4NKHA

Crystal structure of ssph1 lrr domain
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
236
structure length
236
Chain Sequence
b'EYDAVWSKWERDAPAGESPGRAAVVQEMRDCLNNGNPVLNVGASGLTTLPDRLPPHITTLVIPDNNLTSLPELPEGLRELEVSGNLQLTSLPSLPQGLQKLWAYNNWLASLPTLPPGLGDLAVSNNQLTSLPEMPPALRELRVSGNNLTSLPALPSGLQKLWAYNNRLTSLPEMSPGLQELDVSHNQLTRLPQSLTGLSSAARVYLDGNPLSVRTLQALRDIIGHSGIRIHFDMAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase sspH1
publication title Structure of an SspH1-PKN1 Complex Reveals the Basis for Host Substrate Recognition and Mechanism of Activation for a Bacterial E3 Ubiquitin Ligase.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Ligase
total genus 65
structure length 236
sequence length 236
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2013-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4nkhA00
4U06A 4R0AA 1OTNA 2RA8A 1Z7XW 1IO0A 4LI2A 4LSCA 3WPFA 2O6QA 2Q4GW 4H09A 4HQ1A 1W8AA 1A4YA 4WP6A 4QXEA 5AWDA 3WPBA 5IJCA 4FHOA 3C6NB 4Z94G 2A0ZA 3E3ZA 1O6VA 3OGMB 4Q62A 4I6JB 1M9SA 4AW4A 2P1MB 4V2CA 3VQ2A 5IJBA 3E6JA 1FO1A 4OQTA 2WQWA 1PGVA 4ECNA 4Y61B 3WPHA 2OMVA 3ZYIA 4Z8GA 4B8CD 4BV4R 1KOHA 3PMHG 2Z81A 2Z82A 3W3KA 1FT8A 4Q3GA 1XWDC 3VQ1A 3SB4A 4CNCA 5GS0A 3RIZA 1A9NA 4R6FA 2OMXA 4FDWA 3REZA 4NKHA 4PERA 4ECOA 3WPIA 2OMWA 2UZXA 1KOOA 4V2DA 4BSSA 5IYXC 3WPDA 2ASTB 4L3AA 1GWBA 2JE1A 3G06A 1H6UA 3W3JA 1P8TA 3WN4A 3CIYA 4BSRA 2ASSB 2WQUA 2Z7XA 4R6GA 1OGQA 1LTXA 5GMFA 2Z62A 4K17A 2OMZA 3W3LA 2P1OB 4PSJA 1M0ZA 4ARRA 4QBZA 3RW6A 1XCDA 3A79B 4MN8B 3UN9A 3WPCA 3M19A 3O53A 3OJAA 1P9AG 3G3AA 2O6RA 3UL9A 3WPGA 2XWTC 1O6TA 3GOZA 4R6AA 4PQ8A 4GT6A 1G9UA 3C6OB 2Z63A 4KT1A 2OMTA 3DZEA 4R5CA 1K5GC 4Z79A 4WYKA 4MQWX 4U7LA 5AZ5A 2O6SA 4KNGA 4CNMA 2ID5A 5FTTB 1M10B 3O6NA 4U08A 1H6TA 4KXFB 2ELLA 2R9UA 4R6JA 4LSAA 4V2EA 5CMNA 3W3NA 2BNHA 2BEXA 1WWLA 3RFEA 4PKIG 4LXRA 2Z7XB 3ULUA 1XKUA 1YRGA 4P91A 3ZYJA 4R07A 2OMUA 3WPEA 1OOKG 5AWAA 1FQVA 5B4PA 1K5DC 4GLPA 4XSQA 2V9TB 1M9LA 4BSUA 1OZNA 4M7EC 4C2AB 2Z64A 4R5DA 4FCGA 2Y5QA 4Z61C 3CIGA 3OJAB 4UFRA 5GMHA 2CA6A 2RR6A 3G3BA 3OGKB 4NKGA 3ZYOA 1QYYA 3RFJA 3TSRE 2WQXA 4RCAB 2P1PB 4LSXC 2Z65A 5GQRK 4ARNA 3ZYNA 5HDHA 1XEUA 3C6PB 5A5CA 3UL7A 3JB9j 3UL8A 3CVRA 3BZ5A 5AWBA 4LSXA 3RFSA 5B0NA 3P72A 4PEQB 3FXIA 2JE0A 1ZIWA 2OMYA 4R58A 4Z64C 5B0TA 2WFHA 2P1NB 1DCEA 1OTOA 2V9SA 3W3GA 1D0BA 3E2JA 4LI1A 4G8AA 5IJDA 4YEBB 3OGLB 2Z66A 4C2BB 1DFJI 3M18A 4IM6A 4CC4C 1FS2A 4J0MA 4U09A 1P8VA 4LXSA 4CILA 4L3FA 3E4GA 2FT3A 4TZHA 2V70A 5GMGA 4CC4A 1OTMA 2IFGA 4R09A 2WQVA 5AWCA 3ULAA 2P1QB 3RW7A 1U0ND 1XECA 5HZLB 5GS2B 5LFNA 4XGOA 1JL5A 4P8SA 1SQ0B 4FD0A 4RCWA 4FMZA 4FS7A 3RGZA 3W3MA 3ULVA 3RJ0A 4M7EA 3KJ4A 3G04C 3RGXA 4Q3IA 3G39A 2JQDA 4EZGA 5CMPA 4QC0A 1DS9A 4RWTC 4XOSA 4CP6A 2UZYA 5D3IA 4AY9X 4J4LA 1O6SA 2XOTA 4R08A
chains in the Genus database with same CATH superfamily
4U06A 4R0AA 1OTNA 2RA8A 1Z7XW 1IO0A 4LI2A 4LSCA 3WPFA 2O6QA 2Q4GW 4H09A 4HQ1A 1W8AA 1A4YA 4WP6A 4QXEA 5AWDA 3WPBA 5IJCA 4FHOA 3C6NB 4Z94G 2A0ZA 3E3ZA 1O6VA 3OGMB 4Q62A 4I6JB 1M9SA 4AW4A 2P1MB 4V2CA 3VQ2A 5IJBA 3E6JA 1FO1A 4OQTA 2WQWA 1PGVA 4ECNA 4Y61B 3WPHA 2OMVA 3ZYIA 4Z8GA 4B8CD 4BV4R 1KOHA 3PMHG 2Z81A 2Z82A 3W3KA 1FT8A 4Q3GA 1XWDC 3VQ1A 3SB4A 4CNCA 5GS0A 3RIZA 1A9NA 4R6FA 4NZTM 2OMXA 4FDWA 3REZA 4NKHA 4PERA 4ECOA 3WPIA 2OMWA 2UZXA 1KOOA 4V2DA 4BSSA 5IYXC 3WPDA 2ASTB 4L3AA 1GWBA 2JE1A 3G06A 1H6UA 3W3JA 1P8TA 3WN4A 3CIYA 4BSRA 2ASSB 2WQUA 2Z7XA 4R6GA 1OGQA 1LTXA 5GMFA 2Z62A 4K17A 2OMZA 3W3LA 2P1OB 4PSJA 1M0ZA 4ARRA 4QBZA 3RW6A 1XCDA 3A79B 4MN8B 3UN9A 3WPCA 3M19A 3O53A 3OJAA 1P9AG 3G3AA 2O6RA 3UL9A 3WPGA 2XWTC 1O6TA 3GOZA 4R6AA 4PQ8A 4GT6A 1G9UA 3C6OB 2Z63A 4KT1A 2OMTA 3DZEA 4R5CA 1K5GC 4Z79A 4WYKA 4MQWX 4U7LA 5AZ5A 2O6SA 4KNGA 4CNMA 2ID5A 5FTTB 1M10B 3O6NA 4U08A 1H6TA 4KXFB 2ELLA 2R9UA 4R6JA 4LSAA 4V2EA 5CMNA 3W3NA 2BNHA 2BEXA 1WWLA 3RFEA 4PKIG 4LXRA 2Z7XB 3ULUA 1XKUA 1YRGA 4P91A 3ZYJA 4R07A 2OMUA 3WPEA 1OOKG 5AWAA 1FQVA 5B4PA 1K5DC 4GLPA 4XSQA 2V9TB 1M9LA 4BSUA 1OZNA 4M7EC 4C2AB 2Z64A 4R5DA 4FCGA 2Y5QA 4Z61C 3CIGA 3OJAB 4UFRA 5GMHA 2CA6A 2RR6A 3G3BA 3OGKB 4NKGA 3ZYOA 1QYYA 3RFJA 3TSRE 2WQXA 4RCAB 2P1PB 4LSXC 2Z65A 5GQRK 4ARNA 3ZYNA 5HDHA 1XEUA 3C6PB 5A5CA 3UL7A 3JB9j 3UL8A 4NZRM 3CVRA 3BZ5A 5AWBA 4LSXA 3RFSA 5B0NA 3P72A 4PEQB 3FXIA 2JE0A 1ZIWA 2OMYA 4R58A 4Z64C 5B0TA 2WFHA 2P1NB 1DCEA 1OTOA 2V9SA 3W3GA 1D0BA 3E2JA 4LI1A 4G8AA 5IJDA 4YEBB 3OGLB 2Z66A 4C2BB 1DFJI 3M18A 4IM6A 4CC4C 1FS2A 4J0MA 4U09A 1P8VA 4LXSA 4CILA 4L3FA 3E4GA 2FT3A 4TZHA 2V70A 5GMGA 4CC4A 1OTMA 2IFGA 4R09A 2WQVA 5AWCA 3ULAA 2P1QB 3RW7A 1U0ND 1XECA 5HZLB 5GS2B 5LFNA 4XGOA 1JL5A 4P8SA 1SQ0B 4FD0A 4RCWA 4FMZA 4FS7A 3RGZA 3W3MA 3ULVA 3RJ0A 4M7EA 3KJ4A 3G04C 3RGXA 4Q3IA 3G39A 2JQDA 4EZGA 5CMPA 4QC0A 1DS9A 4RWTC 4XOSA 4CP6A 2UZYA 5D3IA 4AY9X 4J4LA 1O6SA 2XOTA 4R08A
chains in the Genus database with same CATH topology
4U06A 4R0AA 1OTNA 2RA8A 1Z7XW 1IO0A 4LI2A 4LSCA 3WPFA 2O6QA 2Q4GW 4H09A 4HQ1A 1W8AA 1A4YA 4WP6A 4QXEA 5AWDA 3WPBA 5IJCA 4FHOA 3C6NB 4Z94G 2A0ZA 3E3ZA 1O6VA 3OGMB 4Q62A 4I6JB 1M9SA 4AW4A 2P1MB 4V2CA 3VQ2A 5IJBA 3E6JA 1FO1A 4OQTA 2WQWA 1PGVA 4ECNA 4Y61B 3WPHA 2OMVA 3ZYIA 4Z8GA 4B8CD 4BV4R 1KOHA 3PMHG 2Z81A 2Z82A 3W3KA 1FT8A 4Q3GA 1XWDC 3VQ1A 3SB4A 4CNCA 5GS0A 3RIZA 1A9NA 4R6FA 2OMXA 4FDWA 3REZA 4NKHA 4PERA 4ECOA 3WPIA 2OMWA 2UZXA 1KOOA 4V2DA 4BSSA 5IYXC 3WPDA 2ASTB 4L3AA 1GWBA 2JE1A 3G06A 1H6UA 3W3JA 1P8TA 3WN4A 3CIYA 4BSRA 2ASSB 2WQUA 2Z7XA 4R6GA 1OGQA 1LTXA 5GMFA 2Z62A 4K17A 2OMZA 3W3LA 2P1OB 4PSJA 1M0ZA 4ARRA 4QBZA 3RW6A 1XCDA 3A79B 4MN8B 3UN9A 3WPCA 3M19A 3O53A 3OJAA 1P9AG 3G3AA 2O6RA 3UL9A 3WPGA 2XWTC 1O6TA 3GOZA 4R6AA 4PQ8A 4GT6A 1G9UA 3C6OB 2Z63A 4KT1A 2OMTA 3DZEA 4R5CA 1K5GC 4Z79A 4WYKA 4MQWX 4U7LA 5AZ5A 2O6SA 4KNGA 4CNMA 2ID5A 5FTTB 1M10B 3O6NA 4U08A 1H6TA 4KXFB 2ELLA 2R9UA 4R6JA 4LSAA 4V2EA 5CMNA 3W3NA 2BNHA 2BEXA 1WWLA 3RFEA 4PKIG 4LXRA 2Z7XB 3ULUA 1XKUA 1YRGA 4P91A 3ZYJA 4R07A 2OMUA 3WPEA 1OOKG 5AWAA 1FQVA 5B4PA 1K5DC 4GLPA 4XSQA 2V9TB 1M9LA 4BSUA 1OZNA 4M7EC 4C2AB 2Z64A 4R5DA 4FCGA 2Y5QA 4Z61C 3CIGA 3OJAB 4UFRA 5GMHA 2CA6A 2RR6A 3G3BA 3OGKB 4NKGA 3ZYOA 1QYYA 3RFJA 3TSRE 2WQXA 4RCAB 2P1PB 4LSXC 2Z65A 5GQRK 4ARNA 3ZYNA 5HDHA 1XEUA 3C6PB 5A5CA 3UL7A 3JB9j 3UL8A 3CVRA 3BZ5A 5AWBA 4LSXA 3RFSA 5B0NA 3P72A 4PEQB 3FXIA 2JE0A 1ZIWA 2OMYA 4R58A 4Z64C 5B0TA 2WFHA 2P1NB 1DCEA 1OTOA 2V9SA 3W3GA 1D0BA 3E2JA 4LI1A 4G8AA 5IJDA 4YEBB 3OGLB 2Z66A 4C2BB 1DFJI 3M18A 4IM6A 4CC4C 1FS2A 4J0MA 4U09A 1P8VA 4LXSA 4CILA 4L3FA 3E4GA 2FT3A 4TZHA 2V70A 5GMGA 4CC4A 1OTMA 2IFGA 4R09A 2WQVA 5AWCA 3ULAA 2P1QB 3RW7A 1U0ND 1XECA 5HZLB 5GS2B 5LFNA 4XGOA 1JL5A 4P8SA 1SQ0B 4FD0A 4RCWA 4FMZA 4FS7A 3RGZA 3W3MA 3ULVA 3RJ0A 4M7EA 3KJ4A 3G04C 3RGXA 4Q3IA 3G39A 2JQDA 4EZGA 5CMPA 4QC0A 1DS9A 4RWTC 4XOSA 4CP6A 2UZYA 5D3IA 4AY9X 4J4LA 1O6SA 2XOTA 4R08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U06 A;  4R0A A;  1OTN A;  2RA8 A;  1Z7X W;  1IO0 A;  4LI2 A;  4LSC A;  3WPF A;  2O6Q A;  2Q4G W;  4H09 A;  4HQ1 A;  1W8A A;  1A4Y A;  4WP6 A;  4QXE A;  5AWD A;  3WPB A;  5IJC A;  4FHO A;  3C6N B;  4Z94 G;  2A0Z A;  3E3Z A;  1O6V A;  3OGM B;  4Q62 A;  4I6J B;  1M9S A;  4AW4 A;  2P1M B;  4V2C A;  3VQ2 A;  5IJB A;  3E6J A;  1FO1 A;  4OQT A;  2WQW A;  1PGV A;  4ECN A;  4Y61 B;  3WPH A;  2OMV A;  3ZYI A;  4Z8G A;  4B8C D;  4BV4 R;  1KOH A;  3PMH G;  2Z81 A;  2Z82 A;  3W3K A;  1FT8 A;  4Q3G A;  1XWD C;  3VQ1 A;  3SB4 A;  4CNC A;  5GS0 A;  3RIZ A;  1A9N A;  4R6F A;  2OMX A;  4FDW A;  3REZ A;  4NKH A;  4PER A;  4ECO A;  3WPI A;  2OMW A;  2UZX A;  1KOO A;  4V2D A;  4BSS A;  5IYX C;  3WPD A;  2AST B;  4L3A A;  1GWB A;  2JE1 A;  3G06 A;  1H6U A;  3W3J A;  1P8T A;  3WN4 A;  3CIY A;  4BSR A;  2ASS B;  2WQU A;  2Z7X A;  4R6G A;  1OGQ A;  1LTX A;  5GMF A;  2Z62 A;  4K17 A;  2OMZ A;  3W3L A;  2P1O B;  4PSJ A;  1M0Z A;  4ARR A;  4QBZ A;  3RW6 A;  1XCD A;  3A79 B;  4MN8 B;  3UN9 A;  3WPC A;  3M19 A;  3O53 A;  3OJA A;  1P9A G;  3G3A A;  2O6R A;  3UL9 A;  3WPG A;  2XWT C;  1O6T A;  3GOZ A;  4R6A A;  4PQ8 A;  4GT6 A;  1G9U A;  3C6O B;  2Z63 A;  4KT1 A;  2OMT A;  3DZE A;  4R5C A;  1K5G C;  4Z79 A;  4WYK A;  4MQW X;  4U7L A;  5AZ5 A;  2O6S A;  4KNG A;  4CNM A;  2ID5 A;  5FTT B;  1M10 B;  3O6N A;  4U08 A;  1H6T A;  4KXF B;  2ELL A;  2R9U A;  4R6J A;  4LSA A;  4V2E A;  5CMN A;  3W3N A;  2BNH A;  2BEX A;  1WWL A;  3RFE A;  4PKI G;  4LXR A;  2Z7X B;  3ULU A;  1XKU A;  1YRG A;  4P91 A;  3ZYJ A;  4R07 A;  2OMU A;  3WPE A;  1OOK G;  5AWA A;  1FQV A;  5B4P A;  1K5D C;  4GLP A;  4XSQ A;  2V9T B;  1M9L A;  4BSU A;  1OZN A;  4M7E C;  4C2A B;  2Z64 A;  4R5D A;  4FCG A;  2Y5Q A;  4Z61 C;  3CIG A;  3OJA B;  4UFR A;  5GMH A;  2CA6 A;  2RR6 A;  3G3B A;  3OGK B;  4NKG A;  3ZYO A;  1QYY A;  3RFJ A;  3TSR E;  2WQX A;  4RCA B;  2P1P B;  4LSX C;  2Z65 A;  5GQR K;  4ARN A;  3ZYN A;  5HDH A;  1XEU A;  3C6P B;  5A5C A;  3UL7 A;  3JB9 j;  3UL8 A;  3CVR A;  3BZ5 A;  5AWB A;  4LSX A;  3RFS A;  5B0N A;  3P72 A;  4PEQ B;  3FXI A;  2JE0 A;  1ZIW A;  2OMY A;  4R58 A;  4Z64 C;  5B0T A;  2WFH A;  2P1N B;  1DCE A;  1OTO A;  2V9S A;  3W3G A;  1D0B A;  3E2J A;  4LI1 A;  4G8A A;  5IJD A;  4YEB B;  3OGL B;  2Z66 A;  4C2B B;  1DFJ I;  3M18 A;  4IM6 A;  4CC4 C;  1FS2 A;  4J0M A;  4U09 A;  1P8V A;  4LXS A;  4CIL A;  4L3F A;  3E4G A;  2FT3 A;  4TZH A;  2V70 A;  5GMG A;  4CC4 A;  1OTM A;  2IFG A;  4R09 A;  2WQV A;  5AWC A;  3ULA A;  2P1Q B;  3RW7 A;  1U0N D;  1XEC A;  5HZL B;  5GS2 B;  5LFN A;  4XGO A;  1JL5 A;  4P8S A;  1SQ0 B;  4FD0 A;  4RCW A;  4FMZ A;  4FS7 A;  3RGZ A;  3W3M A;  3ULV A;  3RJ0 A;  4M7E A;  3KJ4 A;  3G04 C;  3RGX A;  4Q3I A;  3G39 A;  2JQD A;  4EZG A;  5CMP A;  4QC0 A;  1DS9 A;  4RWT C;  4XOS A;  4CP6 A;  2UZY A;  5D3I A;  4AY9 X;  4J4L A;  1O6S A;  2XOT A;  4R08 A; 
#chains in the Genus database with same CATH topology
 4U06 A;  4R0A A;  1OTN A;  2RA8 A;  1Z7X W;  1IO0 A;  4LI2 A;  4LSC A;  3WPF A;  2O6Q A;  2Q4G W;  4H09 A;  4HQ1 A;  1W8A A;  1A4Y A;  4WP6 A;  4QXE A;  5AWD A;  3WPB A;  5IJC A;  4FHO A;  3C6N B;  4Z94 G;  2A0Z A;  3E3Z A;  1O6V A;  3OGM B;  4Q62 A;  4I6J B;  1M9S A;  4AW4 A;  2P1M B;  4V2C A;  3VQ2 A;  5IJB A;  3E6J A;  1FO1 A;  4OQT A;  2WQW A;  1PGV A;  4ECN A;  4Y61 B;  3WPH A;  2OMV A;  3ZYI A;  4Z8G A;  4B8C D;  4BV4 R;  1KOH A;  3PMH G;  2Z81 A;  2Z82 A;  3W3K A;  1FT8 A;  4Q3G A;  1XWD C;  3VQ1 A;  3SB4 A;  4CNC A;  5GS0 A;  3RIZ A;  1A9N A;  4R6F A;  4NZT M;  2OMX A;  4FDW A;  3REZ A;  4NKH A;  4PER A;  4ECO A;  3WPI A;  2OMW A;  2UZX A;  1KOO A;  4V2D A;  4BSS A;  5IYX C;  3WPD A;  2AST B;  4L3A A;  1GWB A;  2JE1 A;  3G06 A;  1H6U A;  3W3J A;  1P8T A;  3WN4 A;  3CIY A;  4BSR A;  2ASS B;  2WQU A;  2Z7X A;  4R6G A;  1OGQ A;  1LTX A;  5GMF A;  2Z62 A;  4K17 A;  2OMZ A;  3W3L A;  2P1O B;  4PSJ A;  1M0Z A;  4ARR A;  4QBZ A;  3RW6 A;  1XCD A;  3A79 B;  4MN8 B;  3UN9 A;  3WPC A;  3M19 A;  3O53 A;  3OJA A;  1P9A G;  3G3A A;  2O6R A;  3UL9 A;  3WPG A;  2XWT C;  1O6T A;  3GOZ A;  4R6A A;  4PQ8 A;  4GT6 A;  1G9U A;  3C6O B;  2Z63 A;  4KT1 A;  2OMT A;  3DZE A;  4R5C A;  1K5G C;  4Z79 A;  4WYK A;  4MQW X;  4U7L A;  5AZ5 A;  2O6S A;  4KNG A;  4CNM A;  2ID5 A;  5FTT B;  1M10 B;  3O6N A;  4U08 A;  1H6T A;  4KXF B;  2ELL A;  2R9U A;  4R6J A;  4LSA A;  4V2E A;  5CMN A;  3W3N A;  2BNH A;  2BEX A;  1WWL A;  3RFE A;  4PKI G;  4LXR A;  2Z7X B;  3ULU A;  1XKU A;  1YRG A;  4P91 A;  3ZYJ A;  4R07 A;  2OMU A;  3WPE A;  1OOK G;  5AWA A;  1FQV A;  5B4P A;  1K5D C;  4GLP A;  4XSQ A;  2V9T B;  1M9L A;  4BSU A;  1OZN A;  4M7E C;  4C2A B;  2Z64 A;  4R5D A;  4FCG A;  2Y5Q A;  4Z61 C;  3CIG A;  3OJA B;  4UFR A;  5GMH A;  2CA6 A;  2RR6 A;  3G3B A;  3OGK B;  4NKG A;  3ZYO A;  1QYY A;  3RFJ A;  3TSR E;  2WQX A;  4RCA B;  2P1P B;  4LSX C;  2Z65 A;  5GQR K;  4ARN A;  3ZYN A;  5HDH A;  1XEU A;  3C6P B;  5A5C A;  3UL7 A;  3JB9 j;  3UL8 A;  4NZR M;  3CVR A;  3BZ5 A;  5AWB A;  4LSX A;  3RFS A;  5B0N A;  3P72 A;  4PEQ B;  3FXI A;  2JE0 A;  1ZIW A;  2OMY A;  4R58 A;  4Z64 C;  5B0T A;  2WFH A;  2P1N B;  1DCE A;  1OTO A;  2V9S A;  3W3G A;  1D0B A;  3E2J A;  4LI1 A;  4G8A A;  5IJD A;  4YEB B;  3OGL B;  2Z66 A;  4C2B B;  1DFJ I;  3M18 A;  4IM6 A;  4CC4 C;  1FS2 A;  4J0M A;  4U09 A;  1P8V A;  4LXS A;  4CIL A;  4L3F A;  3E4G A;  2FT3 A;  4TZH A;  2V70 A;  5GMG A;  4CC4 A;  1OTM A;  2IFG A;  4R09 A;  2WQV A;  5AWC A;  3ULA A;  2P1Q B;  3RW7 A;  1U0N D;  1XEC A;  5HZL B;  5GS2 B;  5LFN A;  4XGO A;  1JL5 A;  4P8S A;  1SQ0 B;  4FD0 A;  4RCW A;  4FMZ A;  4FS7 A;  3RGZ A;  3W3M A;  3ULV A;  3RJ0 A;  4M7E A;  3KJ4 A;  3G04 C;  3RGX A;  4Q3I A;  3G39 A;  2JQD A;  4EZG A;  5CMP A;  4QC0 A;  1DS9 A;  4RWT C;  4XOS A;  4CP6 A;  2UZY A;  5D3I A;  4AY9 X;  4J4L A;  1O6S A;  2XOT A;  4R08 A; 
#chains in the Genus database with same CATH homology
 4U06 A;  4R0A A;  1OTN A;  2RA8 A;  1Z7X W;  1IO0 A;  4LI2 A;  4LSC A;  3WPF A;  2O6Q A;  2Q4G W;  4H09 A;  4HQ1 A;  1W8A A;  1A4Y A;  4WP6 A;  4QXE A;  5AWD A;  3WPB A;  5IJC A;  4FHO A;  3C6N B;  4Z94 G;  2A0Z A;  3E3Z A;  1O6V A;  3OGM B;  4Q62 A;  4I6J B;  1M9S A;  4AW4 A;  2P1M B;  4V2C A;  3VQ2 A;  5IJB A;  3E6J A;  1FO1 A;  4OQT A;  2WQW A;  1PGV A;  4ECN A;  4Y61 B;  3WPH A;  2OMV A;  3ZYI A;  4Z8G A;  4B8C D;  4BV4 R;  1KOH A;  3PMH G;  2Z81 A;  2Z82 A;  3W3K A;  1FT8 A;  4Q3G A;  1XWD C;  3VQ1 A;  3SB4 A;  4CNC A;  5GS0 A;  3RIZ A;  1A9N A;  4R6F A;  2OMX A;  4FDW A;  3REZ A;  4NKH A;  4PER A;  4ECO A;  3WPI A;  2OMW A;  2UZX A;  1KOO A;  4V2D A;  4BSS A;  5IYX C;  3WPD A;  2AST B;  4L3A A;  1GWB A;  2JE1 A;  3G06 A;  1H6U A;  3W3J A;  1P8T A;  3WN4 A;  3CIY A;  4BSR A;  2ASS B;  2WQU A;  2Z7X A;  4R6G A;  1OGQ A;  1LTX A;  5GMF A;  2Z62 A;  4K17 A;  2OMZ A;  3W3L A;  2P1O B;  4PSJ A;  1M0Z A;  4ARR A;  4QBZ A;  3RW6 A;  1XCD A;  3A79 B;  4MN8 B;  3UN9 A;  3WPC A;  3M19 A;  3O53 A;  3OJA A;  1P9A G;  3G3A A;  2O6R A;  3UL9 A;  3WPG A;  2XWT C;  1O6T A;  3GOZ A;  4R6A A;  4PQ8 A;  4GT6 A;  1G9U A;  3C6O B;  2Z63 A;  4KT1 A;  2OMT A;  3DZE A;  4R5C A;  1K5G C;  4Z79 A;  4WYK A;  4MQW X;  4U7L A;  5AZ5 A;  2O6S A;  4KNG A;  4CNM A;  2ID5 A;  5FTT B;  1M10 B;  3O6N A;  4U08 A;  1H6T A;  4KXF B;  2ELL A;  2R9U A;  4R6J A;  4LSA A;  4V2E A;  5CMN A;  3W3N A;  2BNH A;  2BEX A;  1WWL A;  3RFE A;  4PKI G;  4LXR A;  2Z7X B;  3ULU A;  1XKU A;  1YRG A;  4P91 A;  3ZYJ A;  4R07 A;  2OMU A;  3WPE A;  1OOK G;  5AWA A;  1FQV A;  5B4P A;  1K5D C;  4GLP A;  4XSQ A;  2V9T B;  1M9L A;  4BSU A;  1OZN A;  4M7E C;  4C2A B;  2Z64 A;  4R5D A;  4FCG A;  2Y5Q A;  4Z61 C;  3CIG A;  3OJA B;  4UFR A;  5GMH A;  2CA6 A;  2RR6 A;  3G3B A;  3OGK B;  4NKG A;  3ZYO A;  1QYY A;  3RFJ A;  3TSR E;  2WQX A;  4RCA B;  2P1P B;  4LSX C;  2Z65 A;  5GQR K;  4ARN A;  3ZYN A;  5HDH A;  1XEU A;  3C6P B;  5A5C A;  3UL7 A;  3JB9 j;  3UL8 A;  3CVR A;  3BZ5 A;  5AWB A;  4LSX A;  3RFS A;  5B0N A;  3P72 A;  4PEQ B;  3FXI A;  2JE0 A;  1ZIW A;  2OMY A;  4R58 A;  4Z64 C;  5B0T A;  2WFH A;  2P1N B;  1DCE A;  1OTO A;  2V9S A;  3W3G A;  1D0B A;  3E2J A;  4LI1 A;  4G8A A;  5IJD A;  4YEB B;  3OGL B;  2Z66 A;  4C2B B;  1DFJ I;  3M18 A;  4IM6 A;  4CC4 C;  1FS2 A;  4J0M A;  4U09 A;  1P8V A;  4LXS A;  4CIL A;  4L3F A;  3E4G A;  2FT3 A;  4TZH A;  2V70 A;  5GMG A;  4CC4 A;  1OTM A;  2IFG A;  4R09 A;  2WQV A;  5AWC A;  3ULA A;  2P1Q B;  3RW7 A;  1U0N D;  1XEC A;  5HZL B;  5GS2 B;  5LFN A;  4XGO A;  1JL5 A;  4P8S A;  1SQ0 B;  4FD0 A;  4RCW A;  4FMZ A;  4FS7 A;  3RGZ A;  3W3M A;  3ULV A;  3RJ0 A;  4M7E A;  3KJ4 A;  3G04 C;  3RGX A;  4Q3I A;  3G39 A;  2JQD A;  4EZG A;  5CMP A;  4QC0 A;  1DS9 A;  4RWT C;  4XOS A;  4CP6 A;  2UZY A;  5D3I A;  4AY9 X;  4J4L A;  1O6S A;  2XOT A;  4R08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...