4NKLA

Crystal structure of staphylococcal nuclease variant delta+phs v66a/i92q at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYQYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4nklA00
3DMUA 5CV6A 1SYDA 5CR3A 4ME5A 4EQPA 1KAAA 3OSOA 5IGBA 2PYKA 4H7BA 4ZQ3A 3TP7A 5HURA 5ISRA 3SHLA 2SNMA 4B9XA 2F0EA 2HQEA 3SK8A 4NDXA 1JORA 4HMIA 4LAAA 5DEHA 4DFAA 5C6AA 2PZUA 3BDLA 5CV9A 3EJIA 2F0HA 5E1FA 1SNPA 1ENAA 1EY0A 3MVVA 5KEEA 4K8JA 4IZ8A 4KY6A 2OF1A 4G57A 1AEXA 5IGCA 1A2UA 3C1EA 2EYPA 3T16A 5IOCA 4IUNA 4F7XA 5CGKA 2EXZA 1KDAA 1EY8A 1RKNA 4QF4A 4K5VA 3SK4A 4ID6A 3TP8A 5IGFA 4TRDA 4B9WA 3ITPA 3MXPA 4WORA 2F0GA 1SNOA 1KABA 5KRUA 2F0SA 2F3VA 1A3VA 3TMEA 1EZ6A 2OXPA 4J6HA 4R8NA 4RKLA 2F0JA 4NP5A 3SK5A 1II3A 3MZ5A 1EY5A 1KDCA 3HEJA 2F0WA 1A2TA 2EYJA 2EY1A 2RKSA 4HMJA 3NHHA 1JOOA 4RKBA 5M9OA 2SOBA 3S9WA 2RBMA 1SYGA 1STYA 3PMFA 5J39A 4K5WA 5EKLA 1SNQA 3U9OA 1EQVA 2EYMA 2EYHA 1EY9A 3P1HA 4J1MA 5CV4A 3V2TA 2RDFA 4KJOA 1SNMA 4QB4A 2F0OA 2LKVA 1F2MA 4EQNA 4K2KA 2PW7A 1NSNS 5CV8A 5E3FA 1EY7A 5KGUA 2F0QA 1EY4A 1A3TA 4KY5A 4OL7A 3SR1A 5J1ZA 1STNA 3P75A 4PMBA 4EVOA 1SYBA 1NUCA 3EVQA 5C3WA 4PMCA 5KYIA 1EYDA 2F0NA 3R3OA 2QDBA 3D8GA 5CC4A 1JOKA 4ZUIA 4K6DA 4S3SA 5DAUA 5C5MA 4KHVA 4KTAA 2F0LA 2PW5A 4HTHA 2F0PA 1KDBA 1EYAA 2F0UA 3H6MA 2PZTA 1ENCA 4MIUA 4YIJA 5EGTA 1SYFA 4ZUJA 5IGEA 2F0DA 3NP8A 5I6YA 4NMZA 2NUCA 2PZWA 5EKKA 3RUZA 3BDCA 4K14A 1STAA 2F3WA 3HZXA 1EZ8A 3NQTA 2M00A 5IIFA 4KV6A 1SYCA 4NKLA 2F0IA 3NXWA 3C1FA 5C5LA 1F2ZA 4KJNA 4ODGA 2EY5A 4EQOA 5C4ZA 4IALA 4N9PA 5I6WA 3MEHA 4WRDA 3QB3A 5I9PA 3MHBA 4I65A 2F0KA 1U9RA 5CV7A 1TR5A 4PNYA 3TP6A 3TP5A 5C4HA 3OWFA 2ENBA 5I9OA 5IGDA 1SNCA 2F0MA 2PQEA 2KQ3A 1A3UA 4KY7A 5K5PA 2F0FA 3QOJA 5IODA 1SYEA 1STGA 4KD3A 2OEOA 5CV5A 1SNDA 2F0VA 2O4XA 2F0TA 1JOQA 4DGZA 3NK9A 3SK6A 5KYLA 1TT2A 2EYLA 4DU9A 3D4DA 4QMGA 2EY2A 4K2LA 4KD4A 5F2DA 1IHZA 2EYOA 4F8MA 3EROA 4N9TA 3OMGA 5NUCA 5C3XA 2KHSA 3DHQA 1EYCA 4DF7A 3D4WA 2EY6A 5KIXA 3OMCA 3VA5A 5JAVA 5IGGA 3LX0A 3ERQA 1EY6A 4K8IA 3SXHA 1F2YA 5J22A 4E6IA 1STBA 3NUCA 2SNSA 3QOLA 2EYFA 3T13A 2WACA 5HGTA 1STHA 5JOBA 4K5XA 3E5SA 3D6CA 1TQOA
chains in the Genus database with same CATH superfamily
5LHY1 1SYDA 2QKIC 1C9OA 5GAEC 2L4NA 4JI5Q 4JK1C 2Q2TA 4IOAA 3S1QB 4DR5Q 1F9RA 1LTGD 2YTVA 4A3JB 3WOEA 1RF2D 2L11A 2Z0SA 4CJ0B 5IP7G 1ASZA 2K14A 3I2ZA 3MVVA 4LFAL 3GTLB 5IGCA 1AEXA 4IUNA 2ZM6L 5I2YA 2QF7A 4BY1B 5IGFA 3E6ZX 3EIVA 2C35B 1IW7D 5D3DA 3TEHB 1KL9A 2A19A 4JI4L 2I07B 2XVSA 2A6ED 5KRUA 4TKOB 2K05A 1N34L 2DNEA 3GTOB 2QW7A 4A4IA 2KCTA 3K80C 1Q82C 2A6EC 3A5ZB 4DUYL 1S3OA 3RZOH 3U9OA 2LMCB 2MO1A 4JYAL 1EY9A 1TWFH 3KF6A 2UUBL 3GD7A 5DNFA 3CCEA 1G291 3KBXA 4JI3L 2K5VA 3FDTA 4R1JA 1WOCA 2XRQD 4JI8Q 4LF9L 1VQCA 3A5UA 2YU9H 3CQZH 1JOKA 5DAUA 1VCIA 1PH5A 4A3DH 4KTAA 1E1TA 5E4XA 3GO5A 2K1BA 5EGTA 4DV7Q 3RN5A 1M8AA 5M5WH 4A3IH 3F8TA 3K58A 3S1RB 1IBLQ 3PIOA 1RHPA 4CJ2C 3C1FA 4JI6Q 2ZXOA 4DV4L 2KCNA 1HQMC 2RCNA 3GV6A 1HTLD 1XXGA 1QJOA 1FL0A 2JA7B 4GNXA 5C0XH 1L2FA 4KD3A 1EU3A 4YY3L 5CV5A 4U673 1FVIA 2N55A 4UP7A 3I4NB 3NWSA 2BE5D 1XNRQ 3F2UA 1V1PB 3QJYA 4Y7NB 3NENA 3HOXH 1P16A 3BYTB 2BE5C 2B63H 4X65Q 4FXGC 2E8GA 4R4TA 3STBC 1PH3A 3C3LA 3DMUA 1WTWA 1SRUA 3MXNB 1AW7A 2NVQB 3TQYA 3KF8B 3L0OA 2K4KA 3FKIB 2VXWA 4KHPQ 2XNAC 3HOWG 2KEEA 4LUOA 4HSPA 1K0RA 4FO2A 4C3HB 3CC4A 2OQ0A 5CGKA 2EXZA 2ICIA 4RA8A 1X3QA 4MHEA 2QCPX 5CORA 2MJ8A 1K73C 4A3EG 4A3MH 3H3VH 5BR8Q 2ZJRA 3HOVB 1I50H 5C0XI 2ASBA 1MGSA 4GOPA 1EY5A 3ND8A 1VQ5A 1BO0A 5M9OA 2R93G 2UUAQ 1DOKA 2B2VC 4MZ9A 4A3FH 1HPCA 2IX1A 3PIPA 3M4OB 1PZID 2D62A 2HDMA 4EQNA 2PW7A 4A3CH 3DUZA 3CRLC 2O5JC 1MKHA 1GUWA 1QE6A 2NWGA 4DR2Q 3K57A 2PPBC 1PYBA 1VQAA 4AIMA 1PTOH 4QJFA 3KLWA 2F0UA 3K7AB 4WJ3M 1FJGL 2NUCA 3OWEB 3RUZA 2MNAA 2Z8LA 3H15A 1SFOH 4IUTA 1DXMA 4CKCA 4IFDH 5C4ZA 1YHQA 1HR0W 4B3RL 3H3VI 1PFMA 3AU7A 1K8MA 1B3AA 5M3FB 1ZKOA 1SNCA 2KCMA 4C2MH 4A75A 2Z1CA 1VQOA 4B3ML 1MI2A 4JW0A 3QOJA 3FMCA 3I4LA 3HOYB 1VQHA 4L6TB 2O4XA 1JOQA 2NVTB 1TT2A 5M3MG 3PO3H 4K2LA 2JA6H 4L63B 1IHZA 2KJXA 3SVMA 1QVFA 5T1GA 5IYBG 1VDZA 2L0CA 1SE2A 1IBML 1IYUA 4OIKA 5C3EB 4GKKQ 5CV6A 2QILA 1B44D 3EBEA 1OXUA 2DY7A 4CHTB 1JE4A 1X3PA 3AMUA 3W3AA 4NDXA 4LF5Q 4XQQA 4X3TA 3A74A 4DFAA 3MA2B 2R3ZA 4DAPA 1NR2A 4LFBQ 4IFDI 3DXJC 2IX3A 1IBKL 3K7UC 2F1MA 1V8QA 1A2UA 3P20A 1BOSA 3T16A 1EWIA 3CCRA 3RLFA 4ID6A 3SK4A 4BBSG 2VQEL 2Y0SB 4IPDA 3ITPA 1E2VA 4GKJL 1TWGB 4A3GB 1T9HA 2F0JA 3PO2H 3S1NB 4TQUS 1EIFA 2R61A 1DOLA 2ZTDA 1HNZQ 1UUPA 4LF6L 1J5EL 4BA2I 5FLMG 1V43A 4XTCS 1SE8A 1Q8IA 2WFWA 1K3BC 1XX8A 4OONA 3T53B 4A3LG 2N3SA 3P75A 1NCVA 4DN4M 4ZAIA 1LTID 3A0JA 1PZJD 1X54A 3GTKB 3S17H 4OXPA 1FNUA 3T1HL 2B2TA 5EPLA 1Y1WG 2B2UA 1EU4A 1U4RA 1UE1A 3H0GG 1X65A 1Y14B 1SLJA 4DV6L 5I6YA 1T5EA 4IPHA 4K14A 3UE0A 4LFCQ 3PF4A 1TS2A 1JC7A 2F4VQ 3H91A 2E2IH 4B3TL 1NTGA 2OCEA 2BH2A 3HOUH 2A74C 3C46A 2RCFA 4RAUC 5A2QE 4RGOS 1Y8NB 4XYOA 5L37A 1WTPA 2K75A 5JJLA 2IW3A 2EQSA 1SNDA 5FLXc 2F0TA 1S5DD 4UDUC 3RD4A 3F2DA 2XTIA 2E2JB 4YHHQ 3BZKA 1EEFD 3GTLH 4K0KQ 4A93G 2H1EA 3X3NA 3VA5A 1M1KC 3Q23A 1GD7A 3PV0A 4JOIA 4E6IA 4CJ1B 2EYFA 2WACA 4FF1A 1GKHA 4YIJA 4V190 2AHOB 4ME5A 5ISRA 4X62Q 4H7BA 1AZPA 2RDGA 2CVRA 1TWAH 3CXCA 4HMIA 1I94L 4ZRZA 2PZUA 3BDLA 1F9PA 4DV5L 4IZ8A 1XMQL 1C0AA 1R9TB 4BBRB 5C4XB 1Y8PB 1JT8A 4F7XA 1H95A 2K5WA 3I55A 1GOZA 2AQ3B 3KBGA 2CQAA 1XNQQ 4DR6Q 3CHBD 3VR5A 1KABA 1TY2A 1TWHB 1A3VA 2BDNA 4O42A 1EL0A 1U5KA 2EY1A 1KXLA 4OGQC 5CBEE 2Q2UA 4JI0Q 2L12A 1A62A 1E3PA 1SXTA 1KC8C 1IYVA 3M4YA 1SNQA 3CPFA 2AMCB 1JE5A 1Q1EA 3U9SA 2R92B 3EN2A 3RMHA 5KGUA 3QWNA 4KY5A 3J7YW 2NN6G 3VYTA 2C9OA 2IY5B 4M8AA 4AYBB 1F9QA 1A63A 5C0XJ 1AE2A 4ZUIA 1DZ1A 3EA6A 4LMQD 4GNXC 1PMRA 2L1BA 4FF4A 1ICFB 3GTMB 4PZ6A 1NR4A 1Y8OB 1XPRA 2B8GA 4Y7NH 1HXYD 4NPSA 4ABNA 2TSSA 1D5ZC 3EFXD 1K8GA 4JI1Q 3CC2A 3A8KE 3MEHA 4OX9Q 5JJIA 4I65A 1HNWL 5FOBB 4JI7L 3BU2A 1CA5A 2HDLA 3OYYA 1MD2D 5IGDA 4H02A 3CP0A 1A3UA 1RIPA 4GN3B 3ER0A 3CMAA 3CCUA 2GA4B 2LXJA 3KDFB 3FKIH 1AN8A 4R4IA 3SK6A 3D4DA 1SBBB 1YHAA 2KHSA 3I3CA 3GP7A 1PH1A 1LTLA 1ZXTA 1CKMA 1V9PA 2WP8J 3SXHA 1AP0A 1FNWA 1N8RC 4GLVB 3NUCA 1D1IA 1TS4A 1GUSA 3LNNA 3Q0AA 4KMUC 4FF3A 4JI2Q 1EYGA 3NE5B 1GUGA 3OPOA 1I4RA 4NXML 1D2BA 1VF5C 5H1SE 1FD7D 2SNMA 3BYYB 3CCJA 3HOZH 2WKDA 4GOPC 2VNUD 5C6AA 4JV5L 1QZGA 1J6QA 1E2ZA 1VQBA 1RCVD 4P2CB 2HHHL 1D8LA 4PV1C 2YYZA 4QCLA 2K5QA 3A8JE 2JP1A 4BA1I 4DNTB 2UUCQ 1I6HB 4P74A 4MNOA 1K83B 3U4VA 1S72A 1HNXL 4LW1A 4WJ4A 1IL8A 4PZ8A 2N88A 1CFMA 1WYDA 1A2TA 2B2YA 4C3IH 2N49A 3EQLC 3X3MA 4IFDJ 2EPBA 4Q0FA 3GTPB 4JBKA 1SNMA 2JA8G 3AFPA 4H13C 3T56B 3T4AC 3OTOL 1STNA 4PMBA 1NUCA 1VQLA 5KYIA 4QUCA 1I5FA 4JYAQ 1XWEA 1Y1VB 2QDBA 5CBAE 2UUBQ 5HY6A 3F2BA 3HKSA 4JI3Q 4A3DG 4HTHA 1LUZA 1S4ZA 2F3IA 3IFTA 3HOYH 3I56A 1KHIA 1IKLA 4RCNA 2NVTH 4ZYSA 3NELA 3DLLA 4LF9Q 4A3IG 4KN7C 2A1AA 4OWTB 2MPMA 1J8IA 4DR3Q 5BN3A 2JXMB 2E2HH 4X64L 1HFGA 4BS9A 4UPAA 1WVLA 5M5XB 4IPGA 2ENBA 5LL6S 4QGUA 1VQIA 1EFWA 4PG3A 3VR3A 3S2HB 1L0XB 2D2CC 5C0XG 5FJ8H 2JA5H 4RGMA 1HTPA 1Q8KA 4LF4Q 3ZYYX 1D1KA 2EJFC 2WB1E 3S16B 2HD3A 4DV2Q 4FXKC 1PH8A 3RNUA 5C3XA 2K5NA 4RGNA 2Q8TA 3DEPA 3HOXG 1N33Q 4YY3Q 3ERQA 2B63G 5E4WC 4PQXA 3WWVA 4A3BH 2AKWB 3I91A 4C3JH 1PV4A 1HZAA 3E9HA 4NB3A 1TWGH 3PUXA 4EQPA 1KAAA 2ATWA 2LXKA 4J15A 3HOWB 2VZAA 2N8NA 3L2PA 3S1NH 2R7ZH 3SK8A 3S1MH 1HZBA 4G7ZC 4RMFA 4H0LC 4NXNQ 1ENAA 5EBCA 1UE5A 3S2DH 4QY7A 4HSVA 1FYCA 2IPKD 2Z4IA 4A3MG 1BNZA 2XWBB 1EZ6A 2R93B 3GTKH 3I72A 4DAYB 3C2PA 1YIJA 1EQRA 2VB2X 2SOBA 4OO1H 2B2UC 3KJPA 3OW7A 5J39A 4LF7L 5EKLA 4KKUA 3JC66 3QG1A 3RR5A 1FR3A 4AQYL 1E0BA 2KCCA 5IYDH 2MHVA 3BVGA 2KHIA 4F87A 4A3CG 1CT1D 1QCBD 2F0QA 2IL8A 5AFWA 4X3KA 2LY7A 2A69D 2ZTEA 3R3OA 3NWTA 5CC4A 3KLSA 4K6DA 1B53A 1E7ZA 1KDBA 1G2TA 2K50A 2A69C 2ZXRA 5IYCH 5EPJA 2K32A 4LUZA 4DUZL 1BBWA 3VYRA 2E2DC 1EZ8A 3GV3A 4C1NI 4JBWA 2LFNA 1SYCA 2E2JH 3I4MH 1AH9A 1QUQB 4IFDG 2BH8A 1RL2A 2D0OA 5I6WA 4WRDA 1LT6D 1I4XA 2F0KA 3KF8A 3TP6A 1QVCA 1W6JA 4FDBA 3OWFA 1JJCB 1SE4A 2L5TA 4JOIC 1KRSA 4C56C 2KQ3A 3L3OC 4DAVA 1WTQA 2F0FA 1S5BD 2WIIB 5M3MB 4B3RQ 4CKBA 4OO1I 1XPOA 2B2WA 4Z9CB 3CKIB 2I46A 4DU9A 4QMGA 3J81E 1UE7A 2KUMA 1EIHA 3MWYW 3PO3G 2JA6G 1VQKA 2E5LQ 1PLFA 5NUCA 4B3MQ 4HJ5A 1U0LA 4DXGA 3H3VC 4TVAB 1JB7A 5C4XH 1F77A 1ZYRD 1VQ9A 2WB1G 5LMNW 1IKMA 3CCSA 1AE3A 1TWHH 1YVCA 1ZYRC 2IHFA 5IGBA 1PFBA 3R93A 3HP3A 1E22A 1CKNB 1NY4A 1IBMQ 2B8FA 2UXBQ 1QVGA 1HHVA 1X6OA 3QO2A 4EQ5A 1X3EA 4FXDA 4BBSB 2PCFB 2R92H 3U4ZA 3STBD 2K28A 4DR7Q 4N8X1 3LGJA 5JJZA 3M7GA 3K5MA 1PTOC 4HR7B 4LF8Q 3S14B 3GTQB 4DR4Q 4R8NA 1BR9A 1NMFA 4RKLA 3R8BA 2NZHA 3MZ5A 1JR0D 3T1YL 5LMUL 1DJRD 2EYJA 2G9DA 4HMJA 4RH6A 1JOOA 4IUQA 2RBMA 2ZT9C 2F4IA 1SYGA 4N8FA 1SJHD 3E0JA 1G2SA 3K81C 4JPBW 2NVYB 2LKVA 4HJ9A 1ESRA 2V4DA 5E3FA 4HJ8A 4BY7H 3KF6B 1I4GA 2D5DA 4OL7A 5J1ZA 4DV1Q 2Z9HA 2A6HD 2I0QA 2JK8A 4EGVA 2F0NA 1Y1WB 2EJMA 1J5EQ 3PUZA 3H0GB 1N36L 3KFUA 2UXDQ 5ELDA 2PW5A 2A6HC 1EYAA 2PZTA 1WD1A 2VQFQ 3NBHA 2F0DA 1HA5A 3FRPB 5G3LF 3BDOA 4LK1C 1MJEA 5E7NA 3NQTA 1S5FD 2M00A 3JAMc 2WKCA 1EIYB 1ILPA 4HIKA 5GAGC 2N78A 2F0IA 3JAMi 1YITA 4JI5L 3CU7A 4DK0A 1JWSD 5K36H 3CCQA 2FHTA 2KA7A 1SSOA 3QB3A 2NTSA 2EVBA 4DV6Q 1VQ7A 1U4MA 3VR2A 1X9NA 5IODA 5AJ3Q 2NZ1D 4B3TQ 2BCOA 4APVA 4DGZA 1Z6HA 4GNXB 4I7AA 5IP7H 4A76A 4JVZA 3J80c 4A93B 4KD4A 3J80i 1A8VA 4P72A 3IKJA 2C5CA 1M90C 3DHQA 1QZHA 5C4JB 2OTLA 4DNRB 1HJPA 2MUYA 2UU9Q 2AUKA 4TSSA 1K83H 5IT9c 3I70A 3UE1A 1VQGA 4L5RC 1PFSA 4V0BA 1BBUA 1VQPA 2MO0A 1QWYA 3TZUA 2D9UA 1CHPD 4JI8L 2RHSB 3HKZE 3EJIA 2VUMB 2MGSA 4HJ7A 4K6LA 4DV7L 2ZJQA 2XGTA 3ERSX 2H4OA 1LYLA 2Q2IA 1JICA 5LMNQ 1I94Q 1RODA 3G6JB 4KKSA 4L5SA 1Y1VH 1RDPD 3HGBA 3SK5A 4B3SQ 2F0WA 1CA6A 2NVXB 5C44H 4GN5A 4UY8C 3GTJB 4GOPB 3RN2A 1YJ9A 1NAPA 2BA1A 3PUWA 2A5HA 3ONAB 1GUTA 2F0OA 1C48A 4BXXG 2RQXA 1J9OA 2FMMA 2K01A 1XNRL 1VQMA 1I4HA 2HCCA 4P71A 4FF2A 1D5XC 3DM3A 1KRTA 3AYHB 1WTVA 3PUVA 4X65L 3S2HH 1NMGA 2ZTCA 4LWCA 5HGQA 4ZUJA 5KNBA 4IO9A 1PZKD 1R4PB 1D5MC 2AWNA 1ILQA 1CM9A 4NKLA 3PIO3 3NTIA 4PZ7A 4EQOA 4KHPL 1EWCA 1NE3A 1TU2B 4YCVA 1CSPA 4RHSA 2A68C 1WCMH 3PSIA 5IE8A 4DAMA 1YNJD 1IYJB 4IJLA 5IP9H 5T1IA 3HOWH 2ALYB 3W1GA 5FO9B 1PYWD 3DWQA 3IAYA 3OIQA 5BR8L 1QILA 1YNJC 4DPGA 2EY2A 5M5YH 2XWJB 5D3IB 3OMGA 1VQDA 5G3LD 3LX0A 2UUAL 3QOLA 4RHRA 2DNCA 4QUFA 4JCVE 2Z6KC 2NZOA 5CR3A 3U50C 3TP7A 2R93H 3M3YB 3NBIA 4WJWA 1VQJA 3J81j 3HOZG 2AWOA 5E1FA 3S1QH 3L7ZC 1E2WA 2F0HA 4A3JH 2O2LD 4NXMQ 2AUJD 3KOJA 3D31A 1RKNA 1O7IA 1RTNA 1I4QA 4BY1H 1H9SA 2RSNA 2NB0A 1VF7A 1BVSA 3HKZG 2HHHQ 4A3KG 2HCIA 1KDCA 3GTOH 1LTRD 3NHHA 1UEBA 4QIWE 4C3IG 2JA8B 1C8CA 2AQ2B 1WD0A 4XT3B 3TREA 1I6VC 1LABA 1Z47A 2PQAA 1S5ED 3A56A 2DY8A 2H5XA 1QNUA 2B3GA 1MBYA 3PIP3 4P73A 3CAMA 4IN3A 1YJWA 4O1NA 4KHZA 2YU9B 2BA0A 3JAML 4A3DB 3LWUA 3D8GA 3ULLA 2PMZE 4S3SA 1WTXA 2JEBI 1Q3LA 5M5WB 3HOYG 4A3IB 1DYQA 4I7ZC 2VW9A 3ZJYC 2UXCQ 3H94A 3S1RH 4KJNA 4ODGA 4IALA 2E76C 1XMOQ 1ENFA 2ID0A 3J80L 3U58A 1U4LA 1KQSA 3K5NA 3PGZA 1S40A 2JA7H 4O2DA 5FJ8G 2JA5G 2FINB 4X64Q 4HEDA 1WTRA 1NJIC 3I4NH 3M4QA 5IT9L 3HOXB 5IWAQ 3EROA 3FP9A 2B63B 1EYCA 2EY6A 1DOMA 4OWXB 3S24A 3BZDB 5IY0A 3G71A 1PYSB 2DN8A 1HNZL 4K5XA 4A3BG 2CKZB 4GN4B 1L0WA 2CW0D 4C3JG 3S14H 1FNVA 1SMYD 2WAQB 1SR3A 1RTOA 1BCPF 3KK7A 4IPCA 1G51A 2PI2A 2NVQH 2Q8IB 2CW0C 2R7ZG 1CK1A 1SMYC 1B3QA 4AYBE 3CW2C 4DV0Q 4J8QA 1SNPA 1VMPA 1HA6A 2OWOA 5I4DA 3I90A 2NVYH 4A3MB 1O7LA 3DWPA 1CQFA 4QF4A 4C3HH 4K5VA 1G6ZA 3UDIA 4TRDA 3G6EA 1I50B 1LM0A 3M4PA 4GLXA 5EAYA 3HOVH 2M2LA 1JJGA 3HEJA 3L9AX 4DR1L 1PH6A 5JEAH 3IFDA 1Y69U 4OO1G 1EFID 2ZJPA 4J1MA 1LV9A 1LTTD 5CV4A 1GHKA 5FKAC 1GXDC 4FYDA 1B9NA 4DXFA 5IYDG 3M4OH 1O78A 4EVOA 1L1OA 2NYZD 1H9RA 5DM73 4GLAC 3K59A 4LF7Q 2VS1A 1QOHA 2ICEC 1PTOB 1T5XD 2MFIA 3A7AB 3FHWA 4K0KL 1OXXK 2Q2HA 4LFAQ 1HR0L 4KHVA 1AFPA 2ZM6Q 3H6MA 1DM0B 2FFKB 3K7AH 1WTHA 5EKKA 1STAA 4JI4Q 4A93H 4G4KA 1ICWA 4KV6A 1N34Q 3BVZA 1R4QB 1MJCA 3CD6A 5C4JH 1YZ6A 1JQYD 3I4MG 2GVAA 5EKIA 1W3SA 2PNRC 4RFBA 5I9PA 4X6AH 4DUYQ 4DUZQ 4PNYA 5C4HA 1V1OA 5M3FH 5K5PA 2G5DA 4CBVA 4X3SA 1LLRD 1YBYA 1SYEA 2XIWA 4X66L 3BVMA 1JWMD 4F88A 4DR6L 2JA6B 3ULJA 1EQTA 3MC0B 4N9TA 2VUMH 5JAVA 4L8JA 4JI0L 4ZKBB 2WB1B 3N52A 3Q24A 1YEZA 4JC0A 1XTCD 3CPWA 4ZK9B 3DEOA 1K3RA 2BDOA 5C3EH 2PI2E 2PYKA 2R6GA 2EZVA 3SHLA 4DV4Q 1CSQA 2J7ZA 4LAAA 1B4OA 1PTOF 2KOLA 2F03A 4K8JA 1HZCA 4XDXA 3FPUB 1KDAA 2NN6H 2HIXA 5J3BA 2R92G 4QQBX 1GJXA 1LT3D 1OXTA 5ELEA 2F0GA 1SNOA 1PH4A 2F0SA 2KVMA 1K8AC 2AQ1B 3V05A 4AYBG 2CWPA 3W5OA 2JE6I 1AZQA 4DK6C 4A3GH 1OO9B 5EBDA 4JI1L 5I2XA 2J4XA 4ZKCB 1Q81C 2OQKA 3GTGB 1GHJA 2EYMA 1BCPD 3CRKC 4KJOA 1EEID 2E75C 2D0PA 5LMUQ 3D6WA 1VQEA 4A3EB 1BCPC 1TIID 2Q8RE 4BY7G 1SYBA 5C3WA 3G7LA 4PMCA 5GADC 2O5IC 1ONLA 3Q6SA 4FVMA 2F0LA 4JBMA 3PCOB 1JWUD 4C1NK 5IGEA 1LTBD 3NP8A 1TS5A 1QNKA 5FLXE 2B2TC 1N32L 3AEVA 2DUDA 4HCEA 3HZXA 4JI2L 3VDYA 2JA9A 2NN6I 4A3FG 4DV3L 2IWHA 1ML0D 5K36G 1F2LA 3I7FA 2DJFC 3E9IA 1U9RA 5I9OA 3FPPA 3RZDB 1CKNA 1O7YA 1SDFA 1PXUA 1LACA 3OW2A 1TXYA 4RCOA 1O7ZA 3KUPA 2K04A 1V1PA 4LNQA 4IOCA 2OEOA 2UUCL 1I3QB 3M3YH 1B50A 3TS0A 1WFQA 2RVLA 3O13A 1PH9A 1KNEA 3D0FA 2EYOA 4G7HC 1E24A 3A55A 2EXDA 3UDFA 2K5DA 3MXNA 1FJGQ 2JN4A 1MSHA 3D6CA 1LT4D 3R2TA 2QGQA 4UHVA 1IW7C 1QB5D 1ZEQX 3S15B 1SAPA 1PRTF 4B9XA 1TWAB 1SN8A 1VQFA 2IT1A 1N9WA 1UWVA 3AQQA 3UDGA 2JA8H 5KEEA 4FNFA 3MEFA 4KY6A 1B9MA 5COYA 4OELB 1R9TH 4BBRH 3CCMA 1VMCA 1PA6A 1X55A 4POGA 4GS3A 1HUMA 4B9WA 3BJUA 4IUUA 1X3GA 3PUYA 4DR3L 2EOTA 4NP5A 1Y1VG 2Z6BA 4YCWA 2PNHA 5C44G 4ULLA 1JCKB 1RJTA 3MXUA 1Q12A 1G8ZD 1VQ8A 4K2KA 3MFGA 5CV8A 1PTOD 4LF4L 4UAIA 1JMCA 1EY4A 1LO5D 3AFQA 5DLQE 4BWGB 2HQLA 3RLOA 4DV2L 2E74C 3EVQA 2CH4A 5CMDA 2YTXA 1PHJA 1EWHA 1IBKQ 1N33L 2EE1A 1DCZA 4MIUA 1NBWA 3PO2G 2QEJC 3D3RA 4NMZA 4KKTA 2PZWA 5JVH3 2VQEQ 3GTMH 3HFZB 4GKJQ 4RGTA 4Q5VA 2R7FA 3UDXA 5C5LA 1D6EC 3P7JA 2XRSD 4HCSA 2GVBA 4NXNL 2B39A 1XPUA 4LF6Q 2CWAA 1KD1C 4R4CA 2XN9C 3FVQA 1STGA 1WCMG 2LS01 4IURA 3H09A 2TMPA 2F0VA 5IP9G 1JJ2A 5FO8B 1WTOA 4F8MA 3URYA 4H44C 1C4QA 1ESFA 2BOSA 1GUOA 1IZ6A 1PH2A 2Z4HA 3BZCA 3T1HQ 3ND9A 1UE6A 4ME3A 1F2YA 5JVG3 4DR5L 2SNSA 1XTDA 4MTKA 1Q7YC 1SROA 1DGSA 3HOUG 1HRJA 4XIGS 2K03A 3OSOA 3HOZB 3B6YA 5JEAJ 3A54A 3NEMA 2P5ZX 1BUVT 1JORA 3K0XA 1B8AA 1XJVA 5DM63 5CV9A 1C7YA 3PF5A 1TVXA 3E3XA 4A3JG 2EYPA 2A73B 3CCVA 2VB3X 5LL6X 3F2CA 4GZYC 3FEWX 3KJOA 1EY8A 1PVOA 5CYUA 4RWSC 3HKZB 3MXPA 1BF4A 4BY1G 1I6HH 4A3KB 1L1OC 1WI5A 2F3VA 2G9HD 2OXPA 3E0EA 4J6HA 4C3IB 4YWKA 1PH7A 2QA4A 2KHJA 2M9VA 4EX5A 1CZWA 1K9MC 1Z7TA 5ELBA 1UEAB 4YWLA 1Q46A 3CC7A 1B2TA 3PMFA 2B2YC 1EQVA 4YCUA 1PRTD 3K0YA 1F9SA 4JG2A 3GTPH 1M4VA 1PRTC 2QDLA 3SR1A 4DA2A 2E5LL 1CKOA 3RLNA 1B1ZA 1IBLL 2K6AA 2L55A 2L9HA 2KEDA 4DV5Q 1XMQQ 4JI6L 2KENA 2F0PA 3SE0A 3R2IA 4KLKA 2JEAI 3J7ZC 1GVPA 1YI2A 1E1OA 3BDCA 5JPNC 1QG7A 2OT2A 3NBHB 2E2HB 3NXWA 2RSOA 3J7A5 1F2ZA 4R8IA 4N9PA 3MHBA 2UXBL 2JYOA 4G7OC 3BG3A 2GN5A 3K5OA 2PQEA 5M5XH 1HUNA 2JA5B 4RG1A 4UP8A 5JPMC 2JA7G 4DR7L 3ICEA 3TBIB 2RDHA 3CCLA 5A2QL 4LF8L 1BKBA 3AB9A 1JB3A 5F2DA 3I4NG 4DR4L 3S16H 4LJZC 1Q86C 1YNND 4DF7A 3D4WA 5IGGA 2RA4A 5ELCA 3QIAA 1KLGD 1TWCB 4A3BB 2X69A 1YNNC 2I5HA 2A68D 4C3JB 4XQJA 5HGTA 1TKWB 3E5SA 1CHQD 1TQOA 2R7ZB 2IX0A 3S1MB 1V1QA 2J0TD 3NQIA 4P75A 3WDNA 3T51B 4DV1L 1FGBD 1HNWQ 4JI7Q 1OXSC 3FKIG 3GTGH 2VY3A 2Y0SE 5JJKA 3CMEA 2HT1A 1K0SA 1YHBA 2UXDL 3S2DB 4G57A 4AH6A 2VQFL 3MFYA 4KK7A 3TP8A 4A3EH 4HN7A 3SGIA 4C3HG 4CDCC 4WORA 1ET9A 2MQHA 1G91A 3TMEA 4OEMB 1FGUA 3HOVG 3I4OA 4XT1B 2I5MX 1ASYA 4DKAC 1A0IA 5JEAG 1GUNA 4ZCKA 4DR2L 4K5WA 1TY0A 1Z9FA 1EQQA 5EQ0A 3V2TA 2RDFA 1A15A 1I4PA 4L5TA 5AJ3L 3GDEA 4QIWB 1F2MA 2SEBD 2IHEA 4DR1Q 4XYQA 1Q90A 1A3TA 3QR8A 2RHQB 3OIPA 4JBJA 1EYDA 5ELFA 1BXTA 2B29A 3VA7A 3RZDH 3D4RA 1GM5A 4JV5Q 3VYUA 1VQNA 1LTSD 4R4OA 2UU9L 1ENCA 1SYFA 1I3QH 3RZOB 4MN3A 3TSSA 3VR4A 1TWFB 1IXRA 2PMZB 3I4MB 5GAHC 4HIMA 1HNXQ 1HR0Q 3NSWA 1VQ4A 2EY5A 2X6GA 3W2DA 1SJED 1H9MA 1KTKA 4HAEA 2VL6A 1BCPB 5CV7A 1TR5A 3GQBA 3CQZB 5FK9C 4POFA 3KDFA 4M1UB 5M3FG 5ELNA 3S15H 2IJ0A 2CHBD 1YJNA 2JSOA 4ALPA 4XXEA 5M3MH 5LMNL 2R7DA 3OTOQ 2WV6D 1UAPA 2JJQA 4GKKL 2B2WC 3MXGA 5IYBH 4B3SL 3OMCA 2VUMG 3M7NA 4X66Q 3SEBA 3HS0C 3OOCA 4LF5L 5EPKA 5JOBA 4IJHA 3M85A 1NSNS 4LFBL 2CCZA 1PDQA 2XSCA 5HURA 5C3EG 1O80A 3J81c 2L15A 3J81i 1CI3M 5BN4A 1DONA 3K6OA 3J7AF 1EY0A 2PO4A 3DWAA 4BXXH 3C1EA 1SE3A 2RF4A 4CDFC 3TN2A 4BBSH 1S5CD 5KNCA 3VYSA 3M9BA 2FMCA 2Y0SG 5GQOA 2WINB 2HIVA 3F1ZA 3I8ZA 2DJGC 3GTQH 3KLSX 1H9SB 3TDQA 4A3GG 2RKSA 4RKBA 3S9WA 3NTHA 1OTCA 1STYA 2KECA 4DK3C 5FLMH 2OTJA 4X3UA 1ET6A 3BS1A 1G6PA 1VQ6A 1TS3A 2K5HA 3NPPA 3KYHC 5BN5A 4BY7B 3JAME 3PQIA 2NTTA 1EY7A 4A3LH 2PQAB 3I73A 1A6XA 4PMWA 2EIFA 1HH2P 4R4QA 4LFCL 1YNXA 1BBXC 2F4VL 2ZXPA 1Y1WH 5C5MA 4DNIA 5ELOA 3H0GH 2B2VA 1D7QA 3A7LA 5KNDA 2LSSA 2KBNA 1MHWC 4OHJA 1KLUD 1CTMA 4A3FB 3MTSA 3K8AA 4L5QA 3J80E 3IL8A 1LT5D 2WAQE 1Q1BA 2FXQA 2CH4W 4HJAA 1BDOA 1H9JA 4QL5A 1N32Q 2F0MA 2K33A 1MSGA 1X3FA 4YHHL 4KY7A 3SDZA 1P8LA 2YTYA 3VR6A 5IT9E 1PFNA 4AQYQ 4DV3Q 1EIGA 2EDGA 4ZLTF 1X32A 2I5LX 1X56A 5KYLA 4CKEA 5IYCG 3V96A 1SFOB 1B7YB 4FP5D 2NBFA 3HRZC 4MTNA 1BQQT 4Y52H 4X62L 5KIXA 1KIXA 2CQOA 1EY6A 4K8IA 1STEA 4XQNA 5J22A 3IRBA 3WOFA 1DD2A 3T13A 4C2MB 3NTKA 1RD9D 4NW2A 4A3KH 1EOTA 2V1CC 4ZQ3A 1KNAA 1HFNA 4KN4C 3N6RA 5EJWA 5D65A 4LUVA 2F0EA 2HQEA 1XNQL 1B70B 5FO7B 3PO3B 4KI0A 3CF5A 5DEHA 2QEXA 2YV5A 2OF1A 2K7VA 1HQRD 5IOCA 1WJJA 2JQOA 4BBRG 5C4XG 4B08A 4DAYA 2UXCL 3TS2A 3TRZA 3G48A 1SMXA 1II3A 5C44B 3KLRA 5D14A 3ULPA 1XMOL 1EUJA 2HUGA 4CGYB 4U68A 2A8VA 2K52A 2NVXH 4OIJA 3P1HA 2EYHA 3G4SA 3TZDA 3GTJH 4IUPA 4QB4A 4IUVA 3HG9A 5FLXL 1OXVA 3OHXC 5A35A 4R9WA 1CUKA 2F52A 5IWAL 1EOVA 1MIUA 4WFN3 4CDDC 4DK1A 1W6KA 1VS0A 3PO2B 1H9KA 1L1OB 2FJ2A 5TSSA 1XYIA 3Q8DA 4O0AA 4OX9L 4UP9A 1HCZA 3MAQA 3W1BA 1QUQA 2F3WA 3Q22A 5IIFA 3K5LA 4HIOA 1GO3E 1KAWA 2CFMA 3J7AV 3T1YQ 1K28A 1PRTB 3TP5A 1TWCH 2DGYA 2MP1A 1W2BA 1LTAD 1IL2A 4DV0L 1WCMB 3S17B 1UNSA 5GROA 1SEBD 1HZ9A 2SDFA 3UI2A 3LWEA 3DM1A 4ILWA 1U4PA 1CZGA 4OWWB 2WAQG 1K8OA 3NK9A 4CDEC 5M5YB 1L0YB 2EYLA 4HIDA 2EJGC 2E2IB 4IQZA 2ES2A 4YWMA 1N36Q 1NNXA 3J81L 2Z6KA 1CQVA 3HOUB 1STBA 2X6LA 3A8IE 1STHA
chains in the Genus database with same CATH topology
5LHY1 1SYDA 2QKIC 2L4NA 4JK1C 3S1QB 1F9RA 1LTGD 4A3JB 3WOEA 1RF2D 2L11A 4CJ0B 3MVVA 3GTLB 5IGCA 1AEXA 4IUNA 5I2YA 2QF7A 4BY1B 5IGFA 3E6ZX 1IW7D 5D3DA 2I07B 2XVSA 2A6ED 5KRUA 4TKOB 2K05A 2DNEA 3GTOB 2A6EC 3U9OA 2LMCB 1EY9A 3GD7A 5DNFA 1G291 3KBXA 3FDTA 2XRQD 1JOKA 5DAUA 1VCIA 4KTAA 5E4XA 3GO5A 2K1BA 5EGTA 1M8AA 3K58A 3S1RB 1RHPA 4CJ2C 3C1FA 2ZXOA 2KCNA 1HQMC 3GV6A 1HTLD 1XXGA 1QJOA 2JA7B 5C0XH 4KD3A 1EU3A 5CV5A 4U673 2N55A 3I4NB 3NWSA 2BE5D 3F2UA 1V1PB 3QJYA 4Y7NB 3BYTB 2BE5C 4FXGC 3C3LA 3DMUA 1WTWA 1AW7A 2NVQB 3FKIB 2VXWA 2XNAC 2KEEA 4HSPA 4FO2A 4C3HB 5CGKA 2EXZA 2ICIA 4RA8A 1X3QA 4MHEA 2QCPX 5CORA 2MJ8A 3HOVB 5C0XI 1MGSA 1EY5A 3ND8A 1BO0A 5M9OA 1DOKA 2B2VC 1HPCA 2IX1A 3M4OB 1PZID 2D62A 4EQNA 2HDMA 2PW7A 3DUZA 3CRLC 2O5JC 1GUWA 1QE6A 2NWGA 3K57A 2PPBC 1PTOH 2F0UA 3K7AB 2NUCA 3OWEB 3RUZA 2Z8LA 4IUTA 1DXMA 4CKCA 4IFDH 5C4ZA 1PFMA 1K8MA 3AU7A 1B3AA 5M3FB 1ZKOA 1SNCA 2Z1CA 1MI2A 3QOJA 3FMCA 3I4LA 3HOYB 4L6TB 2O4XA 1JOQA 2NVTB 1TT2A 4K2LA 4L63B 1IHZA 2KJXA 3SVMA 5T1GA 1VDZA 2L0CA 1SE2A 1IYUA 4OIKA 5C3EB 5CV6A 2QILA 1B44D 1OXUA 2DY7A 4CHTB 1JE4A 1X3PA 3AMUA 3W3AA 4NDXA 4XQQA 4X3TA 4DFAA 3MA2B 2R3ZA 4DAPA 1NR2A 4IFDI 3DXJC 2IX3A 2F1MA 1V8QA 1A2UA 3P20A 1BOSA 3T16A 3RLFA 4ID6A 3SK4A 2Y0SB 3ITPA 1E2VA 1TWGB 4A3GB 2F0JA 3S1NB 4TQUS 2R61A 1DOLA 1UUPA 4BA2I 1V43A 4XTCS 1Q8IA 1XX8A 3T53B 3P75A 1NCVA 4DN4M 4ZAIA 1LTID 1PZJD 3GTKB 1FNUA 2B2TA 5EPLA 2B2UA 1EU4A 1U4RA 5I6YA 1T5EA 4K14A 1TS2A 1JC7A 3H91A 2A74C 3C46A 4RAUC 5A2QE 4RGOS 1Y8NB 4XYOA 1WTPA 2IW3A 1SNDA 2F0TA 1S5DD 4UDUC 3RD4A 2E2JB 1EEFD 2H1EA 3X3NA 3VA5A 3Q23A 3PV0A 4E6IA 4CJ1B 2EYFA 2WACA 4FF1A 4YIJA 4V190 4ME5A 5ISRA 4H7BA 1AZPA 2RDGA 2CVRA 4HMIA 4ZRZA 2PZUA 3BDLA 1F9PA 4IZ8A 1R9TB 4BBRB 5C4XB 1Y8PB 4F7XA 2K5WA 1GOZA 2AQ3B 3KBGA 2CQAA 3CHBD 3VR5A 1KABA 1TY2A 1TWHB 1A3VA 2BDNA 4O42A 1EL0A 2EY1A 4OGQC 5CBEE 2L12A 1SXTA 1IYVA 3M4YA 1SNQA 1Q1EA 3U9SA 2R92B 3RMHA 5KGUA 3QWNA 4KY5A 3J7YW 2NN6G 3VYTA 2C9OA 4M8AA 4AYBB 1F9QA 5C0XJ 4ZUIA 1DZ1A 3EA6A 4LMQD 1PMRA 2L1BA 4FF4A 3GTMB 1NR4A 1Y8OB 2B8GA 1HXYD 4ABNA 2TSSA 1D5ZC 3EFXD 3A8KE 3MEHA 4I65A 5FOBB 1CA5A 2HDLA 1MD2D 5IGDA 1A3UA 2GA4B 1AN8A 3SK6A 3D4DA 1SBBB 2KHSA 3I3CA 3GP7A 1ZXTA 2WP8J 3SXHA 1AP0A 1FNWA 3NUCA 1D1IA 1TS4A 1GUSA 3LNNA 3Q0AA 4KMUC 4FF3A 3NE5B 1GUGA 3OPOA 1I4RA 1D2BA 1VF5C 1FD7D 2SNMA 3BYYB 2WKDA 2VNUD 5C6AA 1E2ZA 1RCVD 4P2CB 4PV1C 2YYZA 4QCLA 2K5QA 3A8JE 2JP1A 4BA1I 4DNTB 1I6HB 1K83B 1IL8A 2N88A 1CFMA 2B2YA 1A2TA 3EQLC 3X3MA 4IFDJ 2EPBA 4Q0FA 3GTPB 1SNMA 4H13C 3T56B 3T4AC 1STNA 4PMBA 1NUCA 5KYIA 4QUCA 1XWEA 1Y1VB 2QDBA 5CBAE 4HTHA 1S4ZA 3IFTA 1IKLA 4RCNA 4ZYSA 4KN7C 2MPMA 1J8IA 5BN3A 2JXMB 1HFGA 4BS9A 1WVLA 5M5XB 2ENBA 5LL6S 3VR3A 3S2HB 1L0XB 2D2CC 5C0XG 4RGMA 1HTPA 3ZYYX 1D1KA 2EJFC 3S16B 4FXKC 5C3XA 4RGNA 2Q8TA 3DEPA 3ERQA 5E4WC 4PQXA 3I91A 3PUXA 4EQPA 1KAAA 3HOWB 3SK8A 4G7ZC 4H0LC 1ENAA 5EBCA 4HSVA 1FYCA 2IPKD 2Z4IA 1BNZA 2XWBB 1EZ6A 2R93B 3I72A 3C2PA 2VB2X 2SOBA 4OO1H 2B2UC 3OW7A 5J39A 5EKLA 4KKUA 3QG1A 1FR3A 1E0BA 2KCCA 2MHVA 3BVGA 4F87A 1CT1D 1QCBD 2F0QA 2IL8A 5AFWA 4X3KA 2LY7A 2A69D 3R3OA 3NWTA 5CC4A 3KLSA 4K6DA 1B53A 1KDBA 1G2TA 2A69C 2ZXRA 5EPJA 2K32A 3VYRA 2E2DC 1EZ8A 3GV3A 4C1NI 4JBWA 2LFNA 1SYCA 4IFDG 5I6WA 4WRDA 1LT6D 1I4XA 2F0KA 3KF8A 3TP6A 1W6JA 3OWFA 1SE4A 2L5TA 4C56C 2KQ3A 3L3OC 4DAVA 1WTQA 2F0FA 1S5BD 2WIIB 5M3MB 4CKBA 4OO1I 2B2WA 4Z9CB 3CKIB 2I46A 4DU9A 4QMGA 3J81E 2KUMA 1EIHA 3MWYW 1PLFA 5NUCA 4DXGA 3H3VC 1F77A 1ZYRD 1IKMA 1ZYRC 5IGBA 1PFBA 3R93A 3HP3A 2B8FA 1HHVA 3QO2A 4FXDA 4BBSB 2PCFB 2K28A 5JJZA 3M7GA 3K5MA 1PTOC 4HR7B 3S14B 3GTQB 4R8NA 1BR9A 4RKLA 3R8BA 3MZ5A 1JR0D 1DJRD 2EYJA 2G9DA 4HMJA 4RH6A 1JOOA 4IUQA 2RBMA 2ZT9C 2F4IA 1SYGA 1SJHD 3E0JA 1G2SA 2NVYB 2LKVA 1ESRA 2V4DA 5E3FA 4OL7A 1I4GA 2D5DA 5J1ZA 2A6HD 4EGVA 1Y1WB 2F0NA 2EJMA 3PUZA 3H0GB 5ELDA 2PW5A 2A6HC 1EYAA 2PZTA 1WD1A 3NBHA 2F0DA 1HA5A 3FRPB 5G3LF 3BDOA 4LK1C 3NQTA 1S5FD 2M00A 2WKCA 1ILPA 2F0IA 3CU7A 4DK0A 1JWSD 5K36H 2FHTA 2KA7A 1SSOA 3QB3A 2NTSA 2EVBA 1U4MA 3VR2A 5IODA 2NZ1D 2BCOA 4DGZA 1Z6HA 4A93B 4KD4A 3IKJA 2C5CA 3DHQA 5C4JB 4DNRB 2MUYA 2AUKA 4TSSA 3I70A 4V0BA 1QWYA 3TZUA 2D9UA 1CHPD 3EJIA 2VUMB 2MGSA 4K6LA 2H4OA 1JICA 1RODA 3G6JB 4KKSA 1RDPD 3HGBA 3SK5A 2F0WA 1CA6A 2NVXB 3GTJB 1NAPA 2BA1A 3PUWA 2A5HA 3ONAB 1GUTA 2F0OA 1C48A 2RQXA 1J9OA 2FMMA 2K01A 1I4HA 2HCCA 4FF2A 1D5XC 1WTVA 3PUVA 4ZUJA 5KNBA 1PZKD 1R4PB 1D5MC 2AWNA 1ILQA 1CM9A 4NKLA 3PIO3 3NTIA 4EQOA 1EWCA 1TU2B 4RHSA 2A68C 1YNJD 5T1IA 5FO9B 1PYWD 3DWQA 3IAYA 3OIQA 1QILA 1YNJC 2EY2A 2XWJB 5D3IB 3OMGA 5G3LD 3LX0A 3QOLA 4RHRA 2DNCA 4QUFA 5CR3A 3TP7A 3M3YB 3NBIA 4WJWA 2AWOA 5E1FA 3L7ZC 1E2WA 2F0HA 2O2LD 2AUJD 3D31A 1RKNA 1RTNA 1I4QA 1H9SA 2RSNA 2NB0A 1VF7A 2HCIA 1KDCA 1LTRD 3NHHA 4C3IG 2JA8B 1C8CA 2AQ2B 1WD0A 4XT3B 1I6VC 1LABA 1Z47A 1S5ED 3A56A 2DY8A 1QNUA 1MBYA 3PIP3 4IN3A 4O1NA 4KHZA 2YU9B 2BA0A 3JAML 4A3DB 3LWUA 3D8GA 4S3SA 1WTXA 2JEBI 1Q3LA 5M5WB 4A3IB 1DYQA 4I7ZC 3H94A 4KJNA 4ODGA 4IALA 2E76C 1ENFA 2ID0A 3J80L 1U4LA 3K5NA 2FINB 4HEDA 1WTRA 5IT9L 3HOXB 3EROA 2B63B 1EYCA 2EY6A 1DOMA 3BZDB 2DN8A 4K5XA 2CW0D 4C3JG 1FNVA 1SMYD 2WAQB 1RTOA 1BCPF 3KK7A 2Q8IB 2CW0C 1CK1A 1SMYC 4J8QA 1SNPA 1VMPA 1HA6A 5I4DA 3I90A 4A3MB 1O7LA 3DWPA 1CQFA 4QF4A 4K5VA 1G6ZA 4TRDA 1I50B 2M2LA 3HEJA 3L9AX 5JEAH 3IFDA 1Y69U 4OO1G 1EFID 4J1MA 1LV9A 1LTTD 5CV4A 1GHKA 5FKAC 1GXDC 4FYDA 1B9NA 4DXFA 1O78A 4EVOA 2NYZD 1H9RA 5DM73 3K59A 1QOHA 2ICEC 1PTOB 1T5XD 3A7AB 1OXXK 4KHVA 1AFPA 3H6MA 1DM0B 2FFKB 5EKKA 1STAA 4G4KA 1ICWA 4KV6A 3BVZA 1R4QB 1JQYD 5EKIA 2PNRC 4RFBA 5I9PA 4PNYA 5C4HA 1V1OA 5K5PA 4CBVA 4X3SA 1LLRD 1SYEA 2XIWA 3BVMA 1JWMD 4F88A 2JA6B 1EQTA 3MC0B 4N9TA 5JAVA 4L8JA 4ZKBB 2WB1B 3N52A 3Q24A 1XTCD 4ZK9B 3DEOA 2BDOA 2PYKA 2R6GA 2EZVA 3SHLA 2J7ZA 4LAAA 1B4OA 1PTOF 2KOLA 2F03A 4K8JA 4XDXA 3FPUB 1KDAA 2NN6H 1GJXA 1LT3D 1OXTA 5ELEA 2F0GA 1SNOA 2F0SA 2KVMA 2AQ1B 3V05A 2JE6I 1AZQA 1OO9B 5EBDA 5I2XA 2J4XA 4ZKCB 3GTGB 1GHJA 2EYMA 1BCPD 3CRKC 4KJOA 1EEID 2E75C 3D6WA 4A3EB 1BCPC 1TIID 2Q8RE 1SYBA 5C3WA 3G7LA 4PMCA 2O5IC 1ONLA 3Q6SA 4FVMA 2F0LA 1JWUD 4C1NK 5IGEA 1LTBD 3NP8A 1TS5A 1QNKA 5FLXE 2B2TC 4HCEA 3HZXA 2NN6I 2IWHA 1ML0D 5K36G 1F2LA 1U9RA 5I9OA 3FPPA 3RZDB 1O7YA 1SDFA 1PXUA 1LACA 4RCOA 1O7ZA 3KUPA 2K04A 1V1PA 2OEOA 1I3QB 1B50A 2RVLA 3O13A 1KNEA 2EYOA 4G7HC 3A55A 2K5DA 3MXNA 1MSHA 3D6CA 1LT4D 3R2TA 1IW7C 1QB5D 1ZEQX 3S15B 1SAPA 1PRTF 4B9XA 1TWAB 2IT1A 5KEEA 4FNFA 4KY6A 1B9MA 5COYA 1VMCA 1HUMA 4B9WA 4IUUA 3PUYA 2EOTA 4NP5A 4ULLA 1RJTA 1JCKB 3MXUA 1Q12A 1G8ZD 4K2KA 3MFGA 5CV8A 1PTOD 4UAIA 1EY4A 1LO5D 4BWGB 2E74C 3EVQA 5CMDA 1EWHA 2EE1A 1DCZA 4MIUA 2QEJC 3D3RA 4NMZA 4KKTA 2PZWA 5JVH3 4RGTA 4Q5VA 5C5LA 1D6EC 3P7JA 2XRSD 4HCSA 2B39A 2XN9C 3FVQA 1STGA 2LS01 4IURA 3H09A 2TMPA 2F0VA 5FO8B 1WTOA 4F8MA 3URYA 4H44C 1C4QA 1ESFA 2BOSA 1GUOA 2Z4HA 3ND9A 1F2YA 5JVG3 2SNSA 1HRJA 4XIGS 2K03A 3OSOA 3HOZB 5JEAJ 3A54A 1BUVT 1JORA 5DM63 5CV9A 1TVXA 2EYPA 2A73B 2VB3X 5LL6X 4GZYC 3FEWX 1EY8A 5CYUA 4RWSC 3HKZB 3MXPA 1BF4A 4A3KB 2G9HD 2F3VA 2OXPA 4J6HA 4C3IB 2M9VA 1CZWA 1Z7TA 5ELBA 1UEAB 1B2TA 3PMFA 2B2YC 1EQVA 1PRTD 3K0YA 1F9SA 1M4VA 1PRTC 3SR1A 4DA2A 1B1ZA 2K6AA 2L55A 2L9HA 2KEDA 2F0PA 3SE0A 3R2IA 2JEAI 3BDCA 5JPNC 1QG7A 2OT2A 2E2HB 3NXWA 2RSOA 1F2ZA 4R8IA 4N9PA 3MHBA 2JYOA 4G7OC 3BG3A 3K5OA 2PQEA 1HUNA 2JA5B 5JPMC 3TBIB 2RDHA 5A2QL 3AB9A 1JB3A 5F2DA 4LJZC 1YNND 4DF7A 3D4WA 5IGGA 2RA4A 5ELCA 3QIAA 1KLGD 1TWCB 4A3BB 2X69A 1YNNC 2A68D 4C3JB 4XQJA 5HGTA 1TKWB 3E5SA 1CHQD 1TQOA 2R7ZB 2IX0A 3S1MB 2J0TD 3NQIA 3WDNA 3T51B 1FGBD 1OXSC 3S2DB 4G57A 3MFYA 4KK7A 3TP8A 4HN7A 4C3HG 4WORA 1ET9A 1G91A 3TMEA 4XT1B 5JEAG 1GUNA 4K5WA 1TY0A 5EQ0A 3V2TA 2RDFA 1A15A 1I4PA 4QIWB 1F2MA 2SEBD 4XYQA 1Q90A 1A3TA 3OIPA 1EYDA 5ELFA 1BXTA 3VA7A 3D4RA 3VYUA 1LTSD 1ENCA 1SYFA 3RZOB 4MN3A 3TSSA 3VR4A 1TWFB 2PMZB 3I4MB 3NSWA 2EY5A 2X6GA 3W2DA 1SJED 1H9MA 1KTKA 4HAEA 1BCPB 5CV7A 1TR5A 3GQBA 3CQZB 5FK9C 4M1UB 2IJ0A 2CHBD 2JSOA 4XXEA 2WV6D 1UAPA 2B2WC 3MXGA 3OMCA 3M7NA 3SEBA 3HS0C 3OOCA 5EPKA 5JOBA 3M85A 1NSNS 1PDQA 2XSCA 5HURA 1O80A 1CI3M 5BN4A 1DONA 3K6OA 3J7AF 1EY0A 2PO4A 3DWAA 3C1EA 1SE3A 3TN2A 1S5CD 5KNCA 3VYSA 2FMCA 2WINB 3I8ZA 3KLSX 1H9SB 3TDQA 2RKSA 4RKBA 3S9WA 3NTHA 1STYA 2KECA 4X3UA 1ET6A 3BS1A 1TS3A 3NPPA 5BN5A 4BY7B 3JAME 2NTTA 1EY7A 1A6XA 3I73A 4PMWA 1BBXC 2ZXPA 5C5MA 2B2VA 3A7LA 5KNDA 4OHJA 1KLUD 1CTMA 4A3FB 3MTSA 3J80E 3IL8A 1LT5D 1Q1BA 1BDOA 1H9JA 2F0MA 2K33A 1MSGA 4KY7A 3SDZA 3VR6A 5IT9E 1PFNA 1EIGA 2EDGA 4ZLTF 1X32A 5KYLA 4CKEA 3V96A 1SFOB 4FP5D 2NBFA 3HRZC 1BQQT 5KIXA 1EY6A 4K8IA 1STEA 4XQNA 5J22A 1DD2A 3WOFA 3T13A 4C2MB 3NTKA 1RD9D 4NW2A 1EOTA 4ZQ3A 1KNAA 1HFNA 4KN4C 3N6RA 5EJWA 5D65A 2F0EA 2HQEA 5FO7B 3PO3B 4KI0A 5DEHA 2OF1A 2K7VA 1HQRD 5IOCA 4B08A 4DAYA 1II3A 5C44B 3KLRA 5D14A 2HUGA 4CGYB 4U68A 4OIJA 3P1HA 2EYHA 3TZDA 4IUPA 4QB4A 4IUVA 3HG9A 5FLXL 5A35A 1OXVA 3OHXC 4R9WA 4WFN3 4DK1A 1W6KA 3PO2B 1H9KA 2FJ2A 5TSSA 1XYIA 1HCZA 3MAQA 2F3WA 3Q22A 5IIFA 3K5LA 3J7AV 1PRTB 3TP5A 2MP1A 1LTAD 1WCMB 3S17B 1UNSA 1SEBD 2SDFA 3UI2A 3LWEA 3DM1A 4ILWA 1U4PA 1CZGA 1K8OA 3NK9A 5M5YB 1L0YB 2EYLA 2EJGC 2E2IB 4IQZA 3J81L 1CQVA 3HOUB 1STBA 2X6LA 3A8IE 1STHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMU A;  5CV6 A;  1SYD A;  5CR3 A;  4ME5 A;  4EQP A;  1KAA A;  3OSO A;  5IGB A;  2PYK A;  4H7B A;  4ZQ3 A;  3TP7 A;  5HUR A;  5ISR A;  3SHL A;  2SNM A;  4B9X A;  2F0E A;  2HQE A;  3SK8 A;  4NDX A;  1JOR A;  4HMI A;  4LAA A;  5DEH A;  4DFA A;  5C6A A;  2PZU A;  3BDL A;  5CV9 A;  3EJI A;  2F0H A;  5E1F A;  1SNP A;  1ENA A;  1EY0 A;  3MVV A;  5KEE A;  4K8J A;  4IZ8 A;  4KY6 A;  2OF1 A;  4G57 A;  1AEX A;  5IGC A;  1A2U A;  3C1E A;  2EYP A;  3T16 A;  5IOC A;  4IUN A;  4F7X A;  5CGK A;  2EXZ A;  1KDA A;  1EY8 A;  1RKN A;  4QF4 A;  4K5V A;  3SK4 A;  4ID6 A;  3TP8 A;  5IGF A;  4TRD A;  4B9W A;  3ITP A;  3MXP A;  4WOR A;  2F0G A;  1SNO A;  1KAB A;  5KRU A;  2F0S A;  2F3V A;  1A3V A;  3TME A;  1EZ6 A;  2OXP A;  4J6H A;  4R8N A;  4RKL A;  2F0J A;  4NP5 A;  3SK5 A;  1II3 A;  3MZ5 A;  1EY5 A;  1KDC A;  3HEJ A;  2F0W A;  1A2T A;  2EYJ A;  2EY1 A;  2RKS A;  4HMJ A;  3NHH A;  1JOO A;  4RKB A;  5M9O A;  2SOB A;  3S9W A;  2RBM A;  1SYG A;  1STY A;  3PMF A;  5J39 A;  4K5W A;  5EKL A;  1SNQ A;  3U9O A;  1EQV A;  2EYM A;  2EYH A;  1EY9 A;  3P1H A;  4J1M A;  5CV4 A;  3V2T A;  2RDF A;  4KJO A;  1SNM A;  4QB4 A;  2F0O A;  2LKV A;  1F2M A;  4EQN A;  4K2K A;  2PW7 A;  1NSN S;  5CV8 A;  5E3F A;  1EY7 A;  5KGU A;  2F0Q A;  1EY4 A;  1A3T A;  4KY5 A;  4OL7 A;  3SR1 A;  5J1Z A;  1STN A;  3P75 A;  4PMB A;  4EVO A;  1SYB A;  1NUC A;  3EVQ A;  5C3W A;  4PMC A;  5KYI A;  1EYD A;  2F0N A;  3R3O A;  2QDB A;  3D8G A;  5CC4 A;  1JOK A;  4ZUI A;  4K6D A;  4S3S A;  5DAU A;  5C5M A;  4KHV A;  4KTA A;  2F0L A;  2PW5 A;  4HTH A;  2F0P A;  1KDB A;  1EYA A;  2F0U A;  3H6M A;  2PZT A;  1ENC A;  4MIU A;  4YIJ A;  5EGT A;  1SYF A;  4ZUJ A;  5IGE A;  2F0D A;  3NP8 A;  5I6Y A;  4NMZ A;  2NUC A;  2PZW A;  5EKK A;  3RUZ A;  3BDC A;  4K14 A;  1STA A;  2F3W A;  3HZX A;  1EZ8 A;  3NQT A;  2M00 A;  5IIF A;  4KV6 A;  1SYC A;  4NKL A;  2F0I A;  3NXW A;  3C1F A;  5C5L A;  1F2Z A;  4KJN A;  4ODG A;  2EY5 A;  4EQO A;  5C4Z A;  4IAL A;  4N9P A;  5I6W A;  3MEH A;  4WRD A;  3QB3 A;  5I9P A;  3MHB A;  4I65 A;  2F0K A;  1U9R A;  5CV7 A;  1TR5 A;  4PNY A;  3TP6 A;  3TP5 A;  5C4H A;  3OWF A;  2ENB A;  5I9O A;  5IGD A;  1SNC A;  2F0M A;  2PQE A;  2KQ3 A;  1A3U A;  4KY7 A;  5K5P A;  2F0F A;  3QOJ A;  5IOD A;  1SYE A;  1STG A;  4KD3 A;  2OEO A;  5CV5 A;  1SND A;  2F0V A;  2O4X A;  2F0T A;  1JOQ A;  4DGZ A;  3NK9 A;  3SK6 A;  5KYL A;  1TT2 A;  2EYL A;  4DU9 A;  3D4D A;  4QMG A;  2EY2 A;  4K2L A;  4KD4 A;  5F2D A;  1IHZ A;  2EYO A;  4F8M A;  3ERO A;  4N9T A;  3OMG A;  5NUC A;  5C3X A;  2KHS A;  3DHQ A;  1EYC A;  4DF7 A;  3D4W A;  2EY6 A;  5KIX A;  3OMC A;  3VA5 A;  5JAV A;  5IGG A;  3LX0 A;  3ERQ A;  1EY6 A;  4K8I A;  3SXH A;  1F2Y A;  5J22 A;  4E6I A;  1STB A;  3NUC A;  2SNS A;  3QOL A;  2EYF A;  3T13 A;  2WAC A;  5HGT A;  1STH A;  5JOB A;  4K5X A;  3E5S A;  3D6C A;  1TQO A; 
#chains in the Genus database with same CATH topology
 5LHY 1;  1SYD A;  2QKI C;  1C9O A;  5GAE C;  2L4N A;  4JI5 Q;  4JK1 C;  2Q2T A;  4IOA A;  3S1Q B;  4DR5 Q;  1F9R A;  1LTG D;  2YTV A;  4A3J B;  3WOE A;  1RF2 D;  2L11 A;  2Z0S A;  4CJ0 B;  5IP7 G;  1ASZ A;  2K14 A;  3I2Z A;  3MVV A;  4LFA L;  3GTL B;  5IGC A;  1AEX A;  4IUN A;  2ZM6 L;  5I2Y A;  2QF7 A;  4BY1 B;  5IGF A;  3E6Z X;  3EIV A;  2C35 B;  1IW7 D;  5D3D A;  3TEH B;  1KL9 A;  2A19 A;  4JI4 L;  2I07 B;  2XVS A;  2A6E D;  5KRU A;  4TKO B;  2K05 A;  1N34 L;  2DNE A;  3GTO B;  2QW7 A;  4A4I A;  2KCT A;  3K80 C;  1Q82 C;  2A6E C;  3A5Z B;  4DUY L;  1S3O A;  3RZO H;  3U9O A;  2LMC B;  2MO1 A;  4JYA L;  1EY9 A;  1TWF H;  3KF6 A;  2UUB L;  3GD7 A;  5DNF A;  3CCE A;  1G29 1;  3KBX A;  4JI3 L;  2K5V A;  3FDT A;  4R1J A;  1WOC A;  2XRQ D;  4JI8 Q;  4LF9 L;  1VQC A;  3A5U A;  2YU9 H;  3CQZ H;  1JOK A;  5DAU A;  1VCI A;  1PH5 A;  4A3D H;  4KTA A;  1E1T A;  5E4X A;  3GO5 A;  2K1B A;  5EGT A;  4DV7 Q;  3RN5 A;  1M8A A;  5M5W H;  4A3I H;  3F8T A;  3K58 A;  3S1R B;  1IBL Q;  3PIO A;  1RHP A;  4CJ2 C;  3C1F A;  4JI6 Q;  2ZXO A;  4DV4 L;  2KCN A;  1HQM C;  2RCN A;  3GV6 A;  1HTL D;  1XXG A;  1QJO A;  1FL0 A;  2JA7 B;  4GNX A;  5C0X H;  1L2F A;  4KD3 A;  1EU3 A;  4YY3 L;  5CV5 A;  4U67 3;  1FVI A;  2N55 A;  4UP7 A;  3I4N B;  3NWS A;  2BE5 D;  1XNR Q;  3F2U A;  1V1P B;  3QJY A;  4Y7N B;  3NEN A;  3HOX H;  1P16 A;  3BYT B;  2BE5 C;  2B63 H;  4X65 Q;  4FXG C;  2E8G A;  4R4T A;  3STB C;  1PH3 A;  3C3L A;  3DMU A;  1WTW A;  1SRU A;  3MXN B;  1AW7 A;  2NVQ B;  3TQY A;  3KF8 B;  3L0O A;  2K4K A;  3FKI B;  2VXW A;  4KHP Q;  2XNA C;  3HOW G;  2KEE A;  4LUO A;  4HSP A;  1K0R A;  4FO2 A;  4C3H B;  3CC4 A;  2OQ0 A;  5CGK A;  2EXZ A;  2ICI A;  4RA8 A;  1X3Q A;  4MHE A;  2QCP X;  5COR A;  2MJ8 A;  1K73 C;  4A3E G;  4A3M H;  3H3V H;  5BR8 Q;  2ZJR A;  3HOV B;  1I50 H;  5C0X I;  2ASB A;  1MGS A;  4GOP A;  1EY5 A;  3ND8 A;  1VQ5 A;  1BO0 A;  5M9O A;  2R93 G;  2UUA Q;  1DOK A;  2B2V C;  4MZ9 A;  4A3F H;  1HPC A;  2IX1 A;  3PIP A;  3M4O B;  1PZI D;  2D62 A;  2HDM A;  4EQN A;  2PW7 A;  4A3C H;  3DUZ A;  3CRL C;  2O5J C;  1MKH A;  1GUW A;  1QE6 A;  2NWG A;  4DR2 Q;  3K57 A;  2PPB C;  1PYB A;  1VQA A;  4AIM A;  1PTO H;  4QJF A;  3KLW A;  2F0U A;  3K7A B;  4WJ3 M;  1FJG L;  2NUC A;  3OWE B;  3RUZ A;  2MNA A;  2Z8L A;  3H15 A;  1SFO H;  4IUT A;  1DXM A;  4CKC A;  4IFD H;  5C4Z A;  1YHQ A;  1HR0 W;  4B3R L;  3H3V I;  1PFM A;  3AU7 A;  1K8M A;  1B3A A;  5M3F B;  1ZKO A;  1SNC A;  2KCM A;  4C2M H;  4A75 A;  2Z1C A;  1VQO A;  4B3M L;  1MI2 A;  4JW0 A;  3QOJ A;  3FMC A;  3I4L A;  3HOY B;  1VQH A;  4L6T B;  2O4X A;  1JOQ A;  2NVT B;  1TT2 A;  5M3M G;  3PO3 H;  4K2L A;  2JA6 H;  4L63 B;  1IHZ A;  2KJX A;  3SVM A;  1QVF A;  5T1G A;  5IYB G;  1VDZ A;  2L0C A;  1SE2 A;  1IBM L;  1IYU A;  4OIK A;  5C3E B;  4GKK Q;  5CV6 A;  2QIL A;  1B44 D;  3EBE A;  1OXU A;  2DY7 A;  4CHT B;  1JE4 A;  1X3P A;  3AMU A;  3W3A A;  4NDX A;  4LF5 Q;  4XQQ A;  4X3T A;  3A74 A;  4DFA A;  3MA2 B;  2R3Z A;  4DAP A;  1NR2 A;  4LFB Q;  4IFD I;  3DXJ C;  2IX3 A;  1IBK L;  3K7U C;  2F1M A;  1V8Q A;  1A2U A;  3P20 A;  1BOS A;  3T16 A;  1EWI A;  3CCR A;  3RLF A;  4ID6 A;  3SK4 A;  4BBS G;  2VQE L;  2Y0S B;  4IPD A;  3ITP A;  1E2V A;  4GKJ L;  1TWG B;  4A3G B;  1T9H A;  2F0J A;  3PO2 H;  3S1N B;  4TQU S;  1EIF A;  2R61 A;  1DOL A;  2ZTD A;  1HNZ Q;  1UUP A;  4LF6 L;  1J5E L;  4BA2 I;  5FLM G;  1V43 A;  4XTC S;  1SE8 A;  1Q8I A;  2WFW A;  1K3B C;  1XX8 A;  4OON A;  3T53 B;  4A3L G;  2N3S A;  3P75 A;  1NCV A;  4DN4 M;  4ZAI A;  1LTI D;  3A0J A;  1PZJ D;  1X54 A;  3GTK B;  3S17 H;  4OXP A;  1FNU A;  3T1H L;  2B2T A;  5EPL A;  1Y1W G;  2B2U A;  1EU4 A;  1U4R A;  1UE1 A;  3H0G G;  1X65 A;  1Y14 B;  1SLJ A;  4DV6 L;  5I6Y A;  1T5E A;  4IPH A;  4K14 A;  3UE0 A;  4LFC Q;  3PF4 A;  1TS2 A;  1JC7 A;  2F4V Q;  3H91 A;  2E2I H;  4B3T L;  1NTG A;  2OCE A;  2BH2 A;  3HOU H;  2A74 C;  3C46 A;  2RCF A;  4RAU C;  5A2Q E;  4RGO S;  1Y8N B;  4XYO A;  5L37 A;  1WTP A;  2K75 A;  5JJL A;  2IW3 A;  2EQS A;  1SND A;  5FLX c;  2F0T A;  1S5D D;  4UDU C;  3RD4 A;  3F2D A;  2XTI A;  2E2J B;  4YHH Q;  3BZK A;  1EEF D;  3GTL H;  4K0K Q;  4A93 G;  2H1E A;  3X3N A;  3VA5 A;  1M1K C;  3Q23 A;  1GD7 A;  3PV0 A;  4JOI A;  4E6I A;  4CJ1 B;  2EYF A;  2WAC A;  4FF1 A;  1GKH A;  4YIJ A;  4V19 0;  2AHO B;  4ME5 A;  5ISR A;  4X62 Q;  4H7B A;  1AZP A;  2RDG A;  2CVR A;  1TWA H;  3CXC A;  4HMI A;  1I94 L;  4ZRZ A;  2PZU A;  3BDL A;  1F9P A;  4DV5 L;  4IZ8 A;  1XMQ L;  1C0A A;  1R9T B;  4BBR B;  5C4X B;  1Y8P B;  1JT8 A;  4F7X A;  1H95 A;  2K5W A;  3I55 A;  1GOZ A;  2AQ3 B;  3KBG A;  2CQA A;  1XNQ Q;  4DR6 Q;  3CHB D;  3VR5 A;  1KAB A;  1TY2 A;  1TWH B;  1A3V A;  2BDN A;  4O42 A;  1EL0 A;  1U5K A;  2EY1 A;  1KXL A;  4OGQ C;  5CBE E;  2Q2U A;  4JI0 Q;  2L12 A;  1A62 A;  1E3P A;  1SXT A;  1KC8 C;  1IYV A;  3M4Y A;  1SNQ A;  3CPF A;  2AMC B;  1JE5 A;  1Q1E A;  3U9S A;  2R92 B;  3EN2 A;  3RMH A;  5KGU A;  3QWN A;  4KY5 A;  3J7Y W;  2NN6 G;  3VYT A;  2C9O A;  2IY5 B;  4M8A A;  4AYB B;  1F9Q A;  1A63 A;  5C0X J;  1AE2 A;  4ZUI A;  1DZ1 A;  3EA6 A;  4LMQ D;  4GNX C;  1PMR A;  2L1B A;  4FF4 A;  1ICF B;  3GTM B;  4PZ6 A;  1NR4 A;  1Y8O B;  1XPR A;  2B8G A;  4Y7N H;  1HXY D;  4NPS A;  4ABN A;  2TSS A;  1D5Z C;  3EFX D;  1K8G A;  4JI1 Q;  3CC2 A;  3A8K E;  3MEH A;  4OX9 Q;  5JJI A;  4I65 A;  1HNW L;  5FOB B;  4JI7 L;  3BU2 A;  1CA5 A;  2HDL A;  3OYY A;  1MD2 D;  5IGD A;  4H02 A;  3CP0 A;  1A3U A;  1RIP A;  4GN3 B;  3ER0 A;  3CMA A;  3CCU A;  2GA4 B;  2LXJ A;  3KDF B;  3FKI H;  1AN8 A;  4R4I A;  3SK6 A;  3D4D A;  1SBB B;  1YHA A;  2KHS A;  3I3C A;  3GP7 A;  1PH1 A;  1LTL A;  1ZXT A;  1CKM A;  1V9P A;  2WP8 J;  3SXH A;  1AP0 A;  1FNW A;  1N8R C;  4GLV B;  3NUC A;  1D1I A;  1TS4 A;  1GUS A;  3LNN A;  3Q0A A;  4KMU C;  4FF3 A;  4JI2 Q;  1EYG A;  3NE5 B;  1GUG A;  3OPO A;  1I4R A;  4NXM L;  1D2B A;  1VF5 C;  5H1S E;  1FD7 D;  2SNM A;  3BYY B;  3CCJ A;  3HOZ H;  2WKD A;  4GOP C;  2VNU D;  5C6A A;  4JV5 L;  1QZG A;  1J6Q A;  1E2Z A;  1VQB A;  1RCV D;  4P2C B;  2HHH L;  1D8L A;  4PV1 C;  2YYZ A;  4QCL A;  2K5Q A;  3A8J E;  2JP1 A;  4BA1 I;  4DNT B;  2UUC Q;  1I6H B;  4P74 A;  4MNO A;  1K83 B;  3U4V A;  1S72 A;  1HNX L;  4LW1 A;  4WJ4 A;  1IL8 A;  4PZ8 A;  2N88 A;  1CFM A;  1WYD A;  1A2T A;  2B2Y A;  4C3I H;  2N49 A;  3EQL C;  3X3M A;  4IFD J;  2EPB A;  4Q0F A;  3GTP B;  4JBK A;  1SNM A;  2JA8 G;  3AFP A;  4H13 C;  3T56 B;  3T4A C;  3OTO L;  1STN A;  4PMB A;  1NUC A;  1VQL A;  5KYI A;  4QUC A;  1I5F A;  4JYA Q;  1XWE A;  1Y1V B;  2QDB A;  5CBA E;  2UUB Q;  5HY6 A;  3F2B A;  3HKS A;  4JI3 Q;  4A3D G;  4HTH A;  1LUZ A;  1S4Z A;  2F3I A;  3IFT A;  3HOY H;  3I56 A;  1KHI A;  1IKL A;  4RCN A;  2NVT H;  4ZYS A;  3NEL A;  3DLL A;  4LF9 Q;  4A3I G;  4KN7 C;  2A1A A;  4OWT B;  2MPM A;  1J8I A;  4DR3 Q;  5BN3 A;  2JXM B;  2E2H H;  4X64 L;  1HFG A;  4BS9 A;  4UPA A;  1WVL A;  5M5X B;  4IPG A;  2ENB A;  5LL6 S;  4QGU A;  1VQI A;  1EFW A;  4PG3 A;  3VR3 A;  3S2H B;  1L0X B;  2D2C C;  5C0X G;  5FJ8 H;  2JA5 H;  4RGM A;  1HTP A;  1Q8K A;  4LF4 Q;  3ZYY X;  1D1K A;  2EJF C;  2WB1 E;  3S16 B;  2HD3 A;  4DV2 Q;  4FXK C;  1PH8 A;  3RNU A;  5C3X A;  2K5N A;  4RGN A;  2Q8T A;  3DEP A;  3HOX G;  1N33 Q;  4YY3 Q;  3ERQ A;  2B63 G;  5E4W C;  4PQX A;  3WWV A;  4A3B H;  2AKW B;  3I91 A;  4C3J H;  1PV4 A;  1HZA A;  3E9H A;  4NB3 A;  1TWG H;  3PUX A;  4EQP A;  1KAA A;  2ATW A;  2LXK A;  4J15 A;  3HOW B;  2VZA A;  2N8N A;  3L2P A;  3S1N H;  2R7Z H;  3SK8 A;  3S1M H;  1HZB A;  4G7Z C;  4RMF A;  4H0L C;  4NXN Q;  1ENA A;  5EBC A;  1UE5 A;  3S2D H;  4QY7 A;  4HSV A;  1FYC A;  2IPK D;  2Z4I A;  4A3M G;  1BNZ A;  2XWB B;  1EZ6 A;  2R93 B;  3GTK H;  3I72 A;  4DAY B;  3C2P A;  1YIJ A;  1EQR A;  2VB2 X;  2SOB A;  4OO1 H;  2B2U C;  3KJP A;  3OW7 A;  5J39 A;  4LF7 L;  5EKL A;  4KKU A;  3JC6 6;  3QG1 A;  3RR5 A;  1FR3 A;  4AQY L;  1E0B A;  2KCC A;  5IYD H;  2MHV A;  3BVG A;  2KHI A;  4F87 A;  4A3C G;  1CT1 D;  1QCB D;  2F0Q A;  2IL8 A;  5AFW A;  4X3K A;  2LY7 A;  2A69 D;  2ZTE A;  3R3O A;  3NWT A;  5CC4 A;  3KLS A;  4K6D A;  1B53 A;  1E7Z A;  1KDB A;  1G2T A;  2K50 A;  2A69 C;  2ZXR A;  5IYC H;  5EPJ A;  2K32 A;  4LUZ A;  4DUZ L;  1BBW A;  3VYR A;  2E2D C;  1EZ8 A;  3GV3 A;  4C1N I;  4JBW A;  2LFN A;  1SYC A;  2E2J H;  3I4M H;  1AH9 A;  1QUQ B;  4IFD G;  2BH8 A;  1RL2 A;  2D0O A;  5I6W A;  4WRD A;  1LT6 D;  1I4X A;  2F0K A;  3KF8 A;  3TP6 A;  1QVC A;  1W6J A;  4FDB A;  3OWF A;  1JJC B;  1SE4 A;  2L5T A;  4JOI C;  1KRS A;  4C56 C;  2KQ3 A;  3L3O C;  4DAV A;  1WTQ A;  2F0F A;  1S5B D;  2WII B;  5M3M B;  4B3R Q;  4CKB A;  4OO1 I;  1XPO A;  2B2W A;  4Z9C B;  3CKI B;  2I46 A;  4DU9 A;  4QMG A;  3J81 E;  1UE7 A;  2KUM A;  1EIH A;  3MWY W;  3PO3 G;  2JA6 G;  1VQK A;  2E5L Q;  1PLF A;  5NUC A;  4B3M Q;  4HJ5 A;  1U0L A;  4DXG A;  3H3V C;  4TVA B;  1JB7 A;  5C4X H;  1F77 A;  1ZYR D;  1VQ9 A;  2WB1 G;  5LMN W;  1IKM A;  3CCS A;  1AE3 A;  1TWH H;  1YVC A;  1ZYR C;  2IHF A;  5IGB A;  1PFB A;  3R93 A;  3HP3 A;  1E22 A;  1CKN B;  1NY4 A;  1IBM Q;  2B8F A;  2UXB Q;  1QVG A;  1HHV A;  1X6O A;  3QO2 A;  4EQ5 A;  1X3E A;  4FXD A;  4BBS B;  2PCF B;  2R92 H;  3U4Z A;  3STB D;  2K28 A;  4DR7 Q;  4N8X 1;  3LGJ A;  5JJZ A;  3M7G A;  3K5M A;  1PTO C;  4HR7 B;  4LF8 Q;  3S14 B;  3GTQ B;  4DR4 Q;  4R8N A;  1BR9 A;  1NMF A;  4RKL A;  3R8B A;  2NZH A;  3MZ5 A;  1JR0 D;  3T1Y L;  5LMU L;  1DJR D;  2EYJ A;  2G9D A;  4HMJ A;  4RH6 A;  1JOO A;  4IUQ A;  2RBM A;  2ZT9 C;  2F4I A;  1SYG A;  4N8F A;  1SJH D;  3E0J A;  1G2S A;  3K81 C;  4JPB W;  2NVY B;  2LKV A;  4HJ9 A;  1ESR A;  2V4D A;  5E3F A;  4HJ8 A;  4BY7 H;  3KF6 B;  1I4G A;  2D5D A;  4OL7 A;  5J1Z A;  4DV1 Q;  2Z9H A;  2A6H D;  2I0Q A;  2JK8 A;  4EGV A;  2F0N A;  1Y1W B;  2EJM A;  1J5E Q;  3PUZ A;  3H0G B;  1N36 L;  3KFU A;  2UXD Q;  5ELD A;  2PW5 A;  2A6H C;  1EYA A;  2PZT A;  1WD1 A;  2VQF Q;  3NBH A;  2F0D A;  1HA5 A;  3FRP B;  5G3L F;  3BDO A;  4LK1 C;  1MJE A;  5E7N A;  3NQT A;  1S5F D;  2M00 A;  3JAM c;  2WKC A;  1EIY B;  1ILP A;  4HIK A;  5GAG C;  2N78 A;  2F0I A;  3JAM i;  1YIT A;  4JI5 L;  3CU7 A;  4DK0 A;  1JWS D;  5K36 H;  3CCQ A;  2FHT A;  2KA7 A;  1SSO A;  3QB3 A;  2NTS A;  2EVB A;  4DV6 Q;  1VQ7 A;  1U4M A;  3VR2 A;  1X9N A;  5IOD A;  5AJ3 Q;  2NZ1 D;  4B3T Q;  2BCO A;  4APV A;  4DGZ A;  1Z6H A;  4GNX B;  4I7A A;  5IP7 H;  4A76 A;  4JVZ A;  3J80 c;  4A93 B;  4KD4 A;  3J80 i;  1A8V A;  4P72 A;  3IKJ A;  2C5C A;  1M90 C;  3DHQ A;  1QZH A;  5C4J B;  2OTL A;  4DNR B;  1HJP A;  2MUY A;  2UU9 Q;  2AUK A;  4TSS A;  1K83 H;  5IT9 c;  3I70 A;  3UE1 A;  1VQG A;  4L5R C;  1PFS A;  4V0B A;  1BBU A;  1VQP A;  2MO0 A;  1QWY A;  3TZU A;  2D9U A;  1CHP D;  4JI8 L;  2RHS B;  3HKZ E;  3EJI A;  2VUM B;  2MGS A;  4HJ7 A;  4K6L A;  4DV7 L;  2ZJQ A;  2XGT A;  3ERS X;  2H4O A;  1LYL A;  2Q2I A;  1JIC A;  5LMN Q;  1I94 Q;  1ROD A;  3G6J B;  4KKS A;  4L5S A;  1Y1V H;  1RDP D;  3HGB A;  3SK5 A;  4B3S Q;  2F0W A;  1CA6 A;  2NVX B;  5C44 H;  4GN5 A;  4UY8 C;  3GTJ B;  4GOP B;  3RN2 A;  1YJ9 A;  1NAP A;  2BA1 A;  3PUW A;  2A5H A;  3ONA B;  1GUT A;  2F0O A;  1C48 A;  4BXX G;  2RQX A;  1J9O A;  2FMM A;  2K01 A;  1XNR L;  1VQM A;  1I4H A;  2HCC A;  4P71 A;  4FF2 A;  1D5X C;  3DM3 A;  1KRT A;  3AYH B;  1WTV A;  3PUV A;  4X65 L;  3S2H H;  1NMG A;  2ZTC A;  4LWC A;  5HGQ A;  4ZUJ A;  5KNB A;  4IO9 A;  1PZK D;  1R4P B;  1D5M C;  2AWN A;  1ILQ A;  1CM9 A;  4NKL A;  3PIO 3;  3NTI A;  4PZ7 A;  4EQO A;  4KHP L;  1EWC A;  1NE3 A;  1TU2 B;  4YCV A;  1CSP A;  4RHS A;  2A68 C;  1WCM H;  3PSI A;  5IE8 A;  4DAM A;  1YNJ D;  1IYJ B;  4IJL A;  5IP9 H;  5T1I A;  3HOW H;  2ALY B;  3W1G A;  5FO9 B;  1PYW D;  3DWQ A;  3IAY A;  3OIQ A;  5BR8 L;  1QIL A;  1YNJ C;  4DPG A;  2EY2 A;  5M5Y H;  2XWJ B;  5D3I B;  3OMG A;  1VQD A;  5G3L D;  3LX0 A;  2UUA L;  3QOL A;  4RHR A;  2DNC A;  4QUF A;  4JCV E;  2Z6K C;  2NZO A;  5CR3 A;  3U50 C;  3TP7 A;  2R93 H;  3M3Y B;  3NBI A;  4WJW A;  1VQJ A;  3J81 j;  3HOZ G;  2AWO A;  5E1F A;  3S1Q H;  3L7Z C;  1E2W A;  2F0H A;  4A3J H;  2O2L D;  4NXM Q;  2AUJ D;  3KOJ A;  3D31 A;  1RKN A;  1O7I A;  1RTN A;  1I4Q A;  4BY1 H;  1H9S A;  2RSN A;  2NB0 A;  1VF7 A;  1BVS A;  3HKZ G;  2HHH Q;  4A3K G;  2HCI A;  1KDC A;  3GTO H;  1LTR D;  3NHH A;  1UEB A;  4QIW E;  4C3I G;  2JA8 B;  1C8C A;  2AQ2 B;  1WD0 A;  4XT3 B;  3TRE A;  1I6V C;  1LAB A;  1Z47 A;  2PQA A;  1S5E D;  3A56 A;  2DY8 A;  2H5X A;  1QNU A;  2B3G A;  1MBY A;  3PIP 3;  4P73 A;  3CAM A;  4IN3 A;  1YJW A;  4O1N A;  4KHZ A;  2YU9 B;  2BA0 A;  3JAM L;  4A3D B;  3LWU A;  3D8G A;  3ULL A;  2PMZ E;  4S3S A;  1WTX A;  2JEB I;  1Q3L A;  5M5W B;  3HOY G;  4A3I B;  1DYQ A;  4I7Z C;  2VW9 A;  3ZJY C;  2UXC Q;  3H94 A;  3S1R H;  4KJN A;  4ODG A;  4IAL A;  2E76 C;  1XMO Q;  1ENF A;  2ID0 A;  3J80 L;  3U58 A;  1U4L A;  1KQS A;  3K5N A;  3PGZ A;  1S40 A;  2JA7 H;  4O2D A;  5FJ8 G;  2JA5 G;  2FIN B;  4X64 Q;  4HED A;  1WTR A;  1NJI C;  3I4N H;  3M4Q A;  5IT9 L;  3HOX B;  5IWA Q;  3ERO A;  3FP9 A;  2B63 B;  1EYC A;  2EY6 A;  1DOM A;  4OWX B;  3S24 A;  3BZD B;  5IY0 A;  3G71 A;  1PYS B;  2DN8 A;  1HNZ L;  4K5X A;  4A3B G;  2CKZ B;  4GN4 B;  1L0W A;  2CW0 D;  4C3J G;  3S14 H;  1FNV A;  1SMY D;  2WAQ B;  1SR3 A;  1RTO A;  1BCP F;  3KK7 A;  4IPC A;  1G51 A;  2PI2 A;  2NVQ H;  2Q8I B;  2CW0 C;  2R7Z G;  1CK1 A;  1SMY C;  1B3Q A;  4AYB E;  3CW2 C;  4DV0 Q;  4J8Q A;  1SNP A;  1VMP A;  1HA6 A;  2OWO A;  5I4D A;  3I90 A;  2NVY H;  4A3M B;  1O7L A;  3DWP A;  1CQF A;  4QF4 A;  4C3H H;  4K5V A;  1G6Z A;  3UDI A;  4TRD A;  3G6E A;  1I50 B;  1LM0 A;  3M4P A;  4GLX A;  5EAY A;  3HOV H;  2M2L A;  1JJG A;  3HEJ A;  3L9A X;  4DR1 L;  1PH6 A;  5JEA H;  3IFD A;  1Y69 U;  4OO1 G;  1EFI D;  2ZJP A;  4J1M A;  1LV9 A;  1LTT D;  5CV4 A;  1GHK A;  5FKA C;  1GXD C;  4FYD A;  1B9N A;  4DXF A;  5IYD G;  3M4O H;  1O78 A;  4EVO A;  1L1O A;  2NYZ D;  1H9R A;  5DM7 3;  4GLA C;  3K59 A;  4LF7 Q;  2VS1 A;  1QOH A;  2ICE C;  1PTO B;  1T5X D;  2MFI A;  3A7A B;  3FHW A;  4K0K L;  1OXX K;  2Q2H A;  4LFA Q;  1HR0 L;  4KHV A;  1AFP A;  2ZM6 Q;  3H6M A;  1DM0 B;  2FFK B;  3K7A H;  1WTH A;  5EKK A;  1STA A;  4JI4 Q;  4A93 H;  4G4K A;  1ICW A;  4KV6 A;  1N34 Q;  3BVZ A;  1R4Q B;  1MJC A;  3CD6 A;  5C4J H;  1YZ6 A;  1JQY D;  3I4M G;  2GVA A;  5EKI A;  1W3S A;  2PNR C;  4RFB A;  5I9P A;  4X6A H;  4DUY Q;  4DUZ Q;  4PNY A;  5C4H A;  1V1O A;  5M3F H;  5K5P A;  2G5D A;  4CBV A;  4X3S A;  1LLR D;  1YBY A;  1SYE A;  2XIW A;  4X66 L;  3BVM A;  1JWM D;  4F88 A;  4DR6 L;  2JA6 B;  3ULJ A;  1EQT A;  3MC0 B;  4N9T A;  2VUM H;  5JAV A;  4L8J A;  4JI0 L;  4ZKB B;  2WB1 B;  3N52 A;  3Q24 A;  1YEZ A;  4JC0 A;  1XTC D;  3CPW A;  4ZK9 B;  3DEO A;  1K3R A;  2BDO A;  5C3E H;  2PI2 E;  2PYK A;  2R6G A;  2EZV A;  3SHL A;  4DV4 Q;  1CSQ A;  2J7Z A;  4LAA A;  1B4O A;  1PTO F;  2KOL A;  2F03 A;  4K8J A;  1HZC A;  4XDX A;  3FPU B;  1KDA A;  2NN6 H;  2HIX A;  5J3B A;  2R92 G;  4QQB X;  1GJX A;  1LT3 D;  1OXT A;  5ELE A;  2F0G A;  1SNO A;  1PH4 A;  2F0S A;  2KVM A;  1K8A C;  2AQ1 B;  3V05 A;  4AYB G;  2CWP A;  3W5O A;  2JE6 I;  1AZQ A;  4DK6 C;  4A3G H;  1OO9 B;  5EBD A;  4JI1 L;  5I2X A;  2J4X A;  4ZKC B;  1Q81 C;  2OQK A;  3GTG B;  1GHJ A;  2EYM A;  1BCP D;  3CRK C;  4KJO A;  1EEI D;  2E75 C;  2D0P A;  5LMU Q;  3D6W A;  1VQE A;  4A3E B;  1BCP C;  1TII D;  2Q8R E;  4BY7 G;  1SYB A;  5C3W A;  3G7L A;  4PMC A;  5GAD C;  2O5I C;  1ONL A;  3Q6S A;  4FVM A;  2F0L A;  4JBM A;  3PCO B;  1JWU D;  4C1N K;  5IGE A;  1LTB D;  3NP8 A;  1TS5 A;  1QNK A;  5FLX E;  2B2T C;  1N32 L;  3AEV A;  2DUD A;  4HCE A;  3HZX A;  4JI2 L;  3VDY A;  2JA9 A;  2NN6 I;  4A3F G;  4DV3 L;  2IWH A;  1ML0 D;  5K36 G;  1F2L A;  3I7F A;  2DJF C;  3E9I A;  1U9R A;  5I9O A;  3FPP A;  3RZD B;  1CKN A;  1O7Y A;  1SDF A;  1PXU A;  1LAC A;  3OW2 A;  1TXY A;  4RCO A;  1O7Z A;  3KUP A;  2K04 A;  1V1P A;  4LNQ A;  4IOC A;  2OEO A;  2UUC L;  1I3Q B;  3M3Y H;  1B50 A;  3TS0 A;  1WFQ A;  2RVL A;  3O13 A;  1PH9 A;  1KNE A;  3D0F A;  2EYO A;  4G7H C;  1E24 A;  3A55 A;  2EXD A;  3UDF A;  2K5D A;  3MXN A;  1FJG Q;  2JN4 A;  1MSH A;  3D6C A;  1LT4 D;  3R2T A;  2QGQ A;  4UHV A;  1IW7 C;  1QB5 D;  1ZEQ X;  3S15 B;  1SAP A;  1PRT F;  4B9X A;  1TWA B;  1SN8 A;  1VQF A;  2IT1 A;  1N9W A;  1UWV A;  3AQQ A;  3UDG A;  2JA8 H;  5KEE A;  4FNF A;  3MEF A;  4KY6 A;  1B9M A;  5COY A;  4OEL B;  1R9T H;  4BBR H;  3CCM A;  1VMC A;  1PA6 A;  1X55 A;  4POG A;  4GS3 A;  1HUM A;  4B9W A;  3BJU A;  4IUU A;  1X3G A;  3PUY A;  4DR3 L;  2EOT A;  4NP5 A;  1Y1V G;  2Z6B A;  4YCW A;  2PNH A;  5C44 G;  4ULL A;  1JCK B;  1RJT A;  3MXU A;  1Q12 A;  1G8Z D;  1VQ8 A;  4K2K A;  3MFG A;  5CV8 A;  1PTO D;  4LF4 L;  4UAI A;  1JMC A;  1EY4 A;  1LO5 D;  3AFQ A;  5DLQ E;  4BWG B;  2HQL A;  3RLO A;  4DV2 L;  2E74 C;  3EVQ A;  2CH4 A;  5CMD A;  2YTX A;  1PHJ A;  1EWH A;  1IBK Q;  1N33 L;  2EE1 A;  1DCZ A;  4MIU A;  1NBW A;  3PO2 G;  2QEJ C;  3D3R A;  4NMZ A;  4KKT A;  2PZW A;  5JVH 3;  2VQE Q;  3GTM H;  3HFZ B;  4GKJ Q;  4RGT A;  4Q5V A;  2R7F A;  3UDX A;  5C5L A;  1D6E C;  3P7J A;  2XRS D;  4HCS A;  2GVB A;  4NXN L;  2B39 A;  1XPU A;  4LF6 Q;  2CWA A;  1KD1 C;  4R4C A;  2XN9 C;  3FVQ A;  1STG A;  1WCM G;  2LS0 1;  4IUR A;  3H09 A;  2TMP A;  2F0V A;  5IP9 G;  1JJ2 A;  5FO8 B;  1WTO A;  4F8M A;  3URY A;  4H44 C;  1C4Q A;  1ESF A;  2BOS A;  1GUO A;  1IZ6 A;  1PH2 A;  2Z4H A;  3BZC A;  3T1H Q;  3ND9 A;  1UE6 A;  4ME3 A;  1F2Y A;  5JVG 3;  4DR5 L;  2SNS A;  1XTD A;  4MTK A;  1Q7Y C;  1SRO A;  1DGS A;  3HOU G;  1HRJ A;  4XIG S;  2K03 A;  3OSO A;  3HOZ B;  3B6Y A;  5JEA J;  3A54 A;  3NEM A;  2P5Z X;  1BUV T;  1JOR A;  3K0X A;  1B8A A;  1XJV A;  5DM6 3;  5CV9 A;  1C7Y A;  3PF5 A;  1TVX A;  3E3X A;  4A3J G;  2EYP A;  2A73 B;  3CCV A;  2VB3 X;  5LL6 X;  3F2C A;  4GZY C;  3FEW X;  3KJO A;  1EY8 A;  1PVO A;  5CYU A;  4RWS C;  3HKZ B;  3MXP A;  1BF4 A;  4BY1 G;  1I6H H;  4A3K B;  1L1O C;  1WI5 A;  2F3V A;  2G9H D;  2OXP A;  3E0E A;  4J6H A;  4C3I B;  4YWK A;  1PH7 A;  2QA4 A;  2KHJ A;  2M9V A;  4EX5 A;  1CZW A;  1K9M C;  1Z7T A;  5ELB A;  1UEA B;  4YWL A;  1Q46 A;  3CC7 A;  1B2T A;  3PMF A;  2B2Y C;  1EQV A;  4YCU A;  1PRT D;  3K0Y A;  1F9S A;  4JG2 A;  3GTP H;  1M4V A;  1PRT C;  2QDL A;  3SR1 A;  4DA2 A;  2E5L L;  1CKO A;  3RLN A;  1B1Z A;  1IBL L;  2K6A A;  2L55 A;  2L9H A;  2KED A;  4DV5 Q;  1XMQ Q;  4JI6 L;  2KEN A;  2F0P A;  3SE0 A;  3R2I A;  4KLK A;  2JEA I;  3J7Z C;  1GVP A;  1YI2 A;  1E1O A;  3BDC A;  5JPN C;  1QG7 A;  2OT2 A;  3NBH B;  2E2H B;  3NXW A;  2RSO A;  3J7A 5;  1F2Z A;  4R8I A;  4N9P A;  3MHB A;  2UXB L;  2JYO A;  4G7O C;  3BG3 A;  2GN5 A;  3K5O A;  2PQE A;  5M5X H;  1HUN A;  2JA5 B;  4RG1 A;  4UP8 A;  5JPM C;  2JA7 G;  4DR7 L;  3ICE A;  3TBI B;  2RDH A;  3CCL A;  5A2Q L;  4LF8 L;  1BKB A;  3AB9 A;  1JB3 A;  5F2D A;  3I4N G;  4DR4 L;  3S16 H;  4LJZ C;  1Q86 C;  1YNN D;  4DF7 A;  3D4W A;  5IGG A;  2RA4 A;  5ELC A;  3QIA A;  1KLG D;  1TWC B;  4A3B B;  2X69 A;  1YNN C;  2I5H A;  2A68 D;  4C3J B;  4XQJ A;  5HGT A;  1TKW B;  3E5S A;  1CHQ D;  1TQO A;  2R7Z B;  2IX0 A;  3S1M B;  1V1Q A;  2J0T D;  3NQI A;  4P75 A;  3WDN A;  3T51 B;  4DV1 L;  1FGB D;  1HNW Q;  4JI7 Q;  1OXS C;  3FKI G;  3GTG H;  2VY3 A;  2Y0S E;  5JJK A;  3CME A;  2HT1 A;  1K0S A;  1YHB A;  2UXD L;  3S2D B;  4G57 A;  4AH6 A;  2VQF L;  3MFY A;  4KK7 A;  3TP8 A;  4A3E H;  4HN7 A;  3SGI A;  4C3H G;  4CDC C;  4WOR A;  1ET9 A;  2MQH A;  1G91 A;  3TME A;  4OEM B;  1FGU A;  3HOV G;  3I4O A;  4XT1 B;  2I5M X;  1ASY A;  4DKA C;  1A0I A;  5JEA G;  1GUN A;  4ZCK A;  4DR2 L;  4K5W A;  1TY0 A;  1Z9F A;  1EQQ A;  5EQ0 A;  3V2T A;  2RDF A;  1A15 A;  1I4P A;  4L5T A;  5AJ3 L;  3GDE A;  4QIW B;  1F2M A;  2SEB D;  2IHE A;  4DR1 Q;  4XYQ A;  1Q90 A;  1A3T A;  3QR8 A;  2RHQ B;  3OIP A;  4JBJ A;  1EYD A;  5ELF A;  1BXT A;  2B29 A;  3VA7 A;  3RZD H;  3D4R A;  1GM5 A;  4JV5 Q;  3VYU A;  1VQN A;  1LTS D;  4R4O A;  2UU9 L;  1ENC A;  1SYF A;  1I3Q H;  3RZO B;  4MN3 A;  3TSS A;  3VR4 A;  1TWF B;  1IXR A;  2PMZ B;  3I4M B;  5GAH C;  4HIM A;  1HNX Q;  1HR0 Q;  3NSW A;  1VQ4 A;  2EY5 A;  2X6G A;  3W2D A;  1SJE D;  1H9M A;  1KTK A;  4HAE A;  2VL6 A;  1BCP B;  5CV7 A;  1TR5 A;  3GQB A;  3CQZ B;  5FK9 C;  4POF A;  3KDF A;  4M1U B;  5M3F G;  5ELN A;  3S15 H;  2IJ0 A;  2CHB D;  1YJN A;  2JSO A;  4ALP A;  4XXE A;  5M3M H;  5LMN L;  2R7D A;  3OTO Q;  2WV6 D;  1UAP A;  2JJQ A;  4GKK L;  2B2W C;  3MXG A;  5IYB H;  4B3S L;  3OMC A;  2VUM G;  3M7N A;  4X66 Q;  3SEB A;  3HS0 C;  3OOC A;  4LF5 L;  5EPK A;  5JOB A;  4IJH A;  3M85 A;  1NSN S;  4LFB L;  2CCZ A;  1PDQ A;  2XSC A;  5HUR A;  5C3E G;  1O80 A;  3J81 c;  2L15 A;  3J81 i;  1CI3 M;  5BN4 A;  1DON A;  3K6O A;  3J7A F;  1EY0 A;  2PO4 A;  3DWA A;  4BXX H;  3C1E A;  1SE3 A;  2RF4 A;  4CDF C;  3TN2 A;  4BBS H;  1S5C D;  5KNC A;  3VYS A;  3M9B A;  2FMC A;  2Y0S G;  5GQO A;  2WIN B;  2HIV A;  3F1Z A;  3I8Z A;  2DJG C;  3GTQ H;  3KLS X;  1H9S B;  3TDQ A;  4A3G G;  2RKS A;  4RKB A;  3S9W A;  3NTH A;  1OTC A;  1STY A;  2KEC A;  4DK3 C;  5FLM H;  2OTJ A;  4X3U A;  1ET6 A;  3BS1 A;  1G6P A;  1VQ6 A;  1TS3 A;  2K5H A;  3NPP A;  3KYH C;  5BN5 A;  4BY7 B;  3JAM E;  3PQI A;  2NTT A;  1EY7 A;  4A3L H;  2PQA B;  3I73 A;  1A6X A;  4PMW A;  2EIF A;  1HH2 P;  4R4Q A;  4LFC L;  1YNX A;  1BBX C;  2F4V L;  2ZXP A;  1Y1W H;  5C5M A;  4DNI A;  5ELO A;  3H0G H;  2B2V A;  1D7Q A;  3A7L A;  5KND A;  2LSS A;  2KBN A;  1MHW C;  4OHJ A;  1KLU D;  1CTM A;  4A3F B;  3MTS A;  3K8A A;  4L5Q A;  3J80 E;  3IL8 A;  1LT5 D;  2WAQ E;  1Q1B A;  2FXQ A;  2CH4 W;  4HJA A;  1BDO A;  1H9J A;  4QL5 A;  1N32 Q;  2F0M A;  2K33 A;  1MSG A;  1X3F A;  4YHH L;  4KY7 A;  3SDZ A;  1P8L A;  2YTY A;  3VR6 A;  5IT9 E;  1PFN A;  4AQY Q;  4DV3 Q;  1EIG A;  2EDG A;  4ZLT F;  1X32 A;  2I5L X;  1X56 A;  5KYL A;  4CKE A;  5IYC G;  3V96 A;  1SFO B;  1B7Y B;  4FP5 D;  2NBF A;  3HRZ C;  4MTN A;  1BQQ T;  4Y52 H;  4X62 L;  5KIX A;  1KIX A;  2CQO A;  1EY6 A;  4K8I A;  1STE A;  4XQN A;  5J22 A;  3IRB A;  3WOF A;  1DD2 A;  3T13 A;  4C2M B;  3NTK A;  1RD9 D;  4NW2 A;  4A3K H;  1EOT A;  2V1C C;  4ZQ3 A;  1KNA A;  1HFN A;  4KN4 C;  3N6R A;  5EJW A;  5D65 A;  4LUV A;  2F0E A;  2HQE A;  1XNQ L;  1B70 B;  5FO7 B;  3PO3 B;  4KI0 A;  3CF5 A;  5DEH A;  2QEX A;  2YV5 A;  2OF1 A;  2K7V A;  1HQR D;  5IOC A;  1WJJ A;  2JQO A;  4BBR G;  5C4X G;  4B08 A;  4DAY A;  2UXC L;  3TS2 A;  3TRZ A;  3G48 A;  1SMX A;  1II3 A;  5C44 B;  3KLR A;  5D14 A;  3ULP A;  1XMO L;  1EUJ A;  2HUG A;  4CGY B;  4U68 A;  2A8V A;  2K52 A;  2NVX H;  4OIJ A;  3P1H A;  2EYH A;  3G4S A;  3TZD A;  3GTJ H;  4IUP A;  4QB4 A;  4IUV A;  3HG9 A;  5FLX L;  1OXV A;  3OHX C;  5A35 A;  4R9W A;  1CUK A;  2F52 A;  5IWA L;  1EOV A;  1MIU A;  4WFN 3;  4CDD C;  4DK1 A;  1W6K A;  1VS0 A;  3PO2 B;  1H9K A;  1L1O B;  2FJ2 A;  5TSS A;  1XYI A;  3Q8D A;  4O0A A;  4OX9 L;  4UP9 A;  1HCZ A;  3MAQ A;  3W1B A;  1QUQ A;  2F3W A;  3Q22 A;  5IIF A;  3K5L A;  4HIO A;  1GO3 E;  1KAW A;  2CFM A;  3J7A V;  3T1Y Q;  1K28 A;  1PRT B;  3TP5 A;  1TWC H;  2DGY A;  2MP1 A;  1W2B A;  1LTA D;  1IL2 A;  4DV0 L;  1WCM B;  3S17 B;  1UNS A;  5GRO A;  1SEB D;  1HZ9 A;  2SDF A;  3UI2 A;  3LWE A;  3DM1 A;  4ILW A;  1U4P A;  1CZG A;  4OWW B;  2WAQ G;  1K8O A;  3NK9 A;  4CDE C;  5M5Y B;  1L0Y B;  2EYL A;  4HID A;  2EJG C;  2E2I B;  4IQZ A;  2ES2 A;  4YWM A;  1N36 Q;  1NNX A;  3J81 L;  2Z6K A;  1CQV A;  3HOU B;  1STB A;  2X6L A;  3A8I E;  1STH A; 
#chains in the Genus database with same CATH homology
 5LHY 1;  1SYD A;  2QKI C;  2L4N A;  4JK1 C;  3S1Q B;  1F9R A;  1LTG D;  4A3J B;  3WOE A;  1RF2 D;  2L11 A;  4CJ0 B;  3MVV A;  3GTL B;  5IGC A;  1AEX A;  4IUN A;  5I2Y A;  2QF7 A;  4BY1 B;  5IGF A;  3E6Z X;  1IW7 D;  5D3D A;  2I07 B;  2XVS A;  2A6E D;  5KRU A;  4TKO B;  2K05 A;  2DNE A;  3GTO B;  2A6E C;  3U9O A;  2LMC B;  1EY9 A;  3GD7 A;  5DNF A;  1G29 1;  3KBX A;  3FDT A;  2XRQ D;  1JOK A;  5DAU A;  1VCI A;  4KTA A;  5E4X A;  3GO5 A;  2K1B A;  5EGT A;  1M8A A;  3K58 A;  3S1R B;  1RHP A;  4CJ2 C;  3C1F A;  2ZXO A;  2KCN A;  1HQM C;  3GV6 A;  1HTL D;  1XXG A;  1QJO A;  2JA7 B;  5C0X H;  4KD3 A;  1EU3 A;  5CV5 A;  4U67 3;  2N55 A;  3I4N B;  3NWS A;  2BE5 D;  3F2U A;  1V1P B;  3QJY A;  4Y7N B;  3BYT B;  2BE5 C;  4FXG C;  3C3L A;  3DMU A;  1WTW A;  1AW7 A;  2NVQ B;  3FKI B;  2VXW A;  2XNA C;  2KEE A;  4HSP A;  4FO2 A;  4C3H B;  5CGK A;  2EXZ A;  2ICI A;  4RA8 A;  1X3Q A;  4MHE A;  2QCP X;  5COR A;  2MJ8 A;  3HOV B;  5C0X I;  1MGS A;  1EY5 A;  3ND8 A;  1BO0 A;  5M9O A;  1DOK A;  2B2V C;  1HPC A;  2IX1 A;  3M4O B;  1PZI D;  2D62 A;  4EQN A;  2HDM A;  2PW7 A;  3DUZ A;  3CRL C;  2O5J C;  1GUW A;  1QE6 A;  2NWG A;  3K57 A;  2PPB C;  1PTO H;  2F0U A;  3K7A B;  2NUC A;  3OWE B;  3RUZ A;  2Z8L A;  4IUT A;  1DXM A;  4CKC A;  4IFD H;  5C4Z A;  1PFM A;  1K8M A;  3AU7 A;  1B3A A;  5M3F B;  1ZKO A;  1SNC A;  2Z1C A;  1MI2 A;  3QOJ A;  3FMC A;  3I4L A;  3HOY B;  4L6T B;  2O4X A;  1JOQ A;  2NVT B;  1TT2 A;  4K2L A;  4L63 B;  1IHZ A;  2KJX A;  3SVM A;  5T1G A;  1VDZ A;  2L0C A;  1SE2 A;  1IYU A;  4OIK A;  5C3E B;  5CV6 A;  2QIL A;  1B44 D;  1OXU A;  2DY7 A;  4CHT B;  1JE4 A;  1X3P A;  3AMU A;  3W3A A;  4NDX A;  4XQQ A;  4X3T A;  4DFA A;  3MA2 B;  2R3Z A;  4DAP A;  1NR2 A;  4IFD I;  3DXJ C;  2IX3 A;  2F1M A;  1V8Q A;  1A2U A;  3P20 A;  1BOS A;  3T16 A;  3RLF A;  4ID6 A;  3SK4 A;  2Y0S B;  3ITP A;  1E2V A;  1TWG B;  4A3G B;  2F0J A;  3S1N B;  4TQU S;  2R61 A;  1DOL A;  1UUP A;  4BA2 I;  1V43 A;  4XTC S;  1Q8I A;  1XX8 A;  3T53 B;  3P75 A;  1NCV A;  4DN4 M;  4ZAI A;  1LTI D;  1PZJ D;  3GTK B;  1FNU A;  2B2T A;  5EPL A;  2B2U A;  1EU4 A;  1U4R A;  5I6Y A;  1T5E A;  4K14 A;  1TS2 A;  1JC7 A;  3H91 A;  2A74 C;  3C46 A;  4RAU C;  5A2Q E;  4RGO S;  1Y8N B;  4XYO A;  1WTP A;  2IW3 A;  1SND A;  2F0T A;  1S5D D;  4UDU C;  3RD4 A;  2E2J B;  1EEF D;  2H1E A;  3X3N A;  3VA5 A;  3Q23 A;  3PV0 A;  4E6I A;  4CJ1 B;  2EYF A;  2WAC A;  4FF1 A;  4YIJ A;  4V19 0;  4ME5 A;  5ISR A;  4H7B A;  1AZP A;  2RDG A;  2CVR A;  4HMI A;  4ZRZ A;  2PZU A;  3BDL A;  1F9P A;  4IZ8 A;  1R9T B;  4BBR B;  5C4X B;  1Y8P B;  4F7X A;  2K5W A;  1GOZ A;  2AQ3 B;  3KBG A;  2CQA A;  3CHB D;  3VR5 A;  1KAB A;  1TY2 A;  1TWH B;  1A3V A;  2BDN A;  4O42 A;  1EL0 A;  2EY1 A;  4OGQ C;  5CBE E;  2L12 A;  1SXT A;  1IYV A;  3M4Y A;  1SNQ A;  1Q1E A;  3U9S A;  2R92 B;  3RMH A;  5KGU A;  3QWN A;  4KY5 A;  3J7Y W;  2NN6 G;  3VYT A;  2C9O A;  4M8A A;  4AYB B;  1F9Q A;  5C0X J;  4ZUI A;  1DZ1 A;  3EA6 A;  4LMQ D;  1PMR A;  2L1B A;  4FF4 A;  3GTM B;  1NR4 A;  1Y8O B;  2B8G A;  1HXY D;  4ABN A;  2TSS A;  1D5Z C;  3EFX D;  3A8K E;  3MEH A;  4I65 A;  5FOB B;  1CA5 A;  2HDL A;  1MD2 D;  5IGD A;  1A3U A;  2GA4 B;  1AN8 A;  3SK6 A;  3D4D A;  1SBB B;  2KHS A;  3I3C A;  3GP7 A;  1ZXT A;  2WP8 J;  3SXH A;  1AP0 A;  1FNW A;  3NUC A;  1D1I A;  1TS4 A;  1GUS A;  3LNN A;  3Q0A A;  4KMU C;  4FF3 A;  3NE5 B;  1GUG A;  3OPO A;  1I4R A;  1D2B A;  1VF5 C;  1FD7 D;  2SNM A;  3BYY B;  2WKD A;  2VNU D;  5C6A A;  1E2Z A;  1RCV D;  4P2C B;  4PV1 C;  2YYZ A;  4QCL A;  2K5Q A;  3A8J E;  2JP1 A;  4BA1 I;  4DNT B;  1I6H B;  1K83 B;  1IL8 A;  2N88 A;  1CFM A;  2B2Y A;  1A2T A;  3EQL C;  3X3M A;  4IFD J;  2EPB A;  4Q0F A;  3GTP B;  1SNM A;  4H13 C;  3T56 B;  3T4A C;  1STN A;  4PMB A;  1NUC A;  5KYI A;  4QUC A;  1XWE A;  1Y1V B;  2QDB A;  5CBA E;  4HTH A;  1S4Z A;  3IFT A;  1IKL A;  4RCN A;  4ZYS A;  4KN7 C;  2MPM A;  1J8I A;  5BN3 A;  2JXM B;  1HFG A;  4BS9 A;  1WVL A;  5M5X B;  2ENB A;  5LL6 S;  3VR3 A;  3S2H B;  1L0X B;  2D2C C;  5C0X G;  4RGM A;  1HTP A;  3ZYY X;  1D1K A;  2EJF C;  3S16 B;  4FXK C;  5C3X A;  4RGN A;  2Q8T A;  3DEP A;  3ERQ A;  5E4W C;  4PQX A;  3I91 A;  3PUX A;  4EQP A;  1KAA A;  3HOW B;  3SK8 A;  4G7Z C;  4H0L C;  1ENA A;  5EBC A;  4HSV A;  1FYC A;  2IPK D;  2Z4I A;  1BNZ A;  2XWB B;  1EZ6 A;  2R93 B;  3I72 A;  3C2P A;  2VB2 X;  2SOB A;  4OO1 H;  2B2U C;  3OW7 A;  5J39 A;  5EKL A;  4KKU A;  3QG1 A;  1FR3 A;  1E0B A;  2KCC A;  2MHV A;  3BVG A;  4F87 A;  1CT1 D;  1QCB D;  2F0Q A;  2IL8 A;  5AFW A;  4X3K A;  2LY7 A;  2A69 D;  3R3O A;  3NWT A;  5CC4 A;  3KLS A;  4K6D A;  1B53 A;  1KDB A;  1G2T A;  2A69 C;  2ZXR A;  5EPJ A;  2K32 A;  3VYR A;  2E2D C;  1EZ8 A;  3GV3 A;  4C1N I;  4JBW A;  2LFN A;  1SYC A;  4IFD G;  5I6W A;  4WRD A;  1LT6 D;  1I4X A;  2F0K A;  3KF8 A;  3TP6 A;  1W6J A;  3OWF A;  1SE4 A;  2L5T A;  4C56 C;  2KQ3 A;  3L3O C;  4DAV A;  1WTQ A;  2F0F A;  1S5B D;  2WII B;  5M3M B;  4CKB A;  4OO1 I;  2B2W A;  4Z9C B;  3CKI B;  2I46 A;  4DU9 A;  4QMG A;  3J81 E;  2KUM A;  1EIH A;  3MWY W;  1PLF A;  5NUC A;  4DXG A;  3H3V C;  1F77 A;  1ZYR D;  1IKM A;  1ZYR C;  5IGB A;  1PFB A;  3R93 A;  3HP3 A;  2B8F A;  1HHV A;  3QO2 A;  4FXD A;  4BBS B;  2PCF B;  2K28 A;  5JJZ A;  3M7G A;  3K5M A;  1PTO C;  4HR7 B;  3S14 B;  3GTQ B;  4R8N A;  1BR9 A;  4RKL A;  3R8B A;  3MZ5 A;  1JR0 D;  1DJR D;  2EYJ A;  2G9D A;  4HMJ A;  4RH6 A;  1JOO A;  4IUQ A;  2RBM A;  2ZT9 C;  2F4I A;  1SYG A;  1SJH D;  3E0J A;  1G2S A;  2NVY B;  2LKV A;  1ESR A;  2V4D A;  5E3F A;  4OL7 A;  1I4G A;  2D5D A;  5J1Z A;  2A6H D;  4EGV A;  1Y1W B;  2F0N A;  2EJM A;  3PUZ A;  3H0G B;  5ELD A;  2PW5 A;  2A6H C;  1EYA A;  2PZT A;  1WD1 A;  3NBH A;  2F0D A;  1HA5 A;  3FRP B;  5G3L F;  3BDO A;  4LK1 C;  3NQT A;  1S5F D;  2M00 A;  2WKC A;  1ILP A;  2F0I A;  3CU7 A;  4DK0 A;  1JWS D;  5K36 H;  2FHT A;  2KA7 A;  1SSO A;  3QB3 A;  2NTS A;  2EVB A;  1U4M A;  3VR2 A;  5IOD A;  2NZ1 D;  2BCO A;  4DGZ A;  1Z6H A;  4A93 B;  4KD4 A;  3IKJ A;  2C5C A;  3DHQ A;  5C4J B;  4DNR B;  2MUY A;  2AUK A;  4TSS A;  3I70 A;  4V0B A;  1QWY A;  3TZU A;  2D9U A;  1CHP D;  3EJI A;  2VUM B;  2MGS A;  4K6L A;  2H4O A;  1JIC A;  1ROD A;  3G6J B;  4KKS A;  1RDP D;  3HGB A;  3SK5 A;  2F0W A;  1CA6 A;  2NVX B;  3GTJ B;  1NAP A;  2BA1 A;  3PUW A;  2A5H A;  3ONA B;  1GUT A;  2F0O A;  1C48 A;  2RQX A;  1J9O A;  2FMM A;  2K01 A;  1I4H A;  2HCC A;  4FF2 A;  1D5X C;  1WTV A;  3PUV A;  4ZUJ A;  5KNB A;  1PZK D;  1R4P B;  1D5M C;  2AWN A;  1ILQ A;  1CM9 A;  4NKL A;  3PIO 3;  3NTI A;  4EQO A;  1EWC A;  1TU2 B;  4RHS A;  2A68 C;  1YNJ D;  5T1I A;  5FO9 B;  1PYW D;  3DWQ A;  3IAY A;  3OIQ A;  1QIL A;  1YNJ C;  2EY2 A;  2XWJ B;  5D3I B;  3OMG A;  5G3L D;  3LX0 A;  3QOL A;  4RHR A;  2DNC A;  4QUF A;  5CR3 A;  3TP7 A;  3M3Y B;  3NBI A;  4WJW A;  2AWO A;  5E1F A;  3L7Z C;  1E2W A;  2F0H A;  2O2L D;  2AUJ D;  3D31 A;  1RKN A;  1RTN A;  1I4Q A;  1H9S A;  2RSN A;  2NB0 A;  1VF7 A;  2HCI A;  1KDC A;  1LTR D;  3NHH A;  4C3I G;  2JA8 B;  1C8C A;  2AQ2 B;  1WD0 A;  4XT3 B;  1I6V C;  1LAB A;  1Z47 A;  1S5E D;  3A56 A;  2DY8 A;  1QNU A;  1MBY A;  3PIP 3;  4IN3 A;  4O1N A;  4KHZ A;  2YU9 B;  2BA0 A;  3JAM L;  4A3D B;  3LWU A;  3D8G A;  4S3S A;  1WTX A;  2JEB I;  1Q3L A;  5M5W B;  4A3I B;  1DYQ A;  4I7Z C;  3H94 A;  4KJN A;  4ODG A;  4IAL A;  2E76 C;  1ENF A;  2ID0 A;  3J80 L;  1U4L A;  3K5N A;  2FIN B;  4HED A;  1WTR A;  5IT9 L;  3HOX B;  3ERO A;  2B63 B;  1EYC A;  2EY6 A;  1DOM A;  3BZD B;  2DN8 A;  4K5X A;  2CW0 D;  4C3J G;  1FNV A;  1SMY D;  2WAQ B;  1RTO A;  1BCP F;  3KK7 A;  2Q8I B;  2CW0 C;  1CK1 A;  1SMY C;  4J8Q A;  1SNP A;  1VMP A;  1HA6 A;  5I4D A;  3I90 A;  4A3M B;  1O7L A;  3DWP A;  1CQF A;  4QF4 A;  4K5V A;  1G6Z A;  4TRD A;  1I50 B;  2M2L A;  3HEJ A;  3L9A X;  5JEA H;  3IFD A;  1Y69 U;  4OO1 G;  1EFI D;  4J1M A;  1LV9 A;  1LTT D;  5CV4 A;  1GHK A;  5FKA C;  1GXD C;  4FYD A;  1B9N A;  4DXF A;  1O78 A;  4EVO A;  2NYZ D;  1H9R A;  5DM7 3;  3K59 A;  1QOH A;  2ICE C;  1PTO B;  1T5X D;  3A7A B;  1OXX K;  4KHV A;  1AFP A;  3H6M A;  1DM0 B;  2FFK B;  5EKK A;  1STA A;  4G4K A;  1ICW A;  4KV6 A;  3BVZ A;  1R4Q B;  1JQY D;  5EKI A;  2PNR C;  4RFB A;  5I9P A;  4PNY A;  5C4H A;  1V1O A;  5K5P A;  4CBV A;  4X3S A;  1LLR D;  1SYE A;  2XIW A;  3BVM A;  1JWM D;  4F88 A;  2JA6 B;  1EQT A;  3MC0 B;  4N9T A;  5JAV A;  4L8J A;  4ZKB B;  2WB1 B;  3N52 A;  3Q24 A;  1XTC D;  4ZK9 B;  3DEO A;  2BDO A;  2PYK A;  2R6G A;  2EZV A;  3SHL A;  2J7Z A;  4LAA A;  1B4O A;  1PTO F;  2KOL A;  2F03 A;  4K8J A;  4XDX A;  3FPU B;  1KDA A;  2NN6 H;  1GJX A;  1LT3 D;  1OXT A;  5ELE A;  2F0G A;  1SNO A;  2F0S A;  2KVM A;  2AQ1 B;  3V05 A;  2JE6 I;  1AZQ A;  1OO9 B;  5EBD A;  5I2X A;  2J4X A;  4ZKC B;  3GTG B;  1GHJ A;  2EYM A;  1BCP D;  3CRK C;  4KJO A;  1EEI D;  2E75 C;  3D6W A;  4A3E B;  1BCP C;  1TII D;  2Q8R E;  1SYB A;  5C3W A;  3G7L A;  4PMC A;  2O5I C;  1ONL A;  3Q6S A;  4FVM A;  2F0L A;  1JWU D;  4C1N K;  5IGE A;  1LTB D;  3NP8 A;  1TS5 A;  1QNK A;  5FLX E;  2B2T C;  4HCE A;  3HZX A;  2NN6 I;  2IWH A;  1ML0 D;  5K36 G;  1F2L A;  1U9R A;  5I9O A;  3FPP A;  3RZD B;  1O7Y A;  1SDF A;  1PXU A;  1LAC A;  4RCO A;  1O7Z A;  3KUP A;  2K04 A;  1V1P A;  2OEO A;  1I3Q B;  1B50 A;  2RVL A;  3O13 A;  1KNE A;  2EYO A;  4G7H C;  3A55 A;  2K5D A;  3MXN A;  1MSH A;  3D6C A;  1LT4 D;  3R2T A;  1IW7 C;  1QB5 D;  1ZEQ X;  3S15 B;  1SAP A;  1PRT F;  4B9X A;  1TWA B;  2IT1 A;  5KEE A;  4FNF A;  4KY6 A;  1B9M A;  5COY A;  1VMC A;  1HUM A;  4B9W A;  4IUU A;  3PUY A;  2EOT A;  4NP5 A;  4ULL A;  1RJT A;  1JCK B;  3MXU A;  1Q12 A;  1G8Z D;  4K2K A;  3MFG A;  5CV8 A;  1PTO D;  4UAI A;  1EY4 A;  1LO5 D;  4BWG B;  2E74 C;  3EVQ A;  5CMD A;  1EWH A;  2EE1 A;  1DCZ A;  4MIU A;  2QEJ C;  3D3R A;  4NMZ A;  4KKT A;  2PZW A;  5JVH 3;  4RGT A;  4Q5V A;  5C5L A;  1D6E C;  3P7J A;  2XRS D;  4HCS A;  2B39 A;  2XN9 C;  3FVQ A;  1STG A;  2LS0 1;  4IUR A;  3H09 A;  2TMP A;  2F0V A;  5FO8 B;  1WTO A;  4F8M A;  3URY A;  4H44 C;  1C4Q A;  1ESF A;  2BOS A;  1GUO A;  2Z4H A;  3ND9 A;  1F2Y A;  5JVG 3;  2SNS A;  1HRJ A;  4XIG S;  2K03 A;  3OSO A;  3HOZ B;  5JEA J;  3A54 A;  1BUV T;  1JOR A;  5DM6 3;  5CV9 A;  1TVX A;  2EYP A;  2A73 B;  2VB3 X;  5LL6 X;  4GZY C;  3FEW X;  1EY8 A;  5CYU A;  4RWS C;  3HKZ B;  3MXP A;  1BF4 A;  4A3K B;  2G9H D;  2F3V A;  2OXP A;  4J6H A;  4C3I B;  2M9V A;  1CZW A;  1Z7T A;  5ELB A;  1UEA B;  1B2T A;  3PMF A;  2B2Y C;  1EQV A;  1PRT D;  3K0Y A;  1F9S A;  1M4V A;  1PRT C;  3SR1 A;  4DA2 A;  1B1Z A;  2K6A A;  2L55 A;  2L9H A;  2KED A;  2F0P A;  3SE0 A;  3R2I A;  2JEA I;  3BDC A;  5JPN C;  1QG7 A;  2OT2 A;  2E2H B;  3NXW A;  2RSO A;  1F2Z A;  4R8I A;  4N9P A;  3MHB A;  2JYO A;  4G7O C;  3BG3 A;  3K5O A;  2PQE A;  1HUN A;  2JA5 B;  5JPM C;  3TBI B;  2RDH A;  5A2Q L;  3AB9 A;  1JB3 A;  5F2D A;  4LJZ C;  1YNN D;  4DF7 A;  3D4W A;  5IGG A;  2RA4 A;  5ELC A;  3QIA A;  1KLG D;  1TWC B;  4A3B B;  2X69 A;  1YNN C;  2A68 D;  4C3J B;  4XQJ A;  5HGT A;  1TKW B;  3E5S A;  1CHQ D;  1TQO A;  2R7Z B;  2IX0 A;  3S1M B;  2J0T D;  3NQI A;  3WDN A;  3T51 B;  1FGB D;  1OXS C;  3S2D B;  4G57 A;  3MFY A;  4KK7 A;  3TP8 A;  4HN7 A;  4C3H G;  4WOR A;  1ET9 A;  1G91 A;  3TME A;  4XT1 B;  5JEA G;  1GUN A;  4K5W A;  1TY0 A;  5EQ0 A;  3V2T A;  2RDF A;  1A15 A;  1I4P A;  4QIW B;  1F2M A;  2SEB D;  4XYQ A;  1Q90 A;  1A3T A;  3OIP A;  1EYD A;  5ELF A;  1BXT A;  3VA7 A;  3D4R A;  3VYU A;  1LTS D;  1ENC A;  1SYF A;  3RZO B;  4MN3 A;  3TSS A;  3VR4 A;  1TWF B;  2PMZ B;  3I4M B;  3NSW A;  2EY5 A;  2X6G A;  3W2D A;  1SJE D;  1H9M A;  1KTK A;  4HAE A;  1BCP B;  5CV7 A;  1TR5 A;  3GQB A;  3CQZ B;  5FK9 C;  4M1U B;  2IJ0 A;  2CHB D;  2JSO A;  4XXE A;  2WV6 D;  1UAP A;  2B2W C;  3MXG A;  3OMC A;  3M7N A;  3SEB A;  3HS0 C;  3OOC A;  5EPK A;  5JOB A;  3M85 A;  1NSN S;  1PDQ A;  2XSC A;  5HUR A;  1O80 A;  1CI3 M;  5BN4 A;  1DON A;  3K6O A;  3J7A F;  1EY0 A;  2PO4 A;  3DWA A;  3C1E A;  1SE3 A;  3TN2 A;  1S5C D;  5KNC A;  3VYS A;  2FMC A;  2WIN B;  3I8Z A;  3KLS X;  1H9S B;  3TDQ A;  2RKS A;  4RKB A;  3S9W A;  3NTH A;  1STY A;  2KEC A;  4X3U A;  1ET6 A;  3BS1 A;  1TS3 A;  3NPP A;  5BN5 A;  4BY7 B;  3JAM E;  2NTT A;  1EY7 A;  1A6X A;  3I73 A;  4PMW A;  1BBX C;  2ZXP A;  5C5M A;  2B2V A;  3A7L A;  5KND A;  4OHJ A;  1KLU D;  1CTM A;  4A3F B;  3MTS A;  3J80 E;  3IL8 A;  1LT5 D;  1Q1B A;  1BDO A;  1H9J A;  2F0M A;  2K33 A;  1MSG A;  4KY7 A;  3SDZ A;  3VR6 A;  5IT9 E;  1PFN A;  1EIG A;  2EDG A;  4ZLT F;  1X32 A;  5KYL A;  4CKE A;  3V96 A;  1SFO B;  4FP5 D;  2NBF A;  3HRZ C;  1BQQ T;  5KIX A;  1EY6 A;  4K8I A;  1STE A;  4XQN A;  5J22 A;  1DD2 A;  3WOF A;  3T13 A;  4C2M B;  3NTK A;  1RD9 D;  4NW2 A;  1EOT A;  4ZQ3 A;  1KNA A;  1HFN A;  4KN4 C;  3N6R A;  5EJW A;  5D65 A;  2F0E A;  2HQE A;  5FO7 B;  3PO3 B;  4KI0 A;  5DEH A;  2OF1 A;  2K7V A;  1HQR D;  5IOC A;  4B08 A;  4DAY A;  1II3 A;  5C44 B;  3KLR A;  5D14 A;  2HUG A;  4CGY B;  4U68 A;  4OIJ A;  3P1H A;  2EYH A;  3TZD A;  4IUP A;  4QB4 A;  4IUV A;  3HG9 A;  5FLX L;  5A35 A;  1OXV A;  3OHX C;  4R9W A;  4WFN 3;  4DK1 A;  1W6K A;  3PO2 B;  1H9K A;  2FJ2 A;  5TSS A;  1XYI A;  1HCZ A;  3MAQ A;  2F3W A;  3Q22 A;  5IIF A;  3K5L A;  3J7A V;  1PRT B;  3TP5 A;  2MP1 A;  1LTA D;  1WCM B;  3S17 B;  1UNS A;  1SEB D;  2SDF A;  3UI2 A;  3LWE A;  3DM1 A;  4ILW A;  1U4P A;  1CZG A;  1K8O A;  3NK9 A;  5M5Y B;  1L0Y B;  2EYL A;  2EJG C;  2E2I B;  4IQZ A;  3J81 L;  1CQV A;  3HOU B;  1STB A;  2X6L A;  3A8I E;  1STH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...