4NKIH

Crystal structure of a fab
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
221
structure length
221
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYIMMWVRQAPGKGLEWVSSIYPSGGITFYADTVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARIKLGTVTTVDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab light chain
publication title Epitope characterization of an anti-PD-L1 antibody using orthogonal approaches.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 44
structure length 221
sequence length 221
ec nomenclature
pdb deposition date 2013-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nkiH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nkiH01
4JHWH 4MJ6A 2Q7NA 1QTYT 2B39A 1CE1L 4HXBL 2R39A 2HH0H 35C8L 2BXZA 1TNNA 3QEHA 4JFPA 5K9OA 5F9AC 5D6DA 2DLFL 2OL3L 3WLBA 4PJ5A 1E4XH 4BELD 5KANI 3L3GA 5D5MB 5C09B 5IR1A 2BSED 5HY9A 3MJGX 4MA1B 3FMGH 4EN3C 5IW6B 1ULVA 5INCA 1S7RA 3MREA 1BJ1J 4JG1L 3L5WB 3MOBL 4HUNB 2P8MA 3V95A 3BP6B 5IOPA 4UV4L 1GPOH 3IAQA 4PJIF 1S7UB 4LNRB 4XBEL 2VZVA 2GY5A 5D1XD 5HGBB 5JMOC 1AGBA 2F54E 2YK1L 3FN0H 4OCRL 1I8KA 3ARWA 4P2OB 1FFOA 3P3YA 4NJAL 2EXWC 3MACH 4XP6L 3QNYA 1P7KB 1CI5A 1BFOB 2CIKB 1FVCA 3F6LA 1FAKT 4L8DA 2D7MA 2NYYC 3O3DA 3PHSA 1AY1L 4JPIB 4QNPF 4ZUTA 2VXQH 5LGJB 4X7FC 5I0ZA 5KTEH 2YKLL 4LPCA 1OTTD 4RMQA 3VWJD 3NIFE 3H3BC 1E27A 2XWJA 3C6SB 5IBLC 4FTVA 4QXUH 3IJYB 2GT9A 1ZHBB 4MD0A 4MB5A 1I8MA 3LY6A 4ACPA 3GMNA 3D9AH 3SDXB 4J3XA 2AV7A 1T89A 4WHYH 1NBYB 3GMLA 4FQXC 1SY6L 3I2CH 3QFDB 1M7XA 3AM8A 3H9HA 3EO0B 4KXZH 5E95B 5TQ2H 4U0QB 4X80H 2FATL 4HHAA 2V7HA 3OR7A 3VXSE 1PYWA 4K7PY 5KS9E 2QSCL 4OB5H 5FGRA 1MJ7L 1CD8A 1N3NB 1FJ1B 3UJJH 3BIKA 3VFSA 4NKIL 5DHVA 2R2HB 4OLEA 2DD8H 2Q6WA 1D6VH 4HC1H 4ZTPH 3VFVB 4QWWD 4RDQG 5EU6A 4RGMB 3MV7D 3V6FB 3TNNA 4I5BA 3FB5A 4P2RE 1KTLA 5CD3B 4I1NB 5DYOA 5DRWB 2IJ0C 3UAJC 1YJDL 3IFNH 2FGWL 2XTJC 3I6LE 5JXEC 2OSLA 1C8PA 5JHLH 4R3SA 1ZHKB 3EJYD 4FXLA 1G7IB 4P3DB 4RRPA 4XGZA 3CX2A 1KIQB 2AABH 4XXDA 3S5LG 3C87A 3HLAB 4AEIL 4GW4B 2IF7A 5LXGL 3EJZC 4YX2L 1W72H 1VFBB 1KULA 5E03A 1Z6JT 4TNVK 3BE1L 2Q76A 4NKMA 2CLRB 1EO8H 1YEIL 1LEKB 1TJIL 4HIEB 3AU1B 1LP9B 1B6DA 4FABH 5H35A 2P5ED 5KSUB 4BSWA 1OF2A 5T3XH 4PR5A 4FFVC 3L7FA 4MJ6B 1DDHA 1V3MA 3ARDD 3KPPA 4GS7C 1UM4H 3QEHB 5K9OB 4JFPB 2AQ1A 4OLVH 3WLBB 4PJ5B 1YEEL 1R3IL 3L3GB 1Q0XH 5IR1B 5HY9B 1HSBA 2EH8L 3V6OE 3MFGB 1DVFD 2Z31D 2HKHH 4M3JA 5INCB 1S7RB 5IHUH 1XGUA 3MREB 3TT3L 4G8GE 1U36A 2VJXA 3ZYJA 5HVHC 2DM4A 4OZHA 3BRFA 2XXMB 2P8MB 3QCTH 1WFUA 5IOPB 3GRWA 1T2QL 5CJOH 4U1GB 1K6QL 1J88A 2UY7A 3O8XD 1AGBB 1I3GH 1I8KB 1FFOB 4NWUH 1K85A 3SE9L 1K9TA 4EZMA 3SOBL 1KNOA 1FVCB 2EDQA 1F42A 4OKDA 5E4IA 1DQDH 5JNYB 3O3DB 3TV3L 2VQTA 4LSUL 5F93C 3VG9B 1BZ9A 2AJXL 4ZUTB 2HRPH 2H9GA 3TZVB 5GIRA 2R0KL 4YDKL 2HFGL 1BIHA 1E27B 2H45A 2XWJB 3RWDA 3LKNA 1ZHNA 4FTVB 2GT9B 4MD0B 4OD3H 1I8MB 3MBED 3GMNB 1OTSC 4PJBF 2AV7B 4N8CL 5DRXA 2GQHA 4ZFGH 3GMLB 3WIIH 3BAEH 3H9HB 5HVWA 4S0SD 1ZT1A 1EFXD 4ERSH 4HAGA 2BJML 4HHAB 2V7HB 2VXVL 3OR7B 5DO2C 1PYWB 4LOUC 4LEOB 2OX5A 1TZIA 3PHQA 4TNWF 2AW2A 3BIKB 3KLAA 4R2GC 5DLML 4JGJA 2IPUG 3VFSB 2XG5A 4AEEA 3T1WA 2YOCA 1WAAF 5DHVB 2I9TB 2VQ1A 2Q6WB 5EU6B 3JWNC 5TDNA 4H8WC 4DZ8A 2BNQE 3LPFA 3TNNB 1I3UA 4I5BB 3FB5B 3P0VL 1KTLB 4PJ9C 4JE4B 5DYOB 3L9RA 4ZFOL 3QAZC 2VLJE 4NFDA 1BQHB 5FFLA 3O4OC 1UEYA 5C0FA 4XT1C 4R3SB 3TBVA 3QCVL 2H1PL 4XGZB 5KSBF 3QI9C 1X5JA 5SWSA 4XXDB 2YN5A 1AO7A 4TRPH 5CEZH 1G7LA 5A40E 5K9JL 1YN6A 2R1YA 4DOHE 2R56L 1MCPL 2UY6A 3QJFA 4OSUL 5DK0A 4OTXL 4NKMB 4P5TA 3BO8A 2ICWI 3ZE1F 3BRGC 3R8QA 1T20A 5GSVA 5C0BD 1MI5A 4M5YH 4X0KA 4AYFA 1AFVH 4K9EH 4N0RA 5H35B 1OARL 4I4WA 4OGZA 3Q2CA 4BSWB 1WEJH 4Z7NF 3HC3H 1TIUA 1OF2B 2V17L 4L5FL 5F7DA 1YC8A 3GM8A 4PR5B 5F8RC 4KZDH 3L7FB 5JA8B 1PQZA 5FM5M 1DDHB 1X9QA 4YHZH 3KPPB 5J57B 2ILLA 1ZE3C 1F8TL 3U2SA 3TA3A 4OZGE 3SGEH 4PIRF 2PXYC 4NO5A 5FCSH 4JO4L 1HSBB 1H5BA 1JF6A 2EIEA 5DK2A 1XGUB 5CGYD 5M95B 4XCCH 2ZZUT 4EXPX 4OZHB 2RCSL 1JNNH 2YRPA 1JHLL 1SQ2N 5TJWK 4WI4A 4H0HB 2NTSP 4OFPA 4PS4L 4PP1D 4HEPG 2GSIA 2Y06L 4NO0D 1F4WH 5DRZA 1KNOB 5GPRA 1T21A 1AGDA 3MNVA 4JKKA 3ZTNL 4M03A 4O5LL 12E8H 5J6HA 2QSVA 4OF7A 3T2QA 1QBAA 3F62A 1BZ9B 2AKRA 4FQCH 2H9GB 1RI8A 2XY1A 5GIRB 2R4RL 4WVRA 3UPAA 1IKFH 3NGBB 1XR9A 3RWDB 3TN0D 2MQ0A 1ZHNB 1UKTA 2VISA 3LIZH 4KRPD 1KN2L 4WI5A 1GGCL 5DRXB 3VFTA 1BQSA 1DLHA 3P0GB 4MVBD 1QACA 3CFJA 3PP3H 1ZT1B 3AMLA 1FNAA 1NAMA 5TE4L 1YNLH 1TZIB 3PHQB 3QHZL 3KLAB 1WZ1L 3DXAA 5FGCE 3HMWH 4S1QH 5FOBA 2FJFA 1HOCA 3QXUA 5TDNB 1NANH 4NZUL 4DZ8B 3JZ7A 2OYPA 4ZTOH 2R1XA 1UKSA 4X9BA 3SE8H 1MCQA 3L9RB 2R4SH 4F7MA 1DE4B 4MJ2A 5C92A 2J4WL 4MA8L 5EUOE 5DHVH 5C0FB 1B4RA 3SDDC 1JRHI 5F1NA 1ZS8B 1PKOA 3TBVB 4P4KC 4HUWA 4L4VD 2FL5B 4JR9L 5F96H 4Y2DC 3VI3E 5SWSB 1AO7B 1KFAH 2X4PA 5JXEA 1G7LB 1YJDC 2R0LL 2R1YB 3O2WL 2HTKC 2QHLA 3QJFB 2X4OA 5C7XH 3S36X 5DK0B 4P5TB 3BO8B 4YXLH 1PD6A 1T20B 5GSVB 2D03L 3V6BR 4R8WH 1MI5B 4X0KB 1QYGH 2AJYL 4I4WB 3BGMA 4LVOB 1MF2L 4UU9A 4WNQA 4LNVA 2CR6A 5F7DB 5JW4M 1OQXA 1NL0H 1PQZB 3L95B 4HS3A 4V2CB 1LP9F 3I6GA 5EIVA 3TBTA 1D9KD 4ORZC 4GMSH 4N9OB 3TA3B 4YDIH 2H26A 4QGYA 4NO5B 1H5BB 5IT2L 3CZFA 3MRDA 4OBRA 4OGYH 3SKOA 3WNNA 4PJEA 5DK2B 2EDBA 3PWPE 4P2QE 5CJBA 1V3LA 2OM5A 4PJCF 4L9LC 1S7SB 1U2CA 4Z7QF 2YZ1A 3ZE0E 4NN5C 4N0FA 4POZC 1LE5A 4MJIA 1A22B 5DZLA 3TP4A 4XVSH 5HDOA 3O2VH 4KHTL 3ZHLA 4OUUA 1MCNA 2GSIB 1J0HA 2RQ8A 5DRZB 1FVEA 1FNSL 4F3FA 1T21B 1AGDB 3MNVB 4TQEL 3S4SA 2VLRD 1K3ZA 2J8OA 3ARGD 1TJGH 5J6HB 2R2EA 4NNYA 4XB8A 5J3HC 1NCWL 4JPKL 4F7EA 2ZJSL 2E9IA 2AKRB 1IGFH 3GRWH 3GSUA 4X7TA 4QOKD 2I9LA 1Q9KB 3G5VA 4A6YL 4M3KB 1NCBL 2VISB 1KGCE 1FVDA 5F7EH 3KNBA 4HS8H 4LCIH 1M6OA 2J2ZA 3VFTB 1XZ0A 4M00A 3ARED 3BP4A 1IFHL 3FRPA 3HE7C 5B8CC 1OSPL 3CFJB 4WHDA 4DKFH 3SJVD 4JO3L 4KK5D 1J1PH 2FD6L 2M26A 1YUHA 2EIBA 2D4FA 5E9DE 2V5MA 2NY3B 4M7LH 3HR5B 1NAMB 2WSKA 2AEPH 5JIKA 3DXAB 4F37K 1F11A 5FOBB 5LGKA 5D7JD 2AJUH 4ZO9A 2YD4A 4K3DH 2FJFB 1NFIA 1HOCB 5GGVL 4IDLA 2Z8WC 4OJFH 4AMKH 4YHOH 2R1XB 4HXAL 5GJTH 3QDJD 4W81A 2X4SA 4UB0H 1AJ7H 1MFAH 1IRAY 3K1KC 3VH8A 4LPYA 1HXMA 3NCJL 4F7MB 2BK8A 3CMOL 2BNRE 3QWOB 5F71A 1G6RL 3O2DL 3RX7A 3RTQA 4NIKB 4P59H 4N9GA 4U6TA 2VWEC 1N26A 4XPAH 5F1NB 2W38A 4HUWB 4PJ9A 2OMNA 4K23L 4L8SC 3VXRE 2X4PB 2XTJB 3FT4A 3WNPA 1S9YA 3AY4A 4KU1A 4XX1E 3LEYH 4MXVE 2W0FA 1UXWA 2GCYA 2X4OB 3BDYH 4XPTH 4KJPC 1CDBA 4HK3J 5IVXA 1JUFA 4Y8DC 1GL4B 1P7QD 3VG0L 3QI9A 3BX7C 1WF5A 3QUZC 3PE9A 1Q9WB 5DVNA 1OAKH 1JWSA 3BGMB 3BIBX 4IRJA 1MJ8L 4WNQB 4PREA 4FXKA 5IESH 2Q87A 2C1OA 5DRNA 3QDMA 5B3JF 5E94A 4HS3B 5CBEA 4OLWH 3I6GB 1G1YA 2W59A 4B41A 2FB4L 5I1IL 4PJHF 2VSCA 3OXRA 3TBTB 2C3XA 2H26B 4G3YL 1IC5H 3ZE2F 4YBQC 5BV7L 3CZFB 3MRDB 5I8OH 3SKOB 1A6WL 4HZAA 4PJEB 1HKFA 2I24N 4GS7B 5DVMA 2FYYA 3TCLA 3WMSA 3BKYH 2GI7A 1DQQA 2FHCA 1MAJA 3CC5A 3HNVH 3VRLE 3OL2A 2WUBH 1JTPA 1ZKAA 1LE5B 4N0FB 4YZFF 4R6UA 2OTWA 3TO4D 1DJSA 5L0QB 4H20L 4KRLB 3OKKA 4XVJL 5DD0L 1FVEB 4F3FB 5HVHB 2OL3A 1IBGL 4HQQH 3S4SB 4JHAH 2IADB 3G6DL 2R2EB 4NNYB 4DTGH 4F7EB 1NUDA 3D3VA 5I1LB 1N5YH 4MGXA 3GSUB 4X7TB 1NLBH 3RPKA 2I9LB 1QSVA 4BZ2H 3G5VB 3GDBA 3MOAL 4GBXC 1SVZA 3V79C 3WEXA 5D96C 5CSGA 4PGZA 3G08A 1FVDB 1J1XL 3U4EA 1TJHL 3KNBB 4WWKB 1M6OB 2B2XH 1HXYA 4NWTH 3BP4B 4PJXE 1ZVHA 1Z0NA 2IBZY 3BI9X 1J8HE 3CPLA 4HG4K 3TVMD 2UVEA 1F58H 1PBYA 1YUHB 3PV7A 4KV5E 3MRQB 5EU4A 1ZVYA 3UJIL 4CJ1A 3DWTA 2HG5A 1ZT4A 2KH2B 4N5EC 3FO2A 1IGYA 4DVBA 2NLJA 2A74A 1LILA 4GG6E 3N85H 1F11B 1QSFE 1NFIB 4J3SA 4N0CD 4O9HL 5IB1A 4ZFZA 4ZFFA 5DZNA 4UTAH 2X4SB 3ARPA 3K4AA 3VH8B 3ZHKA 1NAMH 4P5KA 1ZLWK 1HXMB 4LRIC 1E4WL 5E2WH 1IGIH 3QUMA 4I3SL 3RTQB 4N9GB 2CDEA 4TN9A 3UTTD 1RPQA 2DWDA 4PJ9B 4B50A 1MJUL 2PW1A 3CLEH 2DTMH 3QAZB 5DFWH 1KPRA 5T1LA 4S2SA 3FT4B 3RHWF 4EJ1C 1S9YB 1KCUL 1SBSL 1JL8A 1MQ8A 3O4OB 3O0RL 5T1KD 3T0AA 1UXWB 4DEPC 5L7XL 3SQOH 4Z8FL 3SDDA 2NCMA 2GCYB 4H1LA 1RIUH 4UIKL 5IVXB 1JUFB 2YPLE 4P4KA 4PRHE 1A4JA 3QI9B 5EH1A 1DQML 4XHJC 1YPZE 3DJ9A 1JWSB 4IRJB 4DFHA 4X6FA 4PREB 1K8IA 4FXKB 2DWEB 3BN3B 2C1OB 2MQ3A 1BFSA 5DRNB 3QDMB 2R29H 5CBEB 4ZD3H 1YN7A 4OCXL 1U95A 3C2AH 3KHOA 2NXZC 5SX5K 3OXRB 4M6OH 1JBJA 3ZDYF 4FMFA 2Z0BA 5E6YA 2XWBA 1M05A 3R0NA 1RK1A 1JK8A 3THMH 4ODXA 2XZQH 3SHSA 2FYYB 4RAVA 3TCLB 3S8WA 1DQQB 1PEZA 2XT1B 3CC5B 2B8OT 3BD5A 4JPWH 4L3ED 1CD1A 5E8DH 4ONGH 2WBJC 4QHKI 3OMZA 3DX8A 2OTWB 4Z77A 5I9QB 3OKKB 2W9DH 4PJDE 4KHXH 4QXWA 2OL3B 2YRZA 4L9LA 4DKEL 3ES6A 4N1CA 2VDQL 4PJAA 4LSQH 1R3LA 3CFBA 3KYOA 3D3VB 2C3HA 1QR1A 3NTCL 4FXGA 4OCMC 3ROLA 3ULUE 3BKMH 4Z0BH 2YN3A 1P69B 2ADFL 4B0MM 4JFZH 3U4EB 2AXJA 2P47B 4JFDA 3AS1A 5HHOE 3GMPA 1HXYB 4EOWL 5ADPL 3I02A 2ZCHL 3CPLB 3H7LA 1HIML 3WHE1 4Y19A 15C8L 3IAPA 4R90H 5EU4B 2IBGA 2HJKA 3A6OA 1ZT4B 3FO2B 1IGYB 4DVBB 2NLJB 1A8JH 1IC4H 2A74B 5FYLH 4P5MA 3HE7A 4DGYH 3KPRD 2YXFA 4ZPVA 4QTIH 3U7WL 1P4BH 3K8LA 3U9PH 3RVVC 4UNUA 4N0UA 1JRHL 3C09C 4ZFZB 5IB1B 3TH4T 2VL5B 4ZFFB 5MEPA 4LLAA 5B3NA 3QXWA 5EZJA 4FHBD 3G04A 5FF6B 2VXSH 4P5KB 1KPUA 5LAXA 4MAYD 3ARTA 4GKNA 3QUMB 3T08A 4OM0L 4YAQA 2NX5D 4WW2F 4UBDD 2CDEB 2PYEA 3D2UD 3MLUL 2DWDB 2SEBB 4CMHC 4MB3A 2PW1B 3VXQA 3DTXA 5ACLA 2XYCA 1KPRB 5T1LB 2FEEI 5ITBH 3HUJE 4HV8A 4QT5A 5F1KC 3TF7C 4LEXH 3E1F1 1JP5A 4H1LB 4M1GL 3PG2A 4PJ8C 4PJGA 5D7KD 4P4KB 3WFCH 1A4JB 4I0KA 2M1KA 4JO2L 3LV3A 4CNIA 4H8WH 4L8SA 1MH5B 3S35H 1U6AL 5HYEA 1UJ3C 4X6FB 1UVQA 4OD2A 5I19L 1U8OA 3VFRB 3DYPA 1YN7B 5C9JA 1U95B 5DQ9B 5JR1L 1OAYH 1YY8A 3QUZA 4GRMA 4CKVX 2OXGA 2VAJA 2XWBB 4JM2F 1M05B 1RK1B 4GAJL 3ME0A 3VGGA 5D7IE 5MERA 4ODXB 1MCJA 1NSNH 3UCRA 4GAGL 1FL3B 4J3VA 5D7SL 2FWOA 4RAVB 4F58L 2IEPA 5J56B 3VRJA 4C58B 2APVA 3RP1A 4WW1A 1G6VK 5L8LB 1A9EA 2MNUA 4PLJC 1CD1B 2I60H 4FZEH 3UMTA 4IEFB 1OP3K 4XC1L 1IGML 5BV7C 3DX8B 1JTTA 4JKPL 3U0PA 4KVCL 4L9LB 4IRSD 25C8H 3VXMA 3ES6B 4PJAB 2DQGL 4NN5B 4TSCH 1PG7W 4WFGD 2P8PA 1R3LB 3CFBB 2HAZA 1QR1B 1AIFA 5I73B 4Y5YC 4FXGB 3F58H 3HG1A 3ROLB 5T3ZL 1L7TH 1H3VA 2MTPA 2MKLC 2XZAH 5L9DL 5FECA 1JTOA 3C2SA 3CK0L 4M02A 5IB2A 4HJGA 1NCNA 4P9HL 2VDPL 2BVUA 4JFDB 1LO3H 3W2DL 3GMPB 5IIEA 4YGAB 1I1RA 4K8RD 1UWEH 2AK4D 3I02B 4GBXA 1XCTA 4XCNA 2Z4QB 4XP1L 3FQWB 3OKOA 2IBBA 4Y19B 3MLSH 2HJKB 2MCG1 4PB0H 3RUGF 1NJ9A 3GSQA 1RIHH 3HE7B 5A2JH 4L4TA 4D0BA 1NFDE 4Z95L 4ZPVB 4PY8J 2AJZA 2YD9A 3RI5F 3BT2L 2YMXH 5DD1L 5MEPB 5DURB 4JKMA 4OLYH 5EZJB 3G04B 5SX4I 4D2NA 5LAXB 1KPUB 1U92A 4GKNB 4YAQB 4EBQL 1AXIB 5GZOC 3OPZH 5C3TA 3U6RA 3SGDI 2PYEB 1F2XK 5C0AD 4NZTL 3LS4L 4OF3A 4M7KH 5CJ5A 4PRIA 2KDGA 5HI4C 1MWAL 4LRIA 2Y1VA 4HV8B 4QT5B 3QUMH 4PJGB 3MQIA 3KXFE 3LV3B 4CNIB 1GHFH 4L8SB 3VXTA 2D0GA 4YK4C 4BQCA 4MJIE 2X9WA 1INDL 3QIWD 1UVQB 2Z8VC 4OD2B 4Y4KD 1U8OB 1MLCA 4NKDA 5C9JB 1LO0H 4JG0H 1UWXK 4IMLB 4H1LH 4YO0A 1YY8B 3QUZB 4GRMB 5T1DH 4Z7VA 5J12C 4F57L 4X4MA 3L6FA 5IM7A 3ZKNC 3HC4H 3JTSA 4WU7A 5MERB 5BXFA 4MXWH 2K9UA 4K2UL 2FWOB 3DARA 3VRJB 5FYJE 4PJFA 4APQD 3MV8A 3WFDH 3MJ9L 1A9EB 4U2ZA 4V1DD 1CXLA 4NHCL 5EO1A 2MKWA 1IEAA 5AD0B 5D2NB 4KMTL 5C0EB 3L3JB 4X5XA 3U0PB 1J11A 1G7QA 4OT1H 2A38A 3HE6D 4XNUH 3O4LE 4KPHH 4BFEA 2WBJA 4HULB 1Z9SA 2P8PB 7CGTA 4RGNE 5AEAA 3U1SL 1AIFB 3LQMA 5DT1H 2BSRA 2VZ3A 3GB7A 4XAWH 5CZKA 2W92A 5B39G 1WBXA 2DQIL 1IQWH 1A02N 5FECB 5IB2B 2AS5M 4KJWC 4HJGB 5T1MA 1P1ZA 4P3CL 1IAIL 5DMIL 5IIEB 2KQMA 2C9AA 1D5IL 3Q6FA 5A2FA 1XCTB 4XCNB 5D96B 1XR8A 3OKOB 4QRRA 3WFHA 1A0QL 3P77A 4HWEL 4CUCA 3BDBA 3W39A 4NZRL 1NJ9B 2DQEH 3GSQB 1T7XA 4L4TB 4D0BB 4JHBA 4OCSL 3MRKA 1MSPA 1Z9LA 5C0RH 4Q9CA 4E5XA 5KVDL 4A6YA 3GNMH 1X7QA 4OAWA 3ARVA 2AJZB 1FV1A 3GKWL 3QBTB 1NCTA 5BOPA 2IPKA 1YECH 4TULL 1TZGL 4UDUA 5IWLC 1TTFA 1U92B 4JJHA 4B7LA 1NBVH 3MCLL 3U6RB 5HGAA 4M1CD 5T3XD 4LIQE 1T1WB 1T1XA 3HI5H 4PRIB 1FH5L 1ADQL 4LHUG 4OF6A 3MLVH 3MLXH 1MCKA 5D8JH 4NRXA 1E0OB 2ORBL 1AQKH 2BERA 2O5YL 1S3KL 3GMOB 1FGVL 3ZHDA 1A6UH 3VXTB 2J6EL 2FX8H 2IPTL 2YBRA 5EOCL 3T3PF 2JCCA 2FECI 4DEPB 4AIOA 4OZIB 2HT4C 4JFEA 1G6RA 4LGSB 5IHZA 4Q9BA 1MLCB 5C09D 4NKDB 2EDDA 4YO0B 4Z7VB 4HG4J 1OAQH 4K3EL 5IFJB 3GMQA 1UJ3A 3L6FB 5IM7B 1RJYA 3JTSB 1JYWA 2MCPH 1ETZB 4MNGE 1MCBA 5BXFB 3OQ3B 5GS1C 1NGPL 3TH2T 2NXZB 1WZLA 1EA9C 3RWCA 1R0AL 4ODHL 3MV8B 2Q8AL 5IMLA 3RWFA 5CSBA 4ZOCA 5DVLA 4WHYG 1T0NA 2C4FU 4P2OD 5IEKA 4NQCE 3C08L 3RKPA 2FH6A 3NACH 5IW1A 3QRGL 1IEAB 3T0DA 2XA8L 1A7NH 1JGUH 1OTTC 4OIIH 5K33A 3VWJC 2WBJB 1T5XB 4DCQA 1XIWA 2DIJA 2F58L 2JB6A 5JHDE 4O02L 1I9RH 1P5VA 2BSRB 1PZUB 3GB7B 3SDYL 1WBXB 1J87A 2E3VA 4LPWA 2IFGA 5F3BA 1IMHC 5T1MB 1P1ZB 1WGOA 5IK3A 4Y5YA 3FT3A 3MLYH 3HCVA 4D9LL 4QRQA 5JIIA 3Q6FB 2RGSA 1NLDH 2L0DA 1ZTXL 1QA9A 4GQ9L 2VDKH 1XR8B 3C6LC 4QRRB 2MHAA 3D0VA 1D3CA 3VXOA 3W39B 2RFXA 4P9HC 5TF1H 4F33A 4YR6A 1RU9L 3CU7A 4FG6D 2Y36L 2B0SL 3MRKB 4PG2A 3AC0A 2YPVH 4E5XB 5CEZD 4OAWB 1X7QB 3WUWA 1FV1B 3D39E 4L3AA 1MFEL 4YPGA 4UDUB 1QFUL 2FEEL 3MUY1 3EJYC 2LU3A 1I7RA 4X4YA 3CCHA 3RVXD 3FQUA 3S3JA 3C09B 1Z3GH 3OAUL 3I9GL 5IB4A 2D9QB 1KTRL 5GGTL 4U2YA 1T1XB 4GXUM 4NQEA 2FEDC 4OZGF 4KKCC 3I3BA 5I66B 3EDFA 1SMAA 1E28A 1MRCH 4DGVH 1LEIA 2XA3A 2ZCKL 4FQHA 4GXUN 4X6BA 1CFNA 4V2BA 5C0CE 2YBRB 4KQ4L 4OM1L 3ARDC 4XP4H 2CLVA 2EDYA 5HXMA 5LBSL 5MP6H 2JCCB 4JRWA 5DJCB 3MV9E 2NY2C 4JFEB 1G6RB 1MFCH 2XRAL 3Q6GH 4PJ5D 5GGVY 5IHZB 5LQBH 1VEPA 2XICA 1UT9A 5JZ7D 1U8HB 3U9UA 4JRYA 4G5ZL 1DVFC 3QUXC 4KK9D 4XI5C 5HD8D 1JZ5A 4E41E 3GMQB 4DAGL 3DGCR 1S5HA 1UJ3B 1RJYB 1FYTA 3NCMA 3GSXB 1B3JA 3CLFH 5IEHA 4O58H 5AYUL 3RWCB 3WN5B 2KZWA 5IMLB 3K0WA 3RWFB 3RKDD 4FFWD 1T0NB 2QBWA 3IAGC 5IEKB 5F1IA 3QFJA 1BD2E 1PAMA 5IW1B 1FCGA 5DMJB 3LHPL 5J1AA 2EH7L 2JB5L 1U3YA 3W0WE 5IQ7H 3TZVD 4C56B 3FAXA 1EHLL 5FCUH 5H2BA 1VGEL 3VGEA 1DEEA 1TFHA 4AEHH 5DF0A 1XIWB 2JB6B 1RVFH 1F3RB 4FTVD 4NQDE 5HSFA 1I7ZB 4AL8H 4S0TD 3DV4B 3MBEC 3W9DA 4JAMA 1QFPA 4N0UE 4X8JB 1AI1L 4MQXD 5F3BB 2DF3A 1U2HA 5IK3B 3MRFA 4Y5YB 3FT3B 2EDKA 4Y2OA 2DKSA 3HCVB 4KVNH 5E99H 4QRQB 1F90H 2FZ3B 2KKQA 1QA9B 3O45A 4N5UA 2OTUA 5I8KH 5GRJL 3D0VB 5EUOF 2DBLH 4YWGH 3ZKMD 4JVPA 3VXOB 2RFXB 5I75B 5FK9B 3BPCA 2KUTA 4F33B 4YR6B 1Z2KA 4OI8A 5EU6D 3VI3F 2VN4A 4B5EA 3WXVL 3WUWB 3UJTL 4DUWA 5J8OA 2FLRT 3G9AB 3KPLA 4S10A 3RFZC 4YDLB 5CLTA 4BQ6A 2V9RA 4JFFA 4YPGB 4MNQA 4R26L 5FUZL 4ALAH 5IHLB 1KCSL 1T03L 3V5HB 5KBNC 3EZJB 1I7RB 4W6WB 3WKML 4X4YB 1TENA 1N7MH 3CCHB 3FQUB 1E4XI 3ARBC 3LQZA 3NZHH 3LKOA 5IB4B 3MLTA 3V4VL 5IWLA 2F9BT 1E4KC 3MRPA 4NQEB 3ECBA 2AXFA 1E28B 4P4RA 3MMEA 5M94B 3B8SA 1LEIB 3FL7A 4X8XA 4FQHB 3OAYH 2QQLL 1CFNB 3T04D 1MQKL 2K3TA 2CLVB 4X9FA 3ZE0F 1N59A 2OK0H 3U9UB 4JRYB 1WIOA 4OZIF 4YK4B 3VD9A 5DJ0A 4JVWA 3VXME 3RVUD 5CGYC 3UROR 1FYTB 3MV11 3TIEB 3SPVB 1FIEA 1RIVL 2XI9A 1SM3L 3HG1E 1ORQA 2PTUA 5JUEL 3FHQA 1RAMA 4ZXBC 5J12B 4XNYH 4HIXH 3C9NA 1ZLUH 5L2KE 4WO4D 5LGHL 4PP1C 1PKQA 3U46A 5F1IB 5GS1A 2MMXA 3QFJB 1GXEA 4NUGH 1K8DA 1OWWA 1WTGT 4KXZI 5J1AB 4TTDC 2JTDA 4G6JH 3RY6C 4MZ3A 5H2BB 1DEEB 3BHBA 4M7ZC 4MS8C 2IG2H 3A6CH 3TN0C 1RJCA 1ZLSL 4IS6A 3UTSE 8CGTA 4I18C 4KRPC 4U1IA 5IB5A 2Q7YA 4DVRL 3EAKA 2BDNH 4HFUH 3W9DB 4WY7L 4JAMB 3VWJA 3U30C 4R7DA 2BRRL 4MVBC 1I1YA 3MRFB 4DN4L 1KENH 5DA4A 2IQAA 4UT6H 4WEMB 4DUXA 3F7QA 3O45B 2OTUB 4CDHA 1FSKC 2ZCLL 3CH8A 4JKLA 5JIPA 3MRHA 3S37H 1OGTA 5D2LE 5FYKH 4KJYB 4MA7H 3BPCB 1QHPA 4HK0A 1RZIA 3P11H 3NFNB 4M1DL 4XNXH 1BQHG 1NEZG 4WFFD 3CSYA 5DC4B 3C6LA 4HWUA 4MXVF 1M7DB 4DW2L 5IFAL 4XB7A 1XCQA 2E7HA 4JFFB 4MNQB 4XNMA 4NC0B 1HH6A 4F8QA 3QUYA 3GBMH 1MRDL 3AFLA 3FN3A 2X42A 5E2VH 1MFDH 1IL1A 2EIZA 3N9GL 4WIQA 3LH2L 2D3VA 3SBWC 5SWSD 1AO7D 2A83A 3LQZB 4X6DE 4RWHA 1TDQA 3LKOB 3TYFA 3MLTB 4LLUA 1V7NL 3MRPB 2VDOH 1EEQA 3KYKH 1V5JA 4FOMA 4K3JL 3ECBB 4DN3L 2AXFB 3MBXH 4P4RB 3MMEB 2ITDA 5AZEH 4WI8A 3E2HC 1KPVA 2Q86A 4ZMAT 2DLTA 4PJFE 4LQ1A 3LQAL 5GGSA 3ULVC 1B0RA 4OLZH 4BZ1L 1OM3H 3VRLF 5EU3A 1D9KC 1UKQA 4LASH 3TA3D 2P5EA 1KEMH 1N59B 1HH9A 1XGYL 1XT5A 3OZ9L 3I3EA 4G8EA 3ARDA 4HH9A 5DJ0B 1MREL 1CN4A 4LQFH 5ICYA 3GJFK 4ETQA 2GW5A 5I18H 5A1AA 1M71A 4E42A 1NUGA 3C8KA 1ORQB 1UC6A 1JMZA 4KRMB 3GK8H 1X4YA 4OD1H 4JQIH 1DVFA 3QUXA 1SHMA 3I3DA 2W9LA 3C9NB 5JXAH 5E70A 4NQSA 4MB4A 2P7TA 1FORH 5DUPH 1PKQB 1OCWL 1BEYL 2VDLH 3EYSL 3U46B 3CUPA 3D18A 5GS1B 4TNVF 2HLAA 3ARGC 1K8DB 1JYVA 4H5SA 4HIJA 1IC7L 4PJXF 3ARFC 1RZFH 2CMRH 2DICA 3GBNL 1FDLH 3ORJA 4H88H 4KV5F 3BHBB 1QRNA 1FZOA 5F9OH 5CBAB 1F4XH 1YEJL 4IS6B 4GG6F 1N2RA 4U1IB 5IB5B 2OJEA 4KGLA 2Q7YB 3WV0A 3AREC 3VMOA 3VWJB 4R7DB 3WCYA 2ERJC 1I1YB 4UT9L 3TBWB 1FO0A 2B1HH 3MBEA 3RIAK 4DQOL 2APFA 2IQAB 1VCAA 4PBVC 1L0XA 5J1TC 2NY3D 3S37X 5BS0E 1MNUH 1FNHA 4M6NH 2YUWA 1KACB 3PXJA 3IU4H 3O6KL 3MRHB 1OGTB 2DQDL 4TOYL 3V4PL 2VZOA 4W68A 4HEME 5LCVL 4HK0B 3SE3C 3CXDH 4H26A 5JOPE 1RZIB 4F8TA 1HN1A 4RA0C 2NW3A 3ZDXE 3CSYB 1RZJC 3V4UL 3C6LB 5C08E 1A5FH 3BKCL 4JN1H 4X6CA 3IF1B 5J4MA 1D5MB 1KJ3H 4XNMB 3TWCH 2GY7B 2A6DB 1HH6B 1PSKL 3H3PH 3QUYB 1YPZF 1IL1B 2EIZB 4XPHL 4YHLL 5JDJA 5CJ8A 3UAJD 2VRAA 3ARYA 2A83B 2XTJD 3GI9H 3SGEI 4G6AD 5JXED 4KTEL 3TYFB 2WANA 3K74B 4LLUB 4ZQKA 5JIHA 3HI6H 2JJUA 5D1QC 1FNGA 4HJJH 4YXHH 2EXYC 1FGNH 2QSQA 3BZDA 3M8OH 1JWMA 2ITDB 3SKNB 5C2BL 1LK2A 2NR6C 1HZHL 1MPAH 3ARBA 1KPVB 1ZLVH 4WUKL 2Q86B 3WNLA 2Q20A 5ICXA 1E4KA 5GGSB 3V0VA 1QSEA 4KY1H 1B0RB 3ZMRA 1YNKL 3V5KA 5D72L 2Y07H 5J13C 1YEKH 4KK8C 5EU3B 4HUUA 1RUML 3MXVL 5C0BA 1HINH 3X17A 2P5EB 2ZUWA 3SKJH 1HH9B 1Q38A 5CHNA 4FFVD 1KJMB 3Q1SL 4G8EB 1B90A 3ARDB 4HH9B 5ICYB 3L5XL 4ETQB 1D5ZA 2HJFA 3QQ4A 2NY2B 1A7OL 1M71B 4NM4L 5KVMC 3C8KB 4YNYA 5TFSL 3LD8C 4FQ2H 3BEVA 3ULUF 3QUXB 5HI3D 1REIA 1U8PA 3ALXA 5GS3A 3B9EA 4ZSOA 1L4IA 4NQSB 4ODVH 5F6IC 1C7SA 4TUKL 3WNKA 4M6AA 3CUPB 3D18B 1LHZA 2EDFA 2AEQH 2HLAB 5TPWL 2PUQT 3ZDZF 5D7LB 1IVLA 4H5SB 4HIJB 4LSVH 4ZXBA 4U1LA 4K8RL 3ROOA 2LU4A 5JW3H 3TBSA 3HRPA 4NO0A 1BGXL 4PYGA 1QRNB 1FZOB 4HKZA 1INEH 3A6BL 4NQVA 4WI6A 3VGAC 4KQ3H 5J7CC 2NMSA 4LKXB 5FYLD 1N2RB 5GXBB 2OJEB 1JGVL 4WWKD 4RX4D 3MLWH 1JNHA 5AWNL 1CK0L 3TN0A 1FFNA 4W4OA 1FG2A 5I6XC 2UWEA 3TVMC 1FO0B 1A7QH 4UAOC 1BHGA 4I18A 2E27L 1PFCA 3GSRA 1S9XA 2ZUUA 4XPGH 1DN2A 3H9SE 2DMCA 4HWBL 4FFYH 1DBJH 1DSFL 3S3SA 4X7SH 4K7FA 4X4ZA 3LMJL 1NAKH 3TJHD 4PJ7A 3CSBA 3TBYA 4H26B 2IQ9H 4JFXA 4JHWL 4N0CC 2AAVA 2DLHA 1WVZA 4O2FA 4LOUD 3ZL4H 2NW3B 2HH0L 4UOW0 1BQLH 5AYQA 2P5WE 3LSOA 1E4XL 4U6HA 4Y1AB 2FJHA 4X6CB 2A9MH 1H8OA 3EDDA 4ZOEA 3OXSA 3FMGL 3RTQD 2D7QA 2Y6SD 1NDMA 4QRPE 3OG6B 4PJ9D 3JWOC 2ICWJ 2XXCB 2GJ6E 3O6MH 3V7AE 3F65A 1RUPH 3L5IA 3BVNA 4MCYA 4ZQKB 1FNGB 2HVJB 3FN0L 4X7EC 3UYRL 2GIYA 3SBWA 3AS3A 1LDPH 1JWMB 3MACL 1LK2B 3T65A 3ZKQD 1X5ZA 3ARBB 5D7IF 1DL7H 4EQ3A 4IRJD 3MRNA 5ICXB 3V0VB 1QSEB 4J7RA 2J8UE 1JNLH 2VXQL 5I1DA 3QDMD 3AVEA 3V5KB 5KTEL 5SV3A 4M62H 3EHBD 5GJSH 4TPRH 4HUUB 4JRXE 5BO1H 1UENA 4I77H 1WK0A 4CJ0A 4JDZA 5HHQA 1J5OH 2IANE 4QXUL 3HZYA 5CHNB 1Y6NR 2P8LA 3D9AL 1D5ZB 2HJFB 3QQ4B 3I2CL 4Q6IC 4N8VA 3DVFA 3FFCE 1D9KA 4PRPB 3VFOA 4KUCF 4MD4A 1OAZH 1EGJH 2UYLA 4POYA 5TQ2L 1UZ6E 3BEVB 3H3KA 4X80L 3S4SG 1U8PB 4I0CC 4JN2A 4ZSOB 4OB5L 3BP7A 2X1PA 3BJLA 3UJJL 2RIKA 3OKDB 4NRYB 2DD8L 1D6VL 4HC1L 4ZTPL 4ZXBB 2A2QT 5DJXA 4Z7WA 3ROOB 3TBSB 1MCLA 3EYQC 4UOJA 3PQYE 2JIXD 3ARGA 3IFNL 4HKZB 4NQVB 3TPUA 5HGDA 2GJZA 4P2RD 5HI5D 1X5IA 3ARFA 5JHLL 1B0WA 3AS2A 3RAJH 5IP4A 1R3HA 4PP2A 2W1NA 4ELKA 1JNHB 1A2YA 2AABL 5GSRA 4ODSH 1UG9A 3KJ4B 1FFNB 4TYUA 1FG2B 4LU5H 4LSRH 3IKCA 1RK0B 4R4FH 1OOAA 1W72L 4Q74A 3SGKC 5IVOA 3GSRB 4PGJA 4Y4FD 1S9XB 2D9CA 3IDMA 1EO8L 2ED7A 1JPSH 1JNJA 3N0PB 1PX4A 4LAJH 3SJVA 4FABL 4HKBA 4K7FB 5EFIA 3B43A 1EH9A 5T3XL 4PJ7B 3TBYB 4F9PC 4JFHE 5JQ6H 3TJEL 4JFXB 5KVGH 4O2FB 1FO0H 2BMKA 1UM4L 4ZNEA 3LSOB 4OLVL 4TVSa 4U6HB 1QFHA 3C5JA 1Q0XL 4ENED 3SE3A 2AXHA 4XAKD 3D1MC 3OXSB 3MGOA 1VFAA 5CWSA 3PXHA 3NIDE 5F1SA 2HKHL 4JANA 2AQ3A 1NDMB 5AZ2H 5ALCH 3BMWA 5IHUL 5T1LD 3QCTL 3BVNB 5FB8A 5CJOL 4MCYB 2EDHA 1WT5C 1I3GL 4P4KD 4NWUL 1XF5A 4WV1C 1IAOA 2IFFH 3T65B 1T5WB 1OGAE 5JOEA 3UDWC 1DQDL 5BVJA 1J1OH 3MRNB 5FO8A 1HQRA 1L7IH 1JZ2A 1CE6A 5D1QA 3SO3C 1TLKA 5I1DB 2HRPL 2NZ9D 7FABH 2HKFH 3RPIA 4JY5H 3SEPA 2QTEA 3E2HB 1ZVSA 3ZKXC 4JDZB 4R4BA 5HHQB 2VC2H 3HZYB 4OD3L 5E4EB 5GZNC 2P8LB 4ZFGL 2CK0H 1WLHA 4LPVA 3HZMA 5FA3A 1I9IH 3NAAH 2DYPA 3IFPA 4N8VB 1I7TA 4YHNA 1D9KB 3WIIL 3VFOB 4MD4B 2UYLB 3CAFA 4ERSL 5DZOA 4X7CC 1ZGLP 1EO5A 3OSKA 4I9WE 3VD5A 4JN2B 1MFBH 5IMMA 1T6WA 3BP7B 1KLGB 4CBPA 1RZ7H 4L8BA 1A7PH 4QHLB 3HNTH 4NYLA 3OR6A 1T7VA 4NBZB 4YEFA 3UYPA 4TUJA 5DJXB 2A6JA 3O81A 4ZAKB 3VI4F 4Z7WB 2DI9A 4S1SH 4HCRA 4F7PA 4U0RC 3TPUB 3ARGB 2BNQD 2YUVA 1NCDH 5HGDB 2GJZB 5T3ZE 3B6SA 3ARFB 3AMKA 3EFFA 4JFDD 4PY7A 3IVKA 1R3HB 4WTWA 3BIAX 4PP2B 4K8RC 4ELKB 1B4JH 2F8OA 1A2YB 2IC2A 2JF1A 3OB0H 4GUPA 4OCWH 3WO4C 2QSCH 5DJ2A 4TRPL 5CEZL 3IKCB 1WJ3A 3P30H 1GGYA 4JREB 4Y19D 1HILA 2FNBA 3MV7E 4NQXB 1FRGH 1R24A 3IDMB 1EHAA 3QXVA 4PV9A 3HE7D 2ERJB 4C4KO 3O41A 4M5YL 1AFVL 1S7TA 4K9EL 3AXLA 3JV4A 4HKBB 3TVMA 3ZSTA 1WEJL 5L8JB 3HC3L 5EFIB 4KZDL 4KWUA 4YHZL 1G7JB 2BC4A 5SWZA 3MJ7A 3AB0B 3DGGA 4ZDHA 3IDIB 4DFIA 3C5JB 4WEUD 3CFKA 4BZYA 5D93C 3MGOB 3KLHD 5CWSB 2LAAA 3HAEA 4JANB 2PYED 4AIXA 4ZS6D 2VXUH 4X6CF 3TYGH 1HHKA 4XCCL 4RMVA 1AHWB 1OWRM 1KN4H 2E7MA 1JNNL 5FB8B 3W81A 5I76A 1H0DA 5CP3A 4DGIH 2ADIA 1JI2A 5LG1A 3WKNA 5I8CA 3PWLA 4ELME 3STZA 1XF5B 1F4WL 1IAOB 4WWID 1UWGH 5DTFA 3IDXH 2UUDH 3EW3B 1KJ2A 4GO6B 5BVJB 4G8IA 5FO8B 5T1KA 5E5UB 2RHEA 3W82A 1GC1H 1CE6B 5D1QB 4KJPD 4Q2ZA 2OMBA 3RPIB 3ALPA 2DJSA 1HHGA 1IKFL 1K3IA 1ZVSB 1G7HA 4R4BB 5IMKA 3VXUA 3NZ8A 3LIZL 1ITCA 1ONQA 1WZMA 2ZUSA 3S6CA 3HZMB 1T2QH 5FA3B 2DYPB 3IFPB 1I7TB 4MNHA 5D1ZD 1GAFH 2ZUQC 4YBQD 1UH2A 4MXQC 1UGNA 1GOHA 5IMMB 1LEGA 2F53E 3ULVH 4Q6IA 1YNLL 3N1PC 3L3HA 2B1AH 4N90D 4L8BB 4OGAC 2NXYB 3HMWL 4S1QL 3LD8B 5E1HB 3RDTA 4NYLB 3OR6B 4K07A 4KRNA 4TUJB 3F7YA 4ZTOL 2A6JB 4FZ8H 3WLWD 3IGAA 3SE8L 4F7PB 2R4SL 1P6AB 5I1GH 2EDWA 2VZSA 3IS1X 1G7PA 4U49A 5J6GA 4LKCA 3B6SB 4K94H 2N56A 3EFFB 4PY7B 3IVKB 1TCRA 3EKCA 3S34H 5ENWA 3QIUB 5F96L 5DMKB 1KFAL 3VGAB 1N0XH 5DJ2B 3CVHA 1VENA 3S88H 2XQYG 1Y0LA 5C7XL 1OHQA 2FO4A 3BPOB 3ZT5A 1R24B 4PG9A 4KTDH 4YXLL 4PV9B 4HGMA 1WFNA 2ENSA 4L4TD 4R8WL 3QJHB 3O41B 4BJLA 1HK6A 1NC2A 1S7TB 4GRWB 1QYGL 3AXLB 3JV4B 1D5XA 3TVMB 1A3QA 5L6YH 4UAOB 4A2LA 4LFHD 3SGKA 1NL0L 3Q5YA 2E9WA 2L4OA 5SWZB 2BC4B 3MJ7B 1IGJA 3DGGB 3CDFA 3NA9H 4ZDHB 4YDIL 2H1PH 3FQTA 4NN6C 1NGQH 4W6XB 5ANMA 5TE7H 1LO4H 3CFKB 1JVKA 5IF0A 1AXSA 4OGYL 3HAEB 4M1CC 4M5ZL 1WFTA 5C6TH 1HHKB 5C0BE 4CVWA 4PRID 1BOGA 1CLCA 2YWZA 2QQNH 4RIRA 1K4DA 3S3PA 1ZANL 4HIHB 1YQ2A 1P84K 3ETBF 1OARH 5I76B 1H0DB 4XVSL 1CLOH 3O2VL 2WP3T 3H9ZA 5I8CB 3PWLB 3STZB 1RZJH 1J9CT 4M48H 4L1HA 1TJGL 1KJ2B 1I7UA 5T1KB 4KROC 2Z8SA 4NC1C 5IQ9B 5EOCJ 4OI7A 2X4QA 4Q2ZB 1WT5A 2Z93A 1IGFL 3GRWL 5SWQA 3BPLC 4LSPH 4WV1A 5SX4H 1MIEH 1FP5A 4GMTH 4G9FB 1G7HB 3VXUB 5IMKB 2IH1A 4XXCC 3NZ8B 5F7EL 3SGDH 1CGUA 1ONQB 4HS8L 2C3VB 4LCIL 1NPUA 1C5BH 1WWCA 2I26N 5I1EH 5I1JH 4QHKJ 2ZG3A 2NXZD 2NY6C 3B2VH 2CD0A 4MNHB 2G5BB 2XZCH 3P4NA 3MV8D 4I2XA 3O9WC 1J1PL 3QQ3A 4PJIA 1UQSA 1NMAH 4M7LL 3ZO0A 1IZJA 1LEGB 2AEPL 4Q6IB 1MCOH 1CXKA 3L3HB 2UWEE 2X4UA 4CU8A 1E6JH 2AI0H 4NSKA 4LDEB 1NMBH 1H8NA 3RDTB 4J1UA 4K3DL 2WBJD 5CMAA 4U6XB 5HVFB 3F7YB 1IEBA 4OJFL 2ITCA 4YHOL 3WFEH 4AMKL 5GJTL 3T2NH 3IGAB 2WP3O 4UB0L 1AJ7L 1MFAL 2F5BH 1IILE 4JFYA 2BY0A 1G7PB 5J6GB 2K7QA 5DVOA 1JE6A 1CDUA 4P59L 1N64H 4XPAL 2BNRD 1TCRB 3L5JA 4GXVH 5ENWB 5ITFA 1OAXH 1UWXH 3CVHB 3LEYL 4HCRH 2Z9TA 5C07A 3BDYL 4I3RH 4WGWB 4XPTL 2FO4B 1U8QA 4JDTH 5B39A 1ZA3A 2D4DA 4MX7B 1BLNA 4LFHG 2DM2A 5TE6H 1CLYH 4DJMA 4FG6C 1NC2B 1OAKL 1D5XB 3UO1H 2HT3D 1EPFA 2Z92A 5IESL 4XCFH 1BM3L 1B6UA 5BVPH 4ZOBA 1U58A 2J4WH 4L4VE 4OLWL 1VERA 2B5IB 1QBBA 5I0DA 3FQTB 4KFZC 2N7AA 1IC5L 1QPXA 3MO1A 5ANMB 1I85C 4K9EC 3RVVD 5KVEH 4GRWH 3RVXC 3C5ZD 5IF0B 1AXSB 5I8OL 4JGUA 1HWGB 5E8OA 3BKYL 5DC0A 1BOGB 4HWBA 4UIMA 3WXWH 3HNVL 4RIRB 1K4DB 1RUKH 2WUBL 2X7LA 4OFVA 2DKUA 5E1AB 2PNDA 3HAEH 4GOSA 1A7RH 1CDGA 4HQQL 4JHAL 5HYJE 4DTGL 4FP8H 3VXPA 4JFED 2X4QB 2Z93B 3MLZH 1A6VH 3GMRA 3Q5OA 4LHUA 5DQJA 5SWQB 1NLBL 5JZ7C 4WV1B 1WBZA 3B3IA 3QEQA 1CTOA 3TC9A 4BZ2L 1PY4A 3KDMA 2J7LA 3JWOH 2LE9A 4YPJA 1ZT7A 2B2XL 4MQTB 3BP5A 4CW1A 4NWTL 3L1OH 1T7YA 1RMFH 2VLRE 4U1GC 3WJJC 3OG4B 2EZ0C 3ZKXB 5L2JA 2QJDA 3WFBH 5DSCA 3LB6C 3UTZA 3QQ3B 5EDXA 3KPSA 4PJIB 1F58L 3RKDC 4FFWC 5I30H 1J10A 4C55A 4PGDB 1UQSB 5J0BA 4QOKE 1DQTA 3FO0H 3N85L 1GIGH 2X4UB 4NSKB 4C56D 3TZVC 1JZ8A 4P48A 4V1DA 4PLJD 4J1UB 4LCWA 1JWUA 1NC4A 2CO6B 3IETB 5CMAB 5L88H 1XIWD 1IEBB 1CU4H 2ITCB 3KS0J 4UTAL 3BUTA 1YQVH 4HS6B 3AUVA 3SJVE 1NAML 4JDVB 4JFYB 3O3EA 1IFHH 1IGIL 2PF6A 5D2LF 5E2WL 4MQXC 3DROA 5FYKD 2XY2A 5ILTH 3WFZA 2Y25A 2CDFA 1BX2A 3J7HA 1FFRA 5MHSD 5ITFB 3CLEL 1I3RA 2DTML 2J12B 4XX1G 1ND0A 1A6ZA 4LPXA 4D9RD 3VFUB 3SQOL 5C07B 5E2JA 3ZKMC 1U8QB 1RIUL 3CFIC 3QDJE 1KCVH 1ZA3B 3WO4B 1TQCB 1WAAA 4LLYA 4X6DF 3ZYZA 4X6EA 2Z92B 2CLZA 5F7YC 3CVHH 2R29L 1U58B 4ZD3L 1HHIA 3C2AL 3W11C 1RUAH 4M6OL 3IDGA 4Z0XA 3BZFA 4GAYB 3MO1B 2HVKA 4R97C 3PWJA 1R5WB 3THML 2XZQL 1RFDH 3LVEA 3TM6A 5KSBA 5E8OB 4CAGA 1YYLH 5T5NF 1FIGH 3D6GA 3QO1A 2C7UA 4JPWL 4YDVA 5D93B 5JTWA 5E8DL 2VE6A 4ONGL 4DZBA 2X7LB 5GZOD 1QZ1A 3HFMH 4LLQA 2W9DL 3EDKA 4KHXL 2WIMA 5HI4D 2WIIA 2EKSA 3MGTA 1T1ZA 4LSQL 4YIQA 4ZPTA 1NCCH 3INUH 5C1MB 3GMRB 1MCSA 4LHUB 4K3HA 5DQJB 3K81A 3BKML 3B3IB 3NVQA 3QEQB 4JRYD 4Z0BL 3KPMA 4PD4K 3EBAA 3C8DA 4OV6F 1FYTD 1B2WL 4XPFH 4JFZL 3N1MC 3RJDA 1ZT7B 4CW1B 4HZLA 3BJ91 2HTLD 3NCBB 1HKLH 3IKKA 2OS7A 5L2JB 1IE5A 4OKVA 2CUIA 5DSCB 3UTZB 3QPQD 3KPSB 4XXCA 4WO4C 3ZKND 5GGRY 4R90L 4Z7UE 1BQUA 1YMMA 3QFJD 3BP6A 1IC4L 5FYLL 4DGYL 3EO1A 1CCZA 3O9WA 2ZUQB 2BHUA 3DNKA 4QTIL 1P4BL 2JELH 4LCWB 3U9PL 1JWUB 3UZVB 1NC4B 2E7BA 3LOWA 1BFOA 4NCDA 5KN5A 1MY5A 3OJMB 5HHMB 1J1XH 3QEUA 2VXSL 3SDAA 4RBPH 5HYSG 1CL7H 3AGVA 3U82B 2Z35A 5C6WH 1AGFA 2CDFB 2O5ZH 3MLRH 1BX2B 1YNTB 3ZDXF 5L8KB 4XCEA 1I3RB 3DYMA 4WFED 4HLJA 5F70A 1ZAGA 5ITBL 4XBPB 4FA8A 1S9WA 1ND0B 3S7GA 5KW9H 1A6ZB 2IGFH 4KJWD 3DX9A 3RA7H 1CDIA 3IU3A 3KYMB 2LVCA 3WFCL 3WUWG 1WV7T 4RNRA 3OKLA 2VITA 4H8WL 4ODBD 4LLYB 3QDGA 3QWRA 4X6EB 3VFGH 3MODH 4U3HA 2CLZB 1FJ1A 3UTTE 1OGAB 2R69H 1MCIA 1F4YH 1HHIB 4JFFD 1OAYL 4MNQD 3IDGB 4Z0XB 2DQHH 2XWTA 3PWJB 5GRXG 5CZXD 1PJ9A 1YEHH 1NSNL 1XAUA 1NEUA 4QYOA 4QY8A 3N1FC 1A6AA 3QO1B 4HAFA 2C7UB 1I85A 1EAPA 4YDVB 4K55A 1OY3B 2I60L 4FZEL 2VE6B 4DZBB 4ONFH 2A6KA 4LVOC 4LLQB 4LDLB 1Q94A 1F6LL 2WIIB 2EKSB 25C8L 2F5AH 4TSCL 4HIEA 2XG4A 1T1ZB 1EHXA 3EYUL 4YIQB 1LP9A 3F58L 1L7TL 1H5BC 1S8DA 4QHNA 5CEXA 2BNUA 3KPMB 2XZAL 4L3EE 4NGHH 1UA6H 4KROB 1X5KA 2HT4D 2X05A 4RFOH 1LO3L 4WTXA 1P7HL 3BPLB 4HZLB 1UWEL 5FAAA 4PJCA 1GZPA 5FYKU 3EOTH 4OKVB 5F44A 3X3FH 4OQ1A 3NFPA 4OV5A 3MLSL 4PB0L 1YMMB 2C3WA 1FQ9C 4WGVB 4M7LT 3GZKA 2NY6B 1CDCA 1RIHL 3NTCH 5CGMA 3WJJA 1QO3A 2WBWB 1XF1A 3EO1B 3O9WB 5FUCC 2E9JA 3V8CA 4PLNC 3T0EE 3E6HA 1DQJB 4YXKH 4YBHA 2YMXL 3QCUH 1CDHA 3QXDA 5KN5B 1I8IA 2D7TL 5JNYA 4OLYL 3QEUB 3SDAB 2VNCA 1P84J 3TZVA 4OZFA 4M7JH 1JPTH 2Z35B 1Q0YH 3PHOA 3OPZL 4LGRB 1AGFB 1RD6A 5F7WC 5CIPB 5EU7E 4M7KL 1YA5A 2CSPA 3KPRE 4XCEB 3RWIA 2NY3C 1KV3A 4Q58C 5I1CH 1S9WB 1S78C 3GMMA 3NFSH 3DX9B 3IU3B 3QUML 4D0CA 5KG9A 4RNRB 3L5HA 3OKLB 2VITB 1GHFL 1ZWIA 2APWA 3QDGB 3PP3K 4LEOA 2NX5E 2DQCH 3Q3GA 4WUUA 3C6LD 4WW2C 1F3DH 2W9EH 1XMWA 2I9TA 2G9HA 1LO0L 4JG0L 1UH4A 1UEMA 5T1DL 3MLUH 3QUYD 2XWTB 2DQTH 1PVHA 4OFYD 3HC4L 5B22A 4KUZH 2J8UF 5D7KE 4MXWL 4AJ0A 1BQHA 1NEZA 2DRUA 2ICEA 2NNAA 4G6AC 4QYOB 4NO2A 3E8UH 4QY8B 5EN2A 3WFDL 1A6AB 4JB9H 5GHWH 1EERB 2X44D 1EAPB 3G6JE 1E6OH 4R4NC 5F7FA 1IM3A 3WIHH 3VFNA 2A6KB 3LEXB 1S5IH 4G7VH 1Q94B 3GKZA 1EVTC 1IQDA 1W0YT 3EDJA 4I2XE 2FEDD 3EGSA 4KKCD 4OT1L 4XNUL 4KPHL 2YD3A 2ENYA 4ESKA 4RQQA 3EOBB 4LLMB 5HGHA 1EIBA 3O4LD 4PJHA 5DT1L 4XAWL 4QHNB 1G0DA 1S8DB 5CEXB 2BNUB 3QWQB 5C8JA 1IQWL 2BOCA 1CD9B 1IGCH 2NY2D 1L0QA 4YQXH 1EJ6A 4XWOD 4ZYKA 5IGXH 4NRZA 1B9ZA 3QUXD 3QSKB 4PJCB 3X3GH 1GZPB 4XI5D 5HI3C 4WI7A 4NFCA 4E9LA 4WFGE 5EA0H 5L0QC 5C0GA 4NNXA 3NFPB 4TSAH 4OV5B 3VMPA 1OL0A 1IARB 1QFWH 2DQEL 5HHXH 5D7LD 2YC1B 1QO3B 5C0RL 4WO4A 3DX7A 3GNML 2GAZA 3E6HB 4X5WA 1SJHA 4JZOA 3EUUA 2Q8BH 1QRND 3QXDB 1I8IB 1YECL 2AK4E 1OT2A 1MLBB 3W2DH 2V9TA 3L3DA 5C0DA 4WWKC 4OZFB 1RQ5A 1NBVL 3ARQA 3PHOB 5DUBA 3UTQA 4GRLD 5DC9B 3RWIB 3HI5L 1CXHA 3MLVL 4EIGB 5FHAH 3MLXL 3GMMB 5D8JL 1AQKL 3NIDF 4D0CB 3TJHC 5KG9B 1A6UL 4EI6A 1J12A 5JW5A 3F5WA 1ZWIB 2FX8L 1QQDA 5CIPH 2ZUTA 2XFXB 3T4AA 1QLEH 3Q3GB 4WUUB 2DDQH 1FHGA 5C0AE 4XVTH 3JWDC 4Y1AD 2G9HB 3WS6C 2ESVA 4NKQB 2CKBB 1OAQL 3RTQC 4K71C 5ABDE 1BZ7A 2Y6SC 4AM0A 3PL6D 2HT2C 4XP5H 2YSSA 2MCPL 1LO2H 5DJ8A 3T2PA 2A1WH 1DE4A 3BW9A 1NEZB 2ICEB 3AY4C 2NNAB 2KBGA 4NO2B 3FOLA 2HMIC 4NBXB 5EN2B 1ZS8A 4Y5XC 4R97B 5D70H 2FL5A 4KKLD 4WU5A 5DEGB 1H3PH 1IM3B 1AQDB 3ARBD 3VFNB 1A3LH 3DETD 3NACL 4IRJC 4Y16C 4U1JA 1IQDB 1QSED 5E7FA 4FQJH 1U3JA 3EGSB 1A7NL 1JGUL 3EHBC 4LCCC 4OIIL 5KSVA 4LCYA 4RQQB 5HGHB 1JZ7A 1I9RL 4AH2A 2EKJA 4PJHB 5ETUA 5CCKH 2W0KA 2MOVA 4WJ5A 5DD5H 3L95A 4V1DE 5C8JB 3NCFB 5JHDD 5C70A 2BOCB 4AZ8A 4PRPD 2OZ4A 4KI5F 4LPUA 5DWUH 4ZYKB 3MLYL 1BFVH 3ZZ1A 3NOIA 4NRZB 5I15H 2YPKA 2DQUH 1NLDL 3BOVA 3RL1A 2VDKL 3U4BH 5I9QC 1DBBH 5C0GB 4WI9A 4PJBE 4NNXB 4PLKD 1WQVT 2OLDA 3RGVD 3REWB 1S7SA 2C3GA 4ZXBD 1BMGA 3WDJA 1OLZA 1BBDH 3MJ6A 3TIDA 2YPVL 2ZWLT 3DUSA 3DX7B 4WO4B 5CSZA 3LKRA 2GAZB 2XOTA 4X5WB 1SJHB 4JZOB 3LKPB 4Q97A 3GGWA 5HHVH 4CN1A 1UACH 3T8XA 4Q0XH 1JGLH 5TDPA 5HI5C 4TTDD 5DUMH 1RZKC 4LBEA 3L3DB 5C0DB 2VLMD 1ZA6A 3Q5TA 4OQTA 4U4BA 4HBCH 1Q9KA 4MS8D 5DUBB 1CF8H 3QUKA 3UTQB 1Z3GL 3VGFA 4FQ1H 5LKNA 3D85A 5DJDA 4WI3A 1C5CH 4Z7OE 1VEMA 3IDYC 4Y4FC 1GSMA 1H3XA 1BREA 4BYHA 3RWEA 1JN6A 1MRCL 4DGVL 4EXKA 4OZFH 5KSBE 1Q72H 4BFGA 2BOBA 2OR9H 4EI6B 2CRZA 5JW5B 3F5WB 3CJJA 5FYJU 4PD4J 1QQDB 3HR5A 5CJXC 1J0IA 3WIFA 4XP4L 3T4AB 5MP6L 4U1SB 5T3XE 4IRZH 4DWHA 1MFCL 3Q6GL 5LQBL 4EQ2A 1VFUA 4ENEC 2ESVB 5ESAA 4ELMF 2R0ZH 3QNXA 3HR6A 3MZGB 1BZ7B 3DRTA 4AM0B 4S1RH 4WW2A 4GJTB 3V6OC 3QDAA 3WHE0 2YSSB 2BSSA 5DJ8B 1I1AB 4AT6A 3K80A 5JOFA 3BW9B 3CLFL 3QWOA 4O58L 3QT2A 1N6QH 3FOLB 4PUBH 5DJZA 4NC1E 2CKBH 5H37G 3OV6A 4WU5B 3RIAF 6FABH 5MENA 5C09E 4FFZL 5D5ME 3OAZH 4TVPH 3OKYA 3BZ4A 4U1JB 5D4QA 4NUJA 5BRZA 1IEHA 5EUKA 5DQDH 4ETYA 5IQ7L 3ZT7A 2NZ9C 4BQ8A 4Q9RL 3QRFM 5FCUL 4ZNCD 1Q9WA 5ERWA 5KSVB 2NZIA 4KKBC 4LCYB 4AEHL 1RVFL 4AH2B 2FX9H 4AL8L 5ETUB 3ULVD 3TFKC 2F19H 4WJ5B 1F5WA 2Y23A 1UM5H 4JM2A 3BH9B 3D5OF 4GW1A 4TTGA 1PW3A 3F8UB 1X3DA 5K93A 1BBJA 4KVNL 5E99L 1FE8H 2YPKB 3R8BB 4MD5A 1F90L 4X83A 1DLFH 3RL1B 5DK3A 3BN9D 2VZUA 5I8KL 3WD5H 2DBLL 2ZPKH 4YWGL 4G6KL 2YS4A 3KPQA 4LVHB 3JV6A 2DS4A 3SDXE 3K2UH 1K5NA 4O02H 4BKLA 3TIDB 5I73C 2OP4H 3DUSB 4ZAKD 3KLSA 2Z91A 5CSZB 3ZTJG 4NM8H 3LKRB 3BDXA 4HKJA 3B9AA 3GGWB 2IADA 2VLKA 5EU5A 1ED3A 2XN9A 3T8XB 2HLFC 5TDPB 4ALAL 3ARFD 1Q9OA 4LBEB 5I1LA 3MNWA 1ZA6B 4XWGH 4KTYA 1N7ML 2HFTA 1EMTH 1VPOH 3QUKB 3NZHL 3RWHA 2D7PA 3D85B 5DJDB 2E9BA 4WWKA 1G9EA 5CEZE 4RX4A 2J8HA 2DIAA 2JJTC 1EZVY 2NY7H 3PWNB 1JN6B 5CINH 3RUGA 3RWEB 5I16A 2QSTA 3B83A 2BOBB 1IM9D 4LAQH 4HMDA 4NBYB 2WM0A 3MRQA 4I0PA 4JVUA 5ISZA 3WIFB 5FGSA 1A3RH 4WFHD 2PO6A 3W5MA 1VADA 2JJWA 5ESAB 2OK0L 3GHEH 4HD9A 2AGJH 2B4CC 3KLHC 1T4KA 3QNXB 3W9EA 5A3ID 3T0BA 3DRTB 4ZS6C 4U6VH 1MRFH 1D6EA 4WW2B 1UB6A 2W65A 1LP9E 2BSSB 5B38A 4AT6B 3ZYOA 3P9LA 1TETH 5JOFB 3WS6A 3MA9H 4QGTA 2FBOJ 4O51A 1K4CA 2VZTA 1T7ZA 4XNYL 4HIXL 5DJZB 3UP1A 1P4LB 4PJ5E 4RZCA 5DHXB 3RVWC 5MENB 2EO9A 1CG9A 1T2JA 4KMQA 5LBSH 5L2KD 3PWVA 1KCRL 1U8LA 4NUGL 4FQPA 3BZ4B 3S9DB 4NUJB 5BRZB 1G9NH 4OF8A 5EUKB 1QOKA 5D1QD 1QFWM 3GI8H 4KDVA 4Y5XA 3PGFH 4G6JL 2EXYD 2ZUVA 2E8YA 3OBAA 2NR6D 2IG2L 2F54A 2A9NH 4L1DA 5ERWB 3A6CL 3H9YA 3TO2A 4AG4H 1PG7H 3I6KA 4Y16A 3T3MF 3GHBH 4N8VG 3LKSA 2DWEA 1SYSA 3NMEA 3TCXA 1I3VA 2EC8A 2BDNL 4HFUL 4M6MH 4JM2B 2CQVA 4KK8D 4LCCA 3HTLX 4GW1B 3UTSD 3FONA 2DYPD 3KVQA 4MQSB 5D1ZC 1HCFX 1A6PA 4GKZA 5E0QA 5EWIH 1JHTA 1KENL 2V5RA 1BBJB 3BH8A 4MD5B 4UT6L 3G5YA 3KPNA 3GJEA 3IDUA 1JIBA 4NP4H 5D2NC 1HQ4A 5ADOH 4FTVE 2NXYD 3S37L 5FYKL 3KPQB 1VGEH 4MA7L 1KELH 2OZ4H 2RB8A 3JV6B 3P11L 2EE3A 4OF0A 1K5NB 4BKLB 1L0YA 4XNXL 4I48A 4UTBH 3WLWC 2Z91B 3RJQB 2YZ8A 4HKJB 3LS5H 2NY5C 2Y7QA 3VXSA 1H9VA 1TVBA 5KS9A 3C8HA 2VLKB 4Y7MA 5EU5B 1ED3B 1D5BA 2XN9B 4XMKH 4HPYH 2GITA 4MMZC 1Q9OB 3GBML 3UTPD 1F13A 3MSPA 3MNWB 5E2VL 1MFDL 2VUOA 3QIUD 5GGUA 3P9WB 2JJSC 2JIXA 1UJTA 4HX1A 5EULV 3RWHB 4NNPH 4P2RA 5EU6E 3BD4A 3RL2A 2VDOL 3KYKL 4PB9H 4PFEA 5IW3A 3TESA 4ZO8A 5AZEL 2CO7B 3RUGB 5I16B 2ADJA 3SKUD 3OKEA 1T22A 4OQTH 3UJTH 2UVFA 4I0PB 1WCBA 5ISZB 5FDYA 5FKAA 3NCYP 4M4RA 4Y4FA 4OLZL 4R26H 1OM3L 5SWZD 1W2KT 2PO6B 3QEGH 2DL9A 1VADB 2Y4SA 4LASL 3KYNB 2FSEA 3O3AB 1KEML 4HUKB 5E6ZA 2VTFA 2YUXA 1T4KB 5CJXA 3W9EB 4NFBA 2VL5A 3E3QC 4RCAA 4LQFL 3X11A 1D6EB 1UB6B 5I18L 2W65B 5FF6A 5KZCB 5B38B 3NABH 2F15A 3P9LB 4OD1L 4G7YH 4JQIL 5BQ7B 1TVHA 3BKJH 4K71B 4O51B 1K4CB 1QLRA 4UV7H 5JXAL 4L8CA 2SEBA 3KPTA 2X89A 3V7MA 3V6OA 1FORL 4RZCB 5DUPL 2EEAA 3GSVA 2VDLL 1CG9B 4PBWD 4NOBA 1N6VA 5C2UB 3PWVB 1RURH 1U8LB 3P73A 2MPAH 3ELAT 4G8GA 1RZFL 4Y5XB 2CMRL 4KMLB 4YZFE 1PG7X 1FDLL 3RVTC 4H88L 1MH5A 4OZHE 2F54B 5F9OL 3TO2B 2VERN 4G9FD 1BVZA 3I6KB 1F4XL 4Y16B 3VXUD 3LKSB 3AROA 3MNZA 1NGYA 1SYSB 1KEGH 4GFTB 5C0JA 2GHWB 3VFRA 4LCCB 5DQ9A 4FQIH 3WS3A 1IAIM 3FONB 1D7FA 4GKZB 5LGHH 5DI8A 1JHTB 1RUQH 3NH7H 2B1HL 1CLZH 3BH8B 3MPCA 3G5YB 2GFBA 3KPNB 3GJEB 1FL3A 3IRPX 1JF1A 1MNUL 4M6NL 1HDMA 1I4FA 4Z78B 4W6YB 1HQ4B 3IU4L 4XMPH 3QIBC 4N0YH 1X6LA 5HBBA 4MAUL 3FKUS 3RDTD 4QTHB 3CXDL 2OQJB 4I48B 5E2UL 5CJQH 1A5FL 4JN1L 4C83A 3MJ8A 2Y7QB 3VXSB 5HHPA 1TVBB 5KS9B 4PGEB 1D5BB 1KJ3L 3TWCL 1QKZL 2GITB 3H3PL 4ONHA 5GS0C 5GGUB 3EYQD 4BH7A 2YA0A 4ZOAA 2JIXB 3GI9L 2BNQA 2VH5H 4HX1B 1SEQH 4P2RB 2KQNA 4ODUB 3RL2B 3HI6L 3I50H 4WFFE 4CVZB 5EPMA 4HJJL 5DFVD 4YXHL 3CSPA 1EZVX 4N1EA 5ELIA 1FGNL 3M8OL 3DHMA 2ADJB 1MPAL 3OKEB 1NC2D 1T22B 3JSSA 1WICA 3QG7H 2ZKHH 4KDTC 2Z4QA 5GGRA 4J8RA 3FQWA 3TT1H 2HT3C 2P24A 4IIQC 1WCBB 4RISH 5FKAB 4KY1L 3IDYB 4Y4FB 3VJ6A 1MCCA 2ID5A 2Y07L 1YEKL 2JJTA 5GISH 5T5NG 1N0LA 5SWSE 3EJJX 1AO7E 3HAEG 1HINL 4G6ML 3V52H 2FSEB 3SKJL 1ZMYA 3MFFA 2BFVH 3C5ZC 4F80A 3X11B 1Z5LB 1MI5E 4YHMH 4QXGH 5HDLA 4LLWA 3ABZA 1MAMH 1NGXA 4Z76A 4XH2A 3MX0A 4FQ2L 2APXA 1TVHB 2PCPA 4KI1A 4OZGA 3H2WA 1QLRB 2HJLA 5EO9A 4L8CB 2D7OA 1FNFA 4LSDA 4ODVL 4YC2B 2XQYK 3GSVB 4KAQH 4PV8A 2AEQL 2PETA 3P73B 1YEGH 3BISA 2PKDA 3JWDH 1UYWH 4JFQA 4LSVL 3ESUF 4G8GB 3LKQA 1BFTA 2G5RA 5JW3L 4IJ3B 3DUHA 1U91A 4Z7UF 4GKSA 1INEL 5TF0A 4JO1H 1X5XA 1VESA 3FZUC 3PABA 3VU2A 2QKIA 3MNZB 1NGYB 3OJ2C 3GM0A 5C0JB 5K9KA 5IV2A 3WS3B 4IMLA 4EDWL 3MLWL 1BJ1H 1MVFA 5FHBH 3WN5C 5DI8B 3TEUA 1A7QL 3P4OA 5GZND 4RGOH 4UINH 3HA0A 2YR3A 2GFBB 4RMUA 4XPGL 1JF1B 3V9FA 1HDMB 1I4FB 1URLA 1DBJL 5D1ZA 4X7SL 1NAKL 4NDMA 2IQ9L 5IHBA 1U3ZA 3ZL4L 1XIWC 1C5DA 5AD0A 5D2NA 2HFEB 3G5ZA 4C83B 3MJ8B 5HHPB 3L3JA 5C0EA 3LEVH 2A9ML 4XC3H 3LRGA 1MCDA 5BJTA 2DJ4A 2P5WD 3QHTC 3F12A 4ONHB 3DXAE 3VA6A 1EDQA 4BH7B 4HT1H 3O6ML 2BNQB 3IB4A 4IMKC 2O93L 1RUPL 3WO3B 1FCCA 5C07D 4KDWA 2VLJB 4YUEH 5F3HA 1A47A 5EPMB 1QLFA 5I75C 5EUOA 1RHHA 5CUSH 1LDPL 3U0WH 1YYMH 2JJSA 4XTRC 1GGIH 4PG2C 1DL7L 5GGRB 4J8RB 4YHIA 2P24B 4RWYH 1MEXH 4MZ2A 4PGBA 1JNLL 2FLBT 3B2UC 4WRLA 1X5LA 2EE6A 3VJ6B 1QBMH 4YDLC 4M62L 2HFFA 2W07A 5GJSL 1RZKH 4TPRL 4DOHB 4J6RH 5BO1L 2XTJE 3Q0HA 4I77L 3PJSA 1J5OL 3MFFB 1OAUH 4FQQA 4KZEH 4JRXD 5I2IA 2OI9C 2EYRA 1JPFA 1AGEA 4LRNH 3CFEA 4BA8A 1NKRA 1MFNA 1Z0MA 4LLWB 1Y18A 2V5TA 5CKAA 1OAZL 4XMLH 1EGJL 1NGXB 3CFCH 5C2BH 5DJ6A 4Z76B 3FAWA 4XH2B 5FA4A 2PCPB 4OZGB 3LRHA 2HJLB 2EDNA 5EO9B 5TQ0H 1T1WA 3KWWA 2EDTA 4PV8B 1G9MH 1XGQA 5D9SA 2QADB 1HEZA 1F00I 1OP9A 4HDIA 2VIRA 3PWPA 4QXTA 4JFQB 4P2QA 5IKCA 3H42H 4PJEE 5FM8A 3S35X 3LKQB 4LHUD 1CIDA 3GMOA 4LGPB 1TXKA 2EDOA 3QEQD 1U91B 4IM8A 4ISVA 4JQXC 1WIPA 4GKSB 4GQPH 3PDOB 4ZUVA 3ULUC 3DV6B 3PABB 4OZIA 2QKIB 4FMKA 4HMCA 5DHYA 5K9KB 3RAJL 1CGSH 3DSFH 5IV2B 5EORH 3A67H 1DFBH 1T80A 2HTLC 3CNKA 4ODSL 1QNZH 4LU5L 5IFJA 4LSRL 3D0LA 2JK5A 4R7NA 3KPSD 3QPQC 3P4OB 4R4FL 1UXSA 3UYOD 1BAFH 1ETZA 1LVEA 1DUYA 3O6FC 3EFDH 1LQSR 1JPSL 5FM4A 5D1ZB 1DCLA 2IMNA 3NIFF 3SKMA 1HNGA 5T5FH 4NDMB 2BVQA 5FYLE 4LCWD 5JQ6L 1NC4D 4UNVA 5KVGL 4MXQD 3B9KC 4M61A 1FO0L 2A77H 1ORSA 5DEFA 1N4XH 1C5DB 2LTQC 4XPBH 5E9DA 5HHMD 5FEBA 1H3GA 3G5ZB 3QIBA 4OGAD 1CQYA 5KVFH 2RR3A 1X5GA 5BJTB 4BUGA 1T5XA 2MSPA 3VGHA 5FGCB 3F12B 2VDMH 3FCTA 5KS9F 5ALCL 3RIFK 1DQLH 4CVUA 4KJQD 3V7AG 1MHPH 5DD6A 2DI7A 3VA2C 4OGXH 2NY4C 2BNRA 1GGBH 5F3HB 1QLFB 1BZQK 5HGGS 5EUOB 1RHHB 2IFFL 3NPSB 1J1OL 3IFOB 3DHJA 4YHIB 5F1OB 1BVLA 2HP4A 1L7IL 4PGBB 3BGFC 4Z18A 3VXRA 1OGAD 5TDOA 2UZIH 2EDRA 5CS7A 3RWGA 2DM7A 7FABL 1T0MA 2HFFB 2HKFL 4JY5L 3G6JF 3M1BA 1FZMA 2C5DC 1QBLH 3PJSB 3BPNB 4KDTA 2Z8RA 2VC2L 1G84A 4ZUSA 4IIQA 1G7MA 4FQQB 5I2IB 5IVXE 2EYRB 5CZXC 4RMWA 2WMPA 2UZXB 2CK0L 4JY4A 1JPFB 3UPRA 1AGEB 1I9IL 3NAAL 5EC1A 3CFEB 1WCQA 2WWKO 3UYRH 1Y18B 3S98A 5DJ6B 5FA4B 3QDME 3C5ZA 1TTUA 3P9MA 4LP5A 4UI2A 1CDYA 1MFBL 1DBAH 1HSAA 2DQJH 3HZKA 3KWWB 1KG0A 5JMRA 5TGBA 1AE6H 3M45A 4I9WD 1RZ7L 1XGQB 1A7PL 2APTA 5D9SB 3HNTL 4D94A 1TVDA 5I66A 1HEZB 2CRMA 1TPXB 4HDIB 1FFPA 2VIRB 3PWPB 4QXTB 2H2SD 4P2QB 4BH8B 5IKCB 2DLGA 1CGTA 4AQ1B 1F2QA 1HYRC 1CGXA 4M43H 2B4CH 4S1SL 4KI5D 3REVA 1CWVA 4ISVB 2C4XA 3X14A 3VD4A 1NCDL 3OAYK 4ZUVB 3WHXA 4KROD 1GZQA 3OKMA 5DJCA 1LNUA 4HUXA 5DHYB 2BVTA 1NCUA 1U8HA 5T3ZD 1B4JL 3O6LH 1H8SA 4OCWL 2LFGA 3D0LB 3QXAA 2JK5B 4R7NB 3P30L 1F6FB 1UXSB 3D3VE 1ZHLA 1IC1A 1FG9C 1YMMD 1YEFH 1FRGL 3GSXA 1DUYB 3IDJA 2NY6D 1CZ8H 1ZGLA 3WN5A 5GS2D 3O9WD 3N1QC 3SKMB 5C0ND 4WCYH 5K59E 4KH2A 2BVQB 4PJXA 3OHXA 3VD7A 2HN7A 4M61B 3VWKC 1J8HA 1ORSB 1ZLUK 5DEFB 1AKJD 2QQKH 5E9DB 1S9KC 4ORGB 3QIBB 5GGQH 3SDAD 3B5TA 1EXUB 4ZUUA 4C56A 4OLXH 4MMXC 3CVIH 4O4YH 2I25N 3NIGE 4GG6A 5D71L 1QSFA 2I27N 3FCTB 2FBJH 2VXUL 3TYGL 3DI2B 1I7ZA 3DV4A 3EYOA 2AJSH 3MRGA 5CILH 5DD6B 5ESVA 1KN4L 3JTTB 4X8JA 5HDQH 3ILQD 1F97A 2ZSWA 4DGIL 2VUYA 2X1QA 2BNRB 4BQ9A 5HYSA 3TJEH 1QG3A 4ONOA 2VDRH 4X5LA 1UWGL 2WUCH 3IDXL 1MVUA 2FZ3A 2VLLA 3QDGD 3QWRD 4IMKA 1ACYH 2ZOKA 4XAKE 5LWYH 2NY5H 2IAMC 1QFOA 1BVLB 1GC1L 4BSJA 3CFDA 3VXRB 5TDOB 2HWZH 2B20A 3RWGB 5FK9A 2RBLA 1T0MB 5SV4A 1R5IA 3M1BB 3QUYC 1FZMB 2YPLA 4PRHA 5E6ID 4P57A 3T0VA 4ZUSB 2P1YA 4IIQB 1G7MB 3T4YA 2IALA 1W8NA 3T3PE 2FH8A 1YPZA 4JY4B 3UPRB 5HJ3A 2QHRH 5EC1B 5FUOH 1GAFL 1CR9H 1DR9A 3V5HA 2GJJA 3QNYB 4YFDB 2MWCA 3DVNA 1OP5H 1HHJA 3C5ZB 4L8DB 3P9MB 5EC2A 1O7VA 2DJUA 3ULVL 4Z5RA 1HSAB 3HZKB 1KG0B 3QO0A 4XNZB 5TGBB 2B1AL 2PN5A 5B4MD 1F45A 2F53D 1JGDA 1FFPB 2AJVH 3RX8A 1UCTA 4JPVH 1A9BA 4FZ8L 4EUPG 4JCLA 3REVB 4MA3A 3QH3A 4RGNC 3X14B 5I1GL 2VKWA 3NCCB 3WHXB 4PJDA 1GZQB 1OVZA 3OKMB 1NGZA 1LNUB 4K94L 4HUXB 1VKXA 4XWOC 3S34L 1M4KA 1KB5A 4JQXA 4I13B 2QV2A 4FNLH 4HJ0D 3HRZA 1A14L 5ID1A 2R8SH 2NTFA 1N0XL 2O5XH 4PJAE 3QXAB 5EIIA 1MOEA 4K7PH 1CL7I 3S88L 3TIEA 3SPVA 1ZHLB 2BY2A 3IDJB 2NY1C 3U7YH 4HPOH 4KTDL 1TTGA 2OJZH 5FGBC 1ZGLB 1Z9OA 2EZ0D 5HHOA 3B5GA 1WIUA 3LB6D 1DUZA 2FHFA 5L6YL 4PJXB 1R6VA 4JFDE 2FO1A 3OHXB 2HN7B 3GIZH 1J8HB 4Z7OF 5E8PA 3O6FA 2NPLX 4U33A 2OSLB 3R1GH 2ATKA 3VRIA 3OWEA 4HUMB 2A0LD 3NA9L 4AENA 1KF9B 1NGQL 4ZUUB 1LK3H 4Y19E 5TE7L 1LO4L 4GG6B 1VACA 3B9KA 4GRLC 1QSFB 5C6TL 4I8DA 2Q76B 1CYGA 5CLWA 1NKOA 3EYOB 3MRGB 2QQNL 4JCMA 4LMQI 1F4AA 5ESVB 4F7TA 3LN4A 1AC0A 1CFQA 3K4ZA 3S36H 2ZSWB 3H7BA 4P49A 3STLA 1CLOL 5CGTA 3UXFA 5HYSB 3RNKA 4JHZA 1MVUB 1RZJL 1IT9H 2BVYA 2VLLB 4M48L 1KIRA 2ZOKB 3MC0A 4WUUD 3R06A 4HH8A 3CFDB 2PYEE 3HUJA 4TSBH 1KBGH 5F9WC 4KJYA 4LSPL 1CTNA 1MIEL 4GMTL 1R5IB 3NFNA 1T04A 5D5MF 5GS0H 2YPLB 4PRHB 5F6HJ 2BSTA 4P57B 5E56A 4TVPD 3PL6C 3T4YB 1M7DA 2VWEE 2IALB 1YPZB 4PJGE 1FLRH 3UX9B 1C5BL 3GSWA 5I1EL 4MHHG 5I1JL 3W11D 1J05A 5HJ3B 1S7VA 4EN3A 3R0MA 3B2VL 5GRUH 4WEBH 2R2BA 2XZCL 4OF5A 5C6PB 4QEGA 3K7UA 3DVNB 2OI9B 1HHJB 4KKLC 1NMAL 4JLRA 1GH7A 4NZDA 5EC2B 3DETC 4LP4A 1WZKA 2BY1A 5JPNA 4Z5RB 1MCOL 1Q1JH 1VB9A 3QO0B 5D7IA 4UQ2A 1CGVA 1E6JL 2AI0L 2VDNH 1NMBL 1JGDB 1OPGH 1VFMA 3LKNB 3ARUA 3QPXH 3WFEL 1A9BB 3T2NL 4LCUA 2X1WL 1A1NA 1SMOA 2F5BL 4MA3B 3QH3B 1DBMH 1ZLVK 3K1DA 4PJDB 3GSOA 1NGZB 4NCC1 3SDXF 3T2OA 3BXNA 1N64L 5K9QG 1VKXB 5DR5L 2FX7H 4GXVL 5D2NE 3DI3B 4K7PX 1KB5B 4N90E 4HF5H 1OAXL 1KC5H 1FAIH 4FQXA 3HRZB 5ID1B 2NTFB 5D6CA 1JYNA 5EIIB 4HCRL 2L7UA 4PLKC 4I3RL 4JDTL 2VQ1B 3P2TA 5HPOA 3RGVC 2ED9A 3T77A 5TE6L 1CLYL 5IBUB 2VKXA 2CXGA 1FBIH 5HHOB 1JPST 1MAKA 4HUVA 3EZ8A 3ULSA 3UO1L 5ICZA 1DUZB 1R3JA 1JHKH 1NUFA 4XCFL 4XP9H 4EDXA 5BVPL 1KJVA 1CFSA 1IJ9A 4OZFG 5E8PB 4EVNA 3O6FB 4QO1A 3VW3H 2ATKB 3VRIB 5DJAA 3FOMA 4AENB 2PR4H 1RJLA 4XBGA 1Z9MA 4LSTL 5KVEL 1VACB 3B9KB 3VWKA 1NFDA 5EOQH 3KJ4C 4W4OC 1YN6B 4U1KA 4HGWA 5CBAA 3SN6N 2LTQB 4L4TE 4YHKH 1XEDA 3MGAA 3WXWL 3DIFA 3ZT6A 3S96A 4F7TB 3LN4B 5KJRH 1CFQB 1RUKL 3BYTA 1IAKA 4WDIA 2KPNA 2WLZA 4MJ4A 1EV2E 3H7BB 3TBWA 2NY0C 3STLB 4FQLH 4HKXA 3MUGA 3RNKB 1AC6A 1A7RL 1CIUA 3GO1H 1KIRB 4QCIA 3R06B 4FP8L 3U2SB 2NY4B 2WW8A 3E3QE 5JW4N 2EDEA 3HUJB 3MLZL 1A6VL 5HYJD 1UM6H 4PRIE 2ESVD 5JLZA 4M5ZH 5EZLA 1T04B 3RY4A 1EEYA 2BSTB 3JWOL 4X9HA 3PIQA 2IAMA 3KXFA 4F7CA 5I71C 2WLYA 3BGFB 1L9MA 5IBTH 1KJ2L 1I1AD 4BK5A 1ZANH