4NJEB

Crystal structure of pyrococcus furiosus l-asparaginase with ligand
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
127
structure length
127
Chain Sequence
b'MAVLVIKLIPGLSGDIFRAAVELGYRGIVIEGYGAGGIPYRGSDLLQTIEELSKEIPIVMTTQAMYDGVDLTRYKVGRLALRAGVIPAGDMTKEATVTKLMWILGHTNNVEEIKVLMRKNLVGELRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords L-asparaginase
publication title Structural and functional insights into an archaeal L-asparaginase obtained through the linker-less assembly of constituent domains
doi rcsb
source organism Pyrococcus furiosus
molecule tags Hydrolase
total genus 40
structure length 127
sequence length 127
ec nomenclature ec 3.5.1.1: Asparaginase.
pdb deposition date 2013-11-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.40 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4njeB00
1HO3A 1WLSA 5DNDA 4ECAA 1AGXA 5DNCA 5F52A 4PGAA 1IHDA 2GVNA 4RA9B 4R8LA 3NTXA 1WNFA 1JSLA 2JK0A 5I48A 1HFWA 3PGA1 5CBPB 1JAZA 1WSAA 2HLNA 1HFJA 1NNSA 1ZCFA 2WT4A 1DJOA 4R8KA 1JJAA 5K3OA 1HG1A 1DJPA 4NJEB 2HIMA 3NXKA 5I4BA 5K4GA 5K45A 5DNEA 1O7JA 4RA6B 2P2NA 1ZQ1A 5I3ZA 2WLTA 5K4HA 2D6FA 2OCDA 1JSRA 1HFKA 3ECAA 5HW0A 4Q0MA 1HG0A 2P2DA
chains in the Genus database with same CATH superfamily
3RG8A 1M1XB 3IL2A 2JPDA 4OMDA 4RD2A 4AKSA 3AUSA 2OCKA 3HU5A 3OQIA 4M6WA 4HRVA 2I7CA 1VLQA 4DS3A 2XCIA 4IYJA 1J5EB 1W5SA 2ZTHA 2I87A 1M0WA 2B30A 2JAPA 4NCNA 5TGTA 4OKNA 3ADDA 1Z8DA 5TXGA 1B8PA 1N6IA 2QX6A 3CZRA 2DHRA 1F48A 1J0BA 2PGJA 4Q19A 1G8YA 4XLTA 1CEQA 5T4EA 2XUZA 5CW2A 1N8NA 4PZAA 1KJ8A 1M1NB 5AJUA 2I5PO 1M5RA 2ID4A 2J3IA 2Q6IA 2TS1A 3ODGA 1KO5A 1ZGHA 2XWJI 3PC8A 4PLCA 4Q21A 4QULA 4AJHA 4F9EA 3O2NA 1E3MA 1A71A 2HCFA 2Z9CA 3CYFA 3QWIA 3JAKB 4B33A 2PX2A 4YWHA 2PMBA 4YT4A 3KTAB 3WFIA 5HJ5A 3G8CA 4MZDA 1L5FA 4DCTA 5K8JB 3D54D 5BWMA 2ZCJA 3CB2A 2WSSD 1Z4KA 5KI6A 4YCNA 4OQEA 3TJZA 4ISCA 2SKDA 1R4MA 3LT2A 2J5KA 3NCHA 4BO9A 2CZQA 5CFZA 1PBNA 3M81A 2XTJA 1LFDB 3E81A 4LECA 3UMMA 2WWVD 1P4RA 2PIDA 2EFJA 2Q6TA 3PICA 1G7CA 1W88B 2WJAA 3K5WA 4YJKA 3HRIA 1HA3A 2LD4A 4M9RA 2ONJA 1F2TA 2ZDGA 4V2IA 3V42A 1GPUA 2GPNA 3PUIA 4K6HA 4DBZA 4FXPA 4YFVA 2AEJA 2H0RA 1QGUB 3KDSE 4XIYA 1RI3A 2QTAA 1UXOA 1Z5NA 3W7BA 3ECSA 1QC5B 3INTA 4RXMA 4KI7A 3PC2A 2NNLD 1D0VA 3FIJA 5EGSA 5E9AA 3WLPA 5KWJA 1J70A 2RHRA 3M0EA 2PUFA 2XGSA 2VXOA 2X0JA 4BLVA 3AOEA 2HPHA 4IICA 2XT9A 4D9NA 3PCXA 3WY9A 3F6EX 2BGKA 1ZESA 4JUFA 1SXJE 1ZP6A 4WBSA 1JTFA 4TYNA 3K70C 1X70A 5JJKA 4KQCA 2QTMA 5IDXA 2FN7A 3K71B 3R77A 3DTNA 5JY6A 2X15A 1JEYA 4H08A 3P2MA 3H5NA 5B5SA 4KNYA 3OQNA 1AZSC 2PZBA 3I5UA 4WNAA 3VBEA 1IC6A 2BELA 1CZNA 3LY9A 1GFSA 4E46A 4P38A 3JR7A 2PD6A 4W9NA 3QSYA 3TAHA 1JE1A 2VDOB 5AKLA 3KV1A 5HS4A 1UPAA 4MUEA 3OCVA 3MB5A 5A5EA 1Z12A 4A5SA 1PD1A 4DC0A 5B37A 4FYHA 1YQEA 4K9PA 4ZYLA 4RF5A 1WOMA 5TVKA 1XCJA 1YRYE 2QN6A 1ZHFA 2PPLA 2JJ1D 1GLGA 2XTNA 1QK4A 4YQEA 4GR4A 3KKLA 5LMUB 3WHKA 4FOOA 5IWAB 3ZWMA 3L4BC 2HGSA 1BMQA 5T6BA 3TOCA 1ZO8A 3I4LA 1XZNA 2GNPA 4YUXA 3DNFA 1X1TA 4NEGA 1Z38A 3BH0A 3QA3E 4RCZA 2JW5A 1B73A 5IZCA 2IS4A 4RMHA 2V45A 2ASVA 2CXQA 3EARA 4RQBA 3H1AA 3OJEA 1EK1A 2IHBA 1W49A 1NI3A 3G9ZA 4AQ7A 3EEOA 2VI5A 4M7RA 3EJ6A 5E1DA 3AERB 4TTQA 2P0EA 1M2GA 2QG6A 4PGGA 4M1MA 1ACLA 3JRNA 4A0FA 3C7DB 1IY8A 3BMCA 3CA8A 3OETA 4FGSA 4KG7A 2VUUA 1RHJA 4PC3A 3EODA 3KU4A 1P1HA 4Q4JB 3V80A 3WKEA 2J6BA 3NBFA 4IOLA 1CEEA 4EHKA 1ZM9A 2FQWA 4AZ0A 1YDFA 1T9HA 4E5SA 3FWHA 9LDTA 5HZKA 3FJYA 4ZV7A 3TFOA 3PYMA 3KHSA 1GD1O 1MRZA 1RRPA 4M6WB 4MVJM 1YAJA 2WJHA 1NMSA 2C5AA 5B53A 3T35A 3O9MA 3A9UA 5BPHA 3WBFA 3OWXA 6AT1A 1E79A 3AF4A 4DWWA 4F5EA 3KC2A 1DFHA 1E92A 1ML3A 1OFUX 1ZMXA 2IIVA 3BG5A 4PSCA 3ND6A 1SU4A 2JBWA 3K6JA 3RYFA 5A5DA 5JSHA 3HDHA 2A5GA 1ZH2A 4WK2B 3BGDA 1I4EB 4JU9A 4RLFA 5C7IO 3DR3A 1FX0A 3SJAA 2HQSA 1WPQA 2YY7A 5LZ5A 4F4CA 4DCOA 1VSVA 3LIIA 4Z0PA 2IWHA 2ZSHA 2Z9BA 1U2SA 1HDIA 4WFJA 1IM2A 2N42A 2XH8A 1OFHA 3RC7A 1CHNA 7ADHA 2UZ1A 1P45A 1KEPA 2XTAA 4NYJR 2NXJA 4DUGD 3ACCA 4OAQA 2FTKE 3DZDA 1YC2A 5DYIA 4P1ZA 1ZMBA 4PRKA 1J7JA 5KYXB 1N5IA 1BIFA 2OCGA 2ZAIA 3RIGA 5BSWA 3NT5A 1AURA 5BNWA 4D0NA 3MT8A 2WTUA 4QL3A 2IWRA 3K0AA 1GRVA 5IABA 3D2LA 1E2FA 1US8A 4YMGA 1CZUA 3UB4A 4GMDA 2XMGA 3LW8A 1YHNA 4TM7A 2Y0BA 4B3CA 1ZX1A 1NJ2A 1TRKA 4RZSA 2CLDX 3GG9A 4IUCS 5HJ7A 1DUIA 5IJZA 2VF7A 1SB9A 1UADA 1F2TB 1KFEB 4G1EB 4KO1S 5FA5A 1X7GA 5A4AA 1O94D 1CD5A 3R1IA 1OIWA 3ETCA 1QIEA 4I9GA 4HFNA 1EB8A 1LDGA 1W9MA 2J9FB 2O2EA 4KIUA 4LK2A 4AJIA 4EOGA 1PBTA 1A5ZA 1QBKC 4OHZA 3D6HA 2DLDA 1OAOA 2IKQA 3LBFA 4LY3A 4PVCA 5HDBB 4BMXA 2IJGX 4UQPA 1XQ9A 4KU4A 1RBZA 5EKUA 1SVKA 3GPDG 3GGJA 4I4NA 4IJKA 3GAZA 3CRNA 4R2KA 2OM2A 4HYQA 2VSNA 3U1VA 3AP1A 3HA2A 1NY6A 2JH9A 1A2OA 3BORA 5D1NA 1VIVA 3LPAA 4ND1A 4XOIA 2F4VB 3HGMA 4QGAA 4YAUA 1XYVA 2GVDC 2A33A 5JAIA 2V6FA 4PO9A 1E2UA 1U31A 3T0FA 3PR1A 1Z29A 2XYRA 4NULA 4Z4GA 3RR2A 1FC0A 4P80A 3R5FA 3QBEA 1P62B 3L6RA 1FSZA 1WA5A 1JZSA 2VT3A 5H1YA 5IVDA 5KU7A 1P3DA 4FHCA 4OXIA 1KZHA 3TZQA 4DW8A 2GHTA 3CWQA 3RGGA 5B30A 2JAOA 5D8DA 2Z58A 3KQTA 4FR5A 2G4CA 4Q02A 3RM3A 2ZI3A 5KO2A 4YC7A 3LQRA 5KKCA 1DAPA 2JJYA 3LXMA 3SYTA 1UJMA 1PT5A 2B4QA 2AD5A 2GVZC 4EL0A 1U99A 4H3VA 3TINA 4EW6A 1EE9A 1FP4B 4RC9A 4RSRA 1RM5A 4PV7A 2UVQA 5F23A 5LYYA 5JS6A 1T5DX 4M3NA 1EGVB 4KDEA 1AUOA 1J2UA 3D7KA 3QX9A 4FU0A 3TEFA 3BKXA 1VPDA 4C0SA 5BYKA 3HA5A 1NPTO 1CLEA 2FZCA 5HCUA 4DV1B 3AJEA 4GI2A 1PU2A 4MCJA 3JQGA 4RBNA 3IP8A 4HXFB 1XI2A 3BEOA 5H02A 1X3LA 4D57A 2ZXFA 5JMTA 1W0CA 4IMJB 3WWOA 5BSUA 2AG6A 2C4TA 4POAA 4KITB 5K8VA 2ZS7A 4DYHA 5DRYA 5ILGA 3OJWA 4EJFA 1I3LA 4MCIA 1LVGA 2GEVA 4KFRA 1KI6B 2CBZA 3I28A 3K8ZA 5EJGA 1N5RA 2WI8A 2WUDA 4QD3A 3L7KA 3F8TA 3PC8C 1JJFA 2FPUA 4URUR 2WW8A 4Q9IA 4EB3A 4C2UA 4Z51A 1T13A 3KUDA 2I1VB 3IKMB 1E98A 4K9OA 3JVEA 3SSAA 3UUFA 2V74B 4RZ2A 1MJ5A 5FPHA 3PJRA 4R5HA 2R6GA 2ATEA 1U5BB 3QYPA 5JNRA 3EULA 2ZJZA 1GZHB 1A9PA 1ANKA 1FVOA 2JHAA 5EERA 5FLYA 3X1JA 3OI7A 4D9CA 5EE0A 4TYYA 1AHNA 4GRDA 4WD3A 4GLLA 4M2LA 3LKDA 3AESB 4EYKA 1XAJA 4JLVA 3GEGA 1XX6A 4CLRA 2REQB 4OB6A 4RLSA 5JAZA 1LLQA 4U2FA 4PG8A 2G83A 4DIMA 2UZ1B 1E1QD 1A9RA 1DT3A 1FX1A 4MW4A 5KHAA 5C8ZA 3QTTA 3QYAA 2EJTA 3VU9A 4RHEA 3IAHA 1U0HC 1CUJA 2PWAA 3L06A 3PPXA 2VYVA 1A7UA 1UKBA 5TPWB 4CM1A 2Q3JA 3HEMA 2G0TA 3IDZA 1JIKA 4D9MA 4EX7A 2YJ4A 1NPDA 1ZD8A 4XX1A 5A3QA 5EMJA 2AUMA 1VSBA 3BZWA 2ETVA 4RETA 2X0EA 2XNCA 4GWGA 4FT2A 1XFDA 3AOEC 2QRUA 1YVRA 1R6TA 1M2EA 1Y6ZA 2CFOA 4FNMA 2IOFK 2XGMA 2ZIFA 2P7IA 3EMKA 4U2DA 3D0KA 3FAKA 3UA3A 4ITRC 3JXEA 1HNWB 1E2GA 3DOOA 2WPDD 1JA9A 2BBWA 4YAIA 4YMSA 4DV3B 1SG6A 1GKUB 2WJWA 2DR2A 1WG8A 4UDNA 4O8ZA 1E2QA 4NE7A 4CUKA 5DX0A 1IZ8A 5L95A 2Q4TA 1XQ6A 3AFGA 3RD5A 2V4MA 3ZIUA 1IY9A 3C4JA 3L0ZA 5ALEA 4GXNA 5LLTA 4UCFA 3AMVA 1EHCA 2XT6A 4KK3A 5G40A 3E70C 1QOPB 1LK5A 2D0OB 5LMZA 2E9SA 4RKYA 1Q0HA 2ZYWX 2HHLA 5LWHA 5HTOA 1KAEA 3HWSA 3QLJA 2VRCD 4MGEA 1JAZA 2YZMA 1SEPA 1G3MA 3L92A 1QYCA 5AKZA 3K31A 4C7OB 2FZGA 1W93A 2W6IA 2M98A 3T7IA 3BRWA 4UQLA 1UBSB 3H1TA 3MTDA 1PWEA 5IZCC 1YZQA 4OHFA 3CCBA 5FPSA 5F2OA 4BQNA 5JISA 3CWZA 3TLYA 1W87A 2VYFA 4OO3A 2VAMA 2AR0A 2I71A 4BJ3A 1U7UA 4POOA 2NU8A 5FDFA 4GR9A 2PMDA 4M8NE 2P27A 1DIRA 4PPQA 3JQQA 2PLFA 4HWSA 5FBQB 3NHYA 2JFYA 1Y5IA 2WWIA 5BYBA 3WXMA 1UWLA 2CEKA 1Y7TA 4ZANA 4R1SA 2YJZA 3W79A 3LS2A 3KJFA 1AXEA 1SQGA 1YGPA 4BWGA 1WSDA 2BR4A 1K63A 4YJDA 5GONB 4JI0B 1FVXA 3U4QB 1KO7A 2OWEA 3ELUA 1EK0A 2YWJA 2VEOA 3EAGA 4ER7A 2COUA 2WE7A 3K05A 3C3EA 1GXSA 3FNEA 4UJ3A 4CM3A 3AY3A 3LA6A 1QYXA 1X3SA 1QRUA 4ETMA 4MARA 5ENDA 3RFVA 5LIPA 4ZYXA 3OOHA 4C2AA 3TSZA 3L6EA 3NTRA 1CUYA 4HVAA 4M7PA 2UYCA 3MJFA 3I0NA 2WM2A 3D8SA 4HGQA 2WIFA 5J2UB 1ECFA 2WVJA 2ZE6A 3KB6A 3C41J 4GM1A 4HO1X 1SKYB 1UKYA 3G2QA 2Y1CA 4RA9A 1OZ0A 1Q3TA 3B1FA 4G5YA 1G3UA 2D2XA 2J59A 3NAGA 1Q84A 4QUBA 4YJ3B 1QO7A 4KH0A 3MUNA 4UHJA 1SBCA 4FYMA 4ND6A 1TJ3A 4EBBA 4NZPA 4MYSA 3WJ2A 3AHIA 4LG1A 4RD6A 1Z2AA 1SNYA 3AY7A 4WZZA 1X86B 4WNYA 5EWJA 2B94A 3B3FA 4TLAA 3KYDB 1E5LA 3T7TA 4RJJA 4U6QA 1Y9AA 4OQLA 5DWVA 1WXXA 2X9VA 4NJMB 3T61A 5TPZA 4ZQGA 1S89A 3OA0A 4PCUA 4R31A 4E4TA 3F4KA 5L4LA 2X8JA 2IZ5A 4P9NA 3WFJA 2AC4A 3MN1A 1RM0A 4ZYVA 2EYUA 1UM9A 2Z5FA 3LUAA 2G80A 2XMDA 3EK2A 3IOBA 4I55F 4S24A 5CXSA 3WKDA 4N6OA 3CW8X 4EFDA 1U80A 4FNAA 1NUUA 2DE0X 3STWA 5TARA 1OMOA 2FVXA 3GRZA 5KNCH 4OIMA 1ZIDA 2RIRA 3W5DA 4MRSA 2NU9B 1OE0A 3KOWA 3RVMA 3SKVA 4F6RB 4WN9A 5L53A 1OAOC 1IPFA 2DT5A 4B4KA 2FHSA 1QV9A 3A1EA 3EFEA 1G291 5IMSA 3CLSC 4IW3B 1AGPA 4HN4B 1T4BA 5H0IA 3BD9A 4BNXA 4R98A 4V38A 1II8B 4OP3A 4WLOA 1SBYA 7YASA 3BE5A 3D0OA 4OM7A 3P9QA 2QP4A 1PR5A 5BQOA 3SZLA 1HTTA 2AKAB 3JZDA 5K8LA 4PIPA 1OI7A 1R4NA 2ZPAA 1UFKA 5JZVA 1V9SA 1NXVA 3DFKA 3IPRA 3QBVA 5IJ0A 4MKRA 2VHWA 3GH1A 3NBXX 2F59A 4EHBA 5AW4A 3L0DA 1ZS9A 4E88A 2NU6B 4FCVA 1T9BA 2B69A 3TLKA 2R8PA 3A9SA 1WBJB 1WWKA 1QWOA 4U9IS 4GWLA 1D5WA 3KR0A 4HI0E 1WVMA 2YV4A 2EJCA 3AEKB 4LC9A 7ABPA 3PXGA 4D9IA 2X8LA 4N82A 1WDMA 2AJCA 3BDVA 3X3HA 3QUSA 4CTJA 4R1PA 3M70A 2OV1A 1ORWA 4Q4AB 3KLNA 5EE9A 4HSEA 4M87A 1YZHA 2VAXA 4DJEC 5FBZA 1GU1A 1XKLA 4L7VA 4WNCA 2BFCB 5HKAA 1XMQB 2YWDA 3GCZA 4JD5A 2WSIA 2G07A 3CC8A 1T1GA 3COPA 3GRUA 4N9QA 1GO2A 2V7VA 4RPJA 1TMKA 4XJVA 1AF4A 3SJBA 1FJ2A 2HWUA 4Z3DA 3ZWAA 3GLIE 3I9MA 2ECQA 2VLBA 1YZ3A 3KT6A 1EBFA 2H07A 3B6KA 1UINA 4EJ0A 4H9GA 5BNIA 3Q0EA 3L4KA 2PRJA 3D5QA 1EP3B 2ACVA 3H5AA 3PWTA 4OQZA 2FP4A 2IE0A 3KQMA 5J9FA 5CITA 1H2RS 4M0EA 1LPMA 2PGIA 4MVJH 3ZE6A 3G7UA 1P1JA 2OCYC 1YFKA 4OX9Y 5JNWA 5JWRA 4PICA 4FMDB 1X7ZB 1RJGA 3GLUA 2OEPA 1GHTA 4ZCTA 1NVVQ 3O8QA 4R71A 6PFKA 5DNYB 1J97A 1B1AA 2R7NA 1JYFA 3HKEA 3A37A 3WLQA 5TMBA 1T10A 4KQJA 1RXYA 3E9EA 4DUZB 2J4DA 1LU9A 1T4GA 3K72B 4LDQA 2QM0A 5D84A 5FO0A 4JQZA 4PY2A 2J5RA 3RSOA 2X3YA 4C0XA 2I4MA 2O4CA 2G9NA 1A9XA 1FA9A 4Z9YA 3L8CA 2N9UA 4NP6A 3ZK8A 2PFKA 2JJMA 3Q3CA 2WG0A 3NHKA 3ESBA 4DJ5X 3S55A 5JQGB 2V7BA 4Z53A 3E35A 3JD0A 4RY8A 4XCQA 3LNCA 4UE2A 3HO1A 4L5YA 3A70A 3KQYA 1WHSB 5CA0B 3B13B 1N7GA 2I76A 3LLSA 2ZI9A 3I30X 5AW5A 3G2JA 1IBSA 3VNAA 3CTPA 1JNXX 2YFHA 3RFTA 3T4XA 4B6JA 3TB6A 3TZCA 3O8RA 1JPJA 1YB7A 4HNUA 3C1AA 1O54A 1SQSA 1Y5NA 3K9HA 4QRDA 1OLSA 3EIFA 2XB2A 1JRLA 2B3TA 5AJZA 2PH1A 3PC7A 3QUTA 4LZJA 5EWJB 1IWOA 4DWOA 2CLOB 4LJ7A 3ZQUA 4C7VA 1MOZA 4LTNA 1PJ8A 3G7NA 4RXUA 4Z8XA 1GG9A 4BBJA 3WLNA 1OU4A 3WZMA 1E1CB 1J33A 3M6UA 3ORQA 4QSMA 3ZGLA 1XSEA 2Y2UA 5C7OO 2P4EA 1X14A 4V03A 2R68A 4XW2A 1G8KA 4Z1MD 3EGXA 1QV7A 1Y3CE 4LF8B 1I3KA 4ZZ1A 1F0YA 1KXJA 3AV3A 4HQNA 5TDHA 2Q7OE 5HWSA 1BRTA 1D2NA 1RLJA 1COWA 4YRKA 4R4JA 5BT9A 1C1YA 4C4AA 5DI3A 5C7YA 4BV9A 1QFYA 1R6AA 3RROA 3G79A 4UHKA 1FMTA 3HA7A 4TV8A 4DSTA 1YJBA 3EAFA 3P5BA 1IM8A 5JNLA 3I01M 2L17A 1A5AB 4HP8A 4CMCA 5IFLA 1OTXA 2XNJA 4PGMA 4KWIA 2F55A 1RXEA 4WN9B 4CT0A 5K9ZA 3L4EA 3WRXA 5AXCA 4BO5A 2XB8A 3W3AA 1BG6A 1GQRA 5EZYB 2EGHA 4ZI3A 3FKSD 4M0LA 3RYHB 4CF5A 2IHKA 4ARSA 3TW6A 5BXQC 4GUAA 4AKIA 4D2IA 1Z7WA 3HR7A 1SD2A 3M5CA 3RARA 1G17A 4BLSA 4EG5A 3MJTA 2F1JA 1Y33E 2BEUA 2ERCA 2JD1A 2XA2A 3CLKA 1JH8A 1ZD1A 2P6PA 4KN5A 4Q3AA 3D4BA 1R4NB 3JZFA 5H5JA 3SGLA 2C2YA 1JDZA 2CL7X 3WLEA 3FAZA 5IJ0B 2RHBA 5BSEA 1OZHA 4Q1VA 5EMKA 3RLIA 3OTQA 5JHGB 2QXYA 1QNLA 3NT2A 2XBUA 1G1MA 1NW6A 2HJGA 1J8YF 4QXPA 5DK4A 4NI5A 1AOXA 3T1NA 4JS0A 2EG9A 4R2IA 3HVIA 1ABFA 3D5TA 3TIGA 3RKRA 1AK9A 4EUKA 2IPNA 2XOKD 3QPDA 3ZHUA 1AZTA 3EBOA 2OSBA 4P22A 1W47A 3E53A 3QEJA 5G02A 3WGIA 4TUYA 2H1FA 5DM0A 3DNMA 2ODTX 1Y80A 2H8KA 3COVA 2WHXA 3SYLA 1NWCA 3RUFA 2O3SA 3DE0X 5DIFA 2Z1NA 3CLTD 4IGKA 3R2JA 5LZ7A 4N5HX 2O20A 3A6LA 3OPYA 3H4TA 1TOAA 1ZRMA 2EFCB 1E7RA 1UKZA 3PEWA 4RVHA 1N0WA 2PTGA 4FCTA 3KHKA 3FUCA 4PAWA 2FJ0A 3VR4A 4YAOA 3UTCA 1MTOA 5CDSA 1Z5OA 2FDCA 4DXDA 4RMJA 4F04A 3VPSA 5EWLA 3OE4A 4NC9A 1SXJC 5HVNA 1V9CA 2EP5A 4DA7A 3DOFA 5H81A 4BX9A 2ZG6A 5HJ2A 3X1ZA 3ZDQA 5KU1A 1K98A 2YXEA 3JQAB 2WJ3A 3HRHA 3WMRA 2EV9A 2P69A 4IZIA 1C50A 1EFVB 5DKFA 3RK0A 3RIYA 3UBTA 4QXAA 4ITUA 4CF7A 4OOEA 1WSBA 1YMUA 2GHIA 1PT7A 1RMTA 4X1YA 5JUWA 4RTKA 4RK6A 3TNJA 3KAPA 1V8DA 4MWGA 2XJ9A 5CEEA 2FLKA 2BHRA 2OY0A 3K1ZA 2IK8A 1NYTA 3UAVA 3BHIA 1P6XA 5ECYA 4RDCA 4XGKA 2YNMD 4U5XA 1DRKA 2ATIA 4MVJD 5EIBD 2Y1FA 4R1OA 1OXKB 1RQ2A 4NMWA 4ZHQA 2JFXA 1J39A 1VLJA 4RZUA 1UPXA 4IOKA 5FUMA 2A35A 5AJVB 4O3FA 2HKIA 1ZOIA 2NO4A 3DZCA 3CLHA 3Q15C 4WZ6A 5ETJA 1ZD5A 4OH1A 4E5PA 4LGCA 2ZYIA 3AVQA 1W1WA 2A94A 3ZE9A 1QONA 3K5HA 4OREX 3VYSB 4Z4EA 2WOJA 3NLLA 1KORA 1LPPA 4ANFA 4CQMA 3GLTA 4Z7NB 3PNKA 3MAJA 4YROA 3ZPXA 4AJKA 2C2XA 1LRLA 2FWPA 3ENKA 4C88A 1Q91A 1Y42X 1NM5A 1KKLA 1WX1A 3A1UA 4Y6QA 3W6NA 1SCUB 1L3IA 4CMIA 1GRRA 5T64A 1Z0KA 1A7KA 4OU5A 5JJCA 2RGCA 3GPBA 3BBLA 3SZMA 1YT5A 5DDIP 2IH5A 1I0LA 2O0MA 3X1XA 3KBBA 2TSYB 1I80A 4A03A 1R0KA 3I52A 2R8OA 3B9RA 3Q5GA 3ZTYA 4AY3A 5EIEA 2W6ZA 1BQEA 1W94A 3K9WA 3DH0A 5FTNA 5CK5A 4DT1B 1PJTA 1EFPA 5AK3A 1ODLA 3A1NA 3U0VA 2DPLA 4N0QA 1KY4A 1U7ZA 4PHTA 3MK31 1HGXA 1W7AA 1EEHA 5EXDA 1GFIA 1W9HA 4WA8A 4HOYA 3ZGXA 4I1IA 1SY7A 5IBPA 1QFMA 4YRRA 1R6DA 3DYIA 4N5LA 3FOEC 2X1HA 4KYVA 1G7TA 1IH8A 2QAJA 2QMQA 1UXJA 3EMDA 3KZVA 4BP1A 3MIIA 4W82A 3M5DA 4NZNA 1HE8B 3JYNA 4GKVA 4IXNA 5D5PA 1E62A 1QGED 2I1QA 2IW1A 5AJTA 2GZRA 4ZTBA 4JI1B 2WSLA 1SM4A 2H4ZA 1NT2A 1Z6ZA 4Y6SA 5C37A 1FS5A 5E4JA 2GSWA 3W4KA 2BP7A 1DG1G 1ORVA 3G9UA 2O05A 3OLWA 4NU0A 2QN3A 4CF3A 1SOWA 1XNGA 3MWDA 4H59A 4LHWA 1Z13A 2AE1A 1M2VB 1N77A 3JAMA 2AT1A 1EZ1A 5JJLA 5L4SA 2CKMA 3HCOA 3SS7X 2IODA 2QXUA 4HWGA 3LXXA 3RH0A 1TGVA 3FROA 5IT5A 1M5UA 1YZGA 3F3SA 3VTAA 3C74A 2O3UA 1GDTA 1UF9A 3R5KA 3W8NA 2B83A 1P7WA 4DQDA 2EIXA 3HCNA 3NBQA 1UFOA 4JQSA 3AF3A 2P65A 1ZGJA 1E4EA 2ZJ0A 5BRAA 5DHAA 1RJEA 5G4LA 1Z75A 2JGKA 2OZVA 4J4HA 4RKQA 4G9BA 3L1VA 4PYRA 3T94A 5AW6A 1CETA 2BN4A 2V1UA 3BH7A 2FFQA 1TTHA 5LOVB 3RFCA 5I3CA 1DEXA 2H5LA 2GBLA 5C3MA 2IPLA 1KDTA 2BE7A 3DOJA 3KJZA 1EVLA 2V4UA 3M6LA 1U1FA 1UWCA 2GESA 2H52A 1INLA 2Q2OA 2XNSA 1R66A 1K6JA 3HBAA 4WCFB 3VR6A 3R3YA 4MQMA 1U04A 2O2JA 1QH8A 1UZMA 3G7SA 3H4MA 6REQA 2D54A 2D1SA 4BFXA 1P0QA 2DF8A 2ZLBA 2FFRA 2M32A 2WILA 4RVSA 5CM2Z 4CG3A 4S05A 4I3FA 1C3JA 1N0UA 1Q50A 3PKIA 1E3SA 1EFHA 4KLCA 3L7JA 4MO2A 4OIFA 2QRKA 3RUIA 4BLOA 2ZWVA 3NNDA 1KY5A 4F56A 4X1IB 5EHQA 5LXTB 1CR6A 3SC3A 1GL9B 1DWOA 3S2EA 5LD2C 2O8CA 1MU0A 1G5RA 2GERA 3IP6A 2X14A 2I1WA 3U6KA 1H05A 4B4OA 1QLWA 1JBKA 4UREA 4YONB 4K1LA 4FIDA 5K1ZA 4K8OA 3D4PA 1GPJA 2D2IA 1B2RA 1ZWLA 2WWWA 2HFKA 1JHOA 1ZL2A 1I1OA 2YHIB 4YXWA 2OECA 3IBCA 5FXMA 1Q7CA 5G1PA 4BLPA 1E5TA 4ZHQB 4MW2A 4JNCA 2CK3A 4RS4A 5DTRA 1ZONA 3C4VA 2H9IA 3DONA 4S1NA 5LP6B 2BLLA 5I9LA 4OTZA 3VH1A 4Q18A 3KJIA 2CY0A 3G49A 1USGA 5ALUA 5FPTA 3ZY3A 4BFWA 4L28A 4OI0A 1G9XA 2QVBA 3AI7A 4R7ZA 2CN1A 2IDKA 3SQOA 2R7AA 4FHFA 4B2YA 4QGSA 5CAEA 2WRZA 4B3RB 1W19A 2O8BB 2GWHA 4HLUC 2H5JA 5BMVF 3UWSA 1EUDA 1MQ8B 4I81A 4MKXA 4DR6B 2XHZA 1DQRA 1GTVA 3RRJA 4WN3A 1G5QA 1QAQA 1VJGA 3PFHA 1S2GA 3ID6C 1FW6A 3WL4A 4UFNA 2FRXA 2YRWA 3AB8A 3OOJA 3PXUA 4MQBA 4TQ9A 5LIRA 4MHSA 5KNBA 5FL7D 1N2SA 2BR5A 2DJIA 2IIPA 4WERA 1X92A 2IZOA 4MB6A 3BMNA 4RMGA 3CBQA 5KSZA 1FUEA 1FXUA 3CE9A 3O2QB 1H6CA 2WYOA 4QLOA 3GHHA 1LDNA 2EDCA 4FI3F 1UBUS 3BXHA 3VZSA 5C2JB 5JV5A 2BHLA 1L8QA 3CUSA 3DE3X 2YIMA 4WUVA 5AO9A 3SVTA 1FS4A 1QHXA 2JNWA 2QW8A 3JQAD 4AYWA 1HDZA 4BQPA 1EFPB 3MS4A 3B6JA 3AM5A 4AU1A 4C29A 4EHHA 3EGDB 1BQ3A 1Z6QA 3C7KA 3GAAA 5A7HA 2R6DA 4EB6A 1Z5PA 3EY9A 1H0RA 2FU5C 3JSAA 4PC1A 2QRJA 4YRFA 1XRMA 1D03A 2ZRCA 1GAJA 3A3NA 1ONBA 1QMPA 5E9QA 5EG5A 3WB1A 2BTQB 1EBUA 4FQ8A 4GF5A 5SYAA 4E0BA 3PVSA 2N75A 3CX7A 3TMAA 1W5AA 3NZEA 3IUQA 4PN7A 1RRKA 4KYIB 4LS3A 4MYTA 3TSAA 4R8VA 4ENUA 3P9KA 1VZ3A 2BGGA 1T3HA 3PDWA 4R83A 3C70A 3DBHA 5HZHA 1A3CA 1OI2A 3L6UA 3AEUA 5M2QA 1D2HA 2HQBA 3RK1A 2WKRA 3REGA 3SHFA 3TSCA 4OYRA 1K5PA 4WINA 1M0SA 4MJXA 4QSHA 4O4HB 3TRDA 4YI5A 2XPCA 3B9QA 3BWXA 3R5HA 1RXSA 4TMKA 3LUJA 2ZM6B 4U5QA 1ZICA 3WMXA 4QE3A 4D0SA 1BXKA 1UKEA 1PQWA 2QA5A 4V0KA 3RUAA 4DJFC 5JIBA 2VNAA 5MN6A 1RYDA 3PDHA 5FBVB 1N6HA 1IAVA 3JQCA 4O4JB 3SIPA 3Q5DA 2ZTMA 1NX6A 3OZGA 3VM6A 5C7LO 4L22A 2C2KA 3NRJA 2E3JA 1B6RA 4ND5A 3G8BA 2PS3A 4KWTA 3CNLA 4JMPA 4EUEA 2LCIA 3GRPA 3GLRA 2W6CX 3GCWA 5EJ4A 2X9GA 4D5EA 2IYAA 1O7JA 1FNBA 1QVVA 2XT0A 2NMVA 2Z8XA 4P82A 3PQCA 1WTCA 4N7RA 1X7WA 3OOYA 4EPXA 1GU7A 1E99A 4DHEA 1Q0RA 4MW1A 4B5KA 2HT1A 2DQKA 2Z8ZA 3OOSA 4XGNA 4YFYA 5A3SA 1MW8X 3VQTA 3NONA 1OLXB 2XRMA 3R23A 3F49S 3LSTA 5T4BA 1MQSA 4WDRA 2Z9DA 4ER5A 2XVAA 3BFXA 3SDZA 1OY1A 2YN4A 3WLOA 3OU2A 1ECCA 1KMMA 2ZSKA 1KQNA 5ESRA 1SZCA 3A3OA 5BRJA 1LNQA 1AS3A 1NBOA 1HDCA 1E9CA 3HLTA 4JOCA 3DUWA 4AWBA 2OKCA 1XRJA 2Y68A 3M9LA 1HQKA 1CJUC 3PLRA 3SDSA 5GZ3A 2ZCUA 4KPUB 1Z3CA 3P32A 3DDHA 1Z39A 2P2CA 2I62A 1TMGE 3IMEA 3ZHRA 1NM5C 1Y8QA 3QVKA 3KOOA 1LPNA 2B4KA 4OI4A 4EH1A 4CMBA 3CH4B 4EFNA 1GG8A 3A6JA 1L4LA 5CLGA 3KZOA 1E9RA 1IB6A 2NSLA 5HIJA 1KYWA 4M55A 4O59O 1L5GB 3ORRA 1KPHA 2DBVO 4FFVA 3TSWA 5BR1A 3PYLA 4ZDJA 1V47A 4MX8A 3JPYA 3FRJA 4XQGA 2WVAA 4P54A 1OXTA 4Q03A 5GZ6A 2PKXA 4GH5A 3PHJA 4D4MA 4BQFA 1Z5WA 3N8KA 1AKYA 2GK4A 4H0FA 3P45A 5DSTA 4JGIA 2HPVA 1V6SA 2HQRA 2QTVA 3HP7A 3V3KA 3VPHA 3IILA 5AVXA 1DX9A 2WIDA 3HSYA 4PFQA 3S7TA 2Y66A 1AQIA 2B8NA 1L5SA 1EHYA 1QJ4A 2WYUA 3UO8B 5B36A 3BE8A 4UBIA 3BXEA 4Z9AA 1QQ6A 5BW6B 3CW9A 2LNDA 1VI6A 1EUZA 3KB1A 2D5IA 3ZQ4A 1GRCA 4X7BA 1U0FA 1VE7A 3QVXA 3H6KA 2OD7A 4D6XA 5DMHA 1X1EA 2JI7A 1UOEA 3QHPA 4GPIB 3SXUA 3NS7A 4QU8A 1T8RA 4N9WA 1X9GA 1YDGA 1Z45A 1N9ZA 3MGCA 4U3JB 3RO7A 4BPRA 4K9NA 1PS9A 1RXUA 1C0LA 1H2HA 3BTSA 2WB2A 4EB6B 1UJCA 2IGTA 4QARA 1MJGM 1SBIA 4NOJA 4OJMX 2WZCA 3M5PA 3PEUA 4MV6A 3D8BA 4U2KA 5E6UA 4WL0A 4X85A 2NACA 1N1MA 2BCEA 4LDAA 3S2GA 2BHNA 5HF8A 1QK5A 2I4RA 4FMCF 3FN4A 1LBSA 3LUKA 1G5TA 2ZUSA 4ARZA 4EGSA 2UXCB 2G9RA 4JX9A 4QEDA 2PA0A 1ZNQO 4EA6A 1Z2EA 1BVUA 3I5XA 4ARIA 4OL0A 2WQ7A 2IEBA 1P29A 2HU8A 1COZA 1MPXA 1CY0A 2CJYA 2ISSD 2JEYA 1W5TA 3K0HA 4LXYA 4OD0A 4WV3A 3NP9A 4FHDA 1OXMA 4FZRA 3U1BA 2JLUA 16PKA 2QRVA 2QLBA 4MW5A 5B58T 2RJ3A 1UZNA 1Z6TA 4G97A 3NOQA 4QDZA 5DN6A 4MMYB 2HMSA 4B6EA 1XXHE 4ENPA 4TKMA 2GBLC 1N5OX 4H6VA 3DM5A 1DMSA 3TSYA 2VWQA 5LVAA 2AK2A 1SUEA 5DH9A 5AJXA 2WMOB 2JGRA 4IQ0A 3KRTA 4ITVA 2DWQA 4YPVA 2EFEB 3AHFA 1Y8CA 4EI8A 3SLGA 2YHAA 5DHQA 2Z4SA 2NYRA 1NXTA 1VGQA 2YJGA 4BYMA 2BR3A 4JC4A 1WLYA 3ONNA 1CY4A 3R6LA 3WWCA 5AVQA 1PR1A 2NUTB 4LDNA 4IPTA 4KSCA 4TZKA 2J08A 3RVKA 1GGFA 1NJ1A 2DG2A 2OHFA 3WP0A 2B2CA 5F3WB 2QY6A 5DYYA 3G2IA 5BSKA 1D2EA 4IY1A 2ZRDA 1C7ZA 4YCDA 2JKZA 2JL1A 1P2BA 1O5OA 3QEKA 4ENRA 3THWB 2HUNA 5FTJA 3CR7A 4KDRA 4ZYZA 1I5RA 3QA9A 3BZUA 4AI6A 3RTBA 3FUWA 4LPSA 2V97A 2GBGA 2QUZA 3EWIA 1K5GA 1U0JA 3RW9A 3RS4A 2FMXA 3ESYA 4MV1A 4QOSA 3UJNA 3KKOA 1Q17A 4CKWB 4KN6A 4EHJA 2C31A 5D6OA 4ZIRB 3ABOB 3IDSA 4YLYA 4YCAA 1R3UA 1E2EA 2H57A 3AQ4A 4LXTA 4Q4HA 1Q19A 3DV0A 1Q12A 1JSCA 3U31A 1UBRS 1W36C 4CT4B 4C87A 1RAHA 2VP5A 5E2AA 4NHEA 4MCHA 4OSOA 4BO0A 3PDUA 4PC2A 2ZB8A 3L0PA 1YAHA 3T7DA 3LC7O 3D1LA 2C2GA 1D2GA 1FPMA 3SM9A 5F21A 3UCEA 2R96A 1BXRB 3RVRA 1ZA1A 1DTWB 3OTGA 1XEXB 3DF9A 1LRKA 4FOSA 2HJSA 5HZMA 2HWKA 1XKTA 2JFNA 3CE6A 3O8LA 421PA 2VAPA 4Y98A 3ILYA 4MV3A 3MMXA 1TYCA 2IBMA 2BYTA 3GROA 4IV0A 4JQOA 5DT2A 5IG2A 3RVJA 2H0QA 5LDHA 4P6VF 4UCWA 3B53X 5ELLA 3CV3A 5IFKA 3D2CA 3OZWA 3PL5A 3DS8A 4O29A 2NSYA 4HYTA 4XOUA 3SKXA 1TQ2A 1EUCB 2YXBA 3EXIA 1KYZA 4ZO9A 3IAS6 3WKAA 4XFDA 4EHLA 4URXR 1KMQA 5JYCA 5GAJA 5LA6A 5T6MA 1QIFA 3AIOA 5EMMA 1XDWA 8AT1A 2XOEA 2IH2A 4KLNA 3RS3A 3KCNA 3ENZA 4ZVRA 1THMA 4AZSA 2A57A 2QX7A 3AM1A 2BMFA 5FI3A 1KEWA 3GZTB 3MHTA 2NVWA 3GEIA 4H6WA 1FDOA 4EKEA 2FSSA 2VCEA 4IDQA 3LDUA 1K27A 5EP2A 2YVLA 4G9GA 5GOZA 1ZU5A 2ZEJA 4K88A 4N65A 2BUAA 4AUMA 4LFCB 3R8FA 2VQ6A 3ZNQA 1YZVA 3I3SR 1FOEB 1IN7A 1V11B 3NHMA 3NV7A 1WB4A 2BPOA 1XRPA 4XQ9A 3UAGA 9ABPA 2O19A 1N1DA 1U0RA 1J49A 1M83A 3QQPA 4YMVA 3LYHA 5J5VA 1M1YE 4I55A 5FR1A 4INOA 3T1YB 1XZLA 1ZMTA 2B37A 3BULA 4ALIA 1R0RE 4ARZB 3N1UA 2Z6QA 2GEUA 3TW8A 3H83A 1TI7A 3PXEA 5HE9A 1Q7EA 1SKYE 2R6CA 3QNWA 1A5TA 3E5NA 1N6RA 5AM1A 1DBVO 2QUIA 3Q12A 1BDBA 1PGNA 2ZAOA 4HKTA 3F71A 3TD2A 3W6ZA 4C06A 1GAXA 3KSMA 4MJ3A 2IS6A 2BFFB 1S1CA 5EIWA 1Q77A 4O63O 4AXXA 3QQ5A 5AVYA 4N03A 4BFYA 4ED9A 2YYZA 4DKJA 2ADOA 4G5GA 3URKA 1GPNA 2AL7A 2PTHA 4DA9A 2WWYA 2X4GA 1GL3A 1KPIA 2WM8A 3AP2A 3P2YA 4DOMA 4EY6A 3IPAA 1MVLA 3TG8A 5B1DA 1UEXC 1YZFA 2Z56A 2RDMA 3D8NA 3CUWA 3PTZA 4E5NA 1HMYA 4F1KA 1BJKA 1F60A 1KSFX 2H51A 3HQ4O 3JATB 4GNKA 2V7QD 4O1IA 4YECA 3WTCA 2PR7A 4YMTA 5DNWA 2B7CA 4HZUB 3WLRA 1X8LA 2CE2X 4K3VA 2H65A 2YW2A 3IP7A 4CLDA 3CVWA 5LPNA 4IAOA 4RIFA 5E6SB 4CIBA 3B85A 3DVLA 1Z4MA 3X2SA 3AKZA 3H84A 1NW5A 2R5FA 3T34A 1GTL1 1JHVA 4IKEA 1P2VA 1X38A 1NQOA 1XJQA 1R88A 1ZM3A 1AV7A 3D6JA 2ZR7A 3OC0A 4H7KA 3KAKA 1QG6A 1PSDA 4JZKA 4MUXA 3V1MA 4DLVA 4YPOA 1T9KA 2HK8A 5LDDC 1Z0SA 3N2LA 2X8AA 3MUOA 1KEZA 5JT1A 2XUPA 1BZYA 1KNXA 1P73A 2BKXA 2HMTA 1I7LA 1H5QA 3CB4A 2GTIA 1EXWA 2QU7A 4JR0A 2GCOB 3L0CA 4KX5A 4MRNA 4MICA 4NNJA 1I13A 2WKPA 1U02A 4ZT7A 1JQKA 4LAFA 3QEAZ 4FGZA 3KT8A 2J4FA 1AK1A 2R8XA 4LDRA 5J5AA 4ZA2A 3SPXA 2CSUA 5JOQA 1UUFA 2LBPA 2Z2KA 5EQJB 4B75A 1FP7A 1G2OA 3SBDA 5CCBA 2VS1A 1L7QA 2W8BA 1MUUA 3BHMA 3O5AA 1UEIA 1E6UA 3V8PA 3IDFA 1VMIA 3ONFA 1KF0A 2KBFA 1DB3A 2Q4RA 1UMDB 3K6SB 4D9EA 3LLMA 2XVXA 3D6NB 5IASA 2PANA 1RP1A 1RYZA 2WFZA 4BMVA 5IYZB 1JGTA 1MGPA 3USZA 4F2DA 2PZJA 3QU5A 2K5UA 4PYKA 1R6VA 4MVJE 3ROTA 2QMHA 3W8EA 2WAMA 1GN8A 1OGIA 4L5JA 3NVKI 4DIUA 2FKAA 3ZLVA 1IM5A 5CA1F 2JFWA 1W44A 2XIJA 3DDZX 3EBPA 3EPPA 3GLSA 4TGLA 5ECWA 2F9LA 4N3GA 2WVGA 3CUKA 4EL5A 3SSOA 4B4DA 2DETA 4EO9A 3PB3A 4I0WB 2YV2A 2A1TR 2VNKA 1PAUA 1GVNB 4L16A 2CYAA 2XKAA 1H42A 1KYVA 3KQUA 4Z4QA 2J85A 1GUZA 2PWZA 2WHRA 1QQ5A 2LZ0A 4BE7B 2Q5LA 4NCAA 1MVOA 1XEWY 3LT5A 1OKKD 1PYDA 3M82A 4X8HA 1DV1A 1GPLA 4B80A 4B6GA 1CQIA 2B98A 4RORA 4XXHA 2ILTA 4HTFB 4U9UA 1NBWB 3BXFA 5LA6B 2I6UA 3NXSA 2O0JA 1KQOA 3SYKA 2XDQA 1KO1A 4D4LA 2X0KA 5JC1A 4Y2HA 3ZCSA 4IMPA 1N6NA 4GBJA 4OYHA 2NYUA 2Z3VA 3VYTB 5L3ZA 5D6NA 5DHSA 2V1XA 3RIMA 4YRGA 1U3TA 3CPEA 4RD1A 1JQAA 3CCCA 1QZTA 5DHFA 2HX1A 1A50B 5FV7A 2D5CA 6LDHA 1SU6A 3EFOB 2BDUA 2XADA 4PYLA 2CLEB 2VTBB 5CDFE 4GS5A 1UK6A 4KNWA 3ROPA 3HABA 3PRYA 4B83A 1JG7A 4EKDA 2PGLA 1FXWF 1PFKA 1NW8A 2UV8A 1SB8A 4O02B 4UUBA 3AV0B 3KOXA 1JYSA 4QFCA 4V1CA 4KJZA 1SKMA 5IAOA 2VDWA 1U4NA 3R7SA 1TIPA 5JPCA 4LDZA 3UGKA 3MZ0A 1M2OA 3DPUA 2FGJA 2WB4A 4HUQA 1N1EA 1X80A 1C14A 4RHCA 5K8UA 1GUFA 5L3RA 1ZZGA 1XRLA 3ZGNA 2AXQA 5B6JA 2XZLA 1U1EA 1HK7A 2JD0A 4AZTA 3L04A 4HX9A 3PXDA 2O8VA 4GR5A 2G7ZA 4UCXA 4KRFA 4UMEA 1EP2B 1YU6A 5E7MA 1YS6A 4ZJPA 3EZXA 3A06A 4HZIA 1QYWA 1P61B 3IOYA 1BYUA 3RSQA 4M1OA 3UH1A 1LB1B 3GIDA 5IKMA 5CB0A 2WZBA 1NZFA 4CKEA 1KK3A 1IXRC 1UPCA 1VSUA 2AHRA 2RGEA 4Q00A 4BMOB 4Z7OB 1PNTA 3LWBA 4BZXA 4Z7JA 5THQA 1OGJA 1EA5A 1TM1E 1Z7EA 2JIQA 4MS3B 3UAZA 4DBLE 1PQUA 4PSVA 1T26A 3WAJA 4LQLA 1RQXA 3OQPA 4CEIA 5CURA 5IJXA 4LJAA 4OVKA 3MRTA 4UAJA 1KC1A 1E58A 1YBMA 2Q3DA 4I50F 4IUBS 2OM6A 4P3KA 4UEQA 1UKCA 2WJVA 2FG5A 5FORA 1I1HA 1ZKMA 4R01A 4YGYA 4JFAA 3UJBA 3I37X 3FGNA 2RC6A 4M0KA 4D41A 4EELA 3V2UA 4HWKA 1QGDA 3LQFA 3M33A 4Y9UA 2OCPA 3DTVB 1XPJA 3DHEA 1DHRA 2VWPA 5BOVA 1O94C 2YWEA 4D8WA 2BRUA 3K73O 4MCAA 1U3WA 2JGDB 4JJIA 4A36A 3TZEA 8ATCA 5KYVA 3UK2A 3EXHA 4L1KA 4MQ4A 1TL7C 2P3LA 4IDCA 2J07A 2Q1SA 4NDAA 2CV0A 3D6MA 3TLCA 4QDJA 3QE2A 3QX8A 1GT6A 3ZVKA 1C1XB 1N2CB 2FH5B 3F96A 5FEMA 5HYVA 4FFWA 2QL6A 4LF5B 1MP0A 5CHYA 1K3TA 3B7GA 3DVAA 4J4TA 3WB9A 1P0MA 3B70A 1AS2A 4YV0A 5BNTA 4AMYA 2ZIZA 2IL1A 2A88A 4E6EA 1FP6A 2L19A 1G2PA 4KDCA 3RTDA 2C3YA 2D59A 2WDZA 3CJRA 3O8CA 5DX8A 1V7QA 1R4AA 4DUYB 2H4JA 1XXHA 1R16A 2BDTA 1OASA 2NZJA 2ZAMA 3I23A 3V97A 2WWXA 2O1WA 3ZCPA 3IJRA 1YZKA 5K5EA 3ZV6A 5KNDH 1PUIA 2JZOA 2V3VA 4NS4A 3VO9A 3NAMA 1X87A 2Q5FA 2I67A 1H65A 2WKSA 5K2MA 2FPPB 2RHOA 3VU0A 2WUFA 3FOCA 4MTCA 2QL5A 4ESOA 1PWHA 3C3BA 4D9JA 4N5MA 3RWMB 1KI7A 4R51A 4NFYA 3BAFA 3ZE2B 4M8KA 2CJPA 2QNIA 4JJKA 4M1EA 3UW1A 4X8OA 4DG5A 1X1AA 1ZK3A 4C22A 3BA6A 1A5BB 3FYHA 1P4AA 5EP3A 2C99A 3WGVA 5JXWA 1J8MF 1M6VA 3DAGA 4BVHA 4J90A 2GHQA 2VNIA 3DZKA 2A9KA 4EYGA 4GO1A 3R9XB 6Q21A 3BQMB 2QTBA 3GUZA 3A3YA 4MEBA 2JI8A 1KS9A 1RQNA 1S1MA 2E18A 2ZZNA 5F5XA 2A1UB 2X2EA 1FJGB 3DPIA 4R2JA 4B8ZA 4YUVA 5FWXA 3DUFA 4DCGA 2JFFA 1NXSA 5BUZA 2R3SA 1DIOB 1IZYA 1EG2A 1U4OA 2ID9A 2LGJA 4C4TA 5K0SA 1E9AA 4FZ3A 3QVTA 2X7JA 1WAMA 2NW6A 2X7XA 3QELA 5ERYA 5KAPA 5KKNB 4FTWA 2E55A 1QCZA 4P4NA 4MWTA 1D1PA 2H7CA 3BWDD 4PZUA 4YRDA 5FQNA 2W83A 4EG8A 1LZLA 3EGCA 4P33A 1X74A 2DECA 3K0EA 3LDFA 3QOWA 5JG7A 4A1OA 3FTNA 1K8YB 2W0SA 3DDCA 3HEAA 3V1UA 2IZ6A 3PPYA 4R68A 4EEKA 6YASA 3OO1A 2Z83A 3HU2A 2YX1A 2JFPA 5U1PA 3IV7A 4ATNA 2X5OA 5HQ3A 1VBMA 5BWOA 4ETWA 3WJAA 1JALA 2Z2ZA 8OHMA 2C1EA 4FZJA 1FP1D 4XYEA 1FZQA 4OEHA 3EFHA 1G7RA 2F62A 4GLBA 4I2VA 1M2OB 2PO5A 1D4OA 1RCUA 1N75A 5E7JA 4HEA1 4HR7A 4NESA 1XVTA 3DMYA 3KJHA 3KQQA 4TQGA 4AUNA 1T3ZA 5C1OA 3WLSA 1K5HA 1GM5A 4IIJB 4ALLA 1B6SA 2BGTA 3PT5A 1NQ5A 4QGGA 1C9EA 3ZWKA 5K0BA 3LC2O 4TLBA 1ADYA 1L2TA 1T35A 4UE3S 2DVMA 1XMOB 3U44B 3A2LA 3COJA 5AOBA 4OXNA 1TU0A 3VH3A 3I2YX 1KOGA 5F5LA 3I6MA 3TVTA 4JDPA 1UBEA 1GZUA 3B1XA 3OO0A 4N40A 3VNUA 2HRDA 4QO7A 3WGOA 5KSWB 4DYVA 5EJIA 5F78A 2ZXUA 5AK5A 2PSHA 5GVSA 3PGLA 1B74A 1YB4A 2P1DA 4KBFA 2H31A 3SZ3A 3I61A 3UUGA 2WLTA 3FHCB 1KETA 1GYRA 1E5VA 1TIKA 2Q07A 2Z43A 2HNKA 3GCXA 4CHGA 1XD2B 4MIKA 3IAFA 5TRTA 2J67A 1F14A 3I1IA 3VOTA 2XCLA 3TTWA 2V9ZA 1TDJA 1F2DA 3JYLA 1GTJ1 3UT5A 2QN8A 1I3MA 1S3SA 3K0FB 3CY6A 3EXHB 1DAEA 1T1RA 1K6MA 2ZXEA 4LZOA 3CF2A 4FHGA 4KP7A 3PGA1 3PUWA 1V26A 4V02A 2YJ5A 3TLEA 1Z28A 2HLDD 4LZZA 5ALMA 4C21A 1Y89A 3FKSA 3GDHA 3N07A 2RJOA 2SHKA 2OZLA 1UMBB 2FZWA 2A0XA 3K7EA 1DPFA 4DRXA 2EX0A 2GPWA 3KJGA 2J9XB 5JSYA 2WSMA 3GZNA 4IOMA 1V8BA 1Y4DE 1W4ZA 3G5AA 4ND8B 4NL4H 5C5EA 1I1NA 5GM1A 2Q5OA 4KFTA 2WYVA 1CX9B 1DWQA 4MQFA 4WW0A 4X9XA 4EYSA 3CHYA 3QPCA 5GMOA 3B1YA 1UC8A 1NE2A 3UOWA 4O4IB 1P31A 1W0JD 3IUNA 4ZVSA 4WACA 3NJ4A 2HM7A 1AXGA 3TPCA 2A1TS 1I24A 1JIIA 3KZKA 3HCCA 2AFHE 1Z82A 3HFGA 2P9BA 1CRQA 3KKQA 4TROA 4TL8A 1U2TA 4J8PA 4ZQCB 1CQPA 4F92B 5EJAA 1F5SA 3GFRA 2JK1A 3OQVA 3OY7A 2A4KA 3V32A 1IBKB 4ZAXA 1IOZA 3Q40A 2WHEA 1K7CA 1KVUA 1EFUA 5GM2A 5HDQA 5HUJA 1YKFA 3TUZC 1PVDA 3VKHA 4XWAA 4ZJUA 2FMTA 2SCUA 3DTVD 3ENVA 3D8HA 3GGSA 4GFDA 5CX1A 3VDQA 5CB6A 4LRWA 3EVDA 4M0MA 5M04A 4KYTA 2PA3A 2GN9A 3D6FA 1U7XA 2MOKA 2CXSA 1T9AA 2H2HA 3IT3A 4LHEA 5CT6A 4AN0A 3NGLA 4YRAA 3QP9A 4UBMA 1K7FB 1DAMA 3EIXA 3NTXA 5BMVA 4G1MB 1EVQA 2IUTA 5IH7A 3I9NA 2X0RA 3MAGA 3IVCA 2APJA 4J1TA 4ZPJA 1JN0A 2PLNA 3VUEA 3W5AA 1U5CA 1KH1A 3FSGD 1JKIA 4HEQA 1C7IA 1OB2A 5M5BA 4KQKA 1S01A 3FNGA 2VSFA 4ZQEA 1DX6A 2IXGA 3JTEA 2VZLA 4QU9A 4DJTA 1E2MA 3LCMA 1UIRA 3CW2A 5EINA 1E7YA 1FMFA 3C85A 2PS1A 4O33A 3QX3A 3CMMA 3C1OA 1NUAA 4Q3CA 4BVFA 4CKBA 2H1IA 4DRZA 2FEWB 1W96A 3VX3A 2I2CA 4IF6A 4XE5A 3WBKA 4W1SA 1T9DA 2M6RA 3R40A 3KL2A 1ENZA 1FFXA 2NUPA 1O4VA 1CEYA 3EZLA 4X90A 7AT1A 3UAOA 4DLSA 4RULA 3GPLA 3KYBA 4OLHA 1T6YA 2V7XA 3DP9A 4ODIA 1E1RA 3OAAD 4PNPA 2MSNA 2A4MA 3BSYA 2Z09A 3TQCA 3WIOA 4Q39A 5IT4A 2ZE7A 4I1YA 4J29A 2ZVJA 4J7UA 4JITA 1Y8AA 3A2MA 1NT4A 5JFTA 4D25A 5I7SA 3ETLA 4EFLA 1Q11A 4RELA 2BRUC 3GRVA 1W46A 4Z9FA 5K3CA 4DQVA 4ZYTA 1WCIA 2PJDA 4W7SA 1F8YA 3VBCA 5D87A 1P9RA 3OIYA 4AO7A 1YU9A 1TA4A 1WCYA 4R6WA 2Q1YA 3ZBTA 1CWUA 3VPDA 2G1KA 2QUHA 3AC0A 3OHPA 3Q8XB 4WZAB 5FL3A 1X7XB 1Q57A 5TGZA 3SC2B 4CIYA 1IY0A 3DMPA 1T5OA 4DKXA 5CDFA 2CZGA 1BFUA 2Y9MB 5JH7B 5IAGA 3LUGA 4RDHA 1SRRA 3ZHVA 2NO9A 2W2KB 4BVKA 1GNSA 4DRYA 1DBQA 4EO7A 3QMMA 4UTVA 2F9MA 2Q21A 4YLEA 3TUIC 1FDWA 2ZJ5A 3CSDA 1X19A 4QTTB 5IN4A 4TVOA 3JYOA 2FOXA 4RWZA 3QE0A 4IGFA 5G41A 2X8WA 3C3YA 4ZU6X 5BOSA 4JELA 4OHKA 4MUAA 4US0R 4LX8A 4OXRA 3WKBA 4ZGGA 3TL2A 4WKNA 3CINA 2RHJA 2BEWB 2C77A 4IIFA 2MU1A 1ZJYA 3B2NA 1ZBQA 3I8SA 1TUIA 4NK5A 4E1VA 1RHQA 4MITA 5ALGA 2P6UA 5JR3A 3AUUA 5ES3A 5CDGA 1WB6A 3H2SA 4JB0A 1BW9A 1PLJA 3H99A 4WOPA 2YXPX 5E4TA 2EARA 3L7NA 3TJRA 3T1VA 1TU4A 5JFOA 4JJ6A 2PYDA 2OCIA 3WHLA 3D9QX 4M1KA 1S2NA 4ROSA 3LLCA 3STHA 1NBEA 2A59A 1XYYA 2FJUA 3HWX1 4BX0A 1SPXA 5F1KA 2WV7A 3WOHA 1L5HA 4RZXA 3E7WA 3I34X 3ZCUA 4Y8VA 1JI3A 1PVVA 3QW4B 2C97A 4PF1A 4IO0A 3M5WA 4I6JA 3KPYA 4DSAA 3GJTA 5LP1A 3SWWA 2Q2VA 2AYYA 2VZEA 4GRAA 2A9FA 1Z4QA 3W1EA 4ZK6A 1PG2A 1ZNXA 1RPTA 2Z6VA 3QVGB 3V55A 3C6KA 2XGGA 3C3JA 3D31A 3AGQA 1HDEA 2P6NA 1WDTA 1WW8A 3JQFA 3K9GA 4GX0A 3RABA 3RFFA 4W8OA 4EFKA 3S99A 1SPBS 2RARA 4RAQA 1PJSA 3B6EA 4IX9A 1JVSA 4S2EA 1YB2A 4DIDA 3PDCA 4M98A 2NNWB 5DM70 1J6UA 2W2TA 1VRCA 3OEHD 5CX1B 1CZLA 4ZZ0A 2W4MA 4X63A 4ARUA 5KQSA 2ZB7A 3AHEA 4LA4A 1P7YA 2JRLA 2XV1A 3W05A 4YQYA 3TEJA 1TZKA 5B1EA 1RKQA 1M5TA 2R1TA 3GEHA 3HJNA 1JHAA 4WKPA 3A6DA 4QJ4A 5TGDA 4ZCMA 3KT0A 1E7SA 1LPSA 3PSHA 3HPQA 3W2FA 2VJNA 3H2BA 2BW0A 5FUXA 4QM7A 1XFAA 3Q9LA 5D3ZA 4CL3A 1M72A 2WT4A 3EYWA 4FCWA 4QJBA 4QUEA 5FBLB 1R2QA 2EEPA 5AESA 3KVYA 4D4IA 1M6WA 1NDUA 5CH8A 2OBLA 5DOVA 4AY6A 1H9CA 1LA2A 2CL6X 2EZ4A 2O23A 4QGHA 3TEMA 4OI2A 4A8TA 1I2DA 5AI5A 3TTTA 3SIWA 1T5LA 2JLCA 1OBVA 2GN4A 4LJ5A 5AI6A 2F8SA 4QEZA 1F06A 1FFXB 1BMFD 3SBXA 3CKLA 4AF8A 3AR5A 3KLBA 2H29A 1G21A 2FGKA 2YFQA 4QHYA 3NMUF 5CXXA 1XEAA 1ZHHA 2W98A 2WIBA 3DMGA 1V6CA 3GJ0A 4C5AA 3H9QA 2ZRJA 3O90A 1T6XA 4HDNB 1GPWB 2TYSB 5B1IA 4XSHA 3WGHA 3I9FA 1DQZA 3BN3A 1BEEA 4FYXA 4TWJA 3UHAA 3GR6A 4GD3Q 2REOA 4RNCA 4QQFA 4YY3B 3GJ8A 2D6FA 2IHYA 4NBTA 5TJ9A 3KZXA 4JI5B 4UUOA 2WF8A 1BN7A 1FS6A 2IOFA 5EPEA 3V6MA 3U4MA 4C5BA 2GAFA 3BSFA 1WOYA 3EGVA 4JLOA 4EENA 1MQ9A 4A2QA 1HV8A 2I6SA 1E0KA 2FK8A 3T3HA 3SLKA 3UK1A 1C2YA 1QF7A 3C8UA 3PSAA 1RAEA 4MAFA 2GT1A 4D79A 5IT0A 3UB3A 3EX7C 3BTVA 1NSYA 1IXZA 4U7WA 2FWNA 3QUQA 4LHXA 3UGTA 3DVQX 4ZV9A 1BFDA 3R8CA 1SUPA 5JCPA 2QIPA 2JZCA 4RF4A 4N48A 2FNAA 4C05A 1ZD2P 4B3JA 1GGMA 3VKFA 1MPTA 3MGKA 5DXJA 4J0IA 3AILA 1WQ3A 4CBVA 3FNQA 4MVWA 5MGNA 1E63A 3WZ2A 4CE6A 3DBVO 1DAFA 1BHQ1 2HK6A 3U3DA 1XZGA 3VC7A 5E8RA 1H2XA 2A58A 1U0TA 2GZ1A 2QRNA 3VR2D 4BLWA 5AM3A 2W70A 4EJ6A 4OV6B 3VFDA 1LDBA 1N4DA 3TOZA 1R8JA 2J30A 3KEMA 1MOSA 4IJUA 4MTLA 5JBNA 1SMKA 2ORED 3FWNA 1MN6A 1XZCA 4LVNA 4R3WA 5DWQA 4E2YA 4H3SA 4G36A 2G67A 4JT9A 2C9DA 2YRFA 4UBOA 3IAS1 2Q5CA 5J40A 4MQEA 3K9CA 3RBXA 1XZPA 1ARZA 1HT3A 1WNTA 2CDNA 1ICEA 3M3PA 3TE7A 4DUPA 3I53A 1A5SB 5ABPA 1OJLA 1L5HB 2NPOA 5TQ0A 2F3QA 2W5UA 4NOMA 4RUKA 4MR8A 3WVNA 4DCVA 4EUNA 1DCTA 4TMZA 1LF5A 1NAIA 3DXFA 5L40A 1WMAA 4C0AC 3G82C 4TZTA 4LI3X 5CM8B 2KX7A 3G5LA 3N2KB 3C3WA 3W06A 2A2ZA 5DVZA 4HDRA 4D0GA 4ZICA 3DZFA 4FDAA 1EA7A 4J1TC 2JGIA 3EN0A 1YS2X 2GFIA 4RIIA 1BO6A 3LCUA 1Z74A 4WY8A 1XHFA 4XWWA 1ZEJA 2EQBA 3THXB 1QQAA 1MX5A 1RZRD 4MV0A 5E4FA 2Y05A 2C9YA 4PTZA 4GOXA 4X91A 3C6XA 1AHIA 4TXJA 1CUVA 3IKLA 4FI3C 2DY1A 3O1IC 1H4SA 1FVFA 2WSYB 1JU4A 1VGRA 5EIBC 1NUQA 1ZL0A 2ZJOA 3H4VA 1PZEA 3VR0A 3BICA 3L1HA 5TV2A 4PNZA 3BX1A 3E0XA 2O2ZA 4Z5XA 5I7EA 1N7JA 2Q62A 3E9ZA 3HBNA 4R1TA 4GKAA 2Q7XA 4LWPA 1O8BA 1J22A 1MAUA 1MORA 2FXVA 3VSEA 5DBFA 4D3SA 3CKMA 1QK3A 3IRVA 5AW8A 1EUYA 2ZJYA 3ZWQA 4K86A 2ABWA 3AFOA 3STTA 2EERA 3GFTA 1T6BY 1RMYA 2HV8A 3IX7A 4GMHA 4R41A 1NULA 3PJFA 4PXSA 4XIFA 3SZGA 1D2AA 3DVSX 1XZBA 4R9SA 3WIBA 1HG1A 4NECA 3K6RA 4HV4A 2O8FA 3GJXC 1ZWKA 3OD5A 4G25A 3ZIAA 5AVJA 2AFHA 2JGAA 3AETA 3FB1A 3UG6A 3JD4A 3SJUA 2FPIA 1K3FA 1P5FA 2H9AA 4KGZA 1PL0A 4XGRA 1NN5A 3A6FA 2OAEA 3QW2A 3E03A 3K53A 3T1OA 1W5BA 4P3OA 2A5YB 1N3BA 2Q3MA 2L69A 2ROQA 3P27A 2FG6C 4DNOA 3GRKA 3OFVA 3U2QA 1ZVJA 1KJQA 2CNKA 1ODCA 2VIIA 3CIOA 3UHOA 4C4XA 1S3GA 1TM2A 4BATA 4CDNA 2O57A 3AO0B 2OV4A 1U7DA 3DFZA 2C57A 2J5QA 3OWOA 3DCIA 4TS1A 1EBBA 1NPYA 1KEEB 2J7PD 5FNZA 2OILA 3HMKA 3AU9A 3KS9A 4CM7A 4YAKA 1W1UA 3H0EA 3B9BA 1ZC3A 4FSDA 1LVHA 4N6GA 4AO6A 1NQTA 1YZLA 3ROXA 1RMQA 1FNCA 3AR3A 3EVFA 4JY7A 2IPAB 2L42A 1RC8A 1YQXA 2PX3A 2XWSA 5TR9A 1ZRNA 3BQ9A 6GPBA 1IN4A 2D0PB 3VO8A 4DCCA 3HFRA 5CCEA 2D2VA 2ODWA 1CZRA 1PJLA 2HBYA 2PS0A 2XUFA 5HW0A 1C3VA 3BJEA 3SYNA 3QV1A 1GTSA 2BMWA 5I4KA 4DCPA 1ZK2A 4XRGA 3DL2A 3B3AA 3NBMA 1SUDA 4LSZA 1NQUA 2O6LA 2JJ2A 2KE5A 3L1KA 3B1VA 3MC1A 4J0FA 4JJGA 3TRKA 3DDUA 4MI9A 3WGYA 3H0KA 1H9AA 2DWCA 4COOA 1OQAA 1HRDA 4A92A 2C7RA 1U3UA 3EF3A 1JV2B 1J2YA 2ARKA 4NATA 3ETHA 4KO3S 3VPXA 4D99A 4YAEA 3BERA 3LYLA 5I8ZA 5AH0A 2QZ9A 4OHWA 4RJTA 5HFNA 4M86A 1GILA 1X8KA 2IXBA 3WJ7A 4ADSG 2D4HA 2VVTA 4PAGA 1CSEE 2JB9A 2IITA 4LRXA 2L2QA 5HFAA 2QS9A 3VDXA 3VYVA 1DBRA 2XNDA 4GI3A 4LHSA 4P4GA 1U98A 2H4WA 3AP3A 3N0WA 3SR3A 1XZQA 2WMNB 2QQGA 4GGPA 5K99A 2RIPA 3L7LA 1EHIA 3KL4A 3OLXA 2VDLB 4RL4A 2JCVA 3IR6A 1TK3A 3G89A 4JJEA 4ID3A 4YJ2B 3JQFC 3QBTA 1IBCA 3BCHA 3GJQA 2AH5A 2VHVA 1ZI8A 3M6VA 3O75A 4HG2A 2H17A 4LGMA 4UXIA 1Z07A 1NN3A 1L8LA 2JF0A 1AGYA 4EARA 2K7FA 3P9YA 3AHHA 4II3A 4E5VA 1ABEA 4B8YA 2RHDA 2CVOA 1QH1B 4JEIA 4EX6A 4Z9XA 3FM9A 1AIPA 4XASA 4R0VA 1D04A 2WF5A 3TQIA 4DIKA 1CZOA 4RO0A 1QS0B 4FCCA 4EHAA 3P9NA 2DSNA 1Z0ZA 3PXAA 2I3ZA 2HA4A 1DJQA 3GFSA 4DNFA 4WSOA 5L3SA 2PUWA 3EOBI 4IQGA 2PL1A 3I9V6 4PAMA 3CX3A 1YFJA 4KSYA 1YSCA 4HDRB 3PJDA 5BV7A 4Q0MA 2G1UA 4LI0A 4W1PA 4F2WA 5KNLA 2JLQA 3QWAA 1YA4A 2D74A 2VTEA 1G98A 1CJKC 3C8MA 3OLZA 4PCLA 3W5UA 4JU8A 3ZDYB 4PN3A 5CA1A 1G0NA 1GPH1 2Q6LA 4IWXA 4F5ZA 4G0VA 8ADHA 3BMOB 3QVMA 4KQWA 1LVUA 1EDDA 3V4VB 1TF5A 2HREA 3A4TA 2O8DB 3RV3A 2FZEA 5U4XA 5BSTA 3KELA 1T8PA 2IYWA 1HEIA 3MJVA 4MS1A 4H7DA 2MSCB 4J4BA 5ALNA 2OUIA 1KE1A 1IG3A 4OQMA 3V2IA 1IVNA 4K0KB 1UEJA 2PM8A 4OFXA 3WLAA 3H5TA 2BH9A 1K8RA 4HF7A 1ZJWA 1BGWA 3OFND 4MYRA 5LLSA 3OSZA 4J03A 1GA1A 1QZXA 5EUQB 4I8IA 5CEJA 4JEHA 4GSLA 4UTZA 4KRYA 3IBFA 4AMUA 5KMGA 1B26A 3TB4A 2NT3A 2V59A 4TV9B 1CDEA 2WNSA 4AG5A 1AMUA 1HY3A 1DKPA 1CYEA 2CLKB 2WJ6A 3A7DA 4J0JA 5PGMA 3I6ZA 4C2BA 2O8FB 3JQ8A 4QREA 3OBIA 4LCEA 4DQLA 3O8BA 4X6UA 1WM1A 1TO1E 1JB9A 2XF8A 1Y1RA 3QNUA 5FPYA 3FVWA 3RC3A 3ZZ0A 5GY7A 3FBTA 4Q12A 2DFKB 2P5YA 3BAZA 3A6GA 4TQAA 2IHTA 2IVFA 3CPJB 3QOFA 4H35A 4OLFA 4Y3UA 2GO7A 1Z88A 3QM1A 3RREA 3C5WP 4KQHA 3W8DA 4AMGA 1D1TA 1NF2A 1N8KA 2QPLA 2QORA 3GFFA 3U7EB 3O84A 4RPIA 1ETHA 2VRWA 2P3OA 3WI7A 5KYWB 4M37A 2TMKA 1NASA 1M8PA 1QVWA 1SVUA 2FFHA 1JEOA 1T43A 3OTWA 1XAIA 1FNSA 1JHQA 3C0KA 1Q0ZA 4HX5A 4JOQA 4RQTA 5JMPA 5FFNA 4GPZA 4QNMA 2OCLA 4WADA 2WICA 5JTUA 1X1RA 3RSCA 2VZ8A 3PE4A 4GL4A 5IUKC 3LSYA 2HIAA 1IU9A 5G1NA 2DWUA 1YMVA 3AJ9A 4GIBA 3F3KA 2XRZA 1N4AA 3PXCX 3M1IA 3MCWA 3PV0A 2X9LA 3DEFA 4J3FA 4PM4A 2G71A 2VUIB 1CZHA 3PG5A 4G8JA 4KX3A 4B84A 4D6PA 5JAUA 1GU0A 1Q1ZA 3NWBA 4JB8A 2F1OA 1BTOA 5BUSA 2ATXA 5JRJA 4WIAA 1UAAA 3H8WA 2Z6UA 2C8LA 4HQLA 1SVMA 3ZHQA 1SC1A 2F00A 2FPGA 4DMLA 3JQPA 4RH3A 1OFVA 1HC7A 4I50A 3A1CA 1SZPA 2PVPA 3RAFC 4UJ5A 4AS3A 4IVQA 3VPBA 1VG9B 5B55A 2OP0A 2R44A 1YVDA 2MYNA 2D3TA 1YH3A 3N3AC 1TCAA 2RHMA 3DP7A 2HNAA 2RK3A 1TT5B 2X13A 5DNUA 1FUIA 2WU4A 3ZYZA 3KEQA 3ZS8A 3QE3A 4TT3A 3IC5A 2BFAA 2OV2A 1VB3A 4X54A 2HFJA 1IATA 4IDNA 5TQJA 3MFYA 1N2OA 2XZPA 1P2FA 5AM4A 4BUZA 3G0HA 4RH0A 4B3IA 5KWIA 4CFYA 3GP8A 3J81A 2EW2A 2JATA 2UYOA 4DTCA 2XX3A 3EISA 1ZJ6A 3WYAA 2EBFX 3F7TA 2ZUVA 4PSKA 1TPYA 3TO5A 3U61B 4ZI7F 3RC8A 3TLBA 3LX6A 3T12A 1IJBA 1PTJC 2ZJ2A 3DTTA 5THXA 1JDBC 1KP3A 1TM4E 4DNXA 1GZ6A 4MKGA 4L02A 1WETA 1DC8A 3AONB 3GQBB 4XIJA 1ZIPA 4JCCA 3ZZNA 1EFKA 4RF2A 5DISB 1S8FA 4BKPA 1DTEA 3X1YA 3PHIA 4OF4A 4YDQA 1Y8ZA 1ISRA 3JYPA 5C0OE 1WU7A 4FNGA 2VK2A 3LM8A 4M49A 3FGOA 5JXJA 4B3GA 4PGFA 3IP1A 2VO1A 3U39A 4OH7A 4MRPA 2YFKA 5HMLA 2CNNA 4UHEA 3KKNA 3IDOA 1DKQA 3VSCA 1NYQA 4EI9A 1E3WB 4LOKA 1FSPA 1IQUA 2XZTA 4D0RA 2FN4A 5A3RA 1RWMA 1JU9A 4BNGA 4F6LA 5JW6A 5M29A 2I3AA 2H3EA 1BMDA 1YOBA 3S1AA 2NXNA 3SF8B 3E9MA 4AIIA 3KQKA 4KQXA 2W9XA 3FWKA 3CUTA 3EDRA 4UM8B 2RBEA 3V2GA 3PA6A 1TUBB 3F6RA 3ZV4A 2XEXA 4NTZA 5K2OA 1Z5GA 2I4IA 4R1QA 5LZ9A 4MV5A 5CIWA 1Y5RA 2ZBVA 1C1HA 3EVBA 2WHYA 1T5TA 1ZN7A 5L8VA 3RUCA 1QHYA 2QMEA 1U9ZA 1D4FA 3OM0A 3OMWA 1G63A 2C88A 4L27A 5B2FA 1M2NA 3OM9A 2Q0QA 5CNMA 4YRCA 2R6JA 1UMCB 3WLKX 1G4AE 4CIXA 4DIOA 3PFCA 4FOTA 1NJGA 1RWQA 2WUVA 4BO6A 3EA4A 3EWAA 1V39A 4WVFA 4L8VA 4UTPA 1MD9A 4ZC1A 1XTIA 2X22A 5TC4A 2HNBA 4QBKA 4EVRA 2UDPA 2CXPA 3A27A 4KCGA 2I22A 3F5QA 5AHXA 4FEYA 5AXBA 1VJCA 1M0EA 2Q3HA 3A36A 3VSDA 3LTNC 3RHZA 1WXDA 4GYKA 1GZ4A 4JLWA 2VRNA 5CCXA 1VJRA 2X9QA 2JC3A 3OE7A 1YFZA 4J75A 4NJEA 1JEQB 2HOQA 4V0NA 4IHJB 4CEHB 3NC1C 5LR6A 3I5AA 3ZHBA 5G0WA 5B4UA 5HZGA 4ZOLF 1H3EA 5DTJA 3HB9A 3K1AB 2CDRA 1JIXA 3C97A 5ER9A 1BXGA 4F11A 3WHIA 5IVPA 5DGDA 1LS1A 2PHZA 3JTMA 4IEEA 1ZI6A 5EXSA 4CCWA 2AF3C 2UU9B 1D07A 3KPUA 4O2AB 1W2GA 3EC2A 5LP6C 1T4MA 3N7TA 2D0DA 4WOJA 4JYAB 1VGVA 4FFMA 4LHVA 3ABQB 1WHTB 4MOWA 2P9JA 5JZ9A 5KS2A 2NVOA 3EZ6A 5A9TA 2IE8A 4HNAA 3LBYA 1USWA 3EOZA 4N8EA 3TZKA 3HUDA 1I0ZA 1YASA 4P53A 2HUPA 2PXCA 4CPDA 5JCJD 1GNRA 4NYIQ 1XVUA 2QTLA 4K05A 5ITVA 4D3YA 2HMAA 2OHHA 4CTNA 4B3TB 5IAJA 4XDYA 4TZ0A 3K9NA 2AD1A 5JMWA 3MMPA 4HMOA 4IG4A 4K7JA 4XIIA 3H2KA 1F8FA 3IUEA 1V3TA 2O7RA 2QLTA 3KKEA 1UDWA 4H7FA 1KDZA 1R50A 2AX3A 4F4JA 2XXAB 2UXDB 4IDFA 1AMNA 4MIOA 1RAFA 2ZJ8A 2OBXA 4GYJA 1C7JA 4G86A 5EUMA 4KR3A 5A0FA 3RIHA 2D8AA 2PMCA 1K6EA 1J1IA 4M0UA 4XLZA 5E38A 1KOLA 3H11B 1ISHA 1E2IA 4GZ6A 4V0MA 4B7ZA 4GKJB 4J16A 5COQA 5BSHA 4EPYA 3T3MB 1KWGA 2Q50A 4KMOA 3LY7A 1JHDA 3L8MA 3MRXA 4G1BA 4EPTA 1CKEA 4P34A 5JALA 3KQNA 4F2PA 3CU5A 4OLAA 3MWGA 5BVGB 4QHSA 4XVQA 1M34B 2NGRA 2IYEA 3DDWA 1ZVQA 3GK3A 1BCRA 3R9KA 2YVAA 4MUJA 5EHGA 5A62A 3SFZA 1OSNA 1G2IA 2RGAA 3SOPA 2OC9A 3A10A 5I7WA 2NUAA 1EINA 1N7HA 1XBTA 4J0HA 3LT1A 4TTVA 4BV8A 1YJ5A 3OZAA 5CLHA 4TVBA 4NBVA 1HH4A 2PAAA 2WWFA 1P1FA 3AUJB 4UTRA 2ATCA 1K7XB 1WP4A 2XDYA 2BGMA 4L8FA 9GPBA 1G8SA 4XVHA 4UQOA 4JZYA 2OCDA 3OJOA 1Q7BA 2H9YA 1POWA 1SBHA 4ECEA 2I34A 1OFIA 3REQA 3U13A 3TLAA 4X41A 3VC3A 4QLAA 4MI1A 2HR1A 2P67A 1W85B 2X3UA 1GAWA 2XJ4A 5A7FA 1A1SA 4UBLA 5EFOA 4QYMA 1BS9A 3NEYA 2XCTB 3MGAA 1V96A 2WHPA 3H3XA 3M49A 1KJZA 2HA0A 2GM3A 3IR5A 4JH0A 4I3HA 5IJWA 2X0DA 1DBPA 1JG2A 2D2FA 2XUIA 5LQRA 3A9TA 4N8DA 1WF3A 3NYIA 4OMUA 4YRZA 2DX7A 5HKKA 2C5GA 2QVCA 3GJYA 3EVEA 3WMGA 1YONA 2PO7A 2C2WA 1ND6A 3QU2A 4I4TF 4P8RA 5DBGA 4Q16A 1OF1A 2ZWMA 4MHTA 3NKLA 4LNUB 4CT5A 1RWNA 3D6UA 1SCNE 3RAPR 3S68A 1X7YB 1EFLA 3ETGA 1F4VA 2G82A 3TRHA 1BVHA 4DV7B 1YVEI 1Q0PA 1MX1A 1WL8A 4NMMA 2V7EA 5E9JA 3W1VA 1J2RA 1SHKA 1BHSA 1U2DA 3FTPA 4GUDA 4X1KA 4BJ1A 3PDJA 4X8LA 1ORRA 1VJ1A 1YK1A 4R5MA 5BR7A 2QM3A 5ARBA 3ZWOA 1NNI1 4F93B 2YV5A 4RKWA 4RTMA 2YZNA 3RS9A 2DUUA 4QUAA 3HP1A 1PQPA 5BQPA 1XVIA 3Q1LA 5REQA 3S5JA 5COAA 5FLXA 1HRKA 1KEVA 4CEJB 4A8PA 1S8OA 4CKCA 4AX4A 4BIMA 3VU8A 1JAIA 5DLEA 2XMCA 2BKEA 5B4TA 4PYOA 3F7OA 3UFXA 3EMVA 5DP1A 5K4HA 4Q5IA 1FFGA 4ZT5A 1I6MA 2AOVA 2DLNA 2OKGA 2JH3A 2MYTA 2VJMB 2ZSUA 4Z4IA 1AUXA 5CMLA 1R5JA 4KEAA 5J23A 3RT7A 2A9PA 1NC1A 2V0NA 4CLHA 4LZWA 5B3KA 4R8MA 3HSSA 3L40A 4ASUD 4Y0NA 1UQRA 3RUPA 3C3CA 2OHJA 3UG7A 1ODIA 3EYAA 5K20A 4WESB 1BKYA 3GNSA 3KSUA 5CGQB 1EDEA 1WUKS 5KQLA 3GYBA 4DLUA 5ELMA 1QP8A 4CU5A 2PCJA 3FFXA 2HF8A 1I2CA 3QWFA 1WMSA 3ZOKA 3CZPA 3ELWA 1XVVA 4LOJA 1P74A 3CLUD 1DC5A 1ND5A 1PK7A 1UK8A 4G5OA 4BQSA 4EFMA 4DV0B 2HK9A 4IGIA 4JWTA 4QXRA 5EXEA 3CZ9A 4JBWA 3K0CA 4HDSA 3RBVA 3ZKWA 4ONEA 1QR6A 4GX5A 1ZIXA 3G0BA 2B1RA 4YDRA 2PY6A 2PMKA 4MB0A 4ECAA 4GBED 4HNGA 4EHDA 3OE5A 3GLGE 1GPYA 1U7PA 1RJ9A 4I9HA 4RK4A 3SSMA 1C0PA 5BVHA 2GEBA 3DT6A 3EVCA 3VOAA 2C03A 1V43A 4Y2TA 1H6AA 1QP7A 3JD1A 2UYQA 1DADA 1DIGA 4FFOA 4X5OA 2GPJA 5KINB 1P9NA 4MW0A 4IUDS 5A4JA 1NVMB 1UAGA 3LX5A 3HJUA 4BO3A 2W71A 4HS4A 3IEVA 4Y2VA 4EQZA 3ZDCA 2AI1A 1SK8A 4Q82A 1X7HA 3RK4A 3F6BX 4M1ZA 5BW8A 1NVVR 3O3CA 1Q5PA 2AGVA 3A05A 3GAMA 2JASA 4ZHSA 1Z37A 2AMVA 1CE8A 4U9HS 4RFSB 4FVTA 2J3HA 5T57A 4PR0A 1VCIA 4WFKA 4RACA 4JUDX 4MW7A 1EEXB 2UYGA 5FBRB 5CYGA 1DXHA 2C4NA 3FYSA 1J06A 2I33A 3CUVA 1RBQA 3DHVA 4IDGA 5JVDA 1HFJA 1G5FA 3JASB 3LTEA 2GM5A 4WDQA 3MBOA 5JSZB 4CIDA 3R09A 4BNIA 3QKRB 1Y4UA 4KN9S 3N2GA 1C1DA 4UTXA 3O0TA 9ATCA 2IF0A 3R74A 4DMUB 1G6HA 2IEGA 4D42A 1P6QA 1XJ5A 4Y18A 3H13A 5FYDA 2JDID 2QPAA 4NOLA 1OC2A 3AFMA 3AZQA 1R4ZA 5IJAA 5K0JA 3UXEA 1SIUA 3IJEB 1PLKA 3LV8A 2EFYA 1KJWA 2WTNA 2ZETA 1WUYA 1T1IA 2R8RA 2W7TA 3ED5A 3NPAA 4Q7EA 3RUHA 4BRWA 4FC6A 2CFRA 5F1PA 1NSFA 1CU1A 1T0BA 1W34A 4FS8A 2D5AA 3MFQA 4EJSA 2M6SA 4OHUA 1WF6A 1CUDA 4LWQA 2PH3A 3R7WB 4BE4A 2VDMB 5K45A 1V8ZA 3T4PA 4XD2A 4R7GA 5DTEA 3H8SA 4GXTA 4ZAZA 2J1LA 1F0PA 1ADBA 1JG3A 2D62A 3ITNA 3E4CA 1JKMA 2E5FA 4G0PA 4JCOA 1KI3A 1V5GA 1OPRA 1OLUB 1IQPA 2Y0CA 1WW2A 3ESAA 2JAHA 4MRMB 4B3FX 4M83A 3M9XA 1P19A 1CF4A 1JJIA 2G70A 2ZWPA 1EWKA 2Q28A 3CN7A 4HAOA 3U4HA 4HGOA 1O77A 5DB4A 1A7AA 2P2SA 4FDTA 4PZDA 1D2RA 4GVXA 5IP5A 4RZQA 2WVHA 1QHHB 4KE6A 3FYUB 1QR2A 2R6ZA 1BU5A 3MTAA 4JYCA 4MWSA 3B1WA 3EASA 2WYHA 2ZUCA 3TPZA 4BNLA 2DTXA 1E2NA 1Y6QA 1GFWA 3CVOA 4LZAA 5I9MA 5LWQA 2QG4A 1J0CA 5DI9A 3EVAA 1J00A 1L7VC 1NIJA 3ODPA 3WNBA 4AYXA 3GWZA 1HOXA 4CM6A 2QD4A 3CNNA 1OCEA 2HA6A 5D01A 4JYZA 3MCTA 4WBNB 3HXMA 1JS1X 4KHZA 1CR2A 2PGOA 3AEQA 4ZN6A 5ADHA 1GRNA 5SZKB 1O2DA 5YASA 4HJXA 1XHLA 2DHEA 5TY0A 1D9ZA 2XUJA 2PWPA 2ZT7A 1BAPA 4BNVA 4RIEA 5HQJA 5K6RA 1SHTX 3IOCA 3FOFC 4HYYA 2OGWA 1V6AA 3IVRA 3K9QO 2O07A 3R20A 2GJSA 3QEMB 4B4VA 4LBYA 5BSGA 3DQZA 5JASA 2ZRKA 3LU1A 3SN6A 1E64A 2O54A 3UW3A 4REQA 2CMGA 3C5EA 4YX9A 1PWZA 4JJAA 2QM7A 3FYCA 2EHJA 4KV9A 4C1NA 1EGMB 2EJWA 4HGZA 4J16C 4LYYA 4FPXA 3UXYA 1HE4A 3DMHA 2PXAA 3TL6A 4OBBA 3KAJA 5EWMB 4G4GA 4DA0A 3EPJA 2PS9A 1OV4A 4E1BA 4A91A 1IY1A 3ENNA 4XX0B 1FFEA 1XRQA 2YCLA 2IKSA 2AN5A 2JLRA 1RJ9B 2PUHA 3K32A 2ODBA 3TIXB 5FTLA 4AROA 4A3SA 5KTKA 1VB5A 3Q8WA 3GDWA 1L5ZA 1Z2NX