Z3ZA 3U37A 2V59A 4TGLA 5CDGA 3VRHA 3CUKA 1XD2B 3UHJA 2EP7A 2W8BB 3U3KA 2Z4RA 5D3MA 1AKRA 2VT6A 4PNPA 1FTNA 4GVPA 4NNJA 5COAA 5DNAA 2UYCA 2G7ZA 2JK0A 3BXZA 2PKYX 5CXUA 3V2HA 4GDFA 5TSDA 4PFQA 3NYIA 4Q7KA 1U0OC 2WOJA 4WTOA 1FJHA 4DADA 4V1CA 4B0OA 5BW4A 4KNYA 4A0FA 2JBAB 4OEHA 2R8OA 2KI5A 1F6DA 2X5KO 1TXGA 3CZMA 4P38A 1JEQA 5FBHA 5U9CA 1FYXA 2RIPA 4IIHA 4WEOA 4YREA 3T7AA 4BZXA 4DLTA 4YRIA 5JY1A 3OJ0A 3HACA 2UAGA 3VHQA 5ISMA 1QIIA 2PSEA 1GZDA 1EJ6A 1JQDA 3QWIA 3FBWA 3FCYA 2I6FA 3EARA 2REQB 3ROEA 4UFOA 1PU2A 1XHEA 3WMGA 4TYWA 1SXQA 3THWB 2D1SA 3WAGA 2CHVA 1GCOA 5AR1A 1Q6ZA 3D6JA 5FPPA 5C1BA 4O4JA 4ZCLA 4EA8A 4ER3A 1S7GA 3GVHA 1W4CA 3H6KA 4LOJA 1MJGA 2WV7A 5HDQA 3VC2A 4JQZA 4CIYA 1Y1TA 2WJZB 4O4HF 4R4JA 1KQNA 5GONB 3HM9A 3ZIAA 3REQB 2ZBRA 2QPAA 3MG9A 1R4NB 4FYKA 4QVGA 5EZSA 1X92A 3SZLA 5C1DA 4WV3A 3WV4A 4FQ5A 2YZ2A 3FOBA 1RWOA 3OA0A 3TLEA 5A71A 4JYAB 3LLUA 1X14A 5IPFA 4RZ2A 4L22A 4YJHA 4NYMR 2E4AA 3JQDA 5FLEX 4A4DA 2WJIA 1BZYA 2OTCA 5C7LO 1V3TA 1Z2NX 2XZPA 2Q27A 2QUKA 3PEEA 3ETNA 3WQHA 1UZNA 1ACMA 3HJCA 2RHLA 4P84A 1I33A 2CLDX 2VSNA 3R0XA 4AURA 3IMCA 1KAEA 2ZSIA 3HNPA 2XE7A 4PG8A 1UT5A 2J08A 3A6ZA 1KMIY 1KYWA 3FFAA 4YP6A 3THYB 1D1SA 2GK3A 4IDQA 2EZ8A 3MTIA 2PFKA 3AM4A 4WKOA 3DAPA 1EXMA 2VZ8A 4OPMA 5G0SA 3GAAA 4DC0A 1B15A 2DFNA 3AQIA 4QA9A 3EG5A 3TJMA 4V0SA 3PCXA 3G23A 5KMGB 3ISTA 3SF8B 4F4UA 3WNQA 2DQZA 1XBTA 5FBRB 1PJRA 4DA7A 2HH9A 1DUVG 3DKIA 1YGYA 3ASZA 4TV9A 5AVSA 2VYND 4IY1A 3LQQA 5CNJA 4URFA 5CXXA 3OIFA 1M0WA 5BV7A 5CM8B 1NVAA 1Z35A 1Z4JA 3VO2A 5T57A 4BNIA 3JD1A 2AYZA 2W2LA 3R5KA 4RAOA 2B78A 5AVXA 2KWIA 4H7IA 5HKAA 4RC9A 5K9ZA 1I10A 2P1ZA 3E9MA 2B25A 2Q4RA 3LKZA 1IG0A 4UXHA 4YRAA 3WO0A 1GAWA 5EJ6A 3S2EA 5EY5B 3OUZA 3VR6A 2VDNB 3VPHA 2D59A 3IUPA 4KDRA 2BMEA 3QQ5A 1VJ1A 3QUAA 4C6TB 1IL0A 3IP7A 1JEAA 1UPCA 3ZWYA 5C3MA 4NARA 2WD7A 3E15A 4AG6A 2O3SA 2XUDA 3GK3A 4D79A 4C14A 1NNLA 4MKXA 2W98A 4CMEC 2VPPA 1E9FA 4PLZA 4OXKA 5IBPA 4ZJUA 2AN5A 1N2BA 1L2TA 4QAQA 4E88A 2R5WA 2VPZA 4PG7A 4IWNA 4L9WA 4PYNA 4E0BA 1CDZA 3AL2A 1E3DA 3C3JA 3IAXA 1L4FA 4GKBA 1SH7A 2PMKA 2VT2A 4LRYA 3U7HB 1L3BA 1F0NA 4B31A 4KDEA 1Y8CA 4PG6A 1M5TA 2BP7A 4HGZA 2FN4A 1U1GA 5DU2A 5J1SB 1O03A 4WJZA 3OPNA 5ILGA 3V97A 1Q84A 3W78A 4EOGA 1PUIA 2WF6A 4PCVA 3KJZA 1EE9A 3PKZA 4QICA 3ND5A 4HV4A 2XMPA 4J1TC 4ZV9A 2WKQA 2B8WA 2FG7C 5G4KB 2GDJA 2IYUA 2OBBA 4RA6B 2DFDA 4BO3A 2G0TA 5GIPE 1IHUA 3JQ9A 1NLYA 1IYZA 3DLCA 4RK1A 4BNXA 4O3MA 2A9FA 5MHTA 5AI6A 1QHXA 3AR6A 3GR6A 1CJSA 1M3SA 3EY4A 4H7JA 4QG7A 1PFYA 5L4NA 1KY2A 2XIQA 4JXXA 4K9PA 1JDNA 1USKA 1QGUA 1R6DA 2C5BA 1EK1A 1GTVA 3PC6A 4DMUB 5J9FA 1AU9A 1IM2A 1UBRS 1PJBA 1IM5A 4P3XA 1S8NA 2E21A 2AN1A 1Y7HA 2RONA 2DYKA 2OSVA 5E9JA 3DPSA 4F2HA 2RHRA 4W8OA 7GPBA 1NP6A 4F4FA 3QSGA 1L5MA 1ZBQA 3R6WA 3N0VA 3T0FA 4B4WA 2I5PO 1Z47A 2FUNB 4YIKA 1WB4A 1YHYA 2YICA 4G5HA 4IRMA 1X7GA 3GNTA 5DYWA 3CF0A 3C97A 3TSZA 3TF5A 4QPPA 3EZFA 2CHQA 3D3WB 2QMOA 1V45E 4H08A 3CIOA 4RMGA 3WMWA 2BTEA 3QEMA 4U2CA 1OV4A 5FBKA 3CPJB 1K98A 1PJLA 4RJ2A 1TW3A 1OBCA 3WMEA 1W5BA 3HJTA 4L2IB 1W36D 3ZD8A 1NBEA 1GGKA 3Q0TA 5IZCA 5EL0A 2AXEA 5FWDA 3V8PA 4M1ZA 3LY5A 3BSYA 4N82A 1H69A 3FAKA 3F7OA 3UGTA 1U3UA 3BA1A 4IIVA 3DZKA 3LUGA 3L18A 4HVCA 1P0CA 1U0NA 2HSEA 2VT3A 4YP9A 3W77A 3CJQA 4RD1A 5KJ6A 5E0OA 4HP8A 4LWZA 1B6GA 2HADA 2Q2VA 5JXIA 3AVWA 3OECA 1JIQA 3AFOA 4KWTA 2K7FA 4ZT5A 3RR2A 1OASA 1SQFA 3C48A 3LU1A 3TLKA 4ZI2A 1UQRA 1EFUA 1N7HA 1OI7A 4EUNA 3PJEA 1YULA 3GGSA 2CHUA 1ZC4A 1MN6A 1TX4B 3G2LA 1GT6A 1CQIA 1FNCA 1QV6A 2AHOA 3ZUGA 1M74A 1OXBB 4AY6A 4JI7B 3FMFA 4H3VA 2ZB8A 1PLJA 4G09A 4L78A 4C3VA 4HLCA 3S44A 4E51A 5KHAA 3PA8A 2GBCA 4AIRA 2FX5A 4KFUA 1QTNA 3A36A 3PHJA 1HFEL 4WEQA 2QE7A 4RZIA 3W6ZA 2EFEB 4XVHA 2GN4A 2F2TA 3H1GA 3D54D 5ECYA 4QGAA 1E2LA 3IVXA 2DJIA 5A6VA 3VZSA 3H17A 3EBPA 1Q7EA 5JJ5A 1W0KA 3VFDA 3FHTA 3H1EA 1LV7A 3N76A 2NP6A 3O9VA 2VATA 3BWCA 1WW2A 2XNDA 1ZK3A 1KRXA 2RGDA 4F9TA 5JJCA 1YI1A 4RGBA 3SDZA 2Q4OA 2FE4A 1G3UA 3HN6A 2RMKA 4KIJA 1QC5A 2RBEA 3PYLA 3VVBA 3RK1A 1VBNA 2XR1A 2WNHA 1ZD2P 1D4FA 1YC5A 2YHBA 4NYIR 3ZGYA 1KO7A 2POCA 2HR1A 4Q9AA 3VKGA 2YXLA 3H83A 2VJPA 4PWYA 3HTXA 3JY6A 4Y98A 4PBTA 1SXJA 3ET4A 3MCUA 4MWOA 4Y2UA 2H16A 1Q0LA 5CB4F 3HO8A 4U2GA 1BIFA 2H1SA 5HF6A 1JSRA 2WU4A 3LC0A 1RWMA 4HAIA 5CDSA 1KYXA 1NKVA 2DBVO 2BM0A 1BJTA 1W87A 1QVWA 4B7CA 1QR2A 4KUGA 2NW6A 4OU4A 1SC6A 5EUBA 3R8XA 3OTHA 1HKHA 3HBMA 4YJFB 1YFJA 1QRUA 1VA4A 1ECCA 2FPGB 3I8OA 3CV3A 3QOYA 5G0WA 5IP5A 1TZCA 5AKHA 3GWGA 4WN9B 4XUGB 3T7CA 3RAPR 2CL7X 1MC8A 3PDCA 3EMBA 2HMYB 1C9DB 1OXKB 4JBYA 1XZQA 3FPKA 3O4JA 4MQ6A 5BR1A 5KOHA 2ZAOA 1BDJA 3D3KA 3KWLA 3NFRA 4M83A 4NZOA 2J1LA 3RC2A 2ABWA 4KGZA 4TWZA 4TMYA 2WPDD 4O2LA 4NMHA 4DRYA 4KVAA 1HG0A 4Z54A 2Q99A 4L4RA 1FRNA 3NZEA 1Y8RB 4X44A 5I4KA 4MINA 5KHOC 2AEEA 3UMJA 4EFNA 1W9MA 2VUTA 3HG7A 1JXMA 4XQ9A 5BQ5A 1NBOA 5F2OA 5H80A 4WCVA 5AVQA 3TNJA 3GFTA 4XWAA 1C7QA 2BUAA 4X5OA 3TZLA 2H65A 2JFHA 3KTAA 4PU0A 4CIWA 4JUAA 3A6PC 5DM0A 3O8LA 3DAGA 3Q8XB 3CH5A 1A0OA 4N0QA 2EBUA 5AJVB 4OFWA 4PZEA 5M5BA 1IOZA 3O38A 2FPLA 5DFAA 4KVGA 3RSOA 3VZCA 2FMKA 1R5NA 3UOAB 5I7UA 5CFNA 1SHLA 3EX7C 4HZUA 4U7PB 1ZH2A 1AUPA 3S2SA 4RV9A 5EE5B 4WFJA 1NXXA 3P9QA 4BMYA 1T8UA 2IBMA 1RZUA 2NZ2A 3FXAA 2YKGA 3V4SA 3DXYA 5K6RA 1OTHA 5C32A 4FBLA 3GA5A 1TJYA 3AEKA 3GJYA 2ZOSA 1N9ZA 1D1PA 2WFZA 3L7OA 5FWAA 3D0QA 2J6HA 4MQ4A 2W2TA 4F04A 5KWJA 3GJ3A 1JYSA 1U8ZA 2XYHA 1WXDA 1VL0A 1BCSB 4R8KA 5KU1A 2CT8A 1I7NA 1LSOA 3VJLA 5C52B 1GU0A 1Q1QA 3L0BA 5A9SA 4NWIA 1XYVA 3IQWA 4J7AA 1NE7A 2VLBA 2IZZA 4N8SA 3GY0A 1JH9A 2VCHA 3M0EA 2OZLB 4MVJP 5H83A 1IVYA 3I2IA 3L77A 4JJ8A 5LYJB 2O05A 2VHXA 1J90A 4IBOA 4Y8VA 2JJQA 2VQ3A 4P83A 1T3SA 4CL2A 2VHYA 3CRW1 2C7QA 3H4IA 1VC2A 5BYKA 2R1VB 5JDIC 5L3ZA 4UEQA 4TMWA 3LWDA 2IU3A 2QZZA 4Q01A 5JVDB 3I52A 5KEIA 1AD2A 2SCUB 4DG5A 1G41A 5D5HA 2C97A 2G4VA 4GMGA 4LWOA 3W7AA 4A8JB 5BORA 4UXJA 5DWVA 4BX3A 2IHZA 4CM9A 3QIAA 1DZ3A 5E7MA 5EE3A 5IC6A 4ZN6A 1SA0B 1UMBB 5J1TB 1E3TA 2W6CX 1IPHA 3KSRA 3ND7A 1FRQA 1P7VA 4O1MA 4B3IA 2G9ZA 4UHJA 5I9SA 4PCAA 4JCCA 4LSGA 1EFVB 3T7DA 4TLMB 4YRPA 2WWWA 4BTVA 1UZMA 1VHLA 2H0QA 4R9RA 5IABA 1JRLA 1CJUC 1PDWA 4Q4JB 1OYVA 1GZSA 1E9BA 2CE2X 2X7HA 2D7DA 4ZYYA 1P9WA 2OMEA 4ONEA 3QVOA 1KMQA 1X0VA 3H8SA 3KTDA 3PENA 2NN3C 4J0HA 4JT4A 2Y0BA 1KZ4A 4MWEA 1XHFA 4BASA 4ZOEA 2PU5A 2RFLA 1IBSA 3IPRA 4XM1A 4LRWA 2XUFA 4Z8XA 4F4CA 3M9XA 1EM8B 4EF4A 821PA 4EJSA 3PIIA 4YRMA 5LFAA 1F5NA 3OT4A 3F73A 1KI1A 2X0JA 4HXFB 2X5XA 6REQA 4OGFA 2ZULA 2EG9A 3H7IA 4IDAA 4CMIA 1RLJA 4BCCA 3RVBA 3AYXB 3AQ4A 2OV2A 3ILHA 2RAVA 4J7UA 4RAQA 5A4AA 4FZ5A 4K6OA 4R6WA 2R3SA 3WOHA 3WK7A 5BW5A 1G8JA 3AY3A 4B81A 2WKWA 2UZ0A 4L4YA 4EL5A 1SCUB 1LTHR 1I3MA 2VRNA 3ONVA 4CG0A 4CEIA 3FX2A 1EXDA 4ZIRB 2OILA 1NWHA 1SZJG 1CYEA 1DBWA 2Q1UA 2FR1A 2HMSA 5FOXA 2HLPA 2Q3EA 2CUKA 5IDYA 4BRSA 2H5EA 2C1ZA 3HB0A 2UZAA 5B7QA 2ZEJA 5DI3A 2YQ5A 5EAIA 2P3LA 1G21E 3SD7A 4IIUA 3SR4A 2GF0A 2Q3BA 2R7NA 4OYYA 2A2ZA 1UM9A 2O2YA 4L76A 5B2FA 1P73A 2RARA 5C1OA 1JIVA 1QP0A 3WGLA 5A4IS 2VNHA 2DPGA 1K6MA 4E32A 4QQKA 1TUIA 1YMVA 1JAYA 2BN4A 3KR2A 4RQAA 1J8DA 5EIFA 3SYRA 4EHLA 5BNIA 1X8XA 8ADHA 1Q0TA 2P91A 1EUCB 2X7XA 4F4JA 3KJGA 1WCIB 2Q9BA 1T34A 1UC5B 3OCZA 3ANXA 2IELA 4ZEWA 4BVAA 2FJ0A 1A7KA 2F64A 3Q6NA 5C80A 1WMEA 5KKCA 1ZK2A 2Z09A 4YUAA 5ES4B 5I9LA 2Q4BA 5T4EA 3DGFC 1Z68A 5L9AA 5F4BA 1RWPA 3DFFA 2XGMA 3IKMB 2GNOA 3IEXA 2RB4A 4NZ9A 2JLAA 4TWAA 3EK2A 1HT1E 2DHQA 2I33A 4RTPA 4JODA 2ZRLA 3L1HA 1ZFNA 4JP1A 1ZGJA 5JE8A 2CC2A 2MSEB 2WMDA 4EY8A 3ICOA 2HIMA 3L4BC 2J9YB 2QVBA 3H2JA 4BLTA 3O8QB 1XZCA 4QDZA 5AM5A 4IDFA 5AI4A 5BSRA 1MX1A 3KAJA 3A7EA 4E07A 4DIEA 3CVOA 3HJUA 5DM4A 4EKEA 2G3YA 5CCEA 5DP1A 3WWDA 2ZE5A 2B5VA 3GU3A 4IZIA 4OQZA 4J0IA 2ZRBA 3I8XA 4CW7A 3KQWA 2W8ZA 3V4LA 4PYMA 4QDTA 5HF8A 5IKOA 1K4MA 4TTQA 3GGJA 3GF4A 3OIYA 3W1EA 1FFAA 3EPHA 4KRGA 3IE2A 4IOLA 2YUTA 5IWAB 3ISVA 4YJ3B 1AZWA 1VL8A 2XB2A 2P9BA 2VP3A 4JJKA 4BKUA 2FWIA 1JJIA 4TS9A 1LJLA 3L0YA 4X6LA 4CTJA 1PWXA 5DSZA 4BOYA 4NKRA 1KIFA 3IILA 1U4OA 1E2QA 1W2HA 1ZA2A 2A5JA 4HNRA 4QUAA 3T3GA 2QY6A 3PQDA 4MHOA 4YJGA 1SCNE 3NHYA 4EYGA 1PS8A 3EW7A 3JATA 1KL7A 1GARA 5FADA 2P67A 1OYOA 3OKCA 5CR9A 3VR4H 2G72A 4NBSA 4GR9A 5JU6A 2HD4A 5ALMA 5E7JA 2ID8A 3Q2OA 3UNXA 2PZBA 3DBOB 4ENUA 1RXWA 4CMJA 5FBQB 5ERGB 2XQJA 1P5FA 3FFBA 4IUDS 5DHQA 5TS3A 4C0QC 2GMWA 1RM3A 3D4OA 4KP7A 4P8RA 1XCBA 1BJKA 1N57A 2RGNC 5DBOA 4BWYA 4JVLA 4RS3A 4CV1A 1QE3A 2V7PA 4IKEA 3H5IA 1E79D 1IN5A 2ORWA 1RAGA 1S1CA 1KEEA 5DKFA 1Z6XA 4L0DA 1WLSA 2VYCA 4KQMA 5FHQA 1OKKA 3QNWA 2WDPA 2V74B 2X9GA 1XJ0A 3VOTA 1QDEA 1E3MA 4NR0A 4XCXA 2O2IA 4OI4A 1ODSA 2V6IA 2NYUA 2EQ5A 5BSUA 3C74A 4CKEA 2W6MA 3GVCA 3N7TA 5REQA 2YRXA 1AO0A 5EP3A 1ZGCA 1C9EA 1LK7A 2E5FA 3JQ8A 4BFLA 1K3FA 1T5LA 4JS0A 3HJGA 1U3TA 1XQ1A 5THKA 3W5SA 1Y6RA 1JLKA 3CUEF 3TRDA 2DTDA 2Q5CA 3HLYA 2VQ6A 2IWRA 3K8OE 1ZUWA 2GAOA 1G6KA 3X1YA 1QHYA 2ZAYA 3Q9LA 4FYPA 4GPEA 1ZRSA 4HDKA 4ITRC 4LAFA 5JTTA 1FP2A 1MIOA 4P80A 4O4IB 3I92A 5FR1A 1BKDR 1WA5A 1NUUA 1Q44A 1UBOS 1SC1A 1HXHA 3GDOA 1VCMA 4WAUA 1I4TD 3WGQA 3KT6A 3RTDA 1ECJA 2CKMA 1XTIA 3KC2A 4HLDA 1ZUNB 3X1KA 1Q7GA 1HSZA 4CNQA 4YP0A 5TLSA 1PGJA 4TKLA 4EW3A 1MGOA 1G4HA 2OC4A 4LZJA 4XH9B 4AO7A 4B79A 1A9PA 1VRVA 1JT2A 3ZJYA 2AFIE 1W5FA 4RD0A 4AK9A 3Q88A 2J9FB 4XVRA 1D9ZA 3H97A 1NDHA 4A2QA 1LQ2A 4ZGGA 3MLAA 5JZ9A 1K4KA 4C4YA 1CHNA 3OEED 4CHTA 5CA1A 4K9QA 2W2PA 4G5OA 3F96A 2Z43A 1OAKA 1LH0A 4KXLA 7ABPA 1BFKA 2JAXA 2M2IA 1GLVA 4L75A 4TVBA 1Z7YA 1O58A 4BN0A 1GPH1 1UQTA 1L7BA 2OZEA 1TO1E 2C20A 1K8RA 2Q46A 2BEVA 2V96A 4HX9A 1R6VA 2WD8A 1AV7A 1A8QA 3CRRA 2L2QA 4HFJA 4ID9A 4AECA 1S2NA 4BX2A 5IT0A 1DBVO 1LBSA 1U28C 4A36A 3DULA 1TUBB 1ZISA 4JLOA 4S1PA 5BWOA 2RHHA 2REXB 3ZHXA 1K1EA 5A02A 3V7WA 2FSGA 1CUVA 3GH3A 3HP7A 4YMVA 1FSPA 1CRZA 4DLUA 1VL5A 3JWEA 5TRTA 1QKIA 3R7AA 3TM5A 4IDPA 1U99A 1YBMA 2VDOB 5F9FA 4WBXC 4PPNA 1GD1O 2G1JA 1JBQA 3ONDA 4IHJB 1L4MA 3TKAA 1Z0AA 3I42A 3KFVA 1KZ1A 1TKRA 2JJMA 4Z2AA 1PV1A 1M8PA 1R0SA 4FK8A 2AJTA 1XT6A 3LIPA 1T5TA 5ALJA 3N2GB 5J2TF 2ILVA 1A9YA 3M4YA 4BO7A 1FZTA 3W5BA 2AUNA 2Y1DA 1I7PA 1E5XA 1GDHA 1QSGA 2ZJBA 3FWPA 2E87A 1ZOLA 1TCBA 4MP6A 2V1UA 2Q5JA 2LIVA 1YC2A 1G8YA 4R71A 4PC7A 2J6IA 3EDMA 4G0WA 2QLBA 5FI3A 1Y63A 2RG7A 1SVLA 5CAEB 3S1AA 3T15A 5BP7A 4X1YB 2QA5A 4N5NA 2JLSA 4AY3A 4D2IA 1AF4A 3VJKA 1RYHA 3R0ZA 1N5KA 1N5OX 4AN0A 4M1KA 2YYAA 1F8XA 1IOWA 3DHVA 3ZWQA 4EQZA 5EJ5A 2Y9PB 3K16A 4C88A 3R6GA 1RADA 2W2XA 4RUKA 3T7KA 4ENQA 2OFPA 2D8AA 2R6JA 4TLLB 2FI1A 1H3NA 3DTVD 2QD2A 3OZAA 4OHBA 1G8AA 1O94C 3ZD7A 2A9KA 3RAJA 4E5MA 1IZYA 3IUYA 4OXXA 2PBZA 3MQFA 4DG9A 1DNPA 5FWXB 4E2FA 1X1AA 3DFIA 3VYVA 2IPOA 3U4AA 3MUEA 4FJ0A 1P4HA 4LYEA 3SZRA 2H5IA 3QLUC 3F7MA 3PFFA 3U49A 4IQ8A 1NKSA 2Q29A 2F1JA 4C0WA 4XWWA 1Z36A 2XDQB 4FFBB 1VSQA 1L9KA 2FHPA 1W1IA 2A0UA 2DPHA 3EXG2 3MRSA 3KYBA 3GZNB 1KP9A 2QIPA 4M55A 1K9VF 5CCBA 4QVKA 5FD8A 5HQJA 1NZJA 1V11B 4X54A 3HDGA 1EGQA 1CF4A 1K68A 1O9GA 2RJ3A 5DGDA 1YDHA 1JR4A 1KDRA 3FCUB 4V0KA 3I72A 3K71B 1BHJA 3O3CA 3MT8A 4K86A 4DWVA 1S6YA 2VAMA 2IBTA 3E7DA 3BD7A 4XWKA 4LX0A 5M7EA 4CLRA 3VGPA 1NNEA 1WOMA 2WSBA 3OESA 4AJIA 5DCWA 4IWYA 4RWZA 2GPJA 4BKPA 2ERCA 1OLOA 1CQWA 2ODQA 2PEYA 4FYXA 4KH1A 4UHDA 3STHA 3WQRA 4DTCA 4C6HA 1X1BA 3IVCA 4DLNA 1L4KA 2VJMA 1BEEA 3FF4A 5C4IA 4XGIA 1SBHA 3ID6C 3ODPA 2AR9A 3PT9A 1Q50A 4Y1FA 3CNHA 1OGIA 4KQ9A 1SUAA 3LPLA 1DBRA 3ZWNA 5CBPA 2VSFA 1NNI1 4BCBA 1AS0A 2YRFA 4RGVA 4D56A 1TJ4A 3ZTWA 3OZXA 2GJ4A 1Z0DA 1CETA 3IE0A 1L5QA 1SBZA 2W6ID 4JYBA 4DSTA 4CG3A 3PXDA 1RPTA 1EGHA 2J32A 5EUCA 5HW0A 1L7DA 1OGJA 1OXTA 1RWQA 2PYZA 2DQSA 4J90A 3RHSA 3SMVA 1S3SA 1GFZA 3GRFA 2QD5A 1OXVA 1Q95A 4ZGWA 5LKAA 2ZITA 2BE7A 3MWDA 3PQ6A 4EQ6A 4YPOA 3EMDA 3RU7A 5KQLA 3BAZA 1RXSA 5BVGA 3A1CA 1RIIA 1UJ5A 2LDXA 3WTCA 3HBAA 1H2HA 4DQLA 1W96A 3OQHA 3V8BA 5JANA 3TPZA 2UUBB 1Z4KA 2QTBA 2XUIA 1WMBA 3PHIA 4LDAA 4RV5A 4JJEA 3CRVA 5U1PA 2J48A 1ICIA 1I7QB 1RP1A 2BEKA 3MRXA 1X7ZB 2NXCA 3DW3X 4FQ8A 3T1YB 2XT6A 4PSCA 1H6DA 4A0HA 2BWJA 2QM7A 2BF7A 1GRRA 4QQRA 1LLDA 4TSFA 5F35A 1M0TA 1JH8A 2B3DA 4RF2A 1RBQA 2Z95A 3RODA 1D0SA 5IDWA 3EEQA 4X45A 5AUQA 2CBXA 4DANA 1TUEA 1GNVA 2ETVA 3GG2A 2XVAA 3KWMA 3LF2A 3QG1A 2VYFA 3QVMA 1KPIA 3OO0A 4JH0A 2R44A 4KI7A 3R2JA 4OHFA 4TXMA 4BN5A 1MH1A 1YOVB 4CFZA 1J49A 2EX4A 1GITA 3NCTA 5CM2Z 1GYPA 4RPKA 2JLQA 3FDZA 4NZMA 1U8FO 5KI6A 5BRNA 3THRA 1PWZA 1I0LA 2K7ZA 3MMXA 4LFBB 1CUXA 5JNLA 1SCIA 3SJZA 1H65A 4G67A 4TMFA 2HNBA 2DJ5A 4BLRA 3G2KA 9MHTA 1OAAA 1G98A 1OLUB 3EXFA 4PAOA 4Y2JA 2FZWA 2F90A 5BNZA 2XGOA 3ETGA 2K4MA 4G25A 2DUNA 1QE5A 3ZGXA 1P0QA 2CVQA 2HZBA 4K81B 4JIMA 4N6GA 4NZNA 4U9UA 1Q1BA 1SEVA 1T0IA 4M60A 3NIBA 2IUYA 1XDUA 1XTRA 3CKLA 4NU0A 5D1NA 5KYUA 3HEMA 3ST7A 4YMUA 3IHWA 1XO1A 5EWLA 3RFTA 2PS3A 2CYCA 4PLWA 3NOVA 2NVUB 4PSKA 5EJ4A 2ET6A 1Y3IA 4D8YA 4W99A 3FA2A 3GHYA 3CN9A 3T9EA 4BQEA 3AR8A 5H1YA 4EDFA 2NV0A 2H4ZA 2FQYA 3DZBA 2VP0A 1DLJA 2O2GA 1Y98A 4A8HA 2A14A 4IZ6A 1KORA 1ULZA 1YQ9A 1OF1A 1JB1A 1C8BA 1W4RA 1OFUX 2VBFA 2IV3A 3NJ8A 3HXPA 1JQKA 2J9ZB 5GJWC 3HHEA 5JW6A 5J23A 3B12A 2NSHA 1OWPA 2OVBA 5FIUA 1L1FA 5E4FA 5HP4A 1P8AA 2V6GA 5AJYA 2F9LA 3D4LA 2YFQA 3TVTA 3TMAA 2GKGA 3TTXA 1JDBC 3CE9A 4TKVA 2O19A 3KZNA 3K1AB 4OM8A 3QUTA 1SB9A 2DQKA 2QT9A 3VPAA 4C4PA 3ZDBA 4JZYA 3RUHA 1EXVA 3IUNA 1U9ZA 4OUDB 1HE4A 2JFZA 4LJSA 4EHNA 3QE0A 2Z9DA 4MUXA 4AZ3B 5B6JA 3FGOA 1TU0A 1KJWA 1N6IA 1V35A 3DNFA 4NZPA 1DQYA 1UDCA 2XMDA 3JQ7B 1HL7A 4DC9A 1YZUA 3ZYZA 1AMNA 3HJFA 1IZ8A 3MJCA 3UV6A 3SC2B 5CFQA 3RWBA 1HQKA 4Z2YA 4I9NA 2PGAA 3R09A 4BWVA 4ED9A 5DM2A 2G88A 2AWOA 3R20A 1YDEA 1IN6A 2ODAA 2Z04A 4UNNA 4JYMA 3PDIA 3ZWAA 3P9XA 5M04A 1U1EA 1NUTA 3GLIE 4DABA 4AJJA 2Q5EA 3I9MA 3MCAA 1OGYA 2PANA 4MW9A 4NCAA 3BOSA 1ZWKA 1K7SN 3DS8A 1N5JA 3N5CA 3GFPA 3ON5A 4RH3A 4ENPA 4Y2SA 4PRKA 1G8SA 1Q3KA 3LZ6A 5JLJA 3GIDA 1UKVY 1TLLA 4LGYA 4DQ0A 4GE3A 2C7GA 3W2TA 1B23P 4RLSA 2A9VA 4WK0B 2BFEB 3LXUX 1E63A 5IF9A 2ZM6B 3FJ1A 1TVCA 1WSDA 3K9NA 3PR2B 1M34B 3WWZA 1H93A 3SXJA 1SVUA 5FOSA 1XF1A 2ZWAA 3ZBQA 4EPXA 1F1BA 2OBMA 3JRWA 4CTOA 1CF9A 3OFJA 2C7VA 3BXXA 3OZ7A 1N2SA 4TT3A 1QO7A 3BPSA 3LDHA 4BQOA 1KKMA 1NTRA 4BQSA 2CW5A 1F3LA 4IOJA 5DOVA 1KY4A 2SKCA 3AONB 3CNQS 3K4QA 4S2UA 3C3MA 2VWPA 2DT5A 3M33A 3FSJX 3UGJA 4HVLA 1U4SA 2W5UA 3CCCA 3V5NA 3MAGA 1C30A 5E1MA 3FCEA 5EQJB 2J87A 1P2DA 1RHQA 2IYRA 3OP4A 4XCVA 2R8XA 2OMKA 1GA1A 1QYWA 4MKHA 3PJRA 3NTXA 4P0TA 3HP4A 4WGGA 3SNKA 5KBYA 4OHVA 2B2CA 3KS9A 1DO0A 4CUKA 3VH4A 2I4IA 2WYOA 1NJFA 1AE1A 1TU3A 4FKBA 4HB3A 4LOAA 3ZGOA 5JRDS 4LRTB 4IUCS 4E6EA 4MDFA 3TQFA 1AGNA 2V7QD 3BBLA 3DHNA 4GPIB 3FJOA 3MOGA 4QASA 5DGTA 1BCRB 1JAXA 1DWUA 3PGMA 3JWPA 4LZAA 5CBKA 1AS3A 2X58A 2A59A 2VWQA 2G1KA 2VRBA 4ENWA 4C2UA 1W30A 1W44A 3F6SA 4LIPD 4RIEA 5JMWA 3GN2A 3ITDA 4QARA 1GQOA 2OESA 3LUCA 3P9IA 4O63O 3WNCA 4GZLA 3KL2A 1ZA1A 3ER8A 1L0BA 5LA6B 2AI1A 3HFSA 4DBLC 1C9KA 3NDPA 3SBDA 3ZDFA 1JDJA 3NIGB 1EEXB 5LJLA 3ZNOA 3AKCA 1JJ7A 2IKSA 4ZMBA 4IVPA 2OHXA 2KM1A 1E1MA 4GICA 4PFSA 4J1QA 1S2DA 4QOJA 4AF6A 1T1SA 1EWYA 3FRIA 2ZYWX 2QYTA 2Y1WA 4BNMA 2LDBA 3ABIA 3HEBA 2MSKA 3ZZ0A 3AFGA 2BKAA 4OJYA 3U1TA 4RQUA 1C1DB 2A5YB 1TMKA 3OPQA 3KVRA 1U0EA 2I7VA 1IN4A 2QSJA 3C3AA 3MCWA 3AWDA 5EVJA 5TE9A 1ZJ4A 3PQ2A 1UIRA 2PMWB 1UBHS 3DNPA 3ZCSA 2ZRNA 3A4TA 3WKEA 3GRRA 2E37A 1HZZA 2HFJA 3CO0S 4Z86A 5KNCH 1EK5A 1GP2A 2BKVA 4YCBA 2R2AA 2AN9A 2A4KA 1K6XA 5DM60 5E9AA 4A5OA 4B3DA 2OHIA 1T36A 1THZA 3T34A 3VDQA 2YC4C 4ODIA 3GRAA 3QX8A 3KOWA 4XYGA 1Z4NA 1I4WA 2BFBA 1ZCFA 3ZXUB 4N5MA 4C7JA 5HE8A 4X66B 1HURA 1OMOA 3JAMA 1VZ2A 3ZE0B 2ZTSA 3FAZA 4XSGA 1PV4A 3QXSA 4D43A 5FDFA 1ZD3A 5J47A 1ULAA 4HRYA 1ZHOA 4TV8F 1H3FA 3B1YA 3L4BA 1X7YB 2OXRA 1FFSA 2VDWA 4L27A 4LYHA 3SSMA 3ENZA 5KNBD 4HNAA 1XG5A 2HWYA 2ZIWB 2ADFA 4C7OB 4ZOLA 1VBKA 1VIMA 3FKQA 5DHRA 3ZD6A 1G6OA 3GT4A 3QFCA 1FDOA 3PC3A 4TVKA 5DLYA 3OZSA 2SHKA 4L07A 1L7RA 2B4QA 1FXWA 2M6RA 4R51A 5DTIA 1MAWA 5C51B 3FOZA 5ALWA 2OCXA 4P3KA 1TZ2A 2HLDD 2VNIA 4QATA 1BYUA 2PSSA 5FWYB 1H5QA 1E3EA 1QB7A 4POAA 3WDKA 4RESA 3LCUA 3GLKA 4OYRA 1H94A 4NG4A 3AERB 3DDOA 1LPMA 2Z57A 5AJHA 3R8FA 3LTEA 1CX9B 1TT7A 4HWKA 1PQYA 5LKRA 1QO0A 2PGNA 4WESB 1AN0A 2ZRDA 3RS2A 1G18A 3STUA 3A7DA 1SRRA 4QRIA 3RS3A 1QFMA 4MR7A 3KUDA 4JFRA 4HH0A 4LRXA 4PNZA 3R7NA 4I9UA 3TW0A 1EAYA 2QN1A 4G0YA 4I4TF 2BM1A 1G55A 3KXPA 4R2JA 3OF5A 3ZV3A 2JDID 4F6RA 2IHUA 5MFZA 4JP2A 3N70A 2AW3A 5DULA 1K6JA 2JAPA 1X7HA 3PD7A 2R6R1 3L9WA 1TT5B 4WFIA 3Q3CA 2RJOA 4YQZA 4G5YA 5B3JC 2Y2VA 4FE3A 1ORRA 5K3BA 3EVNA 4C1NA 1L7VC 2QYOA 3H5LA 4MAMA 2RGNA 2Q2NA 1JYFA 1Q0RA 2HDHA 5K8LA 1P2TA 3GQBB 4M0EA 4QXOA 2XCRB 1UPUA 2UDPA 2FZLA 4XLLA 5JXHA 1SVNA 4DRZA 3WHPA 1ETHA 1CZNA 2IHKA 5F12A 3ZDYB 1B1CA 1PNVA 5DHFA 721PA 3GRZA 1VRCA 3ILSA 2GX6A 3SX0A 2HF8A 4QE3A 3EQ9A 4I1IA 4G4SO 2XSZA 4QDKA 4YLGA 1XEXA 1KQGA 3PHCA 1BC5A 1UMDB 3HHPA 4PHHA 1O8BA 2AXNA 1VMKA 4NTZA 8OHMA 2HPZA 4O2BF 2TRSB 2VBIA 3USCS 3DV0A 2CVFA 1CWUA 3U4CA 1HE1C 2B5WA 3GP5A 3MVEA 1I2BA 4LHWA 1J1IA 4KN6A 1SKYB 1USUA 3NAMA 1GZ5A 1OFUA 1Y3BE 2D3TA 3G85A 3QPWA 3T1VA 4QFDA 2QUBA 2IXAA 1GHTA 3P5BA 3S7TA 1LJ8A 1KZGB 3M4ZA 1V1MB 3AF6A 1CFZA 2WAAA 3IQIX 3OM0A 4BLVA 4ND6A 1MX5A 3U60B 2O8BA 4FYHA 1DKLA 1JSCA 2OQIA 3GFGA 1AKYA 1F60A 3HU5A 2E9SA 4PLCA 4A5SA 4EG8A 5B30A 4ESVA 5K3SA 1D9XA 3BRQA 4KXWA 3IQEA 2CZCA 4MTLA 1G5FA 2YBDA 3LUPA 4ME6A 3KQMA 5TVGA 2J67A 2YN4A 5CEEA 2J3KA 2PIAA 1X87A 2YXDA 4XIFA 4GIBA 2AFHE 4XFKA 3P4UA 1M73E 1OTXA 1W36C 3PKIA 2FWMX 2XITA 4PZZA 3AF1A 1VIAA 3IPCA 4OHUA 3CUUA 3H9QA 4CHGA 2G77B 3AR9A 2WU8A 3MWFA 3IDAA 1BMQA 1VI6A 2V55B 3RTBA 2CL0X 5GM1A 1Z06A 3OKPA 2JAQA 5LQNA 1KO1A 3M3PA 4FIDA 3P9SA 2O8DB 2FY8A 2PXHA 2O2CA 5JZMA 4M3NA 3N3AC 2BGWA 1C1XB 3CNOA 4ZDIA 4IMIB 3SQLA 3UMRA 3CWZA 3OC0A 1CY8A 2H2DA 3RSSA 1Z5OA 3VTFA 1IUOA 3LC1O 3DMNA 1XMSA 3GFRA 3N07A 4NBTA 2QVYX 5MF6A 3KFXA 4DA6A 1U8CB 2X2FA 3B1FA 4CCWA 4PTZA 1MW9X 3RSGA 4NOMA 4E03A 1YQDA 4DR1B 2NV6A 2QX9A 5L3QB 4GZ3A 2ZIAA 5KYXB 1DC5A 3S29A 2PX8A 4EGAA 1T9DA 4L3VA 3HCNA 3AF5A 1TCAA 4Z53A 2D4HA 5CH8A 3ZIUA 2V0CA 4OBEA 3HDYA 4HVAA 3C6BA 4FDLA 3R9XB 5KVAA 4CEJB 4DPLA 2FMHA 2QKYA 1A5AB 3FNHA 4QPZA 1AO3A 2J5KA 2N42A 3B82A 3GZJA 5EHGA 1ISJA 3RVKA 3ZI4A 1I13A 4PN3A 2Z2ZA 1L1QA 3ODGA 1POWA 2BFNA 3VR1A 3RS9A 1E2EA 1H8HD 1WKCA 2RI0A 1KARA 1LBQA 1QS0A 2BI7A 2PTGA 3LFHA 4M8KA 1RQXA 4TUYF 2EBWA 2QL6A 4JLWA 4WIAA 1C1HA 1CJCA 1E61A 1WXXA 5CVCA 4XPZA 3VV3A 3AEQB 4H17A 5DHUA 2L82A 1E4EA 3CZQA 3IVAA 1XZHA 2YXBA 1RKUA 5KPDA 4O5AA 5DMXA 1M8KA 5EZ5A 3DL7A 5ICGA 1NBIA 1O94A 2H7VA 1UWKA 4J7XA 3N75A 4KXNA 4RY9A 2CJPA 5J5CA 3ZHCA 2Z56A 2O14A 2XMGA 3PDWA 3B7WA 3E6AA 5FPQA 4EG3A 1RYNA 2IEDA 5HCNA 2OT3B 1TKCA 1RCFA 3U56A 2NU6B 2J6BA 4OMCA 1DO8A 4WOKA 1DLIA 1LDBA 5I7FA 1UBSB 3QKRA 4TWJA 3PXUA 4OQQA 2J9GA 4C30A 5ADVA 3OICA 2PSFA 1VTKA 2CE7A 5BN4B 1XVVA 4Y1GA 2HMTA 2I7XA 4WVFA 3MINB 4X20A 4GLFA 4K88A 4B6EA 3COZA 5JH7A 3NHMA 2OOSA 3ED1A 4O5OA 1JBEA 5TQJA 2WUGA 4ENTA 3K32A 2HX1A 4YMHA 1SOVA 5ECGC 3ILVA 2V4UA 2GLUA 2ZRAA 4EO4A 2CF5A 4FDAA 2GAJA 4D57A 5EJMA 4KSYA 5KOIA 1VMAA 3MAJA 1MO3A 3W8EA 2FSIA 3OPYA 1VL6A 1YKGA 2IYYA 2WWIA 5DLEA 4CCYB 4DNQA 1MW8X 2BH2A 1PHRA 3UC9A 1XZAA 2FEOA 3FY4A 4O0MA 2IV2X 2JLUA 2BMAA 4ZOCA 4QWMA 3O83A 5A5DA 4AMYA 4MLDA 4NCKA 4KJZA 2RHWA 3A6JA 5D3MB 2X5OA 3PYMA 5JWOA 1R0LA 1D6JA 4Q9LA 2ZRKA 2XCSB 3DT8A 4MJLA 1AURA 1T2DA 2PJDA 4DHWA 1CBUA 1PQUA 1DC8A 2EYUA 4N0MA 4RELA 4W1QA 1BQ3A 4NPHA 4HN4B 2R8ZA 3T94A 1THMA 1Z0KA 5EIXA 5J2UF 4R9NA 3C70A 1HETA 1K8ZB 1HEYA 2HHJA 3BB1A 4MVWA 4MLPA 1PLKA 2ECKA 3O1LA 5AW4A 1H6BA 4DWOA 4V1CB 3R4VA 4P0QB 1BVUA 4XSVA 2R7MA 5IK2D 1GKUB 2ATCA 1ORIA 3JU3A 5BR4A 5KQMA 2VHZA 3FUWA 2HQ1A 4QOFA 3GPDG 4M9QA 3T5CA 1E9DA 2NTEA 1J8FA 1R6TA 1N4DA 2VF7A 5M2QA 4H2DA 5ALQA 1C9JA 3LVBA 1UPBA 1Z17A 1JNYA 1TC2A 1MDBA 3FD8A 4YROA 1YJQA 3WBJA 4ZU3A 2H7YA 2JGAA 3OMLA 4P98A 4BO2A 3MF4A 2PX0A 4FUTA 3QVJA 4OSOA 1PSZA 3D4BA 2WAOA 2X6RA 4YRLA 4YV7A 1R15A 2H0AA 3NC1C 1J00A 3L01A 3M6IA 4DV7B 5SV2A 3VNRA 4RMJA 3ZKAA 2ZZMA 1OAOC 1H4VB 3QF4A 5EWMA 4YUZA 1H2XA 1RLMA 3P9RA 3ZE2B 1D7OA 5BUCA 4V0MA 4GYWA 3ELUA 1KS2A 3BF8A 1BE8A 4YFVA 5ED0A 2B34A 5H70A 1ZR2A 3P0RA 1HMPA 2I2FA 3TINA 1GPBA 5DNCA 4A0QA 2V0NA 1CUWA 4MV6A 3W5JA 2WWHA 1VJDA 2QAIA 3GELA 4LW8A 3RJ5A 5KNDH 2QG6A 2XWSA 4YJHB 3K94A 3OFND 2H1RA 4QDUA 4I3HA 1X38A 3HY6A 3LXMA 3E5MA 2EKZA 2H51A 4FP9A 2LW7A 2GBPA 4NONA 3C24A 1I2CA 4CU5A 3SJUA 1UBFA 2Y3IA 3VA7A 1RJ9A 4JXKA 1K5HA 2I8CA 4M6WA 3SQOA 3SYMA 1NT2A 1VE3A 3U3JA 3UUFA 2ZJ7A 1F12A 3KELA 1T3HA 2BKLA 1XQ6A 5A05A 4B5LA 5T4BA 2C3MA 4BP1A 2V1XA 3KJFA 2XZDA 4IZOA 5AXDA 3RRNA 1DJQA 2GTPA 4IX9A 4AF8A 3GVXA 3H1FA 1JTEA 4KTTE 4Q4CA 3T5PA 3K35A 4JK3A 2D62A 2NXWA 2AMLA 1YDMA 4KV7A 3RT1A 3Q3IA 3W34A 1D6MA 3ZDXB 1RHJA 2PZGA 3KVYA 4ES6A 4M2LA 3ESRA 5T41A 3X43A 1EYZA 1GG9A 1MG5A 1GIAA 1GZHB 1N33B 1ORTA 5F7ZA 5C5CA 4TV9B 4QJ5A 5EJFA 1YS6A 4X97A 1GY8A 1WAMA 5H9VA 3TQCA 5M34A 1VG8A 2AQHA 1WIWA 3TL6A 4KXUA 2J4DA 1G5QA 3R4CA 4ZYTA 5LDDC 3PQEA 2NU7A 1NIJA 3EQ6A 2RKBA 3A4LA 4KQWA 2MOKA 4K9DA 4N9QA 3ONFA 1FS5A 4HDCA 3R9KA 1XE3A 4GHWA 1T0JB 4QSMA 4DKXA 4EO7A 1SQSA 4YX9A 2QLTA 1LNQA 1TIPA 5FUMA 4WJLA 5EJEA 1ZGHA 2VYVD 5ALOA 2VR1A 1MAVA 4FFWA 4Q5IA 4DJAA 1OLSA 2XCIA 4C21A 5LUBA 1NLMA 4TTTS 1GN8A 2D7CA 2JNWA 3F7NA 3TLMA 2JH3A 1GFIA 4MUAA 4BWGA 5JO0A 3RT9A 3BMNA 1TLTA 1DELA 1Y7PA 4FCCA 1QM5A 3JQAA 3KHKA 2BISA 2ZATA 4ENSA 3EODA 3NM5A 4E5YA 1ESMA 2V8BA 1MHPA 4YI5A 1IU9A 2BKUA 5BQOA 4OHXA 4EY6A 1Z5ZA 5A4MS 1HNWB 5GOZA 3TB6A 1E6EA 2PQ6A 5BSGA 1DBSA 3R8CA 3O4GA 1MRNA 4DW8A 2DUWA 1EPUA 1YZNA 1RAAA 3ZDCA 2QRQA 4NS1A 4ZARA 2IX3A 3UH1A 1Y89A 1H9AA 2D2IA 4NBRA 5FEMA 2I7TA 3OOJA 3EXHC 3F5FA 5IDQA 3T4UA 4M1MA 1Q14A 4DLWA 3ROFA 3CW9A 4N5IX 4E7OA 4DUZB 4W1SA 4U0KA 3SC4A 1VLMA 4QPDA 1P4GA 2H2GA 4J76A 1Z3IX 3O5AA 1RMQA 3D3JA 1DTWB 4KTVE 4OMUA 4XD7D 4E5UA 4KFCA 2FA9A 2Q8QA 4CN8A 1QGUB 3PQ8A 3IERA 4F5WA 1P9RA 4PZAA 1U7XA 4UTNA 2ZQZA 3FSRA 4TQAA 3H3XA 2D3WA 4B7XA 4BTEA 4HNTA 4LBWA 1HFJA 1ZC3A 1O77A 3SSNA 4OV6B 2QW8A 1EJ0A 2EIXA 3BXEA 3KKZA 5KVCA 3AKYA 4J0DA 1IDOA 3PK0A 3Q12A 4WZBB 2VWGA 1NJ8A 4M88A 2RGAA 4ZV7A 3GFBA 1SVIA 5DGXA 4PIMA 4KQ6A 3ONNA 4KXQA 4N5LA 3IAUA 1SCQA 2EBHX 3A32A 3O4HA 5CP8A 1HE2A 1V7ZA 1GUAA 3PDUA 1IOLA 1Z6QA 2XCTB 2LPMA 4A23A 1P4RA 4R84A 1LK0A 1I2DA 2EGHA 4N3NA 4Q9KA 1ZR4A 4GW3A 1Z5PA 2P2NA 2RHMA 3CUSA 3C8MA 2CDNA 3C98A 2QP4A 3HGMA 3QW4B 4HB0A 4L4ZA 4B3JA 5I9IA 3VPDA 4FT2A 1NW7A 3IO3A 4J0CA 5A5VA 2AXPA 2AE2A 2PV0A 2MYPA 2Y92A 4GS5A 2P6NA 1KK0A 3DW1X 4Q12A 1Q92A 1T9HA 2TMYA 3DOCA 3N2IA 5B57C 5EWJA 1JKMA 1S4MA 2FMUA 5F21A 1OIWA 3KK0A 1FNNA 1N2ZA 4DJDC 1EVJA 1GAJA 3O74A 4OXNA 5C8DA 1C0PA 4WDQA 5FBZA 2H85A 4PPFA 1GR1A 1XRQA 5AICA 5GGXA 2NU9A 2PMEA 4C7VA 1ILEA 3NGMA 4K3UA 4GXTA 1QRTA 1L5NA 2JW5A 5CU7A 4H6PA 5IAAA 1NN3A 5FUXA 1EDEA 2CLLB 3HCCA 2P6UA 1P77A 3FMGA 5EE1A 5JQWA 1J23A 1CQIB 1M54A 2QYSA 4KNWA 1R0KA 4H6WA 5HS6A 1U3VA 3DDNA 3NT4A 4HMPA 1ZUD1 4KMMA 3OZTA 3ZNQA 3IUQA 5KNLA 1JILA 2H1HA 3HB7A 4Q1EA 2FMXA 6YASA 5AJWA 3HCEA 2QVGA 2C7PA 2P90A 3I2JA 4B3CA 5L7TA 4H4CA 5TGDA 5JPDA 5D5QA 4B6GA 4IJWA 3PEWA 1BEUB 4DDTA 2VP6A 4WZAA 1QMPA 2OL4A 3EDYA 4LE0A 2WM9B 2X40A 4HPXB 1UP4A 5DHPA 4RPCA 2P27A 3CF2A 3M1AA 2AMYA 3QBVA 1UWLA 3JQRA 4CVNA 3UVEA 2HF9A 1SU8A 4URUR 1N2CB 1PT6A 4EAAA 1ULBA 4X0EA 2EZTA 2O59A 5C34B 1DOAA 2HWXA 3FZYA 3OQOA 3KQLA 2QLNA 1ZXBA 2EWVA 1I9CA 2JIZA 1GGJA 4P93A 1GXSA 3JQEA 1SIOA 4KYVA 4QQ8A 2AV6A 1QC5B 4QPJC 4RK4A 4ZT4A 5JHHB 1IQ0A 5IFLA 1SXPA 3PNPA 4C0JA 3FUUA 2HRQA 2NADA 1YQTA 2GPAA 2WYVA 5DYNA 5T67A 1ZXLA 4G1MB 3SEZA 2Y1CA 2GRUA 1STOA 5F7JA 1M0EA 4X61A 3SJBA 5C7YA 5BSMA 3FIUA 4GX0A 4I9HA 3R76A 1XR3A 1PK8A 1A3CA 1YIAA 1NN0A 1SXJB 3IDOA 3KZXA 1AHHA 3MS2A 1S89A 5KU7A 2QDXA 4MDEA 4NP6A 1YR3A 5CJJA 3A9SA 1DOHA 1V2GA 4ZICA 3GLFE 1JF8A 3NTUA 4E5SA 1CZOA 2QLFA 3TZ6A 4ND3A 3KSAC 3OH8A 2O6HA 3RTEA 1EUDB 1U0JA 3OLXA 3TRHA 5C2JB 2B2NA 1QG0A 3ZHBA 4AW9A 2VYNA 1GZ4A 4ZT2A 3C8UA 3OCYA 3P0HA 3R3WA 4IO0A 3RS4A 4LSWA 3K2BA 3TE6A 1ZOIA 2H4XA 3MBIA 3C4QA 5DTMA 1YZLA 2KE5A 3SS8A 5LJIA 3BJMA 5BYBA 2XX3A 5JZSA 1XZIA 5AKLA 5DSTA 2YFKA 1VQ1A 2GRJA 1EQ2A 4KYTA 1KDZA 1YVRA 3ANNA 5HYVA 5KOHB 4P4TA 4NEHB 3UQYS 2D0IA 1U5CA 4PLGA 5A6SA 1Q77A 2PRKA 2EW1A 2TMGA 4MLCA 1ZIPA 1O08A 4KODA 3WIOA 2PTHA 3KSDO 2AMFA 4KO1S 2HREA 4C03A 1Z4OA 1Y0BA 3FPFA 3H19A 1A1VA 3FR7A 2Z8XA 1UODA 4IHQA 4OI2A 4Y7DA 1ZCZA 1B2LA 3G7UA 2UZ4A 3NTLA 5AKKA 4AU1A 2PA0A 1AA6A 2PH7A 3CQ9A 1TZJA 2VHEA 1W5AA 2JEYA 2M98A 3OTWA 1NVDA 3KTAB 2RJNA 3JZDA 2YJ5A 3WL4A 5HOQA 3B1XA 1WUYA 2Q5HA 3H2YA 3M9LA 4F3TA 1HQYE 3CBQA 3FFTA 1Z0ZA 1SY7A 4NPAA 5EMLA 3DE0X 1QOPB 1ONOA 2W00A 3O26A 4EHAA 3MBKA 3E5NA 4IDEA 3QTLA 2QT0A 2CNWD 2JGNA 1Q0UA 3UW3A 1MA3A 3I53A 1O3YA 1E7YA 4H7FA 4KC0A 2WJVA 4WUTA 2G1PA 1ATZA 4LF6B 5JSFA 1UBJS 1GPDG 2G9RA 6CHYA 3MSXA 2A78A 3CXRA 2W6JD 4IV5A 2X3YA 1D5CA 2X3UA 2H18A 3PUJA 4PNHA 2GHRA 1E77A 3OU2A 1GZUA 1ZUIA 3F1KA 2I1LA 5BVHB 2FR0A 3AEKB 3UUGA 3ZLVA 4AL4A 1FTYA 2FOLA 3HCRA 3NETA 5DM1A 2QSYA 5F77A 3OQNA 4ZKDA 2ZXFA 3PIRA 3WP1B 2HHHB 2YCLA 1XZEA 1XP5A 4P2BA 5FUYA 1UM8A 5JQGB 2AD1A 2IC5A 1H1LA 2QU7A 2FZEA 4FHEA 4V02A 3TNLA 3UAOA 3HR4A 2IGBA 5A9SB 3TCKA 3Q11A 4GPTA 4ZYVA 8AT1A 2WSMA 3LQKA 2BFOA 2QN8A 1A88A 1AUOA 4XWYA 5EQDA 4UAUA 3VYSB 4MGKR 1LI5A 1RI3A 1LF0A 1JAIA 2C2YA 2VUSA 3EEOA 2WU0A 2GF9A 2G07A 2BLLA 4R81A 3V4FA 3OWXA 3VZQA 2PK3A 1D4AA 3F97A 3GJQA 3WMRA 4C4SA 1C0IA 1COWD 3ACCA 2F1HA 1UQUA 1II8A 2XA2A 3P96A 1CY2A 4EGJA 3GV0A 3QWBA 3FW1A 1CYDA 2ODBA 5HRCA 1DBQA 3A6HA 1IBMB 1KFKB 4B2PA 2PRZA 1ZDMA 2RKOA 2K2QB 2KS6A 3UT5A 2Z9CA 1BMDA 1IXKA 5JISA 1LA2A 5HF5A 2AVDA 5LMZA 4AKHA 2IFTA 1C3XA 2YIJA 3KYJB 2VBCA 2XW6A 3GX1A 5FUQA 1L4LA 1IJKA 1EK0A 3G0IA 1O6FA 3H4VA 3IDFA 4LJKA 2AZDA 5T3UA 2UZ1A 5DYGA 4MKRA 5FOUA 4UQLA 4HWSA 1T0BA 1LPNA 1T29A 3DMGA 3ECSA 3QE9Y 1RMYA 1EVKA 4WZAE 3LECA 1XTJA 3ZY5A 1PFKA 5GWXA 3TTVA 3EXIA 1R0YA 3TIXB 8LDHA 1AQLA 3UWPA 3OU6A 3GOQA 1C7RA 3U7RA 2RGYA 5TNXA 5AYVA 3RNLA 1NUPA 1K5PA 1YB5A 4DG8A 4CT4B 3F4KA 5DT9A 3L79A 4L9RA 3BEOA 1E1QD 2PT9A 4LK2A 2I6QA 1CW2B 4M1TA 5B64A 1YJ8A 1Z3CA 2YFYA 5I48A 1V5GA 4YAJA 3VKHA 2GN8A 3BYZA 3LUAA 3UO8B 4RHFA 3Q3JB 1RQPA 3C39A 3MWLA 4LKOA 3F90A 4OQ4A 3IFSA 4EJSB 5ESDA 1Z0UA 3W06A 4QNNA 4C6SA 3I1FA 4JKIA 4EPTA 1SG9A 3PQ3A 3HPQA 5AOAA 2XQKA 2C4HA 3DEZA 6REQB 4LF9B 1DQRA 2G4LA 4XFDA 4RIFA 3R0JA 4OAPA 4CMIB 3KL4A 1A5TA 1NDQA 3DDZX 1T5BA 1NOIA 1ODIA 1XVLA 2O3UA 1QDUA 3KZVA 3ABOB 1VGRA 4Q1DA 4UUNA 521PA 4EH1A 5MGBA 4E46A 1CFJA 2NTJA 2IP2A 3FPBA 3QTTA 1E92A 3LX8A 1I0IA 4DA0A 1BA2A 5TF4A 3BZWA 2UXCB 4AJNA 4CEIB 3FUCA 5E1BA 3RRBA 2K6GA 2GNAA 4GOKA 2C3OA 2W2MA 2BZSA 1VMEA 1DRVA 3DMDA 1TZMA 1YDGA 1YONA 4PF1A 2AKAB 2LBPA 2ENUA 4URHA 1W94A 5DI3B 4ZRMA 1CVLA 4ZFNA 4ZODA 1T1GA 3AV3A 4RIHA 1RYBA 5LB2A 3MUNA 4CF7A 1ZGAA 2WWVD 4HUQA 2QXUA 4YEDA 2FE1A 2Q0SA 3DLPX 1KZ9A 3PE3A 4HB4A 3TYXA 3ZXXA 1T0HB 2HCBA 3A9WA 3OT1A 3MILA 4IUYA 4K6MA 4ZREA 5LLDA 5EP4A 2QTVA 2CLIB 1NXVA 5DRYA 4EA7A 4EO9A 2XKKA 3NBXX 1ENZA 1FFCA 1F6BA 2FK7A 2BGIA 3RK0A 5FYDA 4RABA 4ITVA 4Z1OA 4X8HA 4Z3KA 4KAAA 3A0UA 3EZXA 1EDOA 4FFOA 1PUXA 2VKQA 5ERXA 4CM4A 3UB2A 1XP8A 4PZPA 3HZRA 2WTUA 1VKHA 1I36A 4QYXA 4YV1A 5IBQA 2ZYUX 5K8CA 2RIRA 1TECE 2CXNA 4UZEA 3NTQA 1YB4A 5EZYB 3ITNA 4D9EA 2WYWA 2MYNA 3MCTA 1NF9A 3NYRA 3UC5A 2FRXA 2Y1GA 3QBTA 2NMVA 3RG2A 2NLOA 1NLUA 3H86A 4CL8A 3IUSA 1JMKC 3TZHA 3PQ4A 2WPDA 1B73A 1EK6A 4IH9A 3MMPA 5BMVF 4M54A 3TSWA 3DNMA 3O7MA 1WDLA 2KHZA 2C04A 2HF2A 3C5CA 5FFNA 3RPEA 3NO4A 1MB2A 2FPSA 2ZE7A 2YWCA 2FEPA 2P5YA 2JI7A 5JYBA 5DW0A 2WKPA 3V2IA 3ZIDA 3CMCO 1X70A 2FVXA 1Q0QA 2P9CA 4BE9A 5I6DA 2PN1A 1YFKA 3MSCA 4AF7A 1YE8A 1A4RA 4UCQA 4WQMA 1QQAA 3KEOA 3PZBA 3QEJA 3WE7A 4AJPA 2CJYA 2E3JA 4HDRA 5KHLB 1Z8HA 4X1KA 1NW5A 3MERA 1MFPA 2OV8A 4OTZA 4MZDA 1C4WA 1FE8A 3DCJA 2AKEA 1P1IA 1CIJA 4OXQA 5B36A 1C2TA 4IIJA 1CUUA 1E66A 1L6RA 3C1AA 3LQFA 4V24A 5TS2A 1HDCA 2QK4A 3SFTA 3NBZC 2IS1A 2GEUA 3JATB 3P32A 3QLVC 1N2GA 5HK8A 4DSUA 2FPPA 3WMXA 5F76A 4DUYB 4GQBA 4PZDA 4J91A 1GPLA 4MV8A 2VNSA 1HNXB 2IH4A 1YS2X 4CGYA 2B7CA 1U04A 2OAQ1 4BGIA 4NQRA 3GGGA 1GQFA 4KB5A 2BR3A 4EB6A 1G2IA 5B2EA 1RC0A 3GPBA 4QGFA 1AKEA 1VMDA 1AV6A 1GQSA 1VIVA 2FN8A 1G8HA 1M5UA 2B4YA 3GBPA 4Z9FA 1TAQA 5CT8A 4QQFA 2Z5FA 3G2QA 1KJ8A 1KEEB 5IT9A 3ELDA 4L8YA 1S8FA 2OO5C 3O4RA 4I36A 1FLVA 1HDRA 1OAOA 5DB4A 3U17A 3E3OA 3WLNA 5DGIA 4QYSA 3ZHYA 4D6YA 2XA1A 1V7PC 3L1IA 5LXTA 2BD0A 4J7CA 3NHSA 1TPYA 1XMJA 5F3DA 1Y7LA 4AZSA 3UXYA 1VCIA 1Z2AA 4TLAA 4CKBA 3MLEA 4M46A 4KR6A 2D2EA 4KBYA 5LQKA 1WBJB 1M6VA 2W48A 5A2QA 4QUJA 1T8YA 3OPVA 4HXGA 3UJAA 4J94A 3TQOA 3RHFA 1VP3A 1GKKA 1UBTS 1E9SA 4W1PA 3PUWA 4OLHA 5TPZA 1JEYB 4PG4A 2J46A 3E9RA 4JY7A 2H7CA 3PX3A 4BC0A 4RF5A 4BN4A 4W5QA 2X8LA 4H7PA 3LRXA 5AJTA 4DSZA 5B1DA 1HZJA 2BHRA 4NYMQ 3JR7A 4HDKB 3EFEA 2O1XA 2FPIA 1MIOB 3B9PA 2YXEA 5DBIA 4QXQA 4ER0A 1Z4IA 3PRHA 3KLMX 3NNDA 2Z2XA 1Z75A 1Y9EA 2IXTA 4QAJA 4FD3A 5CLFA 3QVUA 3TAHA 5ITZA 3R3HA 2VAWA 3T5BA 4H9GA 2YJ4A 1KJYA 1OC2A 2EDCA 4BZQA 4C4ZA 4CIXA 1JTVA 2VIIA 2D2FA 2ZUBA 3DZCA 3GCZA 3M9WA 5IJZA 2A33A 1YZFA 1FDWA 4HAOA 3SYNA 5K3OA 3IR5A 3TNDA 5AO9A 4BJ5A 4LNAA 5K6TA 1D8TA 4IX1A 4L6AA 4F4DA 5IJ9A 1RKVA 2Q50A 1G66A 3CB2A 3IVGA 4XM0A 5KTPA 3FG9A 4MV3A 4EJ0A 5CA1B 4Z4GA 3B2QA 4PRLA 1C1YA 2A92A 3KKKA 5AM4A 4XWTA 4RKFA 1MPXA 2BVNA 2I62A 3E81A 4FEGA 1YQWA 4ITUA 4TLDA 1FUYB 2W2KA 4G23A 3GT3A 2IHVA 4YB8A 3RVOA 1TM4E 1TGYA 2X23A 3H5AA 4EYSA 4BS9A 4FUQA 2EP8A 3W8NA 5DXAA 1GKIA 1XDGA 2OR3A 1YS7A 2BEVB 2ZXUA 1X9GA 1D2MA 3K09C 3K1JA 5HM6A 3J80A 2O6LA 2W6NA 4L3OA 3DTNA 1HNZB 4V3CA 3U61B 2GETA 4O02B 3M6UA 5DOZA 4ARBA 2PO5A 2XGJA 3K05A 2RHBA 3KCQA 4QFMA 1D04A 4R2LA 1XTPA 1I94B 1JIUA 4X1IA 3IUEA 3N8NA 1U0LA 3KQYA 4H15A 4TWRA 4J0FA 4DJ5X 4QM7A 2HRBA 1T9BA 4OGKA 1BDBA 2GASA 3CX8A 3OY7A 4LHVA 1KMCA 1P5RA 5EHZA 1EVQA 4V3BA 2PEZA 1L4UA 4BE4A 4JVSB 5AVZA 5F1OA 1KH2A 1DAOA 1E6KA 1Y6JA 2WHYA 4KUEA 4Q3NA 2E4YA 2R8YA 2PSHA 2AVNA 3QH4A 3FDJA 3VSCA 4BEBA 3P20A 4DN6A 3RS5A 4F4IA 3K7EA 3FM9A 3P9PA 4OVKA 1ECPA 3KQVA 4P34A 3EXHA 4PHGA 3U40A 1T6YA 2IIPA 2ZYRA 4MRNA 4B45A 5BQ3A 4QUDA 3TTUA 1N8NA 1GDDA 4HBGA 4O4LB 4CKZA 1DFHA 4MQBA 4PYOA 3F9IA 4D0LB 4J3JA 1WXGA 3G8BA 3U9SA 3UXEA 3OZVA 3WK8A 2WF7A 4B3FX 4F12A 4WLFA 2NYAA 4J6EA 3QKWA 1A9XB 2ZSUA 2FSVC 3LCVB 2WIJA 3LBYA 4LY3A 4QTYA 4CMKA 5JFGA 4AO8A 2X8BA 4AWBA 4H0CA 4MOWA 4O3FA 5CURA 3L3BA 4YDQA 1O0CA 3H1AA 2QGFA 2BEWA 2QG4A 3ELYA 4B0PA 4TYPA 2YS6A 1ULHA 2YOHA 2X2OA 2Y77A 3GJZA 3KM0A 2A1TS 4LJ7A 1R4MA 1YQXA 3H3FA 5G41A 3Q2IA 3UY4A 2E1PA 3HXQA 1CB7A 2DWCA 2BJWA 3VAAA 1TQ2A 1A8HA 3CKMA 3DD5A 2AYXA 3A9CA 2IS4A 4FTWA 4K8RB 3DPUA 1K2WA 1KZ7B 5I8ZA 4F5DA 4UTVA 5ICFA 1PJ4A 2AKYA 2BFCA 2H54A 4Q7QA 5IN5A 1RC8A 1QQ5A 4WK6A 2P7HA 1IHDA 5C5IA 1XU4A 2OBFA 3R23A 4TLCA 5K51A 1N4AA 4F3KA 1UMCA 1P6UA 2W7TA 2NUAA 1FMTA 4R05A 1G3MA 3AJ8A 5TB5A 4WECA 3TXYA 4II2A 4GI7A 1RWXA 1IVSA 4KQHA 4ESOA 5J4HA 3A27A 1NF2A 3D6VA 4FFNA 4DY6A 4CLRB 5LP1A 2MINA 1MV5A 3K9CA 3I58A 3E3NA 2RGEA 5T8KA 1C3OA 2RBKA 2EQAA 3IKTA 3B1VA 2PGXA 4R8RA 5ENVA 5KSYA 3W9UA 3KQKA 2G63A 1N77A 2G09A 2HA2A 1LCIA 4DJJA 2GXQA 2ZUSA 2HUNA 5JYDA 2ZJYA 3SXUA 1RS0A 4TLBA 1YRBA 4Y9TA 4KITB 4FSDA 5JNTA 1BU8A 3QV1A 5CBPB 3WGIA 1RI1A 2Q6TA 2IXDA 3BCSA 5MN4A 4YMSA 1HL3A 3ZCPA 4ISCA 1XPOA 2VL7A 5DHSA 1NY5A 3TB4A 5IX8A 3L6CA 3T5TA 4G0MA 4FYYA 1E79A 2L69A 3BB3A 3BMXA 1F9AA 4AS2A 1AXGA 1A9TA 1PR3A 3PWSA 4WADA 4CUJA 3BTSA 1PNRA 1ZUHA 2HRZA 2DFLA 4GXRA 1SUBA 4OGGA 3MWDB 4AI6A 4ETIA 4WACA 2P40A 2IHYA 3VAZA 2YZKA 1KQ3A 3MPUA 2PVPA 2XTAA 5F2KA 4D6PA 3VVCA 3TLYA 1P19A 4EGCB 3SVLA 2NT3A 3ADCA 1XMOB 2CJWB 2OV6A 3AEYA 4ALMA 1ZD1A 2QPLA 3IR6A 4ER5A 4DWJA 1RHUA 2PBRA 4A2WA 4R1NA 4KR3A 1C4XA 1NQUA 4IKPA 2FWRA 2GJ9A 4RTSA 5I4CA 4EITA 4KWCA 4NV3A 1M1UA 4LVUA 3STXA 4RU1A 2OHJA 1HK7A 3I01M 4IFEA 3EGIA 3FVTA 3G8AA 4GSYA 4JJIA 4RVDA 2O23A 1AGYA 1ZIDA 1L5WA 4L4SA 1T6NA 1JWBB 2EL9A 1QCZA 4JNKA 4RHCA 1L6IA 2B0JA 2XF2A 2E82A 3DFMA 3QQPA 4NLLA 2MT9A 5DO9A 1MAAA 4EZIA 4U2KA 2REQA 4D46A 3DCNA 4OIMA 4M7PA 2I6SA 2IUUA 1XQWA 3THWA 4FNMA 4HS4A 4GMKA 4D0SA 3QF7A 4IVQA 5CIQA 1E7SA 1RBMA 3D8SA 3OX4A 4Z0TA 2REBA 4B09A 4D9HA 1JR6A 1B8UA 2QJOA 1AC5A 1R7RA 4NVRA 4NYIQ 2GZMA 5CVDA 3GFQA 3K6RA 3G5TA 2OCPA 2PXXA 3H1BA 3L4JA 4DCJA 1JIXA 1XDDA 2A30A 4GKVA 4O4JF 3EXFB 1TOAA 2Y1FA 3IV9A 5GONA 3RU3A 1UEIA 2D2XA 2JA2A 3ZC3A 4BP9A 1DCTA 3AHGA 1R4NA 2O20A 3L05A 4ZEOA 2YWJA 1VZ3A 1URPA 3OEEA 4FHFA 1BH6A 1IULA 4FFSA 3S99A 2BCJQ 4L8WB 3OZCA 4GBJA 1G7TA 4YCJA 3KVVA 5JIBA 1SIBE 3KOUA 3MJTA 3KIPA 3O47A 1E8DA 3D4NA 3ESDA 3G3EA 3QITA 4GGPA 2QIOA 2FOIA 1V39A 1THGA 4OQFA 3TVYA 3U9LA 5KYUB 4FDVA 1CB0A 1QCCA 2RK3A 4FYIA 1YQGA 1QYVA 3EZYA 1FYEA 2OCYC 3QUQA 3OJWA 1LBEA 3EYWA 2WZQA 3KLNA 1MQSA 1Y81A 4KE8A 1YR7A 4EF6A 3TL2A 1HDGO 3HJNA 4AMUA 5D87A 4RA9A 3NTRA 1JP7A 4ND5A 2C3YA 2IE0A 3VNAA 1J8YF 4R9VA 5CA0B 2PKWA 2B3TA 3ENVA 2VQEB 1USGA 3ZZMA 1PD0A 3TE7A 2PZAA 1Z4QA 2QTAA 2R00C 1Q15A 1AUVA 4RTQA 3T9AA 4XX0B 2W4IA 3GXOA 4H1UA 5EJGA 4LJAA 2EV9A 5LDGA 4TYNA 4MPRA 2HA4A 1LSJA 1KU0A 1OD6A 1PDVA 4LXQA 3FFWA 4AJKA 2X0IA 3H5OA 2MYTA 1LLCA 2A9OA 3C5HA 1K7EB 3MCZA 1A8IA 2HIGA 4I2NA 1SUPA 3B6JA 2ZUCA 5JROA 1UOQA 2CZQA 2EF0A 4MVXA 4UZFA 5A3SA 3T7TA 1F8YA 2C4VA 4TKVB 2QVZX 1QWOA 3BE8A 3G89A 3F6BX 1V5WA 3H5VA 5FNZA 3OQ1A 4X1OA 2F59A 4MW4A 3KTOA 4KFRA 5C31A 1MJ5A 2CNKA 3M5CA 1YXMA 4B6RA 1QKKA 3I45A 2QHXA 4L5CA 1JEEA 3FVVA 2IHNA 1O8CA 5F78A 2FSUA 4J2TA 4TWIA 4G3XA 1DUIA 4D9GA 4EJ6A 1FUEA 5C7IO 4BFVA 3O9MA 4K03A 1Y8QB 2QVLA 4F6CA 4D3XA 2BZ1A 3DTVA 4AG5A 4Q1FA 4YK7A 3PDIB 3FCOA 3FTDA 2DKOA 2FCAA 3R0QA 4BMPB 1BS9A 1SCDA 1BFDA 2D06A 1ND5A 2FFJA 2IOFK 2QV7A 4Q18A 5FYQA 5BWNA 5FPKA 1TZKA 4R7GA 2YMMA 3SEQA 1Y8AA 3RQIA 2JEZA 3COJA 4K2AA 2FR8A 4R1TA 5DI9A 5IASA 1DAKA 3NHFA 5F3RA 2XEDA 2AG0A 2CL5A 3IOYA 3BORA 2WPNA 5KS2A 3G5UA 4KQIA 3B3QA 2YWFA 4RA6A 5FWNA 1MX3A 3A6EA 1EGMB 1TVKA 3DP7A 2PWBA 3EY9A 5D01A 1TMYA 3QENA 1DAPA 1R27A 4R1MA 4Y2HA 2WILA 5ESXA 3E2PA 3TZBA 2IYQA 4UVGA 1Y3CE 1GR0A 5LZ4A 4JBWA 1KYZA 1GDTA 2PX3A 2ZSKA 4PBRA 5I7WA 2EJWA 2O52A 4YRJA 4C5BA 5AVYA 4LXGA 1G8FA 1C30B 4BVKA 4G0QA 3FOFC 4JL8A 1IFXA 2G40A 2GYVA 4RKRA 3QLTA 3WA7A 1KVQA 2IPNA 1P1BA 1SK8A 3PXEA 4HMOA 3WYCA 3FPAA 4LXTA 4PYLA 5THQA 4D99A 4R8LA 3L0ZA 1JBKA 1XI2A 1RPJA 3LPMA 2HU7A 2CD7A 4DMMA 2AI3A 3ER9A 5JZVA 3MWKA 2W6IA 3HY4A 1Z2OX 3CRZA 1QHEA 3DBHA 4MITA 2V6FA 4NCHA 3TTWA 3WTBA 2X2PA 1RD4A 4LHXA 3DGEC 4BV2A 3O8RA 3HGTA 1XLWA 3B6IA 1GRVA 2XLCA 3HSSA 3EIUA 4M0FA 3KU1A 2F9FA 4QPCA 4J16C 5ALUA 1K3UB 4L2IA 4JOSA 4QHYA 4AX4A 1NQVA 1RVDA 2W58A 2XRYA 1NNSA 3DWGA 2A57A 2GR9A 4DLRA 3D64A 4DR2B 1KRHA 2C9YA 2BFDB 1FMLA 2CVHA 1XQVA 2G28A 1L8LA 1SEPA 1W49A 1Z15A 4HS9A 4Q37A 5J59A 5U4QA 4RFLA 4AUEA 5DNUA 3HU2A 3MMZA 4PLPA 3F8WA 3DOJA 3EEIA 1KJNA 1ZM2A 1E3QA 3FCSB 1S8AA 5CCXA 4G4JA 4D9BA 1N0VC 2BHNA 3BILA 3H87A 2WUDA 2AJ8A 4EYOA 4NAVA 1KQFA 2GAAA 3FPSA 4MUYA 5IT4A 2ACKA 1Y42X 1R0BA 2DOKA 4EHFA 3WLIA 4U6SA 2FZGA 1MOPA 1NFRA 2JHCA 4X3PA 2IDJA 1QGYA 3E03A 1KJQA 2ZT8A 2R9VA 5FO0A 5AWFC 5TIIA 5EESA 5JWRA 4QYWA 4D25A 2GAFA 1FBTA 4UMFA 1NHWA 4AWXA 1U2RA 4B8WA 1DO2A 1CEXA 2Z3VA 3IHTA 2WWGA 1REQB 1ZKDA 1PIWA 2CMDA 1V8DA 1FYDA 4UCWA 1HDOA 4FKMA 5KTNA 3EDCA 1JJAA 3Q7SA 4H77A 4YV0A 1E6CA 3RBAA 4ZYZA 2I65A 5JXJA 4QRDA 2CLEB 5KDLA 3UXHA 3ZEAA 1T36B 1Y4UA 1Z62A 5A5GA 5JAPA 3W2HA 1ZH6A 3VU3A 1XAIA 3ABSB 4J1SA 3R24A 2PWAA 1KSFX 1QK4A 2BFBB 4GYJA 1OU4A 2KW5A 1QFJA 3FPCA 4Y6PA 3FCXA 4RK6A 4IO1A 4ILEA 3ZHSA 3U4MA 4ZDWA 1IBRA 3IAHA 1YNOA 4G0XA 3WBKA 2OY0A 3AFHA 3RJMA 4BDSA 1G7RA 4NU8X 3OIGA 4G36A 3NAQA 2VDWB 4LBYA 3UH0A 1P62B 4NEQA 4HNAB 2E5WA 2KQUA 1VL1A 3JZIA 4MQLA 1TGVA 3PF8A 4ZOLB 3K96A 9GPBA 5K4HA 2WD9A 2XB9A 4LDRA 2GD2A 1JG2A 2JIQA 2ZRGA 5D6NA 1CQXA 3WBBA 1LF5A 4FT4A 3PJDA 1O5OA 1NY6A 2VA8A 3EF1A 5FNVA 3U4DA 3ZZUA 4P0PB 3UMSA 3DSRA 1NR7A 5CFLA 4B2IA 4OK5A 5CB8A 2OV4A 3F74A 5E4JA 3WWOA 1GUFA 3BE5A 1N6RA 3GO4A 3CINA 3NTOA 4FVTA 3Q15C 3ONEA 5ALXA 3O9ZA 1WLYA 2HM7A 3HA2A 3ZWVA 5J43A 4FKZA 3I32A 2GUWA 2OK7A 4IDBA 2IV7A 4AN1A 4D74A 1KHHA 3QLVA 2P79A 1XV5A 4WN9A 3L4EA 4RTRA 4MA4A 1RTKA 2PRYA 3OKAA 3K8QA 2X9NA 3BIXA 4O08A 3FDIA 3WFJA 4RTLA 1UBUS 5SY4A 2P75A 1XVUA 4D96A 2Y1KA 3TR0A 2M1ZA 1QBGA 5A4JA 4JI8B 4FINA 1QBKC 4YCCA 4POOA 4TL8A 1C4KA 5DASA 5BOVA 1JHXA 2G08A 2QD4A 3WKCA 3NWOA 3W5VA 5JAUA 4YMTA 1KO5A 4YCNA 3ROQA 2I34A 3V7YA 1U5BB 1YQQA 3FKSD 3HCOA 3N87A 2OO5A 3Q7IA 2YN0A 1CQZA 2JZNA 2C59A 2NZUG 4B7ZA 1Y1QA 1P2BA 3A1WA 4JU8A 4KQXA 3AI1A 1TVEA 2H1WA 1VG9B 4XB2A 5CLLA 3SX2A 1U3CA 3KXLA 2HMWA 1XEXB 4WY8A 3T7IA 4ZVOA 3ZGNA 4K9MA 3TTYA 4BMZA 3BFKA 5A7GA 5E8RA 2C9OA 3DV0B 1YA6A 2C9DA 2OORC 1WQ4A 2ZBFA 4PSUA 5KPJA 1C3LA 2IIBA 2E4UA 3UK1A 4QKQA 4MPDA 4MV5A 3G0GA 4BNYA 1JR3E 1O96B 3CURA 1XKLA 1L7MA 5HQTA 1Z63A 3MAAC 3ZGZA 2IYNA 1IRXA 1GL7A 3WYEA 1TQ8A 5C7OO 3RGWS 3IV6A 3D7SA 1XKTA 5AESA 2Z6QA 2PUDA 1GPUA 4II3A 3O0DA 3V8VA 1CT9A 4FFMA 1P5JA 3CSSA 1BCSA 3B70A 2WWRA 1J20A 1JEOA 5DIFA 4RIGA 4S1NA 4DCCA 2AC7A 3WMFA 3AL0C 5TJHA 2ZJ8A 3W3AH 4JVMA 3EGCA 4Y18A 1XB2A 5FHRA 1J25A 3AVXA 3R77A 3KT8A 2OZLA 3E1GA 2XMRA 4JQYA 3VMMA 1E0AA 3KHUA 1CUEA 2R79A 1WF3A 3QY0A 4EX6A 5JUWA 3GGCA 3BF7A 2YTZA 3DB1A 3IMEA 4NH4A 4CQNA 1ML3A 2WSLA 2OCDA 3KPYA 4ND4A 2PLFA 2R1VA 2WT9A 1VKJA 1YIDA 5JVDA 2BSXA 4OF4A 1ESZA 3GJ6A 5UKDA 1Q19A 1UZLA 1BS1A 1U7TA 2DU8A 3IAEA 3IP1A 3N2YA 4X6XA 4EB0A 1MT0A 1I4LD 4YN3A 3IAS6 4ZVLA 2ONJA 1P45A 3CX4A 3NQ41 3NALA 4A8PA 1D6NA 4EENA 3BFXA 5HE9A 4ZHSA 4YDHB 5BV2P 3WOVA 2A1UB 3K09A 6AT1A 3JD3A 3GB9A 5D84A 2ENWA 4UMVA 2XY4A 4HSEA 4R01A 1U2EA 3LUKA 5IJXA 4FW8A 2AEMA 1BEZA 4F97A 4RJJA 5EFZA 2JD1A 3PUKA 13PKA 4R2HA 2NXNA 1UJMA 5DHTA 1CERA 2IU0A 4DLBA 4XWOA 3ZU5A 5I7HA 2W70A 3ZV7A 5JD4A 2Q2WA 3ABRB 3N8GA 1P60A 3PD0A 3PXXA 4OHWA 4GH5A 3N8HA 1MQAA 1JHRA 1Y6FA 3WYDA 3C1TA 3ELBA 2O3QA 3NDJA 3VNUA 1DMRA 4E1AA 3WGVA 3FZEA 3VR5H 2WWTA 1JW9B 4TM8A 5AI5A 4DJFC 1L1EA 3L7KA 2HTFA 3VJMA 3RH0A 3HCDA 4RQTA 2V7TA 2ACWA 1TEVA 3IS3A 2C8LA 3Q87B 4FZRA 3QI2A 4K40A 3DVLA 2ZPUA 1Z0IA 2P9GA 3GDFA 4FGUA 4RJLA 3CZ4A 4DDKA 3CVYA 2X0NA 4N0DA 5KYTA 4KAJA 5KQPA 4NF2A 3D7NA 2XCUA 3J7TA 1NV8A 1WUHS 3SMQA 3FJYA 3EVAA 4HNGA 5AKEA 1DGQA 3ZU3A 2O54A 4CT0A 3HA7A 1BXZA 2XQGA 2VDKB 2Y0PA 4L15A 4GE0A 3K6KA 1RYFA 1BX1A 2V6JA 2OGZA 2ECQA 2WF5A 1Y4DE 3V34A 1WXQA 3M8KA 4A0RA 4U7FA 3ESBA 4E94A 2P9TA 4XR4A 3T4PA 2PMBA 1IVNA 1JXOA 2WABA 3HP1A 1XRJA 4J49A 5ADUS 5GV8A 4AQYB 1IONA 2FSVA 3HZHA 1M8FA 1OZAA 1ESCA 1SN7A 3JWHA 4I3FA 2PMFA 1BH2A 1E4EB 5EXXA 1ZMRA 4FMCF 2O1SA 1PTKA 4B3HA 4X71A 2YIVX 1R12A 3E82A 1RHRA 1IXSB 4RVHA 4BMOB 1TYEB 2X9LA 2A7XA 2HXGA 4R0MA 5ITVA 2XI4A 4REMA 3KSMA 2WWFA 1ADGA 4KRYA 4F6LA 1XZPA 2GGSA 1CNEA 3WRYC 3Q1LA 5KNBA 5MN5A 1PF7E 2H6EA 4UBOA 2P0AA 5KTOA 5KVSA 1Y7TA 2A1TR 4DV2B 1P33A 2DTXA 3GCGA 3W9YA 5AM3A 2VDVE 4F9GA 3GEHA 1LVHA 3QKRB 4FGSA 5CYGA 1DKUA 3D3QA 4YRRA 2IDKA 4GP7A 1A76A 3NBYC 4B4DA 4QYIA 4X20B 3DE7X 2HLDA 4NX2A 5JH7B