4NKHA

Crystal structure of ssph1 lrr domain
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
236
structure length
236
Chain Sequence
EYDAVWSKWERDAPAGESPGRAAVVQEMRDCLNNGNPVLNVGASGLTTLPDRLPPHITTLVIPDNNLTSLPELPEGLRELEVSGNLQLTSLPSLPQGLQKLWAYNNWLASLPTLPPGLGDLAVSNNQLTSLPEMPPALRELRVSGNNLTSLPALPSGLQKLWAYNNRLTSLPEMSPGLQELDVSHNQLTRLPQSLTGLSSAARVYLDGNPLSVRTLQALRDIIGHSGIRIHFDMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase sspH1
publication title Structure of an SspH1-PKN1 Complex Reveals the Basis for Host Substrate Recognition and Mechanism of Activation for a Bacterial E3 Ubiquitin Ligase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Ligase
total genus 65
structure length 236
sequence length 236
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4nkhA00
4KXFB 1M9LA 2P1OB 3OGKB 5LFNA 2BNHA 4V2DA 4BSUA 4ARNA 1O6TA 4UFRA 4LSAA 4Z8GA 5D3IA 5GS0A 4BV4R 3ULUA 5AWDA 2WQWA 3E3ZA 3WPEA 2Z63A 2UZYA 4RWTC 5B0TA 1FO1A 1OTMA 3WPDA 2Q4GW 1IO0A 1XEUA 5IJCA 3RFEA 4M7EA 1OTNA 1FQVA 4LSCA 2V70A 2WFHA 2O6RA 4XSQA 4R6AA 1M10B 4QXEA 4K17A 4KT1A 1KOHA 4QBZA 4FD0A 1OGQA 4ECOA 4H09A 2FT3A 2OMZA 4PERA 2JE1A 4PEQB 4RCWA 4ECNA 2RR6A 1P8VA 2OMVA 4FHOA 5HZLB 4PQ8A 1YRGA 5AWBA 3RJ0A 4Z79A 4GT6A 4LXSA 3VQ2A 5CMPA 2ASSB 4KNGA 1M9SA 4CC4A 1G9UA 3WPBA 5IJDA 1FT8A 5A5CA 3WPIA 4AY9X 4CILA 5AWCA 5AZ5A 1DCEA 2O6QA 1A4YA 1A9NA 4FCGA 3O6NA 4R0AA 5B4PA 4LSXC 2OMTA 4GLPA 2R9UA 3C6OB 4EZGA 3ZYIA 2RA8A 3E6JA 3CVRA 2OMUA 4J0MA 2Z65A 5FTTB 4ARRA 3BZ5A 4J4LA 5HDHA 4B8CD 3UL7A 5GQRK 2OMWA 1O6VA 4XGOA 4Z94G 1P9AG 3W3NA 4Q3IA 2P1QB 4LI1A 4RCAB 3UN9A 2Y5QA 4TZHA 1KOOA 4U7LA 4YEBB 2XOTA 4U08A 4V2CA 1DS9A 2ID5A 4NKHA 3E2JA 4MN8B 4C2AB 3M18A 2JQDA 3O53A 3WN4A 3RFSA 1LTXA 3UL9A 4Q62A 3G3BA 5IYXC 4Y61B 4G8AA 4I6JB 3G04C 4HQ1A 1FS2A 3UL8A 4R08A 3C6NB 4R6GA 2UZXA 1XECA 3W3KA 1H6TA 3G39A 4QC0A 3RW6A 1P8TA 2IFGA 2Z62A 5CMNA 4U09A 3ZYNA 5AWAA 1ZIWA 3OJAA 3GOZA 4Z61C 2WQUA 2ASTB 1K5DC 2OMYA 4PSJA 3ZYOA 3RGXA 4U06A 4NKGA 3RIZA 1JL5A 4FS7A 4WYKA 5GMHA 4CNMA 4LXRA 5GS2B 1OZNA 3PMHG 4WP6A 3SB4A 4LSXA 2ELLA 2O6SA 3DZEA 4OQTA 4R58A 1XCDA 4FMZA 3WPHA 3WPFA 2V9SA 3RW7A 1K5GC 4LI2A 2A0ZA 5IJBA 3W3JA 1O6SA 4R07A 2Z82A 1WWLA 3REZA 1OTOA 2Z7XB 1XWDC 4CNCA 3W3GA 4M7EC 2Z81A 1XKUA 1U0ND 4Z64C 1Z7XW 3ZYJA 3JB9j 1H6UA 3FXIA 3C6PB 4R5DA 4MQWX 3WPGA 4R5CA 2OMXA 3RGZA 2Z64A 2JE0A 4R6FA 3CIGA 4XOSA 3WPCA 2BEXA 2P1NB 1DFJI 2P1PB 5GMFA 3OGLB 2WQVA 4BSSA 1W8AA 3ULVA 1PGVA 2CA6A 3CIYA 2P1MB 3TSRE 4FDWA 4BSRA 3W3LA 3A79B 4P8SA 2Z66A 4AW4A 4CC4C 4Q3GA 1OOKG 3W3MA 4L3AA 3G3AA 1D0BA 5B0NA 2V9TB 4PKIG 3KJ4A 1QYYA 3OJAB 3M19A 4L3FA 2WQXA 2XWTC 5GMGA 4P91A 3P72A 3RFJA 3ULAA 4R09A 1SQ0B 3G06A 1M0ZA 4IM6A 4CP6A 1GWBA 3OGMB 4C2BB 4V2EA 3E4GA 3VQ1A 4R6JA 2Z7XA
chains in the Genus database with same CATH superfamily
4KXFB 1M9LA 2P1OB 3OGKB 5LFNA 2BNHA 4V2DA 4BSUA 4ARNA 1O6TA 4UFRA 4LSAA 4Z8GA 5D3IA 5GS0A 4BV4R 3ULUA 5AWDA 2WQWA 3E3ZA 3WPEA 2Z63A 2UZYA 4RWTC 5B0TA 1FO1A 1OTMA 3WPDA 2Q4GW 1IO0A 1XEUA 5IJCA 3RFEA 4M7EA 1OTNA 1FQVA 4LSCA 2V70A 2WFHA 2O6RA 4XSQA 4R6AA 1M10B 4QXEA 4K17A 4KT1A 1KOHA 4QBZA 4FD0A 1OGQA 4ECOA 4H09A 2FT3A 2OMZA 4PERA 2JE1A 4PEQB 4RCWA 4ECNA 2RR6A 1P8VA 2OMVA 4FHOA 5HZLB 4PQ8A 1YRGA 5AWBA 3RJ0A 4Z79A 4GT6A 4LXSA 3VQ2A 5CMPA 2ASSB 4KNGA 1M9SA 4CC4A 1G9UA 3WPBA 5IJDA 1FT8A 5A5CA 3WPIA 4AY9X 4CILA 5AWCA 5AZ5A 1DCEA 2O6QA 1A4YA 1A9NA 4FCGA 3O6NA 4R0AA 5B4PA 4LSXC 2OMTA 4GLPA 2R9UA 3C6OB 4EZGA 3ZYIA 2RA8A 3E6JA 3CVRA 2OMUA 4J0MA 2Z65A 5FTTB 4ARRA 3BZ5A 4J4LA 5HDHA 4B8CD 3UL7A 5GQRK 2OMWA 1O6VA 4XGOA 4Z94G 1P9AG 3W3NA 4Q3IA 2P1QB 4LI1A 4RCAB 3UN9A 2Y5QA 4TZHA 1KOOA 4U7LA 4YEBB 2XOTA 4U08A 4V2CA 1DS9A 2ID5A 4NKHA 3E2JA 4MN8B 4C2AB 3M18A 2JQDA 3O53A 3WN4A 3RFSA 1LTXA 3UL9A 4Q62A 3G3BA 5IYXC 4Y61B 4G8AA 4I6JB 3G04C 4HQ1A 1FS2A 3UL8A 4R08A 3C6NB 4R6GA 2UZXA 1XECA 3W3KA 1H6TA 3G39A 4QC0A 3RW6A 1P8TA 2IFGA 2Z62A 5CMNA 4U09A 3ZYNA 5AWAA 1ZIWA 3OJAA 3GOZA 4Z61C 2WQUA 2ASTB 1K5DC 2OMYA 4PSJA 3ZYOA 3RGXA 4U06A 4NKGA 3RIZA 1JL5A 4FS7A 4WYKA 5GMHA 4CNMA 4LXRA 5GS2B 1OZNA 3PMHG 4WP6A 3SB4A 4LSXA 2ELLA 2O6SA 3DZEA 4OQTA 4R58A 1XCDA 4FMZA 4NZRM 3WPHA 3WPFA 2V9SA 3RW7A 1K5GC 4LI2A 2A0ZA 5IJBA 3W3JA 1O6SA 4R07A 2Z82A 1WWLA 3REZA 1OTOA 2Z7XB 1XWDC 4CNCA 3W3GA 4M7EC 2Z81A 1XKUA 1U0ND 4Z64C 1Z7XW 3ZYJA 3JB9j 1H6UA 3FXIA 3C6PB 4R5DA 4MQWX 3WPGA 4R5CA 4NZTM 2OMXA 3RGZA 2Z64A 2JE0A 4R6FA 3CIGA 4XOSA 3WPCA 2BEXA 2P1NB 1DFJI 2P1PB 5GMFA 3OGLB 2WQVA 4BSSA 1W8AA 3ULVA 1PGVA 2CA6A 3CIYA 2P1MB 3TSRE 4FDWA 4BSRA 3W3LA 3A79B 4P8SA 2Z66A 4AW4A 4CC4C 4Q3GA 1OOKG 3W3MA 4L3AA 3G3AA 1D0BA 5B0NA 2V9TB 4PKIG 3KJ4A 1QYYA 3OJAB 3M19A 4L3FA 2WQXA 2XWTC 5GMGA 4P91A 3P72A 3RFJA 3ULAA 4R09A 1SQ0B 3G06A 1M0ZA 4IM6A 4CP6A 1GWBA 3OGMB 4C2BB 4V2EA 3E4GA 3VQ1A 4R6JA 2Z7XA
chains in the Genus database with same CATH topology
4KXFB 1M9LA 2P1OB 3OGKB 5LFNA 2BNHA 4V2DA 4BSUA 4ARNA 1O6TA 4UFRA 4LSAA 4Z8GA 5D3IA 5GS0A 4BV4R 3ULUA 5AWDA 2WQWA 3E3ZA 3WPEA 2Z63A 2UZYA 4RWTC 5B0TA 1FO1A 1OTMA 3WPDA 2Q4GW 1IO0A 1XEUA 5IJCA 3RFEA 4M7EA 1OTNA 1FQVA 4LSCA 2V70A 2WFHA 2O6RA 4XSQA 4R6AA 1M10B 4QXEA 4K17A 4KT1A 1KOHA 4QBZA 4FD0A 1OGQA 4ECOA 4H09A 2FT3A 2OMZA 4PERA 2JE1A 4PEQB 4RCWA 4ECNA 2RR6A 1P8VA 2OMVA 4FHOA 5HZLB 4PQ8A 1YRGA 5AWBA 3RJ0A 4Z79A 4GT6A 4LXSA 3VQ2A 5CMPA 2ASSB 4KNGA 1M9SA 4CC4A 1G9UA 3WPBA 5IJDA 1FT8A 5A5CA 3WPIA 4AY9X 4CILA 5AWCA 5AZ5A 1DCEA 2O6QA 1A4YA 1A9NA 4FCGA 3O6NA 4R0AA 5B4PA 4LSXC 2OMTA 4GLPA 2R9UA 3C6OB 4EZGA 3ZYIA 2RA8A 3E6JA 3CVRA 2OMUA 4J0MA 2Z65A 5FTTB 4ARRA 3BZ5A 4J4LA 5HDHA 4B8CD 3UL7A 5GQRK 2OMWA 1O6VA 4XGOA 4Z94G 1P9AG 3W3NA 4Q3IA 2P1QB 4LI1A 4RCAB 3UN9A 2Y5QA 4TZHA 1KOOA 4U7LA 4YEBB 2XOTA 4U08A 4V2CA 1DS9A 2ID5A 4NKHA 3E2JA 4MN8B 4C2AB 3M18A 2JQDA 3O53A 3WN4A 3RFSA 1LTXA 3UL9A 4Q62A 3G3BA 5IYXC 4Y61B 4G8AA 4I6JB 3G04C 4HQ1A 1FS2A 3UL8A 4R08A 3C6NB 4R6GA 2UZXA 1XECA 3W3KA 1H6TA 3G39A 4QC0A 3RW6A 1P8TA 2IFGA 2Z62A 5CMNA 4U09A 3ZYNA 5AWAA 1ZIWA 3OJAA 3GOZA 4Z61C 2WQUA 2ASTB 1K5DC 2OMYA 4PSJA 3ZYOA 3RGXA 4U06A 4NKGA 3RIZA 1JL5A 4FS7A 4WYKA 5GMHA 4CNMA 4LXRA 5GS2B 1OZNA 3PMHG 4WP6A 3SB4A 4LSXA 2ELLA 2O6SA 3DZEA 4OQTA 4R58A 1XCDA 4FMZA 3WPHA 3WPFA 2V9SA 3RW7A 1K5GC 4LI2A 2A0ZA 5IJBA 3W3JA 1O6SA 4R07A 2Z82A 1WWLA 3REZA 1OTOA 2Z7XB 1XWDC 4CNCA 3W3GA 4M7EC 2Z81A 1XKUA 1U0ND 4Z64C 1Z7XW 3ZYJA 3JB9j 1H6UA 3FXIA 3C6PB 4R5DA 4MQWX 3WPGA 4R5CA 2OMXA 3RGZA 2Z64A 2JE0A 4R6FA 3CIGA 4XOSA 3WPCA 2BEXA 2P1NB 1DFJI 2P1PB 5GMFA 3OGLB 2WQVA 4BSSA 1W8AA 3ULVA 1PGVA 2CA6A 3CIYA 2P1MB 3TSRE 4FDWA 4BSRA 3W3LA 3A79B 4P8SA 2Z66A 4AW4A 4CC4C 4Q3GA 1OOKG 3W3MA 4L3AA 3G3AA 1D0BA 5B0NA 2V9TB 4PKIG 3KJ4A 1QYYA 3OJAB 3M19A 4L3FA 2WQXA 2XWTC 5GMGA 4P91A 3P72A 3RFJA 3ULAA 4R09A 1SQ0B 3G06A 1M0ZA 4IM6A 4CP6A 1GWBA 3OGMB 4C2BB 4V2EA 3E4GA 3VQ1A 4R6JA 2Z7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KXF B;  1M9L A;  2P1O B;  3OGK B;  5LFN A;  2BNH A;  4V2D A;  4BSU A;  4ARN A;  1O6T A;  4UFR A;  4LSA A;  4Z8G A;  5D3I A;  5GS0 A;  4BV4 R;  3ULU A;  5AWD A;  2WQW A;  3E3Z A;  3WPE A;  2Z63 A;  2UZY A;  4RWT C;  5B0T A;  1FO1 A;  1OTM A;  3WPD A;  2Q4G W;  1IO0 A;  1XEU A;  5IJC A;  3RFE A;  4M7E A;  1OTN A;  1FQV A;  4LSC A;  2V70 A;  2WFH A;  2O6R A;  4XSQ A;  4R6A A;  1M10 B;  4QXE A;  4K17 A;  4KT1 A;  1KOH A;  4QBZ A;  4FD0 A;  1OGQ A;  4ECO A;  4H09 A;  2FT3 A;  2OMZ A;  4PER A;  2JE1 A;  4PEQ B;  4RCW A;  4ECN A;  2RR6 A;  1P8V A;  2OMV A;  4FHO A;  5HZL B;  4PQ8 A;  1YRG A;  5AWB A;  3RJ0 A;  4Z79 A;  4GT6 A;  4LXS A;  3VQ2 A;  5CMP A;  2ASS B;  4KNG A;  1M9S A;  4CC4 A;  1G9U A;  3WPB A;  5IJD A;  1FT8 A;  5A5C A;  3WPI A;  4AY9 X;  4CIL A;  5AWC A;  5AZ5 A;  1DCE A;  2O6Q A;  1A4Y A;  1A9N A;  4FCG A;  3O6N A;  4R0A A;  5B4P A;  4LSX C;  2OMT A;  4GLP A;  2R9U A;  3C6O B;  4EZG A;  3ZYI A;  2RA8 A;  3E6J A;  3CVR A;  2OMU A;  4J0M A;  2Z65 A;  5FTT B;  4ARR A;  3BZ5 A;  4J4L A;  5HDH A;  4B8C D;  3UL7 A;  5GQR K;  2OMW A;  1O6V A;  4XGO A;  4Z94 G;  1P9A G;  3W3N A;  4Q3I A;  2P1Q B;  4LI1 A;  4RCA B;  3UN9 A;  2Y5Q A;  4TZH A;  1KOO A;  4U7L A;  4YEB B;  2XOT A;  4U08 A;  4V2C A;  1DS9 A;  2ID5 A;  4NKH A;  3E2J A;  4MN8 B;  4C2A B;  3M18 A;  2JQD A;  3O53 A;  3WN4 A;  3RFS A;  1LTX A;  3UL9 A;  4Q62 A;  3G3B A;  5IYX C;  4Y61 B;  4G8A A;  4I6J B;  3G04 C;  4HQ1 A;  1FS2 A;  3UL8 A;  4R08 A;  3C6N B;  4R6G A;  2UZX A;  1XEC A;  3W3K A;  1H6T A;  3G39 A;  4QC0 A;  3RW6 A;  1P8T A;  2IFG A;  2Z62 A;  5CMN A;  4U09 A;  3ZYN A;  5AWA A;  1ZIW A;  3OJA A;  3GOZ A;  4Z61 C;  2WQU A;  2AST B;  1K5D C;  2OMY A;  4PSJ A;  3ZYO A;  3RGX A;  4U06 A;  4NKG A;  3RIZ A;  1JL5 A;  4FS7 A;  4WYK A;  5GMH A;  4CNM A;  4LXR A;  5GS2 B;  1OZN A;  3PMH G;  4WP6 A;  3SB4 A;  4LSX A;  2ELL A;  2O6S A;  3DZE A;  4OQT A;  4R58 A;  1XCD A;  4FMZ A;  3WPH A;  3WPF A;  2V9S A;  3RW7 A;  1K5G C;  4LI2 A;  2A0Z A;  5IJB A;  3W3J A;  1O6S A;  4R07 A;  2Z82 A;  1WWL A;  3REZ A;  1OTO A;  2Z7X B;  1XWD C;  4CNC A;  3W3G A;  4M7E C;  2Z81 A;  1XKU A;  1U0N D;  4Z64 C;  1Z7X W;  3ZYJ A;  3JB9 j;  1H6U A;  3FXI A;  3C6P B;  4R5D A;  4MQW X;  3WPG A;  4R5C A;  2OMX A;  3RGZ A;  2Z64 A;  2JE0 A;  4R6F A;  3CIG A;  4XOS A;  3WPC A;  2BEX A;  2P1N B;  1DFJ I;  2P1P B;  5GMF A;  3OGL B;  2WQV A;  4BSS A;  1W8A A;  3ULV A;  1PGV A;  2CA6 A;  3CIY A;  2P1M B;  3TSR E;  4FDW A;  4BSR A;  3W3L A;  3A79 B;  4P8S A;  2Z66 A;  4AW4 A;  4CC4 C;  4Q3G A;  1OOK G;  3W3M A;  4L3A A;  3G3A A;  1D0B A;  5B0N A;  2V9T B;  4PKI G;  3KJ4 A;  1QYY A;  3OJA B;  3M19 A;  4L3F A;  2WQX A;  2XWT C;  5GMG A;  4P91 A;  3P72 A;  3RFJ A;  3ULA A;  4R09 A;  1SQ0 B;  3G06 A;  1M0Z A;  4IM6 A;  4CP6 A;  1GWB A;  3OGM B;  4C2B B;  4V2E A;  3E4G A;  3VQ1 A;  4R6J A;  2Z7X A; 
#chains in the Genus database with same CATH topology
 4KXF B;  1M9L A;  2P1O B;  3OGK B;  5LFN A;  2BNH A;  4V2D A;  4BSU A;  4ARN A;  1O6T A;  4UFR A;  4LSA A;  4Z8G A;  5D3I A;  5GS0 A;  4BV4 R;  3ULU A;  5AWD A;  2WQW A;  3E3Z A;  3WPE A;  2Z63 A;  2UZY A;  4RWT C;  5B0T A;  1FO1 A;  1OTM A;  3WPD A;  2Q4G W;  1IO0 A;  1XEU A;  5IJC A;  3RFE A;  4M7E A;  1OTN A;  1FQV A;  4LSC A;  2V70 A;  2WFH A;  2O6R A;  4XSQ A;  4R6A A;  1M10 B;  4QXE A;  4K17 A;  4KT1 A;  1KOH A;  4QBZ A;  4FD0 A;  1OGQ A;  4ECO A;  4H09 A;  2FT3 A;  2OMZ A;  4PER A;  2JE1 A;  4PEQ B;  4RCW A;  4ECN A;  2RR6 A;  1P8V A;  2OMV A;  4FHO A;  5HZL B;  4PQ8 A;  1YRG A;  5AWB A;  3RJ0 A;  4Z79 A;  4GT6 A;  4LXS A;  3VQ2 A;  5CMP A;  2ASS B;  4KNG A;  1M9S A;  4CC4 A;  1G9U A;  3WPB A;  5IJD A;  1FT8 A;  5A5C A;  3WPI A;  4AY9 X;  4CIL A;  5AWC A;  5AZ5 A;  1DCE A;  2O6Q A;  1A4Y A;  1A9N A;  4FCG A;  3O6N A;  4R0A A;  5B4P A;  4LSX C;  2OMT A;  4GLP A;  2R9U A;  3C6O B;  4EZG A;  3ZYI A;  2RA8 A;  3E6J A;  3CVR A;  2OMU A;  4J0M A;  2Z65 A;  5FTT B;  4ARR A;  3BZ5 A;  4J4L A;  5HDH A;  4B8C D;  3UL7 A;  5GQR K;  2OMW A;  1O6V A;  4XGO A;  4Z94 G;  1P9A G;  3W3N A;  4Q3I A;  2P1Q B;  4LI1 A;  4RCA B;  3UN9 A;  2Y5Q A;  4TZH A;  1KOO A;  4U7L A;  4YEB B;  2XOT A;  4U08 A;  4V2C A;  1DS9 A;  2ID5 A;  4NKH A;  3E2J A;  4MN8 B;  4C2A B;  3M18 A;  2JQD A;  3O53 A;  3WN4 A;  3RFS A;  1LTX A;  3UL9 A;  4Q62 A;  3G3B A;  5IYX C;  4Y61 B;  4G8A A;  4I6J B;  3G04 C;  4HQ1 A;  1FS2 A;  3UL8 A;  4R08 A;  3C6N B;  4R6G A;  2UZX A;  1XEC A;  3W3K A;  1H6T A;  3G39 A;  4QC0 A;  3RW6 A;  1P8T A;  2IFG A;  2Z62 A;  5CMN A;  4U09 A;  3ZYN A;  5AWA A;  1ZIW A;  3OJA A;  3GOZ A;  4Z61 C;  2WQU A;  2AST B;  1K5D C;  2OMY A;  4PSJ A;  3ZYO A;  3RGX A;  4U06 A;  4NKG A;  3RIZ A;  1JL5 A;  4FS7 A;  4WYK A;  5GMH A;  4CNM A;  4LXR A;  5GS2 B;  1OZN A;  3PMH G;  4WP6 A;  3SB4 A;  4LSX A;  2ELL A;  2O6S A;  3DZE A;  4OQT A;  4R58 A;  1XCD A;  4FMZ A;  4NZR M;  3WPH A;  3WPF A;  2V9S A;  3RW7 A;  1K5G C;  4LI2 A;  2A0Z A;  5IJB A;  3W3J A;  1O6S A;  4R07 A;  2Z82 A;  1WWL A;  3REZ A;  1OTO A;  2Z7X B;  1XWD C;  4CNC A;  3W3G A;  4M7E C;  2Z81 A;  1XKU A;  1U0N D;  4Z64 C;  1Z7X W;  3ZYJ A;  3JB9 j;  1H6U A;  3FXI A;  3C6P B;  4R5D A;  4MQW X;  3WPG A;  4R5C A;  4NZT M;  2OMX A;  3RGZ A;  2Z64 A;  2JE0 A;  4R6F A;  3CIG A;  4XOS A;  3WPC A;  2BEX A;  2P1N B;  1DFJ I;  2P1P B;  5GMF A;  3OGL B;  2WQV A;  4BSS A;  1W8A A;  3ULV A;  1PGV A;  2CA6 A;  3CIY A;  2P1M B;  3TSR E;  4FDW A;  4BSR A;  3W3L A;  3A79 B;  4P8S A;  2Z66 A;  4AW4 A;  4CC4 C;  4Q3G A;  1OOK G;  3W3M A;  4L3A A;  3G3A A;  1D0B A;  5B0N A;  2V9T B;  4PKI G;  3KJ4 A;  1QYY A;  3OJA B;  3M19 A;  4L3F A;  2WQX A;  2XWT C;  5GMG A;  4P91 A;  3P72 A;  3RFJ A;  3ULA A;  4R09 A;  1SQ0 B;  3G06 A;  1M0Z A;  4IM6 A;  4CP6 A;  1GWB A;  3OGM B;  4C2B B;  4V2E A;  3E4G A;  3VQ1 A;  4R6J A;  2Z7X A; 
#chains in the Genus database with same CATH homology
 4KXF B;  1M9L A;  2P1O B;  3OGK B;  5LFN A;  2BNH A;  4V2D A;  4BSU A;  4ARN A;  1O6T A;  4UFR A;  4LSA A;  4Z8G A;  5D3I A;  5GS0 A;  4BV4 R;  3ULU A;  5AWD A;  2WQW A;  3E3Z A;  3WPE A;  2Z63 A;  2UZY A;  4RWT C;  5B0T A;  1FO1 A;  1OTM A;  3WPD A;  2Q4G W;  1IO0 A;  1XEU A;  5IJC A;  3RFE A;  4M7E A;  1OTN A;  1FQV A;  4LSC A;  2V70 A;  2WFH A;  2O6R A;  4XSQ A;  4R6A A;  1M10 B;  4QXE A;  4K17 A;  4KT1 A;  1KOH A;  4QBZ A;  4FD0 A;  1OGQ A;  4ECO A;  4H09 A;  2FT3 A;  2OMZ A;  4PER A;  2JE1 A;  4PEQ B;  4RCW A;  4ECN A;  2RR6 A;  1P8V A;  2OMV A;  4FHO A;  5HZL B;  4PQ8 A;  1YRG A;  5AWB A;  3RJ0 A;  4Z79 A;  4GT6 A;  4LXS A;  3VQ2 A;  5CMP A;  2ASS B;  4KNG A;  1M9S A;  4CC4 A;  1G9U A;  3WPB A;  5IJD A;  1FT8 A;  5A5C A;  3WPI A;  4AY9 X;  4CIL A;  5AWC A;  5AZ5 A;  1DCE A;  2O6Q A;  1A4Y A;  1A9N A;  4FCG A;  3O6N A;  4R0A A;  5B4P A;  4LSX C;  2OMT A;  4GLP A;  2R9U A;  3C6O B;  4EZG A;  3ZYI A;  2RA8 A;  3E6J A;  3CVR A;  2OMU A;  4J0M A;  2Z65 A;  5FTT B;  4ARR A;  3BZ5 A;  4J4L A;  5HDH A;  4B8C D;  3UL7 A;  5GQR K;  2OMW A;  1O6V A;  4XGO A;  4Z94 G;  1P9A G;  3W3N A;  4Q3I A;  2P1Q B;  4LI1 A;  4RCA B;  3UN9 A;  2Y5Q A;  4TZH A;  1KOO A;  4U7L A;  4YEB B;  2XOT A;  4U08 A;  4V2C A;  1DS9 A;  2ID5 A;  4NKH A;  3E2J A;  4MN8 B;  4C2A B;  3M18 A;  2JQD A;  3O53 A;  3WN4 A;  3RFS A;  1LTX A;  3UL9 A;  4Q62 A;  3G3B A;  5IYX C;  4Y61 B;  4G8A A;  4I6J B;  3G04 C;  4HQ1 A;  1FS2 A;  3UL8 A;  4R08 A;  3C6N B;  4R6G A;  2UZX A;  1XEC A;  3W3K A;  1H6T A;  3G39 A;  4QC0 A;  3RW6 A;  1P8T A;  2IFG A;  2Z62 A;  5CMN A;  4U09 A;  3ZYN A;  5AWA A;  1ZIW A;  3OJA A;  3GOZ A;  4Z61 C;  2WQU A;  2AST B;  1K5D C;  2OMY A;  4PSJ A;  3ZYO A;  3RGX A;  4U06 A;  4NKG A;  3RIZ A;  1JL5 A;  4FS7 A;  4WYK A;  5GMH A;  4CNM A;  4LXR A;  5GS2 B;  1OZN A;  3PMH G;  4WP6 A;  3SB4 A;  4LSX A;  2ELL A;  2O6S A;  3DZE A;  4OQT A;  4R58 A;  1XCD A;  4FMZ A;  3WPH A;  3WPF A;  2V9S A;  3RW7 A;  1K5G C;  4LI2 A;  2A0Z A;  5IJB A;  3W3J A;  1O6S A;  4R07 A;  2Z82 A;  1WWL A;  3REZ A;  1OTO A;  2Z7X B;  1XWD C;  4CNC A;  3W3G A;  4M7E C;  2Z81 A;  1XKU A;  1U0N D;  4Z64 C;  1Z7X W;  3ZYJ A;  3JB9 j;  1H6U A;  3FXI A;  3C6P B;  4R5D A;  4MQW X;  3WPG A;  4R5C A;  2OMX A;  3RGZ A;  2Z64 A;  2JE0 A;  4R6F A;  3CIG A;  4XOS A;  3WPC A;  2BEX A;  2P1N B;  1DFJ I;  2P1P B;  5GMF A;  3OGL B;  2WQV A;  4BSS A;  1W8A A;  3ULV A;  1PGV A;  2CA6 A;  3CIY A;  2P1M B;  3TSR E;  4FDW A;  4BSR A;  3W3L A;  3A79 B;  4P8S A;  2Z66 A;  4AW4 A;  4CC4 C;  4Q3G A;  1OOK G;  3W3M A;  4L3A A;  3G3A A;  1D0B A;  5B0N A;  2V9T B;  4PKI G;  3KJ4 A;  1QYY A;  3OJA B;  3M19 A;  4L3F A;  2WQX A;  2XWT C;  5GMG A;  4P91 A;  3P72 A;  3RFJ A;  3ULA A;  4R09 A;  1SQ0 B;  3G06 A;  1M0Z A;  4IM6 A;  4CP6 A;  1GWB A;  3OGM B;  4C2B B;  4V2E A;  3E4G A;  3VQ1 A;  4R6J A;  2Z7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...