4NKIH

Crystal structure of a fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
221
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEWVSSIYPSGGITFYADTVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epitope characterization of an anti-PD-L1 antibody using orthogonal approaches.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords Fab light chain
total genus 44
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2013-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nkiH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nkiH01
4HHAB 4OD2B 2XY1A 3E8UL 4HK0B 5C07D 1G6RA 1IAIM 4YDJA 1S7QA 3ZO0A 4ONFL 1OCWH 3BQUC 2BVYA 5E6ID 2B4CC 1YY9C 5F96H 4XXCA 5CMAA 3SDCD 5C0JA 3OF6D 5TGBB 4MNGE 3VFUB 3UMTA 1YYLL 3GSNL 1F4WH 4EQ3A 1N6UA 5EULV 3VXRB 5E2WH 4PRPB 2GK2A 5EUOB 3S36H 3SQBA 4N90D 1KXVC 1A1OB 3MRGB 5ESVB 4Y4HC 3Q3GA 4KZDH 4PRIE 1D3CA 4P9HH 3KPSA 1D5MA 4HGMA 3IU4H 3H9SD 1BLNB 5ID0A 3CSBA 3ES6A 4X6DF 2VKWA 2FH6A 2CRIA 2NY2C 2R1WB 1VEMA 1FORH 4PS4L 1GCFA 1DR9A 1OL0A 1NC2A 5EU6B 2G5BA 1A21A 5EC2A 1RV6X 2VR9A 1NGYA 3HFML 4LLAA 2H41A 5JOPE 4GUPB 4ZUWA 1ZEAH 1JPGA 4NO5A 5E95B 3TO2A 4PJGF 1LP9F 2B1HL 3QHFH 1I8LA 3TA3D 3HNSL 2VZVA 5I16A 3HNTH 5AYUL 4AEEA 1XGRA 3MLWL 4YNYB 5C3LD 1WVZA 1JHTB 2EYSA 4TSCH 4XZUB 5BV7L 3DXAA 2CK0H 5FYKD 1K9TA 5IG7B 5E8EA 4OUUA 2BNQB 3X17A 1HH9B 5EC1B 3C8DA 2ITCA 1ZLUH 3RUGA 5CD5C 4QRQB 5C0DA 1F00I 1FDLH 4ONGL 4NRYA 1DUZB 5FIEA 3QDGA 3AVEA 3B3IA 3MRIB 4PJAB 5T1KB 2D03L 1KCVH 5SWZE 4NZUL 5EUKA 3P4MB 1MLCB 5T3XD 4PJAF 3RBSA 4FQ1H 5J89A 3NCEB 3QIUC 1T80A 1DQJB 3BZEA 4PJIB 4RMWA 4UIMB 1NCNA 3MFFB 1MFEL 4PTTA 2AJUL 2X89A 3RBGA 4PJ7B 1UFUA 4Z95L 2AJVL 3U4BL 3V6OC 3ZKNC 3TZVC 3NA4A 3HNSH 1VERA 4ZTPH 1F2XK 5D71L 3M07A 2E7LA 3NPZB 3IGAA 4GG6A 1OY3B 4WW1B 5I1JL 1KTDA 1M71A 2RIKA 4GW5A 3LMJH 4FTVE 5MI0C 2DQGL 4P2OD 4AEFA 1DBAL 2EKSB 3EYUH 1KYOK 5DJDA 3W9DA 4P23B 4AEIL 5IEKB 4WWKD 1LHZA 2DLHA 4H8WH 5JR1L 1EEYA 1R5VA 4ZQKA 4YDVA 2PCPA 1JGVL 4MQTB 3HE6C 3R06B 2X9XA 3RPKA 1YMMD 3ARUA 5CP3A 1QLFA 4F2MA 5BVPL 4PJDA 3NA9L 3VXTB 1FV1A 5EU3B 4BSVA 2GUOB 5CZVH 3SKOA 2J5LB 2DF3A 1PFCA 3MV8B 4RDQF 1JN6B 3HPJA 1RUMH 5JUEH 4N8VG 2IADA 4WUUD 2YD2A 3GSNH 3DVGB 2R23A 3BKJH 3HI6H 4Q97A 1A6WH 1P4LB 1V5JA 2R1YB 4W4NA 2CXGA 2UWEF 2FH8A 5DEFB 1T89A 1QFWI 4M7LT 5E8DH 5B38G 5C2UB 2Z31D 5IQ9A 4YHIB 3LN4A 1RURH 2AQ2A 1SYSA 4JLRB 4Z7UA 4QHNA 2AK4B 5DRNA 4RZCB 5IB3A 4IRJC 1JIBA 2ORBL 4RISL 4F58H 5DZOA 4NRYB 4DVRL 1ZT1B 2AAVA 4LQFL 4A6YH 1N7MH 2Z35B 3BWAA 6FABL 2VXUL 1KN4H 4APQA 3TP4A 1Q72H 5JTWA 3HZKB 3U9UA 3IS1X 4PB9H 1JWSA 3EDEA 3MR9B 5KSUA 1PG7X 2HAZA 5DJ6A 1F11A 3VE0A 4Z5RB 5IMOB 5J1AA 1OP3K 3OKKA 2GTWB 2DYPA 1MFCL 4YH6A 4MJIA 4TRPL 1NGXB 4P46A 2CSPA 3WN5B 5HDOA 2H2SC 2OS7A 2FL5B 3EJYC 1MIEL 1CGSL 3BEVA 2Y6SD 1JYNA 2VLJB 2OR7A 4ODVL 3JWNC 3MJGX 1XF1A 4O5LL 5A3IC 3O3BB 3O11B 4G6KH 5HGDB 5IVNA 3RWDB 4HZLB 2HLAB 2Q8AH 3WIHL 4M6OL 3T08A 1H8NA 5KSVA 4L3ED 4JRXB 1MWAA 2WIIA 3MLSH 5DTFB 1AQKH 4OZHE 5D1QC 1P5UA 3FAXA 5C0NC 3DX6A 4IDLA 2Y4SA 3THML 3MV11 5INCB 4JPVH 2ZCLL 4KDTC 1CFSA 2ZCLH 4HLZH 3F5WA 1E6OH 2JCCF 1AGDA 4R26H 1ZHNB 3MLXL 5FO8B 1P4LA 5GISH 4J3WA 5E2VH 5D7JB 2BHUA 3UYRL 2H26B 2V7NB 3QDAA 4KRPD 1YQVL 3QYCA 4I18B 3P11H 3ZT6A 3ARDC 1CTOA 5FK9B 3PABB 1HNFA 2GHWB 4NM8H 1U8QA 4OV5B 2F8OA 2BDNH 2D7QA 4RMTA 1D5XA 2MHAB 3BESR 1BD2A 1NUNB 5D7JC 2IAND 1UM5H 2Z8SA 4PJHF 5CUSL 2F54B 3LEXB 5E6YA 1HHHB 1JRHH 5AWNH 3BJ91 1MJUL 2H3NB 1BZ7A 3QFJD 1F5WA 2COQA 5DHVB 5CBEA 3X12A 2F53E 5LXGL 2IFFH 1H3TA 4RCAA 1NCBH 4RGMC 4XCNB 5D1XC 3P0YH 4OI9A 4WWKC 2R0WL 4H1LA 2EDRA 4KVCH 3LPFA 1IAIL 2BSTB 2YD7A 5HDBE 5A1AA 3EYQC 4PRIB 5GISL 4LARL 5D1XB 1EBPA 1FJ1B 1X5FA 2VLKE 4IOFD 3BZEB 3OZ9L 1D7FA 1BVKA 3FQTB 5FYLE 2IQ9H 4LVOC 3DX8A 3VXRE 3QH3B 2QV2A 2R4RH 3MRHA 4LHUA 3H3PL 3LVEA 3S3JA 5C7XL 1FVCB 5GGSY 5JOEA 3L3HA 3Q2CA 5L9DH 1D5ZB 2V17L 4DK3A 1YPZE 4GRWF 4YDIH 2A74B 4TUOA 1HE7A 1DJSA 4BSWB 3NACL 4LVOB 3NOIA 3S3PA 1CU4L 4ONHA 5IM7B 4OV6F 3MA9L 4GRLC 3BH8B 5GRJH 4J2XA 3T0XA 1INDL 2FRGP 2AP2A 3CLFL 1U58A 3C5SA 1TQBC 4PP2B 2L7JA 4CW1B 5EU7C 3ETBF 3VXNA 4LSTL 1QR1B 4GW1A 4GMTH 4NSKA 5CJOH 1W8NA 1M7DB 2W0FB 1KNOB 3TBWB 1RY7B 2C4FU 2CUMA 2VC2L 3N50A 2VLME 3MNVA 5C6TL 2LU7A 1JYVA 3RVUC 5DK3A 2E8YA 1K8IA 2D7PA 4X4YB 3MLTA 3VXMB 5CKAA 5SWZD 1OAXL 2P1YA 3OG4B 4G42A 4AMKL 1MQKH 5DRNB 3HMWL 5JW4M 1QYGL 3EYOB 4PIRF 2P24A 1CD1A 5EN2B 1VB9A 3CLEL 5TH2A 5KOMC 1P9MC 2QKIA 1CQKA 3LEVH 3VXMD 1XR8B 5HVWA 2H1PH 2XN9A 4YZFF 4PY7B 1MAMH 4C55A 3MQIA 5LQBH 3S36L 4AENB 4TSBH 4ZNEE 1JF5A 2YS4A 1KTDB 1M71B 5DUPL 5E2WL 3ULUL 4D0DB 3IFLH 4P2RA 1WQVT 1YMHA 1S5HA 4IEFB 3QXDA 4F57H 3GSXA 3O41A 4UUJA 1CK0H 4ZDHB 5JPMB 2HVJB 2NY6B 1EEQA 3SDCC 1EUUA 5F97E 2R0LH 4LEOA 2EE2A 3HNVH 3LV3B 3R8QA 4WTZA 2LTQC 3KYKL 1MWAH 4YO0B 2OBGA 4WU7B 3V6OA 3UBXA 1YPZF 1T1YB 1TQCC 2VQUA 5TE7L 2YWZA 1UCBH 3IDMA 4KK5C 4HD9A 5CEYB 4HUXB 2PYEA 3VH8G 3P0YL 1HI6A 4PBVC 1QLEH 1OD9A 4ODWB 3FQXB 2OYPA 5DVLA 1B2WL 1OGAB 5FO9A 5HYQA 5F9OH 1E4KA 1MHHA 4Z78B 3I75B 4LLUA 2NR6D 3KDMA 5D70H 5DTFA 4XVSH 4HS8L 1CWVA 4KWUA 4ODXB 4O02H 2VN4A 1QSZA 3D3VB 4YFDB 3NMEA 1SEQH 2YSSA 1MLBB 3VFWA 4L9LB 4OKDA 2CKBA 4P3CH 1TVBB 4Y8DC 1CZ8L 4MAYD 4XWGL 5GXBB 3U1SH 4X83A 5DMKB 4NZUH 5DJAB 1M7IA 4X6FB 4OZ4B 3JUYA 1B4JL 1J1XL 1NBZB 1YEKH 5I76A 2AEPH 1Q9KA 4M7ZC 4L9LC 1AGCA 5T3XL 4P49A 1SVCP 3GK8L 3CUPA 2XTJB 4TVSa 1KJ3H 2J88H 5C0ND 1QA9A 2P7TB 4LSVH 3ZYIA 3I6KA 4MCYA 1DZBA 3C2AH 3O45B 4HWNA 2P8PB 4DFHA 3GMNA 3V5DA 3QRGH 1IBGH 1NFDB 3R4DA 3U4EA 3LCYA 3FB7B 4FQIH 1CL7I 1UH3A 4Y1AA 1U8JA 2NY4D 1I1AA 1AO7A 3HZMA 3O9WC 2GAZB 3H9SA 3HUJE 2J6EL 3QEHB 5HI3D 5HYJA 2N7BA 3QCTH 3V79C 1VFMA 2XTJD 3HB3D 1BHGA 4M3KB 3QZWB 4GSDL 3LOWA 3E0GA 4PJGB 3SKJL 3G5YA 2FJGA 5MEOB 3O4LB 1DCLA 2DJ4A 5KW9H 1S78D 1B0WA 4C4KT 2VDKL 3MRCA 1T5WA 3QUMA 3ZDZE 3SDYH 3GRWL 4LDOB 3L1OH 1JPTH 3TBSA 3MPCA 3P40A 3P4NA 5D7LE 3O3EA 3MYJA 2D9CA 4U6VH 3MGOA 2IFFL 4YAQB 5HPOA 4OFKA 2VXSH 4K3JH 1N59A 2Q20A 2I24N 5LCVH 4ZS6D 3D85B 3NCYP 1QLFB 1GOFA 4DJMA 1X4XA 1T1WA 4PV8A 3DV6A 4OLVL 1BMGA 4HZLA 1HOCB 4LP5A 3WUWA 1QG3A 5C71A 1KCSH 3QG7L 3LB6D 3BGMA 3MBEA 2NY0D 4XB7A 4UV4L 2F8XC 4HXBL 3Q6GH 1KC5L 3ARGA 4TVPH 2X89D 1HHHA 1QBAA 4RISH 4F58L 1BF2A 4J1UB 5EPMA 2PYFB 3PGDB 5ITBL 4MNHB 2EYTB 3SOBH 1MCIA 2EO9A 3HNVL 3UJJH 1J8HD 1Z5LB 4L8SB 4PJBA 2UZIL 2CKNA 3VXNB 4Y4FD 1UACH 2FCBA 4IRSA 1CCZA 1UC6A 3FT3B 4BQ9A 3ARPA 2V5SA 4OZFA 4L5FL 1KEML 3MMEA 1G9EA 1INDH 3AY4C 4RAVA 5F1SA 1B0GA 4WFHD 1ZTXH 1A7PL 4P2CG 1JTPA 1A7PH 5BQ7A 1T2JA 2FR4B 5FYLD 5FCUL 2UWEE 1UJ3C 3ZHLA 1U95A 1U8IA 3R0MA 5HDBF 4UIMA 3MSPA 4I3SH 1IAKA 5I73B 5D7SH 4UIKH 1OTUC 2JJUA 4KQ3H 1AGEB 2G5RA 1UJ3B 5E9DB 1ZA6B 5ITBH 4Z7NE 2EIDA 5DQDH 4R4BB 5A2JH 3EDJA 5GPRA 5DVOA 3D25A 3O6LH 4H26A 3C9NA 3PV6A 5A16A 1IBGL 3R1GH 3VFPA 2KQMA 3GSNA 5I6XB 1A6ZB 1M7XA 4KHXH 3UDWA 5D1QD 3I6GA 1TZIA 3TF7C 4HPYL 3B2VL 4Y19E 1EUTA 4HUXA 1QLRA 4KKCD 5F7YC 1N6QL 3OPZL 4UV7L 4D0BA 2PN5A 3ZKQD 5EO0B 4JRYD 2K9UA 1TFHA 2NY6D 4XPBL 5GRYA 1FAIL 1XAUA 1BBJB 1ZSDA 3D87B 1T5XB 2HFFB 4HX1B 4XHQA 3GJFA 4LKXB 4Y4HA 2D4FA 1KULA 4ZFFA 1MRDH 4PY8J 1F4XL 1IZJA 4JAMA 4JY5L 4ZAKC 4YFEA 3DUHA 4M1GL 3MLPA 1U8HB 5DUBA 4BFEA 2AI0H 4H0IA 5IGXL 4YHKH 5D96B 1MLBA 2H2SD 3BKML 3HUJA 2R69L 4XMLL 2BNRD 2NX5D 2XKUA 2ATPB 4L29A 5F6IC 1YYMH 4M93B 1CLZH 5DF0A 3WFDH 1K3ZA 4ZAKB 4JM2B 5ACZA 3K81A 2R2EA 1OF2A 2DQDH 2YUWA 3EBAA 3QHFL 1H5BC 3CXDH 1U8HA 5DUBB 1SYVB 3LKQA 3DGGA 2ILLA 3CZFB 3MBXL 4KI5F 4R96B 3SDDB 4E41A 1A4JA 3DJ9A 4XCYB 1HH9A 2HN7A 2X4QB 1I9IL 5FB8B 4PUBH 3IXTA 2YMXL 4C56E 4APQC 3T04D 3SDCB 1W0VB 2ZUWA 4P3DB 4FXGB 2ERJC 4WO4C 4WEBL 4PV9B 4CVZB 1ETZA 3PGFH 4F33B 4TQEH 2YPKA 1FDLL 1CFNB 1IFHL 3FB5B 5E56A 3MRBA 1S9WA 4KZDL 1CTNA 1BQSA 1ZLUK 2OXGA 4OB5H 1S7XA 2OI9C 3MUGB 2IBGA 2NYYD 1P4IH 4O9HH 5C09A 4Y0GA 4BZ1H 2AKRB 1JUFA 1T0NA 1WFTA 3IJSB 2IGFH 4OM1H 3GEWB 2VYRE 3CDGB 4FFYL 2FX9H 4ZPTA 4P99A 3OWEA 4N8PA 4PJ8D 1C16A 5D7JD 3W81A 3PHQB 1IKFL 1Y6NR 2IPTL 1VSCA 1MSPA 5F1IB 1U42A 2BVOA 1BJ1H 2OZ4A 1HHKA 2FJFA 2GSGB 5GSVB 1F3DJ 4XPAH 5DHXB 1OAXH 4IRSC 2R2BA 2G60H 4ZXBD 4LP4A 1NC4B 2FJHA 5JOFB 4JFED 2W1NA 2D7OA 4L8DA 5HI4C 4KZEL 3CVHA 4ELME 2K7QA 1DQML 2LV4A 2B8OT 2YA0A 3L5WB 4LU5L 4XWOC 4JPWL 3GMPB 3TA3A 4QXUL 4RFEB 2PTVA 4QRTA 4TNVK 5KSAA 4PGEB 4WHDA 12E8L 3KVQA 1LO4H 1FO0B 1OVZA 3MCLL 1I8IB 3BWUC 1NC4A 2J6EA 1SEBB 2E8ZA 3CXHK 5T1KD 3TBTA 2OTUA 5JOFA 1KBGH 1RUML 3W11D 3KJ6H 1LE9B 5LCVL 2APFA 5LQBL 3FAWA 1OCWL 5DUPH 2KL6A 5I9QC 3FZUD 2BSRA 3B9DA 1RZ7L 3DMMD 4NGHH 5IEHB 2NZIA 4LFHG 3RL2B 3Q48A 4PJ7F 1ZT1A 1BZQK 1ETZB 4JM2D 1C5BH 4HKJA 5C08D 5I9QB 3DLQR 3GSXB 3O41B 2R1XA 4RNRB 4OZIB 2I9LA 5CD3B 5ICZA 2XPGB 4Y4FB 1GZPB 2ZOLA 3UTQB 1CGVA 2XQBL 1F45A 4WFGE 5DJXA 3NFPA 2APTA 1HEZA 5D72H 3DX9A 1YYML 4KV5E 3X3GH 1FYTE 2ICEA 3LIZH 4JFYA 5EIIB 2D7MA 1CXLA 1VHPA 3G6JA 4JQXA 1RULH 5D7LB 3ZTJH 1UCBL 4MAUL 1CD1B 1D6VH 3FJTA 4JDVA 3B4NA 4G7YH 5D6CB 2ENYA 1UYWL 4EQ2A 4OD3L 5SWQA 3BKYH 2P48B 2LVCA 4B0MM 1C08B 2Y5TA 5L8JB 4FQJL 3O11A 3VMPA 2CGRH 4P2OB 5IMMA 4MD5B 3ULVH 1S9VB 4JDTL 5DHVA 1UWGH 2HMIC 1RZ7H 1QNZL 4WUUB 2WK2A 2DQIL 3UTPE 2AJSH 1F6AA 3LRSA 3MRLB 4F57L 2JCCB 5B8CB 1KIPB 4ODSH 4XRCA 2RCSL 1KELL 2I5YL 4H20H 2HT2D 3WHXB 1F3JB 4QYOA 4CU8A 3ULUE 2P49B 2FBJH 1NAKH 4NM4L 4KTYA 3QDMA 4A2LA 1AQDB 5JDSB 4AM0B 1G7HB 3SDAB 1YEFH 3I3BA 4XBPA 2HFFA 1MFDH 1RIHL 3BYTA 4UQ3A 2R9HD 5GZNC 2VOTA 3R1GL 5DQJB 2DQHH 4G43A 4LCCB 3S35L 3BQUD 1QLEL 1X5HA 1EFXB 2F19L 1XF3B 5C0AB 4MB5A 2F19H 3NFSH 4JRYB 5ETUA 2ZOKA 3CLFH 2GK0A 3N06B 4ORGB 1BFOA 1DVFC 2X4UA 4LLMB 1J0ZA 1FIGL 4TUJA 4ZSOA 2QKIB 5DEFA 1ZLVK 3P73B 4XVUD 3RY6C 4YJZL 2EDOA 4XXDA 4NKOB 3KYMB 1FZOA 1U3HD 4QXGH 3QISA 1ZOXA 2DKUA 4KRPC 4X8XA 1PY4A 5D7SL 5C0RH 4I0CC 4JY5H 4ALAL 3HG1B 5HI5D 3NFNB 2XNAB 3EZJB 1FBIH 3O4OC 2VKXA 4Z8FH 4Z7UB 1IM9B 3WXVH 3MJ7A 1T4KB 3T0BA 3QXWA 3QEGL 4HIIB 5SWSD 1FLRL 4XXDB 1KUMA 4DKEH 2GSIA 1E28A 1RZKH 1H15B 2YA1A 3MLVH 4ELMA 2ED8A 5F9OL 4CNIB 4GBXB 5IMKA 5J1AB 2P8PA 4MGXA 1KJMA 3NIDF 3CDGA 3MLZH 3HAEA 4BFIB 5KBNC 1P7HL 3QIUA 1AI1H 4GXUN 5ICXA 4G8GA 2V9TA 3VDCA 5FM5M 4G9FE 3HR6A 4HC1H 4MAYB 2IQ9L 1I7TA 3O2VH 3FN0H 3MACH 1ERNA 2DQCL 2BNRE 2NX5E 2C7UB 3WS6C 5JXEC 3X13B 1OQOA 3BYYA 3AAZA 3OX8A 2JTDA 4LNVA 1YUHB 4YXHL 4PTTB 4TPRH 1KPUA 2JB5L 4UOJA 1TLKA 1Z3GL 1NJ9A 1PY9A 5T3ZE 1JJUA 4GS7B 3IKCA 4X6CE 1PEWA 2X4OB 1WWCA 4MCZB 2DYPD 5KSBA 5C8JA 3EHBD 4XNMA 3SJVA 3PJSB 2VDQH 4M8QB 2IQAB 3V8CA 1NCUA 2NMSA 4KQ4L 3L6FA 5CJQL 2F8VA 3FB6A 3K2UH 5A43C 1K8IB 3G6AB 1ZSDB 4NO0B 2Q76A 2GFBA 5D70L 5I18L 1EVTC 5FYKU 4I9WE 2ZUQC 1KJ2H 4POUB 4CMMA 3I9GL 4KI5E 4ACPA 1T7WA 1WBXA 3JV4A 2EYSB 1BGXH 4NQDD 4MXQD 3LPWA 1RK0A 3UAJC 2JJWA 1KXTB 4KMTH 3K2MC 3G5VA 1S9YB 1RHHB 2I9TB 2NW2A 3C5ZB 4DKDC 2DQFB 3FQNB 5CD3A 4POZD 6CGTA 4GAFB 1I1AC 1LK3L 2GTWA 5MEOA 3L7EB 4XAWL 1AY1H 2VH5L 3ZYZA 4R90H 4LPCA 1D9KA 1QQDA 2YOCA 1IGJB 1XGUB 3GBML 1D5BB 1U3HB 8FABB 4OFYD 4OLVH 3C2AL 2Z92A 4LLWA 3IFLL 4NGHL 3C5ZA 5TE6H 2H32A 3IFNH 3CDYA 3HR5B 4N8CH 2PTTA 4YFLI 3ZE1F 4MXVF 3MO1A 1OW0C 5DK2B 2CO6B 3DX7A 4Y5YA 3HS0B 3PWPD 2Y5TB 3ZDYE 1BEYH 3DGCR 3KR3L 4FQLL 4HBCL 1GHFH 3D18B 1V7NH 3EYUL 2CLZA 5T33L 3BD3A 3H8NA 2ZWLT 3P0VL 4NRZA 4LASH 3GMOB 5DJ8A 1TZGL 4RFOH 1K4CB 3ZE0F 3LS4H 3T8XA 4AZ8A 2B2XL 2IF7A 5JIHA 4PRPA 4UBDD 4KK8D 5KJRL 3IJYB 4PJGA 1IM3A 4KJPC 1IAIH 4NN7B 4OZGF 2VLJA 4HEME 4LCWB 3BZFB 1FC1A 3RL2A 5IHLB 1EVUA 3IDGB 3HI1B 5FOBB 2PYFA 1SY6L 4N5ED 4LGPB 4HKJB 5C08E 1WZ1H 4NQSB 3WBDA 1UB5B 2FECI 4K8RH 4XPFH 1UGNA 2CKBL 4HWBH 1NAMB 2EIZA 4NQED 5FV2A 5AZEH 5DMGC 4YWGH 3G08B 4N0RA 3FMGH 3PNWA 3WS3B 1EMTL 4FXGA 1J9CT 1T2QH 3HI1A 5FOBA 5E6ZA 3TA3B 1I3GH 5ABDE 4N9OB 1A7QH 2I9TA 4WW2A 4X6FA 2NNAB 2DM4A 3G6JB 1X6NA 2DN7A 3L5JA 4E41E 5DJ2B 2XN9D 1J8HA 2A9NL 2MWCA 3VFNB 4OZIE 2RR3A 1C1EL 4G6FD 4LLVA 3U0PB 1MI5A 5EU5A 5D1QB 3S98A 4KKAC 1MFAH 2P5WB 4Y16A 4CAGA 1I8KB 1Q9OB 3WXWH 4FFZH 3CDFA 2GIYA 3CK0H 4RMUA 4HJGA 3QI9D 3PDOA 3KPRB 3VA6A 5LGHL 5L7XL 1A6TA 3PHQA 4KY1L 2XN9B 4LLVB 4B7IA 2IPKB 4GW4A 1B4RA 2VLKA 4G6AC 3SE8L 5C3TA 4MD0B 5BOPA 3ZYOA 4WO4A 2RFXA 3F7QA 4AT6B 3B8YA 1BP3B 4PJDE 3MUZ1 3ARDB 3VFGH 5JW4N 5JPNB 4U3CA 5IBLD 1MF2H 3UTPD 5ACMA 3KAAA 3GI9H 1JZ6A 3BP7B 2GJ6E 3H0TB 1MH5A 4JG0L 1NGQL 5BMFL 3B83A 2BVPB 1N64L 4RFEA 2FX7H 3DUSA 2W0KA 4JDZA 4GQ9H 2C3VA 2HA1A 2NY5H 5J06A 4NQDE 5BV7H 2F53B 1MUJB 1E4KC 2H1PL 4WWKB 1PX3A 1NLBL 5JHDB 4O51B 3TN0D 3VG9C 2IWGA 5TFSL 1K85A 3FT2B 4UU9A 1IC7H 3DV4A 4UNTA 2BVOB 4R4FL 2ITDA 5CEXA 1ZGLP 2FHBA 3OKMA 3QUYC 3H3PH 4KRPB 3L6FB 4A6YL 3PWLA 2HJKB 4FZEL 4G8IB 2OK0H 3KDMB 4ZUUA 5DDHB 3BO8B 2E6PA 1JN6A 1ZT7B 4HXAH 4MZ3A 2ARJB 1BZ9B 1XCTA 2CDGA 4AYFA 5TH2B 1NDGB 1MWAL 1ZHLB 2NQCA 1M6OB 2PUQT 5F7EH 4XT1C 4PRDA 1EX0A 2VXSL 2FX9L 1LP9A 3W2DH 3DVGA 1FE8L 3AS2A 1JMZA 1KT2A 2QR0A 2XWJA 4XHJD 1T1XB 3TNNB 3PWPE 4R0LC 4JAMB 1KLUB 2QHRL 1JHTA 1TMCB 4TYUA 4XZUA 4XP9H 2YD8A 3ISWA 3SBWA 3V0WL 5D9SA 1G7JA 4M62H 5I16B 1FVDB 1ND0B 5I18H 2BFVH 5CIPB 5JQHC 5C09B 4JJ5A 1Q1JL 4GG8A 3RDTD 1SJHB 3VWJA 1D5IL 1U3YA 3TH4T 5ANMA 3LKQB 4UB0L 5TDNB 5F7DB 5GGRA 2X4RB 4QY8A 3LEXA 5HGGS 4OCXH 4JPVL 1H15A 1IKNA 3ARGD 3O6LL 3CSYA 4FQCH 3O6FD 4HWZA 4P5TC 2UUDK 3DMMA 2IAMC 4X6DE 5EUKB 2DMCA 2QQNH 4EVNB 2XTJE 2A74A 4TUOB 5ISZA 4PG9A 4Y1AD 4MJ5B 1T7ZA 4MD4A 4WNQB 2B7DT 2APVA 3VA2C 1EAPB 2ICEB 1AO7D 4K3DL 4MSWA 1WIPA 2NXYB 4Z7WE 3D0VB 3TBYA 3RWGB 4D9QE 3QRGL 4KI5D 2WBJA 4K3HA 2R29H 1H3GA 3STLA 5F1NB 4OCRH 4EOWH 1MCHA 1WUNT 1JNJA 5C08B 2J12B 3K2UL 2Z91A 3KPOA 3O0RH 3QSKB 4LL9A 1BFOB 3U0TB 3BW9A 1UWGL 3Q1SH 3OX8B 4L3CB 1A4KB 2EDDA 1EAJA 3GKZA 2W07A 4JG1L 4OF7A 4OBRA 5T3ZH 3CFJA 3TT1H 1UB5A 3C08L 3NCJL 5HHME 3U7YH 4O4YL 3KJ4B 3GRWH 5J11C 4OJFH 1XIWB 4U1LB 5JR1H 3S37H 1JZ3A 5IP4A 2BHZA 5EPMB 1G7LA 4JPWH 1NFDA 5F7KC 5T5FL 1IM9A 3QDMB 3QQ4B 3PABA 4OM0H 2Y1VA 5HJ3A 1XIWC 1BLNA 5IBTH 4CGTA 1A7OL 5IBTL 3KGRA 5GRVK 2ICWB 3VCLB 5AG8A 3IDJB 3HN3A 2IH3B 1AI1L 4F7EA 4S1DC 4Z95H 3MV9A 1HSAB 3FB5A 3UZVB 3TBVA 1TITA 3B43A 32C2A 4X4ZA 5GGSB 4URTB 3JWDC 4QRPD 5F3BA 3PDOB 2GJZB 1I3GL 1HCFX 2RBLA 5T1MA 5D7LA 3SDAD 4XCNA 1NUDA 1Z0MA 4LLWB 1N59B 2PW1A 1IQWL 1MJJA 4KK6D 2CO7B 4NQXA 2JKXA 5D1XA 1FBIL 1A6AA 1U3HA 2HJFA 3K4ZA 2YD3A 4NT6B 5FKAA 4P9HC 2BY1A 4JHWH 2DJSA 4QHMA 5L8KB 1Y18B 4BH8B 3NPSC 3VGAC 4MDIB 2HH0L 1LDSA 3X3FL 5E2UL 2AGJL 4NZTH 1CICD 1JCKA 4RX4A 3G5XA 4P46B 2Z8VC 3EFDL 1MCWM 3ARGB 4AM0A 1KB5H 4MNQA 1H3PH 3QUKA 4YDLB 3FB8A 2GUOA 3W39A 1OWRM 4KKLC 4L3CA 4ZTOH 1ZHBB 2NY4C 5IFJA 5FYJU 3BPLC 1VESA 3CX5K 2V5YA 5CJXA 4K7FB 2B39A 5EU4A 3PF2A 3SGKA 4X4XA 3K1KC 5D6DC 1S5IL 1JYXA 3DIFA 1XCQB 3TPUA 5LXGH 3I6LD 3UP1A 2EDNA 1I1FB 1QBML 3WJLC 4PRHB 3BPLB 5HGHA 4KVNL 2FBJL 4XGZA 5IUSA 2OQJB 2AJYL 2DI9A 5TPWH 1BX2B 4DGVL 5TGBA 1C1EH 4HS6A 2IPUK 4M9PA 3JWOH 3ZDYF 3BWAB 1GAFL 4OIIL 1KTKE 5FYJL 4LMQI 4UT6L 1A7NL 3OHXB 2EDJA 1AXIB 5C0FB 3ZE2E 2P8MA 1E4XI 1YYLH 3HUJF 3L3OB 4M8QA 4UAOC 3TBVB 1VEOA 3TJEL 1UJTA 4S11A 2ZCHH 1SBSH 2V2TA 2ITCB 1MHCB 3HZMB 3DETC 5ALCL 4LOUC 5DJ0B 2ZKHL 1QKZL 5DD0H 3QWQB 3OJMB 2VQTA 3RP1A 3ARTA 4DUVA 5I1IL 5CEZD 1P4BH 5B4MC 3V4VH 2FWOB 1G7JB 5I1EL 1W72H 4JQIH 4WI8A 5EB9A 4C83A 4FHBD 4HDIA 4K8RD 3VXRD 5J8OA 1OT1A 4I77H 1A3RH 1B0GB 3VXOA 4GG6E 4PB0L 1KG0B 3VFPB 3DRTB 1ZT4B 4ZG1A 3UBXI 4N5UA 4K94L 1I7ZB 4DOHB 2LAGB 4NKIH 4QXTA 2JIXB 4F8TA 1EZVX 3WEXA 3QDJB 1INEH 1MY5A 4GMTL 2NTSP 1ACYL 3GSVB 1T0MA 5IMLB 4M7JH 4Z5RA 3VE0B 1W0WB 2IFGA 4GW5B 4NBZB 5JPMA 2F74A 3WFHA 4U1NB 4HMCA 4KRNA 2AJSL 4HZAA 4U1SB 3ZDXF 1NKRA 3FQWB 5DGRA 1WAAE 3C5ZD 5GS1A 4J4PD 2EC9T 3D25B 2N7AA 2CXKA 3QDGE 1NKOA 1N0XH 5EUOA 5FO9B 5HYQB 1BM3H 4YFLF 4KKNA 5E94B 3PQYB 2DQCH 4XCFL 3BW9B 2IGFL 5FA3A 1DQJA 4NPYB 4JM2A 1CFBA 3C60A 4CMMB 5C08A 3INUL 1NBYB 4I0KA 3VXQA 5DS8B 5ID1B 4F9LC 1N0LA 1U8PB 4HS6B 4R0LB 3S35H 2BSSB 4DAGL 2A0LD 3FT3A 1C7SA 2VXVL 2R8SL 1N4XH 3SJVD 5CSBA 5D71H 4X8JA 2I26N 4RAVB 2HP4A 4YXKH 3FONB 1T03L 4O5LH 1DSFH 5EORL 5DQ9B 5IV2B 1RUAL 2DDQH 2E7LC 1D6EA 4ZYKA 5A2KH 2Y36H 3BD4A 2VDPL 3CFCH 4AT6A 3MRKB 5C9JA 2OCFD 4D0CA 4WY7L 5LGJB 4FQQB 4X6BB 1OF2B 4L8SA 1FNSH 4BQBA 1QBMH 1O0VA 5ID0B 3FTGB 1KBGL 5D96C 3E2HB 3P4MA 1LO3H 5FYLH 4HMEA 4P4RB 1IZKA 1KJMB 1NGPL 4OGZA 3U0PA 2GITB 5E5RB 5FUZH 1W72B 3CCHA 3E2HC 4OZHA 4OFYA 3MJ9L 5E4EB 2WNGA 3I85A 3QEQB 1VCAA 4GRLA 2NXZD 4MDIA 3EFFA 4R4ND 5IWLA 3JZ7A 4Y2DD 4I13B 4L8DB 4WFFD 3HZVB 3QIWA 3SE8H 2X4RA 5EUOF 4HHAA 3QUXD 4OD2A 5DT1H 4PP2A 4JFFD 4RMQA 5I8KH 3HE7A 4OIAA 1KN4L 2ZUUA 2WIIB 2Q6WA 3MNWA 3O3AA 3VD3A 2APWA 5FGRA 3U7YL 1FNEA 2BVQA 5AYQA 5F89B 1MFAL 5I30L 2AK4D 3RQ3A 1TZHA 3LQZA 3SE3C 4DQOL 2X4TA 3RVXC 3P30H 3N1GC 1J0HA 4JR9H 2EYTA 3F7RA 3HCVA 1AJ7H 3Q3GB 1J05B 2H2PC 5IJKC 2WP3T 1IGYA 2DQIH 3LSOB 1NGYB 5F93C 5FCUH 5IBUB 2ICCA 3VFMA 4IRJB 4PP1D 4EBQL 3L95A 3IDYB 4PJCB 2CKBB 3OZ9H 4OLXH 3WS6A 5JXEA 1BBDL 1AR1C 2Q8BL 3RIFF 5C0FA 1LP9E 2DI7A 3QIBA 2PYEE 2YSSB 1MRFH 5SWSA 1MJJB 4NUGL 3LHPH 4RGND 1REIA 2YPVH 4W70A 4Z7VB 3DO7A 3IDYC 1LD9B 2Z35A 4IJ3C 2PNDA 4P4KD 3O2WL 4QRSB 4TNWF 4U6HB 3INUH 3IDXL 1T1ZA 5C9KA 4HKZB 1XEDA 5MEQA 3KYKH 1QUNA 4E5XB 3GIZH 1FNLA 1DFBL 4X5XA 2CDEA 3UYOD 1NUFA 4IJ3B 2DAVA 5IW1A 4LVNC 2HVKB 1NLBH 2VDQL 4BM7A 2E9IA 2NXZB 3MLYH 2HH0H 2WWKO 5CJOL 3WMSA 4B50A 3QJFA 3WN5A 4EOWL 1BWWA 1PKOA 4DUWA 2R29L 1DBKL 4YUEL 4GAGL 5IFHH 4XPBH 1PBYA 5D2NC 1MCNA 5E99L 3FCTA 5IT2L 3GB7A 4L8CA 3DSFL 3QUYA 4X80H 2MSPA 1IMHC 1AFVL 5DD3L 1ZHKB 2ZUXA 5JW5A 1TZIB 3BP5A 3U79A 1KF9B 4PJ7A 1NFKA 1RULL 2Z31B 1I8MB 1A8JH 4I48B 1JWSB 2WM0A 5EFIA 3IAGC 1GH7A 4QRPB 1U9KA 3QR2A 5DJAA 8CGTA 5I1DB 3HKFA 4J7RA 2ADGA 1LO5A 3PDGA 5B39G 4HIHB 4NQDA 4CN1A 4N0YH 1YY8A 2OTWB 4IRJD 5EU6D 3BVNA 43C9B 4YPGB 3V4PL 5JXAH 3QG7H 4HJ0D 3SE4C 5CFHA 1FV1B 3GNMH 5EU3A 2YPLB 2UWEB 4DN4L 1KIQB 4JN1H 4ZAKA 4XBEH 1KCUL 2WINA 1YEEH 2ARWA 2ATPA 4OCMC 1A0QH 5INDA 2A83B 4J8RB 5E9DE 1CICB 1F13A 1S7UB 4M8VA 3JWDH 5K9JH 2O5YL 3AC0A 4PRID 3EOBA 3RVVD 4UDUB 1LO2H 5C9JB 4RGMB 2WBJD 3NACH 1CLYL 3TIDB 4CMHC 1BQUA 1ZVSA 1EFXD 2DQFA 5FKPB 3CX2A 2R39A 1S9YA 1H0DA 1S7VA 4ZFOB 3VGEA 1U6AH 1M7DA 1T2XA 1K2DA 1FE8H 5JOPD 5CJ5A 3PWPA 1QQDB 1FVEB 1OGTB 4MCYB 3UPCA 1RVFL 2HVJA 1NDMA 4YIQA 3KYNA 4CVZA 1KB9J 2G2RB 4U49A 4X4MA 3QXDB 3WIIL 1FZMB 4R9HA 2AKRA 5AD0A 3HZKA 2Q8BH 4LEXL 3BSZL 2ADFL 2MKWA 4KJQD 4XNUL 5EZOL 4AIZA 3TBYB 1NFDF 2C4XA 4XMPL 4OZGB 3RDTA 1KELH 5ICYA 4OJFL 1D5IH 4JG0H 4P57B 2V2XB 1K3IA 1FO0H 4Q7DA 4OIBA 2WBJC 2A77L 3BHBA 5K59F 3MRPA 4LSPH 5F1NA 3IDIB 4PJHA 4NJ9H 3DYMA 3SBWC 2VRAA 3PXHA 3GHEH 3SDAA 3BDYL 3T1WA 4F7MB 2XWBA 5EH1A 3UO1H 4EN3B 4XNQA 4JZNA 1HNGA 2AJXL 1J88A 3PGFL 3MUY1 3SDXE 1J1PH 3WDHA 2V5RA 4Z7WF 4ODTH 4RIRA 5E6IB 3RTQA 1I7UA 5CJXC 4XI5D 3MOAH 3NCMA 4XCCL 3FT4B 1VDGA 5DJDB 5C07B 3NTCL 3WSQL 4Z18A 1ZK9A 4G6FB 4Y5YC 5FGSA 5EZJA 2AABL 2V5TA 3BISA 4JQIL 1P2CA 4KQ3L 3WO3B 1FSKC 4I5BB 2VDLH 4BQ6A 4NN5B 3P0VH 3CSPA 3VW3L 2DRUA 4X8JB 1OGAE 4OV5A 3LKSA 3FB6B 4BZ2L 3EW3B 4ETQB 1UKTA 2OR9L 3EYSL 1PG7W 3S6CA 3SE9H 3U46B 4NUJB 2CGRL 1PAMA 2BFVL 3D0LA 1U8NB 4M62L 4OD3H 3QXTA 3S34H 3KPRA 1JZ5A 3V4UH 4N0CD 1MI5E 4RMVA 2XPGA 1CN4A 5L2KE 2HT3D 4H0HB 5I66A 3ARSA 1XR9A 4XVJH 2BOCA 5F6HJ 1TJGL 4EI5C 3FMGL 1QFWM 3T8XB 2MPAH 3S96B 2NY2D 5TDPA 1PW3A 5K9OA 4AG4L 1CU4H 1PG7L 1WBZA 4KK9D 3AS0A 3RIAF 4F80A 5JORA 2V2WB 5IHUL 3FB7A 1DDHA 1GJIA 4HUVB 3DNKA 3PP4L 1IC5H 1MH5B 3QI9A 1JFQL 4J3UA 1WITA 5LG1A 3O2DL 5IVXB 3SCMD 1P6AB 4FQIL 4L9DA 5IVZB 3PHOA 2EXYC 4QRRE 4Q9QL 1QFUH 2I07A 4EUPA 3QNXB 4ZTPL 3RX7A 5BRZE 1EEYB 4PGDA 5L2KB 1OPGL 3OKNB 5DD1H 5T5NF 3WHE0 3KPQB 2D0FA 1F3DH 3SKNB 4LLYA 4DGIL 5C0EA 2ZCHL 1XF5A 1I7UB 2YA2A 4GAGH 4NT6A 3WJLA 5IFHL 4HCRL 5E08L 3STZA 1HZHL 5ADPH 5JQ6L 2O61B 1J1OH 5JQ6H 2ADGB 4YGVA 3U82B 4PPTA 5IHZA 2AERT 2HJKA 3LZFH 1INQA 2W60A 4XX1E 4DEPC 2X40A 2UWEA 1MHPH 4XVUC 5J4MA 3TIEA 3BIKA 2FHCA 3ALWA 4X5LA 2X4UB 2JIXD 3I50H 4NQCA 4JANA 1E27A 2YD4A 3RGVD 4WI6A 3MCLH 4RZCA 1FFRA 5BQ7B 5IB3B 3TN0C 5ETUB 1LE5B 3UJTL 3QUXB 3RWFA 2QQKH 3PP4H 1ZKAA 4WHCA 1IGYB 1YNTA 4ZO6A 4K3GA 3MUJA 3QNZB 1N4XL 4H88H 4M61A 2CPCA 3OGOE 3D3VE 3GMLB 2FSEA 4NKMB 1RZGA 1FGNH 3C2SA 2OXHA 3VD5A 3B9KD 4CDGC 1NAKL 3DHMA 2FEDD 3Q5TA 3O2DA 4YHZL 5GJSL 2DWDB 5CEZH 4XCYA 3DVNB 3QWRA 3B8SA 1NDMB 4JO3L 1EHLH 3NCJH 3ARFC 5AEAA 1NQBA 5C07E 2X6MA 5FKAB 4LFHD 1FYTB 1ZLVH 4Z76B 1S9WB 3MRBB 2CMRL 4RWHA 1CE6A 3MA9H 3OR6B 4P2RE 5CILL 4CU6A 4KROC 4PV9A 4X5WA 2VZUA 2XI9A 4U1IB 3VDAA 4M7KL 4YBQD 1L0QA 2XZQL 5D6CA 4G80A 1JV5A 5GIRB 1X7QA 3VFSB 4PY8I 4M48H 3DXAD 2Y06L 3GBNH 4KMLB 4XNZC 4F7CB 4YBQC 1IM3B 4YDKL 5HYSB 2FNBA 1P7KA 3FFCB 4P4KB 4LSQH 3PUCA 4FQPA 3M1BB 4M5ZH 4RAHA 4JCMA 5JA9A 3RUGF 4H0GA 2IAMD 2NY1D 2MOVA 3NCBB 4Y1AE 1JF6A 5DO2D 1TVHB 1BFVH 4BUHA 3IDXH 3FQXA 3PNWB 2AJZA 3IDNA 5IK3B 5A2FA 1JGEA 1Q72L 4IIQB 2XG4A 1YPZB 4M4RA 3HMXA 1FNFA 2XRAH 3FQUA 4XBPB 2PXYC 4Y2DA 5EBGA 3FT2A 3ZKXC 1DLFL 2YXFA 1BD2E 4O2EA 4JKPL 3OTTA 4YXLH 3KWWB 2H3NA 4YUEH 4UILH 3T77B 2DKMA 2AK4A 2X1XR 5MEPA 3CUPB 1AJ7L 3EAKA 1T6VN 5GRXG 3QP3A 1X5GA 4Z0BL 3DRQB 1JPGB 1BJ8A 2Z8RA 3RGVB 4XCEA 3FO2B 3ARVA 3P3YA 4EDXA 2J2ZA 2W9DH 3OV6A 4TPRL 3DUUA 4ZUSA 4M1CD 2VLJE 3N85H 3QPXH 1DVFB 4UDUA 4XNXL 1JPSH 4P2OA 5IMMB 2F58H 1AGFA 4JKMA 1NGZB 3BPNB 4HS3A 4AIOA 2PETA 3UROR 5C92A 4KGLA 2IH1A 3BKCL 3UTTD 5DRZB 1HHGA 4Z9KB 4JO1H 1NAMH 4KJQC 3R0NA 1LEKB 3GJEB 4TTDC 5I6XC 1JE6A 2YWYA 5IW6B 4Q6IB 1X6LA 2DLIA 1II4E 3RWGA 4I48A 3B3IB 3MRIA 3O4OB 2Q1EA 4BFGA 4OBSA 4U1MA 3SE3A 4QRPE 5MENA 1UM4L 1G7QA 4FQ2L 3TVMC 2QSCL 1HEZB 5IMLA 5JZ7D 1UZ8A 3EDKA 4HIHA 1BAFH 4L3EE 1TPXC 2BJMH 3RWIB 3T3ME 2BC4B 1T7VA 3ZKMC 1KYOJ 4U7KA 2ZCKH 2ZJSL 3F7VA 1ORSA 1C5DB 4LBEB 1KFAL 4MMZC 1IARB 4R4NC 3O3UN 5C0EB 5C7XH 3QIWD 1ES0B 3ULUC 5DGQA 5C09E 5F6IB 3MREB 3VGHA 4MWFB 3IGAB 3RU8L 2CH8A 3U7AA 3UCRA 2PR4H 1NEZG 4XNQB 4G3YH 3PDDA 4HF5L 3DETD 4AJ0A 1R3IH 2HG5A 1LE9A 1RMFL 1WLHA 1AHWA 1YN6B 1ZEAL 2IAMB 5HPMB 1CF8H 3MV8E 4M02A 2Q86A 4JFXB 1RUKL 3QG6A 4NNXA 4G8EA 3FO0L 3WUWG 3H7BB 4PJFF 3MRGA 3OHXA 4MJID 2XZAL 4ZUTB 3I6LE 4X9HA 2ADIB 3BIAX 2XYCA 4XVTH 1JGDA 2WW8A 1NCDH 3PIQB 1JMXA 3WIHH 5GRWA 1BOGB 1K5NB 1DVFA 1KCRL 3CH1B 1NBQA 3K7UA 2GJ6B 3RA7L 1EGJA 3SJVE 5I0DA 5CLTA 5I1GH 1KCUH 3F62A 3CMOH 2ZUQB 3ILPB 3S3SA 2L7UA 1Q9OA 3V5KA 1DEDA 4XCFH 4G9FD 1G6RL 3RWEA 3KJ4C 1N8ZB 5DMIH 3ALXA 2DWEA 3OGCA 4JPIB 1XGUA 3T0AA 3S5LB 4LHUD 3RKDC 3B5GA 5TF1H 2X1OA 3MV9B 3HRPA 5HVHB 4P0DA 1RZ8A 5EO1B 3VG0L 5E8PA 1JUFB 1T0NB 3AS3A 4PJIE 1QSFE 5HGAA 1I1AB 5GS0D 1OP3H 2NY0B 4R26L 4EXKA 2BCKA 1RUKH 3DRTA 3OB8A 2EDWA 5MHSD 4YQXL 4CADA 5CBAA 3QIBC 4J23A 4XNYL 3K0WA 4S1DD 2OK0L 1VPOL 2FEEL 3VRIB 1UWEL 3RL1A 3RZCB 3WSQH 3QIWB 4P2QA 1FVCA 2P43B 1CYGA 1W0VA 4D9LL 4OGAC 4ODTL 1TVDA 1UG9A 4K9EC 2QQLH 1S7WA 3K46A 4I77L 4HUUB 4HUWB 5KN5A 1WFUA 1VKXB 4BK5A 4C4KO 1MAJA 4PG2C 1QTYT 2A2QT 4GAJH 4WFFE 3AXLB 2RHEA 5D8JL 3BVNB 2ZOKB 1LEIB 4YHPB 5ID1A 2VAAA 1QFHA 1QSFA 1G9MH 3IKCB 1ZLWK 3C60B 4FQXD 4OAWA 1HQ4A 3CH8A 5GJTH 3WNLA 4IRJA 1WK0A 3TIEB 4NQSA 4UINL 5KSBB 1XCQA 4Y4FC 3DVNA 3WHXA 3IVKA 4PJGE 3SCMB 5HSFA 3LHPL 4M1DL 3CC5B 4JFPB 1M1SA 4RNRA 4UTBH 1WBYA 3ET9F 2CR3A 4NQVB 3BP6A 3TNMB 2JJTA 5D93B 1UM6H 3GHBL 1DBJL 4MXWH 4L4TD 2XZCL 2X7LB 4G6AD 1HH6B 1E6OL 3QDJA 4R7DB 3KHQA 2VZOA 3V6ZB 4GAYA 4WFED 2PF6A 1MCPL 3OAUH 3PL6D 1VADB 5IW1B 1NANH 1L7IH 2DD8H 5A40E 5L88H 2FYYA 2W9EL 4RGOL 3OKDB 1IEAA 4HUMB 3OPZH 4HW6A 4ZO8A 5DJZB 3QNYA 3HZYB 4YAQA 1SJEA 3ARFA 5E99H 4FQJH 3DVFA 5BS0E 4I1NB 2BNQA 3ESVF 4KAQH 5DI8B 1F4XH 3RA7H 4KAQL 5C0RL 4EEEA 4UMGA 3WJJA 1AP2A 1KPUB 5DJZA 1ULVA 1ADQA 3E1F1 1BFVL 1DLHA 5CEYA 4F7CA 4EZMA 2FJFB 1UXSB 4K7PH 3FRUA 2GCYA 3WKML 5IVXE 1WCBA 1E6JH 1ZVYA 5GIRA 3MOBH 2PXYB 3FOLA 1KTRL 5I19H 2DM3A 2FL5A 5EFIB 4LLUB 1I4FA 3FZUC 5CSZA 3BDBA 5BV7B 4HKBB 3JTSA 3P77B 1OAYL 1RSFA 1OP5K 3CFJB 4JO4L 3ZZ1A 1I8LC 3TYFA 4HKXB 4IRZH 1IVLA 1KCSL 15C8H 3JBG7 4MNGB 3O8XD 4N8VB 3TM6A 2P5ED 3RAJH 2HTLC 1SJVA 4NO5B 4KJYA 5HHQB 2NY5C 3QHZL 4CVXB 4DFIA 1P1ZB 2JF1A 1QSED 5E5MA 3PGCB 1XH3A 1KCVL 1J0JA 2Z4QA 5KVEL 1KFAH 3MBEB 1U3JA 4LASL 4OLEA 3N1QC 3DURB 1I3UA 1NEZA 2ZUYA 4O9HL 5C70A 4Q6IA 1YEHL 4UOW1 3GMQB 3EOYG 4GRWE 3LDBC 3PGDA 4BELD 3LN9A 3C8KB 1I9JH 4K3DH 3QUYD 4HIXL 5C2BH 3N1PC 4OD1L 3BKYL 2DIAA 5DVNA 4N0FA 5T1LB 4KHTL 1Q9LA 5DYOB 5JW4R 1SVZA 2DBJA 2R2HA 5ELIA 5IB2A 3RGVA 5FHBL 3F6IA 4GH7B 1RZJL 3MMEB 2DQGH 3BEWB 4I8DA 4OKVB 2C3VB 2WUCH 3BSZH 1EO7A 3NAAL 1I8KA 1BGXL 4ORGA 2BHYA 5H35A 4KK9C 5I8EB 5HGDA 4HH8A 3U30B 3QDHA 5F7DA 2UY7A 5CGYC 5CBEB 3W0WA 1JWMA 1FL3B 3E6FB 2NLJA 4G9FB 5C0AD 5K33A 4GS7C 3T2NL 4YHLL 2X1QA 4MAYA 4KKAD 1CFTB 2VLRA 2I07B 4WW2F 5DMIL 1V05A 2DL2A 2PXYA 2W38A 4XMKL 4Y2DC 5EO0A 5LBSL 3OSKA 1NGPH 2EO1A 2XIDA 5IK3A 1IAOB 4GW1B 4OIIH 3V6BR 3WDJA 1HYRC 4QLRA 3LS5H 4JFDE 3B9EA 3QEQD 5BO1L 3FHAA 1XF4B 2V7HA 4M7KH 4U1JB 4Y2DB 2XRAL 1IC1A 1KENH 3P9MA 3QCTL 4PTUB 1DL7H 3ZE1E 2OJZL 3SKUD 4G7YL 4XP9L 5IW3A 3CH1A 4ZS7L 3QJHB 5SWSB 4K9EH 1LE5A 2BY3A 4X6DA 2ZUTA 1FFNB 2OL3A 1HQ4B 1CDIA 3QXVA 3HI5H 1P4BL 4WI7A 5JO5B 3FO1B 3U0TA 6FABH 3SY0A 3TZVB 1EFXA 5DD0L 2C3WA 2FD6H 4MHHG 1WWWX 3NH7L 3S4SG 5EDXA 3OKMB 2X05A 3W11C 4OZFB 3H7BA 3WKMH 4HGKC 5DMKA 1X5IA 3WO4B 1P7QB 1N3NB 2DMBA 1KNOA 5F1OB 4Z7OF 4OCXL 1EH9A 1GPOL 4KTEH 4L1DA 1P5VA 4AQ1B 4YNYA 3FOMA 5H2BB 5JZ7C 5DMGD 4ETQA 4BFBD 5IB5B 2MQ0A 1AXSA 5HI3C 2R0KL 3ZKSD 5EOCJ 3WO4C 2VITB 3KXFA 3MBED 3CSYB 2BERA 4YDVB 5I2IA 3MUGA 2HWZH 2P42B 1HHJA 4LQ1A 2HYMA 1ZVSB 4TTDD 1CE6B 4MD0A 3MJ8B 4UV7H 5AZ2H 5TDOB 3OAZH 1JPFB 3A0OA 3QDMD 5EZIL 4NOBA 5GGUB 5MHSE 1KXQE 3H42L 1WZKA 3SDDD 2ZCKL 1MPAL 2ZJSH 2MHAA 3ZL4H 3KPNA 2CRZA 2R1YA 4XPGL 1OP9A 5K9OB 1LEIA 1KV3A 1L0XA 5JW3L 1WF5A 1KB5B 4MXWL 4Y19D 4E9LA 1UM6L 4X9GA 5ESAB 4NHUB 2EEDA 1QR4A 2PW1B 5BZDA 1FL5B 2JE8A 4IRSD 3QT2A 4NQDB 3F65A 4Q9QH 3PP3K 5F44A 5HHMD 1R3HA 3RPIB 3SGJC 4H1LB 4OM0L 3RTQD 3TWCH 1CGTA 4KY1H 5D7IA 5F9JB 4UNVA 1BVLB 1PEZA 5CZXC 5JUEL 3AAZB 4NHUA 4NZRL 5IEKA 4OF6A 3H2WA 3NPSB 2I60H 4CDHA 4ZFFB 4UT9L 3SCMC 2F54D 4PG9B 4QRRD 2H8PA 1KPRA 4M9OA 2CLVB 1JHLH 4YWGL 3KPRD 4Q9CA 3SN6N 1TNMA 4J1UA 1F8TL 1RK1B 1WWBX 4YDLC 4Z7OE 4OB5L 2LU3A 5FK9A 2N4IA 3QWOA 1A7QL 1XH3B 4R90L 4LAQH 2EDXA 1H0DB 1OQXA 4MXQC 4DGVH 4ZUWB 3KPTA 4JY6B 5DURD 3ZLQC 4BH7A 3MRJB 4LSPL 1TJIL 2G5BB 3FKUS 5SV3A 2DMKA 3BPCB 2CQVA 4IRZL 4MQ7B 3TLRA 1WEJH 2HFGH 4XNYH 3UC0H 3VFWB 3Q6GL 4WFEE 2XWTA 2HJFB 5IBUG 2D9QB 2AJ3B 3V0VA 3ZE2F 1I7RB 4PGCA 1HXYA 3BO8A 4WHTA 3E6HB 4LPVA 4RBPK 4PJIF 1IRAY 5TE4L 4HBCH 1KJ2L 4TNVF 1FH5H 1IC4H 2K7PA 3TT1L 3CFBB 2Z92B 4Q9BA 4FN0A 2YD6A 1A7RH 1MCFA 3TO4C 1MREL 1YNKL 4JGUA 1NL0L 4HUKB 2C26A 3LS4L 2LQRA 4UDTB 4FQXC 5C0CD 1UJ3A 1MVUB 4YHOL 4CU7A 4RBPH 4QRQA 3DMMB 4U31A 2YN5A 1FRGH 1RFDH 4OF5A 5BV7C 3HR5A 4NQEB 5IQ7L 2BOBA 2VISA 4M6ML 1P84J 1WJ3A 5F7WC 4MJIB 1FZMA 5F7LB 3QNYB 4JPKL 4DZBA 4WI3A 3NN8A 1QBLH 3MLWH 4NWUL 4N0YL 3GI8H 3T3PF 1I9RL 1NC4D 3GSVA 4F8QA 2V5MA 2J8UA 3RHWF 1CVRA 3NAAH 2XA8L 4DN4H 2BVTA 5EZJB 1X5JA 5MP6H 1NC2B 2YZ8A 2ZZUT 4RDQG 2KKQA 3PQYE 2EYRA 2VXUH 3L3OA 4QT5A 5FGCB 4JREB 1CDHA 1L7TL 5GS0C 1KJ3L 2J88L 4FMFA 5C0JB 3CGTA 5FO8A 3BGFB 1WC7A 5BW7A 1ZHLA 4PJ8A 4BZ1L 2O5ZL 2WBJB 2EE6A 1EFQA 4JANB 2VXTL 1I1AD 2M8XA 1FL6A 1MJ8L 4JFOA 1YC7A 5B39B 3MV8A 4KDWA 1MJ7L 1MFBH 4LMQE 3BIKB 2VDRH 4LGRB 3AB0C 1YY8B 4KRLB 5EC1A 3DO7B 4LLDA 4WFGD 2DM2A 3ESUF 5JDJA 5CZKA 2GJZA 3N9GL 4HJ0C 4YR6B 3GI8L 4OZIA 2JJVA 5DD1L 3IFPB 4FTVA 2HRPH 3PXJA 2FJGB 1NGZA 3VWKC 1R24B 3DURA 4Y4KA 2E27H 3QRFM 4QHKJ 2NY3C 3MJ8A 4HCRH 5CCKH 1UB6A 4OFPA 2QSTA 5C0GB 4W81A 5E03A 5HD8C 1BZ7B 2J8UF 3RI5K 2BCKB 1R6VA 3BQUB 2CD0A 5DLMH 4WCYL 2H6PA 2B4CL 2IBZY 1XF4A 1FSKB 2V7HB 1EO5A 3C6LD 3DXAB 3VD9A 5IVZA 2NY3B 1ITBB 1FYTA 2NXYC 1NFIB 5I74B 3HG1A 1CDGA 4DW2H 3C6LC 2MKLC 3GSWA 5BS0A 3KLHC 3KXFE 2CLRA 2WAHA 5GQBA 4Q2ZA 5A2IH 3SKMA 3U36A 3KPQA 5D6DA 1CI5A 1BJMA 4DK6A 5CKGA 2I27N 4PJHB 4FMKA 1JNHA 5IFAL 2OMBA 3G04B 5C0BD 3MRRB 2F5BH 5D2LF 3WFEH 4HFUH 4OFIA 1T6WA 3B9KA 3C6LB 1QRNB 3O6FC 2O5XH 3IJHA 5HDLA 2NY2B 4J6RH 3S5LA 4K2UL 4OTXL 1K4DA 3S35X 1HILB 4HH9A 3QWRD 3RPIA 5J11B 4HJJL 5I1AA 1BOYA 4PJAE 2QSQA 1JPTL 4OZIF 4XBGB 1GGIL 1XZ0A 4PLOB 3L5XH 3HPJB 1FFQA 4P2YA 3C87A 3ULVC 1NAML 1NGQH 5BMFH 1UZ6E 3RL1B 3NIFF 4YGAB 5IB1A 4XAKE 5FUOL 2VLKD 4LHJB 3JV6A 3DOSA 3C8KA 1U58B 3EYSH 2OR8A 3T0VA 1ZGLM 4LSRH 3ZT7A 1XT5A 3ZDXE 3UTTA 4DVBB 5K9KA 1J8KA 1K8DB 5J13B 4ERSL 2WUCL 1RVFH 1G6VK 1RZJH 1QP1A 4LCIH 4FQXA 1ONQB 4LCIL 3V5DB 5CLWA 3K74B 1P69B 4NKDB 5DD5L 1WTLA 3SPVB 1IC7L 3U9PH 1CGWA 4NUGH 1VFUA 4KJYB 4M7LH 3UTTB 5EZIH 4DVBA 5K9KB 3KNBA 5LAXA 2GFBB 3X11A 1FVDA 4GKZB 3CVIH 4X98A 4F3FA 1HYSD 2YD9A 3FHQA 3TYGH 4CL7A 3MODL 4CNIA 1YEHH 1T1ZB 3AU1A 3CXHJ 1AR1D 5IF0B 3QDJE 3GBMH 3BDYH 5DD6A 5LBSH 2HVKA 4JKPH 1S5HB 5EUOE 3IXTB 1BFSA 3TN0B 4UILL 1B0RB 1YN7A 4M7ZB 2QADD 3QUXC 1KTLA 3QUZA 5JXAL 2R56H 1MFCH 3ABZA 3GSOA 2JB6A 1B6UA 4AQOA 5E2VL 1MEXL 3RZCA 4PJ8C 2C5DC 4UQ2A 5HHOA 4MJ5A 4P4RA 4F7EB 2DBLH 4JRXA 3IDIA 4HX1A 3HE6B 4LSSH 1CD0A 2H32B 2JCCE 1T1YA 3IJSA 3O9WB 1FIEA 1J86A 4LDEB 1C16B 2BNRA 2NX5A 3MRFA 4X9BA 2DYPB 1CDYA 3WYRA 1LEGB 4JFQA 4PJBE 2X10A 2R69H 4Z7UE 3H9SE 3LB6C 3A6CL 1EEUA 1P1ZA 1TJHL 1L6ZA 5HHXL 4L8BB 2JK5A 4KROD 4XC3L 5E7BA 1FLRH 1CBVH 4P5MA 2AEQL 1RJLB 4NRXA 1WIUA 3KPPB 2FO1A 3VFOA 4UAOB 5T5NG 2AEIT 2E7BA 4L9LA 5GJTL 4D2NA 2FJHB 4I18C 3I6GB 2CK0L 1QNZH 1A7NH 4RIRB 2HKHL 5MEQB 4I0PC 4JDTH 1MCJA 4ZSOE 3DBXA 3QZWG 3GZKA 1WZLA 5KSBE 4K2UH 4OTXH 2VLRD 3D39E 3IKKA 3QIUD 5FECA 1EEZB 5KS9A 4I3GA 5KTEL 5D5MA 1O7VA 3KS0J 1QSEA 2GK0B 2MQCA 3IU3A 5JO5A 5DWUH 3QO1B 1S9XB 1VFAA 2EIBA 5DJYA 4MQ7A 3KS0H 1SY6A 2EEAA 1QVOA 1YEIH 4P2QD 5IB4B 4MMXC 2FX8H 2PW2B 1VADA 2LAAA 2D0GA 3KYMA 4KJPD 1MRCL 4Y88A 3D0LB 2BRRH 2DTML 1CICC 4JM4L 3OR6A 3X3FH 4DAGH 3HZYA 3HTLX 3EYVA 5GHWH 3GM8A 1IJ9A 1F4HA 3ORJA 4KDTA 2R0WH 4CMHB 3BP7A 1X5LA 1ZMYA 3PWPB 4G8GE 3BXNA 4ZXBA 4UBDC 4IOIB 1LK2B 2X41A 3IYLW 3MXVL 1DVFD 4JZJA 43CAB 4QXGL 3DUSB 4KJWC 2MJWA 3GMLA 1HHIA 1G7HA 3LZFL 1U3ZA 3SDXB 1MF2L 3GSRB 1GZQA 4CADB 4U6VL 2X1PA 4Q0XL 1QSVA 4O2FA 3GUTA 2EDHA 1AY1L 2VH5H 3CMOL 1JGUL 3U2SB 3ARDA 2Z0BA 3BZ4A 4KTEL 4LCWA 2APXA 4HAFA 2Y25A 1Z9LA 2D31A 4C57C 1Z2KA 3LQAH 1F3RB 4KC3B 1MRCH 4MSWB 2EDFA 2VR4A 1EXUA 4PUBL 1QRKA 2W91A 4L4TA 2NYYC 2CJUH 1FZOB 1VPOH 4CVXA 4Z7WB 2AJXH 5TE4H 4HC1L 1AO7E 1PQZA 3O6KH 4GKSB 4PREB 3V6FB 4B41A 3OG6B 4K55A 4FABL 1R3JB 1R5VB 4U1NA 4PLJD 2FBOJ 4KGJA 1KLFA 1MCLA 4XGZB 2MMXA 3QDJD 5DMJB 1AE6L 2Z4QB 3WV0A 2G9HA 5DC0A 1MJUH 4XCEB 1HHJB 5DJXB 4QCIB 5J6HA 1BFTA 4WEUD 2ESVB 4WI4A 2VITA 1U8OB 3KXFB 3QG6B 4NNXB 4YX2L 3VFTA 5I71C 4Q2ZB 2CMRH 5I74C 2E9WA 3KPMB 1UVQA 1OTSC 1XGRB 3P30L 5TDOA 1BQLL 4IDJH 3EYVB 4NO0D 3TNMA 1SY6H 5TPWL 3RUGE 4YHMH 5INDB 2X1WL 1AGCB 3MNZB 2XFXA 3MZTA 4NN5C 5FF6B 1NGWA 3U83A 4M93C 4TSCL 1RUQH 2ESVD 2LVEA 2DQUL 2I60L 5AAWA 4P5TD 1GGBH 4HDIB 4PJXF 4PJEE 2XZZA 3TFKC 3NFNA 1ZANH 3FL7A 3FOMB 5I8EA 5T1DH 4IMKA 3BN9D 5KSUB 5FHAH 1N8ZA 1GIGL 4R4FH 4GRLB 3DX8B 1EV2E 4AG4H 3MOAL 3MLSL 2A6JB 2QLVB 1H8SA 2ICWJ 3G6DL 1IILE 3EDDA 2ERJB 4FQ1L 1B4JH 4WI5A 1ED3B 3VDBA 3VH8B 4UQ2B 3MRCB 1I8MA 4IMLB 5TF1L 4FFZL 1CG9B 3BN9C 2VWEC 1BVLA 4HIJA 1T89C 5HYSA 2P5EA 5GSVA 3IJHB 4FFYH 5BO1H 1KIRB 4UT6H 2IBZX 4TUKH 2Z93A 1MFBL 1GC1H 4MAUH 3T4YB 1RAMA 3MRRA 4OCRL 1F97A 2D7TH 3WLWD 1DUYB 2VXTH 5L6YH 3KPSD 4EUPB 4BKLB 3X13A 4DGIH 3CNKA 1UEMA 4FG6C 3AUVA 1RPQA 3ZSSA 2G60L 3MJ6A 5C6PB 1PD6A 4NZJA 1RU9L 4WHYH 4K7FA 1Q9KB 4WIQA 3IRPX 3NH7H 4QCIA 3WS3A 5MP6L 4MLIA 4EN3A 5E00A 3KWWA 5H2BA 3T0EE 3A6BH 4PJ9D 3TV3L 3ILQD 2YHGA 4I18A 5C07A 3DGGB 3CAFA 1CXEA 3BKCH 4L3EA 2R9HC 3TNNA 1D6EB 3CXDL 2P5EE 4JFHD 5E6IA 1CL7H 1NCAL 4N1HB 4UT7L 4BUGA 1K8DA 1LD9A 1O7SA 4G5ZH 1OSZA 2FB4L 3QFJB 5BXFA 1A4JB 1TVBA 2NY5L 1U8KA 2EIEA 4ESKA 4PJ9B 5GRZA 2GYSA 3C60C 4DZ8B 2D7TL 3W0WD 4HV8B 4Z77A 4NQXB 1EBAA 5BW7C 1F4WL 4X98B 3G5ZB 4F3FB 4I4WA 4M3JA 3PWJA 5F70A 4WU5A 5FOJA 5IESH 4N1CA 1I7TB 1CDCA 3N9GH 3X11B 4NC1C 5IBLC 3OQ3B 3ARBD 3SKJH 4KUCF 2GTZA 3Q1SL 1U8LA 3V2AR 4P2QB 2B1AL 2CIIB 3BOVA 4IS6B 4JO3H 1DUZA 1F2QA 2MCG1 4MA3B 1SJXA 4DZBB 3SDXA 1D9KC 2AW2A 1EGJH 2ICES 2V6HA 3JTSB 3P77A 3BRFA 2JELL 2EEBA 2YPLD 3I3EA 4KJWD 4MQSB 1C5CL 3C9NB 3PV6B 4D94A 1RMFH 3E6FA 1P7QD 2MCPH 5IKCA 1RZJC 1OM3L 3L5IA 5B21A 4MNGA 1R3LB 2AVGA 4LCYB 4NFCA 3RDTC 4EBQH 1FYTD 2B0SL 2V2WA 1HIMH 3ARED 5FYJD 1L6XA 4YE4L 5E8DL 4XTRD 3O3AB 1U41A 5FHBH 1AKJA 1R5WA 3VMOA 2AV1A 4KKLD 2JJSC 1YMMA 1RZKC 2KH2B 2XTJC 1IM9D 2V9RA 3H9HB 1YJDC 3MYZA 1R5IB 3IDNB 1HILA 2LFGA 3PQYA 3CFEB 5D2LA 1J1XH 2QTEA 4J12A 1TETH 5K9QI 1I85A 4Y8AA 3V6FA 2CDFA 1D9KD 3VXQB 5CIPH 2ESVE 4L29B 1MHCA 5DJCB 4QTIH 2B5IC 4KK8C 2NY1B 2WIMA 3AU1B 1PYWB 4N1EA 4ODUA 3HPLB 2WMPA 3A6OA 3VRLF 4ZPVA 3SKOB 4JVUA 1WEJL 2HFGL 3UC0L 3SDAC 4X4YA 3EO9L 3KYOB 1IGCL 1IGML 2IEPA 4M5YH 1LO5B 1KPVA 4QRUB 1GZPA 3UTQA 3CDCA 5I73C 4ZFOA 5E5UB 3QO0B 4D3CL 3ZKXB 3JVGA 3SGEI 1RZIB 3MV7A 1J1PL 2C4FT 4NC2B 5EZLB 5ITFA 2VDNH 2BVPA 1JPFA 2APBA 1FCGA 4ZPVB 2Q7YA 4ZTOL 3TO4A 4G6JL 1N5YL 3VWJB 1MRFL 3WFZA 5K59E 1F8TH 3EO1A 3MBEC 4NNPL 3GJEA 3NA9H 5B22A 1LEKA 1JVKA 1YEGL 1CLZL 4LNRA 1FNSL 2IH1B 2FSEB 5DVMA 3VI3E 5EOQH 1P84K 1T21B 4X7EC 4ZFZA 1A6WL 4IMLA 3GJFH 3NABL 3MV9D 3NABH 1GAFH 4XBGA 4QGTA 4HUUA 3DI2B 1B0RA 1YN7B 2WANA 1NBYA 1LMKA 2AV7B 1GGUA 3FFCA 4QT5B 3BT2L 3TVMB 2LE9A 1JNNL 4RA3A 4Y5YB 2Z31A 2VTFA 4GSDH 4APQD 2C1PA 5TF0A 2NY7L 4QRPA 1CIUA 1ROWA 1DN0B 4CN6A 3ULSB 1XGPB 4G8FB 3ZL4L 2XICA 2R4SL 2HTLD 4C59B 2X4PA 1W72L 5F8RC 3D48R 2X70A 2PR4L 3X14B 2R1WA 4K3EH 4HULB 1LILA 3WCYA 1ONQA 1KENL 1WAAF 4S0TD 3NCFB 4Y7MA 3OMZA 3SKNA 5FUOH 3CC5A 4JFPA 4DTGL 5ILTL 3ZTNH 1HXMB 4L4VA 3SEPA 4G8FA 1G7IB 1TIUA 1RZGB 5CEZE 1JGLL 1S7SB 1DEEA 3O0RL 5JW4Q 2V2TB 1JGLH 1MCSA 1M6OA 3NIDE 1DSFL 3EJZC 3O45A 3WNKA 4EI5B 4MNQD 2DQEL 3H3KA 3TJHD 2DLFH 3VGFA 3EZ8A 3VFGL 3U9UB 4OZFH 2B4CH 3RNQA 2R2CA 4KVNH 3S96A 4WCYH 4I9WD 3NZ8A 2VL4A 1QYGH 3E8UH 5BZDB 1C12A 3U7WH 1WFNA 1S5IH 4PGZA 2Q87A 4FP8L 1EZVY 2IMMA 1T21A 3HZVA 4ODWA 4FP8H 1WICA 3HA0A 5C0IB 2CJUL 4OCWH 2UV3A 4FQHA 3KNBB 2GEEA 4YC2C 1ODAA 4MLSA 3RVTC 4NUJA 5FXCH 4Q6YA 2X09A 3BMVA 5HYJE 1U3HC 1YN6A 3CFKA 4AY0A 1TZHB 3MV8D 4UUJB 2DWDA 3I2CH 3JXAA 5H35B 4ZDHA 5KVFH 4IOFC 4JN2A 5HTSA 1A02N 5DEGA 1GHFL 2JCCA 4NN6C 5B8CA 2EXYD 2B1AH 5KW9L 3L3KA 1FL3A 1H5BB 1DTUA 4OSUL 5DFVC 1NAMA 3FB8B 3W39B 1CFSB 5GGQH 4Z7NF 2AQ1A 3OKLB 4BZ2H 3RTQB 4WUKL 1B2WH 1A3RL 4XPTH 3QUMH 3OAYH 4XB8A 2C9AA 4S10A 5KS9F 3MRMA 5JHLH 2KQNA 2R23B 1S9XA 1VFAB 5FGBA 3OJDA 1Z9MA 3CZFA 1E4XL 5EU5B 1OAQH 1I9RH 3QULB 4LHUG 2XQYG 4NN7C 4ODUB 4ZUSB 2P47B 5L0QC 3F8UB 4FNLL 1MVFA 1BBDH 2UZXB 4LOUD 4YEFA 3P0GB 3CZJA 3QEUA 1CK0L 1JK8B 1J05A 3D5OF 2PW2A 2A6KB 1KEGL 1HHGB 4FZEH 4G8EB 1IQDA 3TZVA 5L0QB 2FR4A 3PIQA 1D9KB 1ZA3B 5IHUH 1TETL 3MODH 1N64H 3D2UB 3K80A 5FGCE 3MV9E 4YHNA 4LSVL 1CFQB 4YBHA 3R06A 1BD2D 1Q0XL 3V6ZA 3EGSA 1RZIA 3MV7B 3H9YA 4S1QH 4X5WB 3ROOA 4XNZB 3K4DA 4WV1A 3LKOB 1WT5A 3GGWB 5L88L 5L6YL 1MJ7H 1HHIB 1FAKT 3FN9A 4PRNA 1GC1L 1DDHB 1U93B 1ZA6A 3S36X 2AXJA 4MS8D 2BC4A 4RWYH 3TJHC 2Z9TA 1K4CA 4KKCC 5F3HA 3MREA 3C6SA 4NQUA 3J8F7 3AM8C 3L3DA 4ONHB 1GGBL 5IM7A 1SHMA 3TCLA 1A9EB 5T3XE 2X5PA 3N85L 1DQTA 3GDBA 3P2TA 3QPXL 4RFNB 5I1EH 2FD6L 4MJ4A 5C86A 1PSKL 3RWJA 1DBML 5IW6A 4U1KA 2DQTH 4NWTH 2WQRA 2PO6A 5E1HB 4R97C 3MRNB 4NNYA 2VE6A 5EOTA 4HWUA 5I19L 3MOBL 3DMMC 2Y72A 4RFNC 1ZT7A 1FZJB 3V0AC 5MENE 4NWUH 3G9VA 5GGRY 3ALPA 2YRZA 2EKJA 3ARBC 3WXWL 4S1QL 5J6GA 1WCQA 1IAMA 4N8CL 2P45B 5ITFB 2D3VA 3EUUA 1AKJB 3GSUA 3L9RA 1ZS8A 1MCWW 2F5BL 3UTSE 1FFPB 5E8OB 4JDZB 2KPNA 2B20A 3O6KL 1BX2A 3OB0K 3O3BA 5E70A 3VWJC 2R4RL 4G7VL 2DI8A 5HGHB 1MUJA 2QQLL 3MACL 3RZCD 4ZYKB 2J8HA 4XXCC 5FYKH 4AL8H 1WBXB 2FZ3A 5DK0B 4B5EA 4S2SA 4H8WL 5LAXB 5DJCA 4X6CA 1IE5A 2VLRE 3D39D 4RRPG 1HYSC 2QADB 3QUML 2OJEA 1R3KA 3P9LB 4Y5XA 1CICA 3HRZB 1Q9LB 5L7XH 4MJIE 4ENED 5DZNA 3ARYA 4FS0A 4PBWD 4OZGA 3EFDH 3JSSA 3MLVL 4N9GB 3FQUB 3UZQA 1W2KT 1J5OH 3PWNA 1G0DA 4Y5VC 2EC8A 5E2UH 4GKNA 5B8CC 1IAKB 4Y19B 1NMBL 4EI5D 4M5ZL 2L4OA 4J3OC 3OKYA 4POZC 5SX5K 4E41D 4JJHA 1FN4B 4HH9B 4I3SL 2F5AH 3VXSB 5EA0L 4TTGA 2E9JA 4PJ9A 4F37F 5I66B 4Y5VB 2E9BA 1OARH 1FVEA 1OGTA 3CFDA 3QUZB 2RCSH 1A14H 3QZWA 5CMAB 1OARL 2BXZA 2IC2A 3NIFE 5I1GL 5L2KD 4KKBD 3D69A 4U1GC 1YMMB 4G80B 4KTDL 4JM2F 4X4XB 4QXTB 4QOKE 2D03H 1LQSR 1RIUH 2D0HA 3M1BA 1LNUA 4LCCC 5IJKA 3LH2L 2VDOH 3U36B 4CKVX 1DFBH 1C7TA 2R15A 4P4KA 3O8XC 1VA9A 1IAOA 1T04B 3JV0A 4OCWL 3AMKA 5F89A 4R7NA 3GSNB 1QRND 3K1DA 1CF8L 4W68A 4I5BA 4D3CH 3VD7A 2YPLA 4WTXA 2PYED 3GSQA 4LEOB 3BZFA 1A9BA 1X4ZA 1YDPB 2ZKHH 1H3PL 1IGCH 2C1PB 4M5YL 5H8DA 1FCCA 1KJVB 1U92B 3U0WL 3QFJA 2WUBH 2IPUG 5AG9A 5JIIA 1L0YA 4YHKL 4YX2H 2VSCA 3JV6B 3VGDA 4C56D 1JP5A 3ARWA 1PZUB 5J12B 1G7MB 4GBXC 3DHJA 2AJ3A 3V0VB 2ZSWB 3LKPB 1JZ4A 3MCG1 5HHNB 4PRHA 2A77H 4LAJH 1CXFA 2Y23A 4Y5XB 4ZD3L 1IEAB 4DCQB 4TVPE 4X9FA 3MV7E 3VD4A 1CL7L 1NCAH 2EECA 4QHLB 4LCUB 3S4SA 2R0KH 1NCWH 4ZODA 3SPVA 1ZLSL 4Y5XC 2YC1B 5DHVH 3SKMB 5T1LA 5TDNA 5LGJA 2YBRA 1OLLA 3D39B 4AIZB 1YQVH 5CBAB 3O3EB 1GSMA 3QB7C 4E42B 3SOBL 3G04A 3QEQE 3FQWA 1LDPL 3BP6B 3F12B 2AXFB 4LCWD 2WWMD 4DVRH 3ULVE 1E4WH 3D2UD 2VQ1B 1OTUD 1UKQA 2GY5A 4HXAL 3CD4A 1YEIL 2X4TB 4XPGH 1J11A 1IC5L 2Q7YB 1BIHA 3AFLA 1A22B 4PR5B 1FO0A 4RFOL 4F7TB 1R3IL 3WL9A 4TUKL 4PLJC 2W65A 5EU6E 5KSAC 1OLZA 1YEJL 1J7VR 4FFVC 4ZO7A 1YEJH 5GZND 4R4BA 2A6DA 3KLAB 4WDIA 1G9ML 2R2BB 3V6OE 1DP0A 5IR1B 5F8QC 2W9LA 1T20A 2ZP0T 2C1OB 1UYWH 4HIEB 5DO2C 1IGTA 4GRWH 4K71C 1OAZL 2FIKA 5E08H 4NZDA 3P4NB 1SEQL 3MXWL 4XP4L 2VDNL 4PJ8B 2ZG2A 5KS9E 2BJML 3VI4E 5T1DL 2IADB 3F6LA 1UXSA 1YECH 2GQHA 1FL6B 1JNNH 3T0EA 2AS5M 3WE6A 5CGTA 5GGTL 1U2HA 1PJ9A 4NJAL 2NY4B 1YQ2A 5DDHA 4V2CB 3GGWA 2YR3A 3MLTB 3VXMA 1HDMB 4LKXA 3UBXB 3THMH 2ESVA 3U7WL 2AJUH 2W59A 2FZ3B 3GJFK 5DK0A 1S7XB 4JCLA 4N8VA 3WHE1 4ZMAT 4ZUVB 3DTXA 4QTIL 1LWRA 3EOBB 3SDXF 4RA0C 1QPPA 1MELA 1HQRB 3L5HA 3RVUD 3FQRB 4NFDA 4PG2A 1K2DB 1ZWIB 2DWEB 4PRPE 3ARXA 4NO3A 2AGJH 4NZTL 4P5KA 4HWEH 3BEWA 4OKVA 4K23L 4IM8A 4KQ4H 5CJQH 3WEXB 3D85D 4TULL 1D5XB 1MRDL 1CE1L 3F12A 5FB8A 1I1CA 1AE6H 5DRXA 3UPRB 3BE1H 5D9SB 5DURB 5TDPB 4OLZL 4AENA 4LPTA 5L9DL 2DKSA 4MA8L 3HPLA 1I9EA 3WFBL 4F33A 1IQWH 1JHLL 4N0UA 4R97B 1P7KB 3MFFA 1AP2B 4EIGB 5FDWA 1HCVA 3VXME 5E2TH 1WSST 5KJRH 2OR9H 3VXPB 3FTGA 4ZO9A 2MCPL 3WNPA 4P57A 5FEBA 1NFDE 5KG9B 5IOPB 1EXUB 5D1ZB 1OM3H 4KK6C 2NTFB 2DQDL 4J4PC 1TXKA 3HC4H 1ZLSH 2QQKL 4XP6L 4EVNA 1KTLB 1T03H 3IDMB 4O58H 5F3HB 1BBJA 1S7WB 3TA3C 1RJLA 4ZSOB 3QUYB 3MLZL 3IF1A 4X7FC 2E27L 4OI7A 4JY6A 3MCKB 5HYIA 4YHPA 5I1HL 3EOAA 2Q8AL 2NLJB 4G9FA 1Q8MA 2X9WA 4UTBL 4HKXA 1DANT 3VFVB 1KC5H 1V3KA 1PGRB 2ZUSA 1C5BL 3I84A 4F9PC 4OLZH 3TPUB 1A0QL 2H26A 4GOSA 2V7NA 1OGAD 2AXGB 3KLSA 5E1AA 1S7SA 1I75A 1F3JA 4QYOB 1V7NL 4HQQH 1MCDA 4EI6A 4FA8A 4WV1C 4HIIA 1AXSB 1JNLL 1FZKB 3L9RB 3ILQC 5ISZE 5C09D 1DLFH 1QLRB 2ADJB 3OXRB 5DJYB 1Y6MR 3D3VD 3QQ4A 4JREC 4HSQA 1I8IA 3DTXB 4KHXL 5ESQA 1F4YH 4L5FH 4WV1B 1BJ1J 1I4FB 1KN2L 4NOFA 5CSZB 1D6VL 4LF3A 5DJ0A 1V3JA 4DN3H 4YQXH 4OZ4A 4LIQL 5DS8A 4IBLT 3HC4L 5KZCB 1T83A 1U8IB 2V9QA 4LSSL 4TUJB 5ENWA 2VDKH 2IPKA 4GW4B 2XY2A 4HAGA 1DQMH 5F9AC 5I15H 1YECL 2BSTA 5BZWA 3RY6A 4M6OH 4GJTB 4FXKB 2ZG3A 4K7PL 2O93L 3L5XL 2JIXA 4Z7UF 4WFHE 4XMLH 4ZS6C 3QEGH 5DD6B 1W72A 4LPUA 5ERWA 3O8XB 5KZCD 5IROC 4PGCB 1KG0A 5HDQL 4PRHE 3UJTH 1S8DB 1KJ2A 2XG5A 5IMOA 3TZVD 4OGXH 25C8L 3JWOL 4WJ5B 2GSGA 1FC2D 3BZ4B 3GSQB 4I2XE 2WZPD 4PJ5A 2VZ3A 3BRDA 3QQ9C 2M26A 1H3VA 1G9NH 5SV4A 2CKBH 2UVEA 3LPGA 3DO3A 4NYLA 5IVXA 1DLHB 5F7FA 4D8PB 1GIGH 3AS1A 1IL1A 1WISA 1IFHH 4AEHL 5SWQB 1BQHG 5TJWK 4F15C 1T1WB 4X7TB 1F6AB 3MRLA 4LLDB 4LIQE 3FQTA 2YUVA 4EXPX 3PL6A 3VGBA 3X3GL 1RZFH 1NLDH 1PX4A 4PGBB 4U3HA 3MV7D 4X7DC 1IGTB 2NY6C 5INCA 2EDEA 3O2DH 1B3JA 4JGMA 4MS8C 2BX5A 1JFQH 1OWWA 1P7QA 1XZ0B 4JY4A 2ATKB 5AUMA 3L3IA 3UDWC 5A3ID 2LU4A 1MCCA 2Z91B 3KPOB 4JVPA 1A1NA 5CJ8A 3UBXG 4GXVH 2LTQB 1TENA 2JLLA 1QSFB 4IDJL 5KVMC 1IKFH 1OP5H 4KMQA 3RY5A 5I1DA 3QAZB 4QWWD 1NMAH 3ARRA 2VLJD 4L4TB 5GGSA 3O4LD 1BPVA 3FN3A 4PJAA 1KB5L 5T1KA 4E5XA 4NQCB 1QO3B 5GS2H 1YJDL 2QSCH 4MVBC 4UT9H 5D5MB 2IAMA 5HPMA 1NFIA 1C8PA 1HSBA 1ORQB 1PKQB 5I2IB 4K8RL 2ZPKH 3HCVB 4Y2OA 4ISVA 3FQNA 5E8PB 1GGTA 3QIUB 1T22B 2V17H 5HJ3B 4YHLH 3T2NH 12E8H 4UT7H 1KJ2B 1RIHH 4NJAH 3VFTB 3MR9A 2F9BT 5DRXB 1FG2A 2VLLA 3GIZL 4NCC2 3BQUA 4YEEA 3FRPG 5IROA 5I1AB 3EO9H 3W0WB 3BXNB 4ZXBB 4JO4H 1T04A 4V1DB 5E2JA 2P5EB 2XWBB 1XR9B 1ZA3A 3RHWK 2R0ZL 3HS0A 3TVMD 4C56B 1BF8A 5GSRA 2Y9RT 4HKZA 1EA9C 2CIKB 4YXLL 3MRHB 4LHUB 3SJVB 2K1MA 4L4JA 1JZ2A 1V7ML 2EH7L 1QFWH 2HRPL 3PWVB 4PJ9C 1I3RB 3BP4A 1FG9C 4H26B 1YMME 3VJ6A 4UOW0 2DL9A 2VE6B 2DQEH 4N68A 5EOTB 3I75A 5IGXH 1Z9SA 2NTFA 3HAEH 3WFBH 4Z8FL 1KJVA 1U92A 4QGYA 4Y5VA 3DROA 3HMXH 3T65B 2A6DB 4WDIB 1TVHA 2A73B 1UQSA 1G7PA 2F53A 4POYA 2IJ0C 4LU5H 4P3WA 4U7SA 1MCOH 3I02A 4PGDB 5L2KA 3C5JB 1G6RB 4LSDA 4DW2L 1PLGL 2QQNL 5C6WH 1MCRA 4KRMB 5KOVC 3HNTL 5AYUH 2FGZA 1E4XH 3H6JA 2OP4L 3QFJE 4JB9H 2EKSA 1A6VH 1A3LH 2XN9E</