4NKLA

Crystal structure of staphylococcal nuclease variant delta+phs v66a/i92q at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYQYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4nklA00
2F0FA 1F2ZA 2KHSA 2SNMA 2F0WA 1EY4A 3DHQA 4K14A 5NUCA 1EY7A 3BDLA 5JOBA 5KIXA 4KY6A 5KRUA 1SNOA 3R3OA 2F0LA 3SR1A 2SNSA 4YIJA 5M9OA 2F0QA 4K8IA 5J22A 3P1HA 1EYDA 5DEHA 1KABA 2EYPA 3EJIA 2EXZA 1A3UA 2EYHA 4KJOA 1A3TA 1JOOA 1SNCA 4K2KA 4ZUJA 2PW5A 4KY7A 3TP8A 4EQNA 5IGEA 2LKVA 4K5VA 4B9XA 5IGBA 3D4DA 4KHVA 5IGGA 5IODA 5IGDA 5C3XA 1KDAA 3MEHA 3SK8A 2F0DA 1SYDA 2F0SA 4KJNA 3PMFA 5I6YA 5KYLA 3MVVA 4KD3A 3TMEA 3D6CA 4K5WA 2PYKA 2KQ3A 3NK9A 4QMGA 3HEJA 3NQTA 1A3VA 3D8GA 3ERQA 3QOJA 4KTAA 2F3VA 4MIUA 3SK4A 5DAUA 5CV9A 2F3WA 2OEOA 4KD4A 1KDBA 1SYBA 2EY2A 2F0EA 3V2TA 4F7XA 1SYFA 3EROA 5CV7A 4ZQ3A 1SNQA 2EY5A 4QF4A 1EY9A 3SHLA 1SNDA 5CR3A 3C1EA 3D4WA 5EKLA 1STHA 5I6WA 2EY1A 2F0UA 4PMBA 4WRDA 1EQVA 5C4HA 4E6IA 5IOCA 5ISRA 2F0KA 3E5SA 2PZWA 5EKKA 4J1MA 3U9OA 5E3FA 3H6MA 5EGTA 4RKLA 4HMJA 4WORA 3SK6A 4K6DA 2NUCA 3C1FA 4TRDA 5C5MA 5HGTA 3SK5A 5I9OA 5CV6A 5C5LA 1NSNS 3QB3A 4QB4A 2F0JA 2PW7A 1A2UA 1STGA 4HTHA 3VA5A 4KV6A 4ZUIA 2RKSA 1EZ6A 2PZTA 3NXWA 4ME5A 1AEXA 1SYGA 2EYOA 2EYMA 3MXPA 4DFAA 4EQPA 4EQOA 4NKLA 5J1ZA 5CV5A 5E1FA 4F8MA 1EYCA 3P75A 4DF7A 2EYFA 5C3WA 1EY8A 1II3A 4DGZA 5K5PA 2HQEA 5HURA 4NP5A 4K2LA 4NDXA 4PMCA 5I9PA 1EZ8A 4NMZA 2F0OA 1A2TA 2O4XA 4K5XA 1TQOA 1TR5A 2ENBA 1ENAA 4LAAA 3HZXA 1U9RA 2F0IA 1SNMA 5CGKA 5KEEA 2M00A 5KGUA 1SNPA 2EYLA 4DU9A 2F0PA 4H7BA 4HMIA 2RDFA 3RUZA 1JOQA 2QDBA 2OXPA 4PNYA 3EVQA 3TP6A 1F2MA 5IGCA 1F2YA 1EY5A 3TP7A 1STAA 2RBMA 3OWFA 2F0GA 3OMGA 1JOKA 2PZUA 2SOBA 4K8JA 3T13A 5JAVA 3LX0A 1NUCA 4S3SA 4IALA 1SYEA 4OL7A 1TT2A 1SYCA 5CV8A 2EYJA 5KYIA 4B9WA 1JORA 4G57A 4ODGA 4R8NA 4IUNA 1STBA 1STNA 4EVOA 3NHHA 3ITPA 3MZ5A 2F0NA 3NUCA 4N9PA 5CV4A 3DMUA 4J6HA 3T16A 5IIFA 5F2DA 1EY0A 5C4ZA 2EY6A 2PQEA 4KY5A 1EY6A 1EYAA 2F0TA 2F0MA 2OF1A 2F0HA 3NP8A 3OMCA 4I65A 4ID6A 3TP5A 1STYA 3QOLA 5C6AA 3SXHA 5CC4A 4N9TA 5IGFA 5J39A 3MHBA 3S9WA 3OSOA 1RKNA 1IHZA 2F0VA 1KAAA 1KDCA 4IZ8A 2WACA 4RKBA 3BDCA 1ENCA
chains in the Genus database with same CATH superfamily
4MHEA 1EEID 2PCFB 3PO2G 5KIXA 2VL6A 3MA2B 5A35A 1X65A 3R2TA 2Q8IB 4A93B 4R4OA 5M9OA 1B4OA 3CRKC 2JXMB 5CYUA 4ZUJA 4C1NI 4KY7A 2MUYA 1BBUA 5IGEA 2RDGA 5G3LD 1AH9A 3EN2A 3RLNA 1IBKQ 5IGGA 4LFCQ 3M4PA 1YIJA 2RCNA 2IL8A 2MNAA 2K50A 3J80c 2NTSA 3TMEA 2MQHA 5K36H 3J7AF 2NN6H 5DAUA 5IYDG 2CVRA 5IY0A 1Y8NB 1VQ9A 4A3MB 3AMUA 1ESRA 1UEAB 2KEDA 4RHSA 1EOTA 1FJGQ 5C0XI 1CFMA 1BXTA 1PTOH 2F0UA 4LUVA 1LT6D 5IOCA 4GOPA 5FJ8H 2PZWA 1DJRD 3H6MA 3S2HH 4YY3L 2WFWA 3BDOA 3PUWA 2D62A 1YNND 1Y1WG 2QDLA 4FVMA 3SK5A 2JA8G 4A3DB 1RCVD 2DY8A 2QA4A 1LYLA 2F0JA 1GOZA 1HFGA 4L5QA 4KN4C 3STBD 2QGQA 3U9SA 1IL8A 5FLMG 3DUZA 3ULJA 2EYMA 4X64Q 1HZ9A 1VQ8A 1TWCH 4F8MA 5COYA 3HS0C 4LF7Q 4NDXA 2B2VC 4A3FG 2AUJD 4KLKA 2FFKB 2Y0SE 1GUNA 4IPHA 2F4VL 1S40A 2M00A 3NWSA 1QVFA 2EYLA 3TEHB 2C9OA 1PYWD 3K5LA 3CCRA 4A3GB 1MGSA 5M5WH 2X6GA 1JOKA 4H0LC 2CW0C 1KNAA 1N9WA 1QNKA 5CMDA 1TT2A 3H3VH 3S15H 3MWYW 1VQMA 2H5XA 2KEEA 4QGUA 1CI3M 3NHHA 4FP5D 4HJ9A 1U4LA 4POGA 4DXFA 5F2DA 2F0TA 1Q81C 2JA9A 2B63B 3BYYB 4L5SA 4LF5Q 4JV5L 4ZK9B 2G9HD 2R92B 4IZ8A 4JI5L 4DAYB 2KBNA 2RHSB 2PI2A 1HFNA 5C4XG 1EFID 2A5HA 3HOXG 1T5XD 1EU4A 2Z1CA 5KRUA 4P2CB 1DONA 1I4QA 2XWBB 5E4XA 1L1OB 1ZYRD 3TN2A 5IGBA 3I8ZA 2K1BA 3A5UA 3U58A 1E1TA 5IODA 1SDFA 2Z4HA 1PTOC 3GDEA 1J5EQ 2F0DA 4KJNA 1I5FA 1KHIA 1VQBA 3NK9A 5IP7G 3HEJA 3ERQA 1YHQA 2R6GA 1P8LA 3HG9A 4APVA 1F9SA 2KVMA 4F7XA 3DWAA 3EROA 3QJYA 5K36G 4CKCA 2K14A 4Q0FA 1C48A 4CJ2C 5LMNL 1RJTA 2R7DA 4WRDA 5C4HA 2FJ2A 2WINB 5GADC 3ZYYX 3TBIB 5C44B 3RLOA 2K32A 1MSHA 5C0XJ 1AEXA 5C44H 3G6EA 3SEBA 4X3SA 3O13A 4LWCA 5ELCA 3GTGH 2HQEA 3GP7A 4CKEA 2JA5G 1QE6A 1EZ8A 1G8ZD 4PQXA 4JI6Q 2D0OA 2H1EA 3HP3A 1O7YA 5LMNW 3FKIG 2V4DA 5LL6X 3FKIB 3L7ZC 3BS1A 3H91A 4A3EH 1SR3A 4NW2A 2JSOA 2AUKA 2CFMA 1I50B 2MHVA 3RD4A 3HOYG 4GLAC 1B3AA 4IALA 1KRSA 1J9OA 3K7UC 3TZUA 1GUWA 2YU9H 1NNXA 2EYJA 1STBA 2BDOA 1EEFD 4R4CA 1J6QA 1ET9A 1KAWA 3SGIA 2BCOA 3T16A 4GOPB 4F88A 3TP8A 3NP8A 3OMCA 1MJCA 5AJ3Q 5CC4A 1BVSA 2EJGC 1X54A 3JAME 1GM5A 1R4QB 1D5ZC 2PI2E 1K3RA 3UDGA 1ENCA 1L0YB 1YVCA 4OONA 4A3KG 4BY1B 1KXLA 5BN4A 2RCFA 4LNQA 2A1AA 3S1QB 4YCVA 1DYQA 4RFBA 3HRZC 5IP9G 2UUAL 4YWLA 2BH8A 2A6EC 2F03A 3HOVB 2N88A 3OW2A 1K0SA 1IW7C 4KHPQ 1LO5D 1BQQT 4DR6L 1SMYD 2KHJA 4QMGA 3T1YL 1A3VA 4BBRG 4LF4Q 1QB5D 2F3VA 4JI4L 4KD4A 1PVOA 3CF5A 2F0EA 4LF6L 1CQVA 2YTYA 4Z9CB 2JA6G 4ME3A 5I4DA 5CR3A 2E2DC 3CU7A 4HSPA 2DN8A 4E6IA 1KLUD 2LXJA 2K6AA 2VW9A 2UXDQ 1E2WA 4WORA 2ICEC 4M8AA 2NWGA 5GQOA 3QB3A 3CXCA 2PW7A 3R93A 5JVH3 3I4NG 1OXVA 2MO1A 1B8AA 2EYOA 4DFAA 1G6ZA 4GLXA 1IL2A 3I73A 1EU3A 4IPGA 1EY8A 5M3MB 4LFBQ 1R4PB 4IQZA 5I9PA 2RVLA 1JT8A 3IKJA 2UXCQ 2DY7A 3VR2A 1BKBA 3AYHB 4DR4Q 4CJ1B 5KEEA 1JJCB 1L1OA 2JA5H 3HKZG 4ILWA 4DU9A 4DV2L 4PZ6A 4IPDA 5JJZA 5IGCA 4FXKC 2K5QA 3OWFA 4XT1B 1KIXA 4A3MG 1QZGA 5JPMC 3JC66 1MHWC 1W2BA 3RZDH 2WIIB 1I6HH 1HQMC 4GOPC 5JEAJ 1FD7D 1LTID 4DR7Q 3S9WA 3ER0A 4DV0L 4TKOB 1SE8A 4FNFA 1E0BA 2F0FA 2VQFL 3GTLB 2WKCA 1CKNA 4A3IB 4C1NK 4K0KQ 4O2DA 5LMUL 3N52A 2FHTA 5DLQE 1ML0D 1PZID 2JYOA 1JR0D 2NVXB 3FHWA 2EXZA 1LTLA 2CQAA 4NXMQ 1A62A 5D3IB 3KDFB 1PH3A 2ZM6Q 4B3MQ 4B3RL 3KLRA 1PRTF 2CWAA 4IFDI 1N34Q 4HR7B 2F0SA 4HEDA 4K5WA 5IT9L 3QOJA 1V43A 2XN9C 1LT4D 3FDTA 1N36Q 2JA6B 2B39A 1DOLA 1XJVA 4GN4B 2EY2A 3BZKA 1GD7A 2MP1A 3C1EA 3GTOH 4MNOA 4DR3Q 1B2TA 4JI4Q 4AYBB 2F0KA 1GJXA 1DXMA 3T1YQ 2GVBA 4NXNL 5BR8Q 3PQIA 1V1PA 2ZM6L 3GTKH 3NQIA 1NSNS 1B1ZA 5DM63 4HTHA 2E2JB 4A76A 4FF3A 2JA8H 3GO5A 4BXXH 4DK6C 3I4NH 5FLMH 2O2LD 4DV1L 2O4XA 3G71A 1CM9A 3S1NB 1YZ6A 2E76C 1I4HA 3J81j 2AMCB 1E2VA 4LFAL 1F9RA 2CH4A 4J15A 3KF8B 1JMCA 3EVQA 3FEWX 1WOCA 5FO7B 1Z7TA 2IHEA 2QF7A 2WB1B 3NBIA 1TWCB 3M7NA 1SYEA 1HUNA 3P20A 2LY7A 1DOMA 2ZXPA 1ILQA 3IFDA 3FPPA 2NTTA 3BU2A 4B08A 5KYIA 4A3MH 1JORA 5IP9H 4QJFA 2PNRC 4YCWA 5CV4A 1YBYA 4A3BH 3DMUA 5IIFA 1ESFA 4G7ZC 4DAPA 2A73B 2K5HA 2PQEA 3PV0A 2OF1A 4Y7NB 3I4LA 3X3MA 3QOLA 2XRQD 2QCPX 5EJWA 3SXHA 1WD0A 2VB3X 2KCNA 4BBSG 3GV6A 1ET6A 2NN6I 1YNXA 5ELDA 5C4XB 2B8GA 4KN7C 4B3SQ 4RWSC 1G2SA 4A3FB 1OXSC 4JI6L 2A8VA 1SNOA 3R3OA 4IUVA 1WTHA 4K8IA 1EYDA 1FNVA 3Q6SA 4A3CH 1SNCA 4RGNA 2JP1A 1SJED 1EYGA 1I94L 5JJLA 1ENFA 3CAMA 4M1UB 1CHQD 1H9RA 1XXGA 3SK8A 5KYLA 2E8GA 4RKLA 1ASZA 1JQYD 1QILA 2EQSA 3KOJA 4YWKA 2OEOA 4GKKQ 1SYBA 3T51B 5C3EG 2K03A 4QF4A 1SNDA 4LF4L 1WCMB 1GVPA 3PUVA 3NPPA 2JA8B 4A3DG 1PH1A 5M5XH 5BN5A 4XT3B 3SK6A 1Q46A 5HGTA 2AWNA 3S1RB 1PH9A 5C5LA 4G7HC 1X3QA 5LHY1 1OXTA 1HZCA 3CCSA 3C46A 1PH6A 3C3LA 4DR4L 4DV3L 4BS9A 5E4WC 5E1FA 4A93G 1I3QH 2Z8LA 2JE6I 1EOVA 2AWOA 4ZKBB 3S2DB 5IYDH 1F77A 2EPBA 1PH4A 4K5XA 1HNZQ 1M8AA 4DK1A 3CMAA 1Q3LA 1SNMA 5KGUA 4BY7H 1IKLA 1JCKB 4N8X1 4HIDA 1CA5A 3HOVG 5J3BA 2BE5D 2QDBA 2OXPA 3E0JA 4P72A 4JI5Q 3TP6A 1F2MA 4DV5Q 1EY5A 3F2DA 2BA0A 3D6WA 2SOBA 3CMEA 1D7QA 3C2PA 4KKUA 4HJ5A 1KQSA 4ODGA 5DNFA 1R9TB 1CUKA 1EWHA 4HJ8A 4DN4M 3SVMA 1SSOA 3KFUA 1VQGA 2B2YA 1YNJD 2Z9HA 1STYA 4JK1C 1SBBB 4OELB 5D3DA 1Y1WB 1CA6A 2E5LL 2LSSA 1YHAA 4QIWB 5C0XG 3P1HA 4NXML 5IE8A 2X69A 2K75A 2AHOB 5JOBA 2DJFC 3EIVA 4OX9L 1PZJD 4LF8Q 4C3JB 1VMCA 3OWEB 4DV6L 1XWEA 2C5CA 5M3FH 1PFSA 1A3UA 1B3QA 2AQ1B 2JA7B 2CW0D 1AP0A 1Q86C 1N33L 2L12A 1FVIA 3DEPA 1TU2B 2DGYA 1BCPD 1K3BC 1JWSD 4KD3A 4YY3Q 3D6CA 1PTOD 3TP5A 3NQTA 1XNRQ 1TWFB 4OHJA 4DR3L 4L8JA 3H3VC 3GQBA 4GKKL 1G291 2IX1A 2XNAC 4RCNA 3AU7A 3D4WA 4H02A 4CDDC 3NTKA 1JE5A 1QJOA 5EKKA 4A3GH 1H9KA 1OXUA 5FOBB 1GUTA 2G9DA 2J0TD 1IBMQ 1E7ZA 1T5EA 3S1QH 4PZ8A 4A3DH 1R9TH 2R92G 1YNJC 4KV6A 2UXCL 2RKSA 1EIHA 1HNXL 4PMCA 1SRUA 1L0XB 1WFQA 2D5DA 3EA6A 4X65Q 2EJMA 3BVZA 3WDNA 5T1IA 3RMHA 3CHBD 1VQPA 1ONLA 3CD6A 1AE2A 2MFIA 1LT5D 4XYQA 4P74A 3HFZB 4WJ3M 2PQAA 4DV0Q 1F2YA 4HCEA 1SROA 3NE5B 3UDIA 3M3YH 1IYVA 3HOWB 1AW7A 5JAVA 5JEAH 2Q2TA 4DR7L 1SN8A 2DNEA 4IPCA 1VQ4A 3M4OH 3MXNA 4JYAL 3UE0A 1E24A 4K6LA 1ASYA 1CSQA 2M9VA 4EVOA 4CHTB 3CPWA 4GNXB 4C3IB 3GTMH 1QVCA 5IYBH 2R93H 4PG3A 1W6KA 2RQXA 1TWFH 1EL0A 5C6AA 1HR0Q 1K8MA 1PV4A 2EXDA 1PH7A 3OSOA 1VQCA 1WI5A 2Z6BA 3FPUB 3F1ZA 1Q7YC 3HOUG 5ELOA 1PHJA 1F2ZA 4I7ZC 1VMPA 4DAYA 1XX8A 3HOZB 1V9PA 2SDFA 2IT1A 3KLSX 2WB1E 3AB9A 2IWHA 4XYOA 1DZ1A 1EUJA 4LFBL 4HAEA 4OWTB 2BDNA 4DK0A 2XIWA 4PV1C 2PW5A 2LKVA 3J81i 3RZDB 1IXRA 2CKZB 3E9HA 1LUZA 2LS01 4JBKA 3IRBA 2VNUD 2ZXOA 2VB2X 4KKTA 1H9SB 4GKJL 3DWQA 4A3FH 1YJWA 1M4VA 4YHHQ 1XNQL 4U68A 1M90C 1BCPF 2B2YC 2WV6D 1A8VA 5EKLA 3QR8A 4PMBA 5ELBA 2IX3A 4JI1Q 5D65A 5ISRA 5JJKA 1X55A 3M7GA 3I90A 3PO3B 3D31A 5E3FA 4HMJA 4JI8Q 5EBDA 3A5ZB 1VQLA 2MPMA 4OIJA 4C2MH 1STGA 2NB0A 3K0YA 3FRPB 1KRTA 1ZXTA 2PZTA 3CCVA 2Y0SG 1H9SA 2TMPA 5M5YH 4NKLA 1V1PB 4X3UA 1PRTB 2K28A 1MD2D 5C4JB 4LF9L 1H9JA 2FXQA 5FO9B 4K2LA 3M3YB 3KF6B 2FMMA 2A68C 1BNZA 3HKSA 4BXXG 2ZXRA 2ENBA 4X64L 4FF2A 1X3EA 1JWUD 2JA6H 1CTMA 2Q2HA 3GTKB 1VQDA 1PFNA 4JBMA 3QIAA 3NELA 2L0CA 4UPAA 3GTJH 5C3EB 2PZUA 4WFN3 4FXGC 4XDXA 4DR1Q 1VQIA 4CKBA 3S16H 4C3HB 3MAQA 4CJ0B 2A6HD 3PGZA 4QQBX 3BJUA 4G7OC 2DUDA 1V1QA 4EQ5A 4HN7A 5L37A 2MGSA 4AQYQ 1PXUA 1MSGA 2D9UA 2X6LA 4GKJQ 2EY6A 4A3IH 1S3OA 3HOXH 4A3JB 1EQQA 1SAPA 1LTBD 3S1MH 1U0LA 1RL2A 1LABA 2HIVA 1RKNA 4KJOA 3R8BA 2BH2A 1BO0A 4RCOA 1HR0W 2LMCB 1TY0A 1ZEQX 2BA1A 4NPSA 3VYTA 4OO1H 3JAMc 1U4MA 3NSWA 1KLGD 1RODA 4TSSA 1PH5A 1T9HA 3EJIA 2EYHA 2K01A 3I72A 4HCSA 3STBC 2EE1A 4B9XA 1Q8KA 2R92H 1L0WA 1BCPB 3M4OB 1DD2A 1S4ZA 4O42A 4IUUA 2HDLA 3MEFA 3VYUA 3OOCA 1HR0L 2RDHA 2O5JC 2GVAA 3Q22A 1CSPA 2R93B 3TS2A 2IW3A 5LMNQ 2A68D 2WP8J 3FKIH 1FR3A 3U4ZA 1RF2D 1TS2A 5ELNA 3SHLA 2WKDA 4CDFC 4JYAQ 2K52A 3PF4A 1STHA 1DGSA 5C3EH 1DM0B 1EQVA 2I07B 2KENA 3JAML 4JI7Q 1B44D 3CCEA 1HHVA 1JB7A 2K33A 2FMCA 5JEAG 1STEA 5I2XA 4A3KB 4R9WA 3A55A 2B63G 5M3MG 2ZJQA 4XQNA 1PMRA 4DV1Q 1LTTD 3I91A 2GN5A 5J1ZA 1W6JA 4DF7A 1SLJA 3HOZG 1FYCA 3HKZB 4BY7G 3PIP3 4RGOS 3WOFA 2F0OA 3VDYA 2E2HB 1G51A 3EFXD 1CZGA 2Z6KC 1OXXK 2E5LQ 1UE5A 1JC7A 3U50C 4HIOA 1IBML 4V0BA 3G4SA 1DCZA 3OMGA 2HT1A 3E9IA 4MTKA 3HOYB 1NUCA 1WCMH 3BYTB 4GN5A 4LUZA 1GXDC 4RGMA 3GTGB 5GAGC 2E2IB 1I4GA 5CV8A 4B3TQ 1BF4A 2OT2A 1LTGD 4IUNA 1N36L 4RA8A 3LWUA 4BBSB 1KL9A 3QG1A 3GD7A 1U4PA 3HOUB 2HD3A 1O7ZA 4DR1L 1TKWB 3BG3A 2YTVA 3Q8DA 1IBKL 1D5MC 4LUOA 1JE4A 2B3GA 3E6ZX 4L5TA 5CGKA 4ALPA 4QUFA 3HOXB 2IHFA 1GUGA 1HUMA 4LW1A 2F4VQ 4K14A 1WD1A 3M4QA 1JICA 3I4MH 4ZAIA 1CT1D 1TWGB 4A3EB 1I4PA 3J7YW 4OO1G 1CKOA 4LF9Q 3TDQA 5CBEE 1X9NA 1QNUA 1SEBD 2B2WC 1HZBA 3RZOH 3D4DA 5GAHC 3J80i 3J81E 1NBWA 1Q8IA 5BR8L 2UU9L 3D8GA 2G5DA 4HJ7A 3ONAB 3VR5A 4A75A 1KDBA 3ICEA 3PO2H 1YJ9A 4JBWA 2ES2A 2K5NA 1TVXA 3DLLA 1FGUA 5FO8B 4DV5L 4C3JH 3PCOB 4LFCL 3H09A 2I0QA 1WTXA 4IOAA 4X65L 3S1RH 1EZ6A 4Q5VA 3K7AH 4HSVA 1AE3A 1V1OA 4IOCA 3GTLH 3H0GH 3VA7A 4MTNA 1PFBA 4GNXC 2R7ZG 2XTIA 2TSSA 4JOIC 1U9RA 2A69C 4UDUC 3K57A 2OTJA 4JPBW 2F0PA 2AKWB 4JV5Q 3RUZA 3M85A 3UE1A 1ICFB 2UXDL 3S14H 4AYBE 1N8RC 5EPJA 2B2TA 2F0GA 1O78A 3W2DA 3FVQA 2I5LX 4FYDA 3PIO3 5M5WB 1LV9A 1EQTA 3ITPA 3MXGA 5IYCG 1XPUA 3PUYA 5FLXc 4KHPL 3LNNA 3K5NA 5IGFA 2NVTH 3KYHC 1N33Q 2L55A 1TWHB 4RKBA 2EZVA 1QZHA 2KHSA 1TIID 5I2YA 4DV6Q 3SR1A 1ZKOA 3I3CA 2P5ZX 1Z47A 2QW7A 1HNXQ 5DEHA 4FXDA 1TWGH 3X3NA 1HQRD 3T56B 1A63A 2HHHQ 3F2CA 1JOOA 2VUMB 1X3FA 4X3KA 3AEVA 3A7LA 2Q2IA 4JI8L 4RH6A 3RN5A 3Q23A 2YTXA 3GTQB 3VR4A 3PMFA 3MVVA 2UXBQ 2OTLA 2N3SA 2A74C 4NB3A 1PRTC 1XNQQ 1PZKD 3WWVA 2B2TC 3J81c 3CC2A 3TQYA 1GHJA 1B9NA 3V2TA 1GKHA 3J80E 1F9PA 5CV7A 3RNUA 1SNQA 1Q1BA 1EFWA 4BY1H 2EJFC 2RF4A 2ZJPA 1QUQB 2JQOA 3W3AA 3LGJA 2E2IH 2YV5A 4O1NA 1KTKA 3E5SA 2XVSA 1Y8PB 1KNEA 1BCPC 1I50H 3ND8A 4GNXA 1VQJA 5I9OA 3URYA 4QB4A 2XWJB 1HNZL 2IPKD 3TZDA 4ZUIA 4LFAQ 1X6OA 3NXWA 1UAPA 1K8AC 1I3QB 5IWAL 5FLXL 1HTPA 1II3A 4DGZA 1Y1VB 1TWAH 2K5VA 5IP7H 4LF7L 1I4RA 1A2TA 4DXGA 4JW0A 2ID0A 3HZXA 3KK7A 3F2UA 4H7BA 1AZQA 2UUCQ 2JA7G 3S17B 2M2LA 5EPKA 3TP7A 3I4MG 1STAA 2RBMA 2ZT9C 5AJ3L 1FNWA 4OWWB 1PTOF 1EQRA 3LX0A 1YI2A 5C4JH 3T1HQ 3V05A 3W1BA 3CPFA 3RZOB 4BBRB 4DV4L 4MZ9A 3HOWH 3DM1A 2ZJRA 3BZDB 1S5FD 1WJJA 4GS3A 1STNA 3D4RA 3I7FA 1VQ5A 2PO4A 1W3SA 3NUCA 4ZCKA 1PRTD 2KHIA 5H1SE 1XMQQ 5AFWA 3LWEA 3KJPA 2L9HA 2IJ0A 4N9TA 1Y8OB 3MHBA 3W5OA 3KLSA 4A3EG 1CKMA 3A54A 1TWHH 1EY4A 2F0WA 1O80A 3TS0A 4DK3C 3QO2A 1GO3E 4RHRA 2PNHA 2RHQB 1HNWL 4N8FA 1KABA 5A2QE 4B3SL 2EOTA 2KOLA 3S1NH 4CBVA 3EQLC 4K2KA 2E2HH 4RAUC 2HQLA 1VQNA 1NY4A 1BBXC 3ZJYC 4DUZQ 3IAYA 4KHVA 4UP9A 1KDAA 3MEHA 2NBFA 3H0GG 3K5MA 4A93H 2F52A 2R7FA 4AQYL 2NVXH 3KBXA 2UUBL 5EBCA 3A56A 2HDMA 1XMOQ 2DJGC 1D1KA 3D0FA 3Q24A 4JI3Q 3E0EA 1AZPA 1XNRL 1RHPA 2ZTCA 4C3IG 1S5DD 4UHVA 2ICIA 4RMFA 1UUPA 4J1MA 2QEJC 2B63H 4XXEA 5ELFA 3S17H 2NUCA 1PYSB 1SE3A 1I94Q 2UUCL 4X62Q 1ICWA 5HGQA 1SYGA 5IYCH 4EQOA 1WTVA 4LF8L 2CHBD 1EYCA 3P75A 4DPGA 1SMYC 5HURA 2ALYB 4L5RC 2IY5B 4JOIA 4HJAA 1TQOA 4LAAA 4UP8A 3I56A 2VY3A 1N32L 2B2VA 3P7JA 4PNYA 1K8GA 4A4IA 4LF5L 4JI1L 4UP7A 1PA6A 4GLVB 1YJNA 3L0OA 1E2ZA 3H0GB 4YHHL 4B9WA 4G57A 3K59A 4OIKA 4X66Q 4IO9A 2Q8TA 3CP0A 1EY0A 3K6OA 5JVG3 1EYAA 3PF5A 2F0HA 1L2FA 4B3ML 4DR6Q 4XTCS 3S15B 2F0VA 1KAAA 2LFNA 4KK7A 3NEMA 4DV7Q 3BVGA 4BY1G 2E75C 1EY7A 2HHHL 1N32Q 4KY6A 1O7IA 2H4OA 3ULPA 3DEOA 5FKAC 2SNSA 2B2WA 1QUQA 4F87A 1I6HB 4DNTB 3FP9A 3PO3H 2I5MX 1UE6A 2VUMG 1VQ6A 2KCTA 2WAQB 3T4AC 4IUQA 4BBRH 4OEMB 3HGBA 2JK8A 2KQ3A 3CQZH 2N78A 2JJQA 3DM3A 3PIOA 2E74C 1SE2A 2GA4B 1FJGL 1E3PA 1EY9A 3M4YA 5C4XH 4X3TA 1B9MA 2EY1A 1J8IA 3TREA 2NVQB 1NE3A 2UUBQ 2J7ZA 2RSOA 1S5CD 5EGTA 2O5IC 3C1FA 3K81C 5C5MA 3V96A 1RTOA 4AYBG 2Y0SB 3A0JA 1I6VC 1U5KA 2XGTA 1WTOA 2B2UA 2YYZA 4EQPA 1Y14B 5IGDA 4JBJA 1X56A 2Q2UA 4NP5A 3I4NB 1HZAA 2Z6KA 1KC8C 4K0KL 4DV7L 1SMXA 5EAYA 3HOUH 4R4IA 1AFPA 1WTQA 3PUZA 3RN2A 2I46A 1MBYA 1VQAA 1K8OA 4EX5A 3KF6A 1NCVA 2EVBA 3VYSA 4K8JA 1RTNA 1IYJB 3T13A 1UNSA 3GTQH 3UI2A 2VS1A 4QUCA 1NMFA 1XPRA 3VYRA 3NBHB 4LF6Q 1XMQL 4KHZA 4A3CG 2K5WA 1Z9FA 2F0NA 4ZRZA 4HIKA 1C0AA 2K5DA 3PIPA 4DA2A 1O7LA 3HOZH 1GUOA 4L6TB 4I65A 4IJLA 1QCBD 2UU9Q 1JJ2A 4ID6A 3TSSA 5J39A 3NWTA 2CH4W 4L63B 2YU9B 4OGQC 1KDCA 3OIQA 3CCLA 2F1MA 3DHQA 1TS3A 1F9QA 1XPOA 3BDLA 1K9MC 2A19A 3PSIA 5LL6S 1M1KC 3A8JE 4OX9Q 2F0LA 4C3IH 3GTMB 2MJ8A 1HCZA 2MO0A 3MC0B 3WOEA 2KA7A 1V8QA 3KF8A 3K0XA 3KDFA 2PMZE 3D3RA 3F2BA 3UDFA 4EQNA 4MN3A 2CQOA 1VCIA 1KD1C 4JVZA 4Y7NH 1D5XC 2VUMH 1SYDA 4JI0Q 1A0IA 1BBWA 1B53A 1PH2A 3SK4A 4KTAA 1VQFA 4R4TA 2NYZD 4AH6A 1YEZA 3B6YA 1UEBA 4CGYB 3OTOQ 1WVLA 1OO9B 1K0RA 1UWVA 2EY5A 2JN4A 4OXPA 5KNDA 3L2PA 1Y69U 4A3JG 1OTCA 3W1GA 4R1JA 2OQ0A 4IUPA 1N34L 2NVTB 2UXBL 4B3RQ 4K6DA 3I55A 4TRDA 1ZYRC 2NVYH 4ZLTF 3S14B 5CV6A 1IYUA 3VA5A 4XQQA 3F8TA 1WTPA 4JC0A 4JCVE 1NTGA 3K8AA 4PMWA 2KCCA 4X6AH 1CQFA 4V190 4DV3Q 5IT9c 3OIPA 1ENAA 2F0IA 1MIUA 1NJIC 1EIFA 3CCMA 1HXYD 3CQZB 1C8CA 3VR3A 3NBHA 4KI0A 1JB3A 1BOSA 3HOWG 1BDOA 4BA1I 1VQKA 4S3SA 2L4NA 3CCQA 4QL5A 1PFMA 5M3FG 1NR2A 5E7NA 1VQEA 4WJWA 4R8NA 1SE4A 4JI3L 5CBAE 1XMOL 3MZ5A 1RIPA 2FINB 4A3LG 4C2MB 1WYDA 4CDCC 1H95A 2Z0SA 2F0MA 3CCJA 1NMGA 2BOSA 3S2HB 4PZ7A 2ASBA 4LK1C 4DV2Q 2SEBD 1ILPA 1SXTA 2QKIC 3R2IA 4DUZL 4G4KA 2BE5C 1D2BA 4RGTA 4WJ4A 2J4XA 1JWMD 2ZTEA 3AQQA 2B8FA 3H3VI 3I2ZA 1E22A 4YIJA 5J22A 3J80L 2JA5B 3I70A 2IX0A 3GTPH 3PUXA 1GUSA 4LJZC 4AIMA 4C3HH 4K5VA 1PTOB 3T53B 1FNUA 1WTWA 1MJEA 3JAMi 4OO1I 3GTPB 5M3FB 3RR5A 1CZWA 1HA5A 3K7AB 3KJOA 2ZTDA 2WAQG 2D2CC 3E3XA 1QOHA 5C0XH 1D1IA 2PQAB 2EIFA 2HCCA 3K5OA 4RG1A 2LXKA 2V1CC 1SYFA 4ZQ3A 4TQUS 4GN3B 3NTIA 4FDBA 4DV4Q 3EBEA 3H15A 3RLFA 3ERSX 2KCMA 2NZ1D 3HOYH 1Q1EA 5EKIA 3J7ZC 5KNCA 2KECA 4DR5L 1SFOB 2QILA 1J5EL 2UUAQ 1GHKA 1QWYA 2A6ED 3QWNA 4A3BB 4TVAB 2NVYB 2L15A 4UY8C 1VQ7A 3MXPA 3CRLC 1D6EC 2NZOA 3SDZA 5IYBG 2DNCA 1S5BD 2N55A 2K04A 3PO2B 4NMZA 5IWAQ 4JG2A 1HRJA 1CHPD 4X62L 1FGBD 4HMIA 2RDFA 4A3KH 2RSNA 1BR9A 2KJXA 4NXNQ 3I4MB 2N49A 2WB1G 4A3GG 3ULLA 2JEAI 4C56C 2Z4IA 1LTSD 1VQHA 2KUMA 4DNRB 2ATWA 4DUYQ 1QVGA 2B29A 1LM0A 1P16A 1S72A 2OWOA 3OTOL 4N9PA 4B3TL 4J6HA 3L9AX 3CW2C 3MFGA 1EIYB 1TXYA 1S5ED 1LLRD 1VS0A 4JI0L 5GROA 2NVQH 1TS5A 2JEBI 5JPNC 4A3IG 3L3OC 4LMQD 1DOKA 2JA7H 3MXNB 4P73A 1HNWQ 4ZKCB 1XYIA 5LMUQ 1Q12A 1VF5C 3CCUA 5EPLA 4A3JH 1SJHD 2R7ZB 2F0QA 3KLWA 1SFOH 1Y1VG 4FF4A 3MFYA 5T1GA 2K7VA 2WAQE 2VQFQ 1F2LA 4P71A 5HY6A 4C3JG 1G91A 4FO2A 5EQ0A 1VQOA 3TRZA 1G2TA 3DWPA 4YWMA 5C3XA 3AFQA 1IBLL 5I6YA 4HIMA 1VDZA 4QY7A 2VXWA 1Q82C 4BBSH 4MIUA 4IUTA 2R3ZA 4IFDH 2L1BA 5KNBA 2VQEL 3KUPA 1BUVT 2RA4A 3K80C 5A2QL 1X32A 1C9OA 1C4QA 5DM73 1QG7A 4XQJA 3S2DH 4I7AA 1RD9D 4H13C 4IFDJ 1IBLQ 4QCLA 3GV3A 3J81L 4BA2I 1HH2P 1NAPA 3M9BA 1HJPA 5C44G 1A2UA 2B2UC 1XTCD 4KKSA 2D0PA 1NR4A 2QEXA 1HTLD 3BZCA 1TS4A 4EGVA 3OYYA 1H9MA 5CV5A 3K58A 5C3WA 4DR2L 1HA6A 2EYFA 4UAIA 3OW7A 3S24A 4JI2L 5CORA 1LTRD 1TR5A 3NENA 2Q8RE 1SNPA 3CC7A 3G7LA 1RDPD 2L11A 3H94A 1K83H 2EDGA 3SE0A 5M5XB 3S16B 4IURA 3CC4A 4OL7A 3A7AB 5ELEA 1SYCA 4CDEC 3A8KE 1VF7A 2R93G 4BWGB 4DUYL 3S1MB 3ND9A 5TSSA 1AN8A 4C3HG 3MXUA 2CWPA 3VR6A 3OHXC 5C4ZA 1LT3D 4KY5A 4FF1A 1X3PA 5K5PA 1PYBA 3UDXA 4DAVA 2N8NA 1A15A 1YHBA 3NTHA 1IHZA 4R4QA 2HCIA 3BDCA 5D14A 3HOVH 1TY2A 1YITA 1D8LA 2K4KA 2SNMA 2F4IA 5G3LF 3GTJB 2C35B 5NUCA 1IZ6A 2VZAA 3U4VA 3I4OA 1UE1A 5JJIA 4OWXB 3G6JB 1LTAD 2EYPA 4BY7B 4ULLA 4YCUA 1Q90A 2A6HC 1B7YB 2OQKA 1A3TA 3CKIB 1U4RA 1IW7D 3DXJC 4DR5Q 1CK1A 1HPCA 4DNIA 5M3MH 3FMCA 2NN6G 5M5YB 4JI7L 1X3GA 2PYKA 5CV9A 4GZYC 1K28A 2F3WA 1CKNB 1K73C 1B70B 1UE7A 2A69D 2K05A 4X66L 4POFA 5FJ8G 4Y52H 2CCZA 1PDQA 4DKAC 5I6WA 3G48A 1L1OC 1FL0A 1Y1WH 3U9OA 2NZHA 2XSCA 1WCMG 3PO3G 1B50A 1PLFA 1A6XA 2AQ2B 5GAEC 4H44C 2E2JH 2AQ3B 2L5TA 4O0AA 1PH8A 5IT9E 3A8IE 3BVMA 4ME5A 4IJHA 4JI2Q 4A3BG 4DR2Q 4ZYSA 1E1OA 1K83B 4ABNA 5BN3A 1Z6HA 2R61A 1C7YA 1EWIA 4KMUC 2HUGA 1I4XA 1MI2A 2I5HA 2OCEA 2PPBC 3J7A5 1EWCA 2R7ZH 3OPOA 1G6PA 1IKMA 1JOQA 4IN3A 3IL8A 1LACA 2HIXA 1WTRA 3N6RA 1Y1VH 5FLXE 4QIWE 4A3LH 4U673 3A74A 2VQEQ 5FK9C 4R8IA 1MKHA 4XIGS 3IFTA 3J7AV 3T1HL 3AFPA 3KBGA 1YNNC 2XRSD 4P75A 2F3IA 4J8QA 3HKZE 1EY6A 1JJGA 3Q0AA 1EIGA 2PMZB 1TWAB 1XTDA 4IFDG 2WACA 3MTSA 4DAMA 3GTOB
chains in the Genus database with same CATH topology
4MHEA 1EEID 2PCFB 5KIXA 3MA2B 5A35A 3R2TA 2Q8IB 4A93B 5M9OA 1B4OA 3CRKC 2JXMB 5CYUA 4ZUJA 4C1NI 4KY7A 2MUYA 5IGEA 2RDGA 5G3LD 5IGGA 2IL8A 2NTSA 3TMEA 5K36H 3J7AF 2NN6H 5DAUA 2CVRA 1Y8NB 4A3MB 3AMUA 1ESRA 1UEAB 2KEDA 4RHSA 1EOTA 5C0XI 1CFMA 1BXTA 1PTOH 2F0UA 1LT6D 5IOCA 2PZWA 1DJRD 3H6MA 3PUWA 3BDOA 2D62A 1YNND 4FVMA 3SK5A 4A3DB 1RCVD 2DY8A 2F0JA 3U9SA 1GOZA 1HFGA 4KN4C 1IL8A 3DUZA 2EYMA 4F8MA 5COYA 3HS0C 4NDXA 2B2VC 2AUJD 2FFKB 1GUNA 2M00A 3NWSA 2EYLA 2C9OA 1PYWD 3K5LA 4A3GB 1MGSA 2X6GA 1JOKA 4H0LC 2CW0C 1KNAA 1QNKA 5CMDA 1TT2A 3MWYW 2KEEA 1CI3M 3NHHA 4FP5D 1U4LA 4DXFA 5F2DA 2F0TA 2B63B 3BYYB 4ZK9B 2G9HD 2R92B 4IZ8A 1HFNA 1EFID 2A5HA 1T5XD 1EU4A 2Z1CA 5KRUA 4P2CB 1DONA 1I4QA 2XWBB 5E4XA 1ZYRD 3TN2A 5IGBA 3I8ZA 2K1BA 5IODA 1SDFA 2Z4HA 1PTOC 2F0DA 4KJNA 3NK9A 3HEJA 3ERQA 2R6GA 3HG9A 1F9SA 2KVMA 4F7XA 3DWAA 3EROA 3QJYA 5K36G 4CKCA 4Q0FA 1C48A 4CJ2C 1RJTA 4WRDA 5C4HA 2FJ2A 2WINB 3ZYYX 3TBIB 5C44B 2K32A 1MSHA 5C0XJ 1AEXA 3SEBA 4X3SA 3O13A 5ELCA 2HQEA 3GP7A 4CKEA 1QE6A 1EZ8A 1G8ZD 4PQXA 2H1EA 3HP3A 1O7YA 2V4DA 5LL6X 3FKIB 3L7ZC 3BS1A 3H91A 4NW2A 2JSOA 2AUKA 2MHVA 1I50B 3RD4A 1B3AA 4IALA 1J9OA 3TZUA 1GUWA 2EYJA 1STBA 2BDOA 1EEFD 1ET9A 2BCOA 3T16A 4F88A 3TP8A 3NP8A 3OMCA 5CC4A 2EJGC 3JAME 1R4QB 1D5ZC 1ENCA 1L0YB 4BY1B 5BN4A 3S1QB 1DYQA 4RFBA 3HRZC 2A6EC 2F03A 3HOVB 2N88A 1IW7C 1LO5D 1BQQT 1SMYD 4QMGA 1A3VA 1QB5D 2F3VA 4KD4A 2F0EA 1CQVA 4Z9CB 5I4DA 5CR3A 2E2DC 3CU7A 4HSPA 2DN8A 4E6IA 1KLUD 2K6AA 1E2WA 4WORA 2ICEC 4M8AA 2NWGA 3QB3A 2PW7A 3R93A 5JVH3 1OXVA 4DFAA 2EYOA 1G6ZA 3I73A 1EU3A 5M3MB 1EY8A 1R4PB 4IQZA 5I9PA 2RVLA 3IKJA 2DY7A 3VR2A 4CJ1B 5KEEA 4ILWA 4DU9A 5JJZA 5IGCA 4FXKC 2K5QA 3OWFA 4XT1B 5JPMC 2WIIB 1HQMC 5JEAJ 1FD7D 1LTID 3S9WA 4TKOB 4FNFA 1E0BA 2F0FA 3GTLB 2WKCA 4A3IB 4C1NK 3N52A 2FHTA 1ML0D 1PZID 2JYOA 1JR0D 2NVXB 2EXZA 2CQAA 5D3IB 3KLRA 1PRTF 4IFDI 4HR7B 2F0SA 4HEDA 4K5WA 5IT9L 3QOJA 1V43A 2XN9C 1LT4D 3FDTA 2JA6B 2B39A 1DOLA 2EY2A 2MP1A 3C1EA 1B2TA 4AYBB 2F0KA 1GJXA 1DXMA 1V1PA 3NQIA 1NSNS 1B1ZA 5DM63 4HTHA 2E2JB 4FF3A 3GO5A 2O2LD 2O4XA 1CM9A 3S1NB 2E76C 1I4HA 1E2VA 1F9RA 3EVQA 3FEWX 5FO7B 1Z7TA 3NBIA 2QF7A 2WB1B 1HUNA 1TWCB 3M7NA 1SYEA 2LY7A 1DOMA 2ZXPA 3P20A 1ILQA 3IFDA 3FPPA 2NTTA 4B08A 5KYIA 1JORA 2PNRC 5CV4A 3DMUA 5IIFA 1ESFA 4G7ZC 4DAPA 2A73B 2PQEA 3PV0A 2OF1A 4Y7NB 3I4LA 3X3MA 3QOLA 2XRQD 2QCPX 5EJWA 3SXHA 1WD0A 2VB3X 2KCNA 3GV6A 1ET6A 2NN6I 5ELDA 5C4XB 2B8GA 4KN7C 4RWSC 1G2SA 4A3FB 1OXSC 1SNOA 3R3OA 4IUVA 4K8IA 1EYDA 1FNVA 3Q6SA 1SNCA 4RGNA 2JP1A 1SJED 1ENFA 4M1UB 1CHQD 1H9RA 1XXGA 3SK8A 5KYLA 4RKLA 1JQYD 1QILA 2OEOA 1SYBA 3T51B 2K03A 4QF4A 1SNDA 1WCMB 3PUVA 3NPPA 2JA8B 5BN5A 4XT3B 3SK6A 5HGTA 2AWNA 3S1RB 5C5LA 4G7HC 1X3QA 5LHY1 1OXTA 3C46A 3C3LA 4BS9A 5E4WC 5E1FA 2Z8LA 2JE6I 2AWOA 4ZKBB 3S2DB 1F77A 2EPBA 4K5XA 1M8AA 4DK1A 1Q3LA 1SNMA 5KGUA 1IKLA 1JCKB 1CA5A 2BE5D 2QDBA 2OXPA 3E0JA 3TP6A 1F2MA 1EY5A 2BA0A 3D6WA 2SOBA 3C2PA 4KKUA 4ODGA 5DNFA 1R9TB 1EWHA 4DN4M 3SVMA 1SSOA 2B2YA 1YNJD 4JK1C 1STYA 5D3DA 1SBBB 1Y1WB 1CA6A 4QIWB 5C0XG 3P1HA 2X69A 5JOBA 1PZJD 4C3JB 1VMCA 3OWEB 1XWEA 2C5CA 1A3UA 2AQ1B 2JA7B 2CW0D 1AP0A 2L12A 3DEPA 1TU2B 1BCPD 1JWSD 4KD3A 3D6CA 1PTOD 3TP5A 3NQTA 1TWFB 4OHJA 4L8JA 3H3VC 3GQBA 1G291 2IX1A 2XNAC 4RCNA 3AU7A 3D4WA 3NTKA 1QJOA 5EKKA 1H9KA 1OXUA 5FOBB 1GUTA 2G9DA 2J0TD 1T5EA 1YNJC 4KV6A 2RKSA 1EIHA 4PMCA 1L0XB 2D5DA 3EA6A 2EJMA 3BVZA 3WDNA 5T1IA 3RMHA 3CHBD 1ONLA 1LT5D 4XYQA 1F2YA 4HCEA 3NE5B 1IYVA 3HOWB 1AW7A 5JAVA 5JEAH 2DNEA 3MXNA 4K6LA 2M9VA 4EVOA 4CHTB 4C3IB 1W6KA 2RQXA 1EL0A 5C6AA 1K8MA 3OSOA 3FPUB 1F2ZA 4I7ZC 1VMPA 4DAYA 1XX8A 3HOZB 2SDFA 2IT1A 3KLSX 2IWHA 3AB9A 4XYOA 1DZ1A 4HAEA 2BDNA 4DK0A 2XIWA 4PV1C 2PW5A 2LKVA 3RZDB 2LS01 2VNUD 2ZXOA 2VB2X 4KKTA 1H9SB 3DWQA 1M4VA 4U68A 1BCPF 2B2YC 2WV6D 5EKLA 4PMBA 5ELBA 2IX3A 5ISRA 5D65A 3M7GA 3I90A 3PO3B 3D31A 5E3FA 4HMJA 5EBDA 2MPMA 4OIJA 1STGA 2NB0A 3K0YA 3FRPB 1ZXTA 2PZTA 1H9SA 2TMPA 4NKLA 5C4JB 4X3UA 1V1PB 1PRTB 1MD2D 2K28A 1H9JA 5FO9B 4K2LA 3M3YB 2FMMA 2A68C 1BNZA 2ZXRA 2ENBA 4FF2A 1JWUD 1CTMA 3GTKB 1PFNA 3QIAA 2L0CA 5C3EB 2PZUA 4WFN3 4FXGC 4XDXA 4CKBA 4C3HB 3MAQA 4CJ0B 2A6HD 4G7OC 4HN7A 2MGSA 1PXUA 1MSGA 2D9UA 2X6LA 2EY6A 4A3JB 1SAPA 1LTBD 1LABA 1RKNA 4KJOA 3R8BA 1BO0A 4RCOA 2LMCB 1TY0A 1ZEQX 2BA1A 3VYTA 4OO1H 1U4MA 3NSWA 1KLGD 1RODA 4TSSA 3EJIA 2EYHA 2K01A 3I72A 4HCSA 2EE1A 4B9XA 1BCPB 3M4OB 1DD2A 1S4ZA 4O42A 4IUUA 2HDLA 3VYUA 3OOCA 2RDHA 2O5JC 3Q22A 2R93B 2IW3A 2A68D 2WP8J 1FR3A 1RF2D 1TS2A 3SHLA 2WKDA 1STHA 1DM0B 1EQVA 2I07B 3JAML 1B44D 1HHVA 2K33A 2FMCA 5JEAG 1STEA 5I2XA 4A3KB 4R9WA 3A55A 4XQNA 1PMRA 1LTTD 3I91A 5J1ZA 1W6JA 4DF7A 1FYCA 3HKZB 3PIP3 4RGOS 3WOFA 2F0OA 2E2HB 3EFXD 1CZGA 1OXXK 1JC7A 4V0BA 1DCZA 3OMGA 3HOYB 1NUCA 3BYTB 4RGMA 1GXDC 3GTGB 2E2IB 1I4GA 5CV8A 1BF4A 2OT2A 1LTGD 4IUNA 4RA8A 3LWUA 4BBSB 3QG1A 3GD7A 1U4PA 3HOUB 1O7ZA 1TKWB 3BG3A 1D5MC 1JE4A 3E6ZX 5CGKA 3HOXB 4QUFA 1GUGA 1HUMA 4K14A 1WD1A 1JICA 4ZAIA 1CT1D 1TWGB 4A3EB 1I4PA 3J7YW 4OO1G 3TDQA 5CBEE 1QNUA 1SEBD 2B2WC 3D4DA 3J81E 1Q8IA 3D8GA 3ONAB 3VR5A 1KDBA 4JBWA 1TVXA 5FO8B 3H09A 1WTXA 1EZ6A 4Q5VA 4HSVA 1V1OA 3VA7A 1PFBA 2TSSA 1U9RA 2A69C 4UDUC 3K57A 2F0PA 3RUZA 3M85A 5EPJA 2B2TA 2F0GA 1O78A 3W2DA 3FVQA 4FYDA 3PIO3 5M5WB 1LV9A 1EQTA 3ITPA 3MXGA 3PUYA 3LNNA 3K5NA 5IGFA 2L55A 1TWHB 4RKBA 2EZVA 2KHSA 1TIID 5I2YA 3SR1A 1ZKOA 3I3CA 1Z47A 5DEHA 4FXDA 3X3NA 1HQRD 3T56B 2VUMB 1JOOA 4X3KA 3A7LA 4RH6A 3Q23A 3GTQB 3VR4A 3PMFA 3MVVA 2A74C 1PRTC 1PZKD 2B2TC 1GHJA 1B9NA 3V2TA 3J80E 1F9PA 5CV7A 1SNQA 1Q1BA 2EJFC 3W3AA 4O1NA 1KTKA 3E5SA 2XVSA 1Y8PB 1KNEA 1BCPC 3ND8A 5I9OA 3URYA 4QB4A 2XWJB 2IPKD 3TZDA 4ZUIA 3NXWA 1UAPA 1I3QB 5FLXL 1HTPA 1II3A 4DGZA 1Y1VB 1I4RA 1A2TA 4DXGA 2ID0A 3HZXA 3KK7A 3F2UA 4H7BA 1AZQA 3S17B 2M2LA 5EPKA 3TP7A 1STAA 2RBMA 2ZT9C 1FNWA 1PTOF 3LX0A 3RZOB 3V05A 4BBRB 3DM1A 3BZDB 1S5FD 1STNA 3D4RA 2PO4A 3NUCA 1PRTD 5AFWA 3LWEA 2L9HA 2IJ0A 4N9TA 1Y8OB 3MHBA 3KLSA 3A54A 2F0WA 1EY4A 1O80A 3QO2A 4RHRA 1KABA 5A2QE 2EOTA 2KOLA 4CBVA 3EQLC 4K2KA 4RAUC 1BBXC 3IAYA 4KHVA 1KDAA 3MEHA 2NBFA 3K5MA 3KBXA 5EBCA 3A56A 2HDMA 1D1KA 3Q24A 1AZPA 1RHPA 4C3IG 1S5DD 2ICIA 1UUPA 4J1MA 2QEJC 4XXEA 5ELFA 2NUCA 1SE3A 1ICWA 1SYGA 4EQOA 1WTVA 2CHBD 1EYCA 3P75A 1SMYC 5HURA 1TQOA 4LAAA 2B2VA 3P7JA 4PNYA 1E2ZA 3H0GB 4B9WA 4G57A 3K59A 4OIKA 2Q8TA 1EY0A 3K6OA 5JVG3 1EYAA 2F0HA 4XTCS 3S15B 2F0VA 1KAAA 2LFNA 4KK7A 3BVGA 2E75C 1EY7A 4KY6A 2H4OA 3DEOA 5FKAC 2SNSA 2B2WA 4F87A 1I6HB 4DNTB 2WAQB 3T4AC 4IUQA 3HGBA 2KQ3A 2E74C 1SE2A 2GA4B 1EY9A 3M4YA 4X3TA 1B9MA 2EY1A 1J8IA 2NVQB 2J7ZA 2RSOA 2O5IC 1S5CD 5EGTA 3C1FA 5C5MA 3V96A 1RTOA 2Y0SB 1I6VC 1WTOA 2B2UA 2YYZA 4EQPA 5IGDA 3I4NB 4NP5A 1AFPA 1WTQA 3PUZA 2I46A 1MBYA 1K8OA 1NCVA 2EVBA 3VYSA 3T13A 1RTNA 4K8JA 1UNSA 3UI2A 4QUCA 3VYRA 4KHZA 2K5WA 2F0NA 4ZRZA 2K5DA 4DA2A 1O7LA 1GUOA 4I65A 4L6TB 1QCBD 4ID6A 3TSSA 5J39A 3NWTA 2YU9B 4L63B 4OGQC 1KDCA 3OIQA 2F1MA 3DHQA 1TS3A 1F9QA 3BDLA 5LL6S 3A8JE 2F0LA 3GTMB 2MJ8A 1HCZA 3MC0B 3WOEA 2KA7A 1V8QA 3KF8A 3D3RA 4EQNA 4MN3A 1VCIA 1D5XC 1SYDA 1B53A 3SK4A 4KTAA 2NYZD 4CGYB 1WVLA 1OO9B 2EY5A 5KNDA 1Y69U 4IUPA 2NVTB 4K6DA 4TRDA 1ZYRC 4ZLTF 3S14B 5CV6A 1IYUA 3VA5A 4XQQA 1WTPA 4PMWA 2KCCA 1CQFA 4V190 3OIPA 1ENAA 2F0IA 1HXYD 3CQZB 1C8CA 3VR3A 3NBHA 4KI0A 1JB3A 1BOSA 1BDOA 4BA1I 4S3SA 2L4NA 1PFMA 1NR2A 4WJWA 4R8NA 1SE4A 5CBAE 3MZ5A 2FINB 4C2MB 2F0MA 2BOSA 3S2HB 4LK1C 2SEBD 1ILPA 1SXTA 2QKIC 3R2IA 4G4KA 2BE5C 1D2BA 4RGTA 2J4XA 1JWMD 2B8FA 4YIJA 5J22A 3J80L 2JA5B 3I70A 2IX0A 3PUXA 1GUSA 4LJZC 4K5VA 1PTOB 3T53B 1FNUA 1WTWA 4OO1I 3GTPB 5M3FB 1CZWA 1HA5A 3K7AB 2D2CC 1QOHA 5C0XH 1D1IA 2HCCA 3K5OA 1SYFA 4ZQ3A 4TQUS 3NTIA 3RLFA 2NZ1D 1Q1EA 5EKIA 1GHKA 5KNCA 2KECA 1SFOB 2QILA 1QWYA 2A6ED 3QWNA 4A3BB 2NVYB 3MXPA 3CRLC 1D6EC 3SDZA 2DNCA 1S5BD 2N55A 2K04A 3PO2B 4NMZA 1HRJA 1CHPD 1FGBD 4HMIA 2RDFA 2RSNA 1BR9A 2KJXA 3I4MB 2JEAI 4C56C 2Z4IA 1LTSD 2KUMA 4DNRB 4N9PA 4J6HA 3L9AX 3MFGA 1S5ED 1LLRD 1TS5A 2JEBI 5JPNC 3L3OC 4LMQD 1DOKA 4ZKCB 1XYIA 1Q12A 1VF5C 5EPLA 1SJHD 2R7ZB 2F0QA 4FF4A 3MFYA 5T1GA 2K7VA 1F2LA 4C3JG 1G91A 4FO2A 5EQ0A 1G2TA 3DWPA 5C3XA 5I6YA 1VDZA 2VXWA 4MIUA 4IUTA 2R3ZA 4IFDH 2L1BA 5KNBA 3KUPA 1BUVT 2RA4A 5A2QL 1X32A 1C4QA 5DM73 1QG7A 4XQJA 1RD9D 4H13C 4IFDJ 4QCLA 3GV3A 3J81L 4BA2I 1NAPA 1A2UA 2B2UC 1XTCD 4KKSA 1NR4A 1HTLD 1TS4A 4EGVA 1H9MA 5CV5A 3K58A 5C3WA 1HA6A 2EYFA 4UAIA 3OW7A 5CORA 1LTRD 1TR5A 2Q8RE 1SNPA 3G7LA 1RDPD 2L11A 3H94A 2EDGA 3SE0A 5M5XB 3S16B 4IURA 4OL7A 3A7AB 5ELEA 1SYCA 3A8KE 1VF7A 4BWGB 3S1MB 3ND9A 5TSSA 1AN8A 4C3HG 3MXUA 3VR6A 3OHXC 5C4ZA 1LT3D 4KY5A 4FF1A 1X3PA 5K5PA 4DAVA 1A15A 3NTHA 1IHZA 2HCIA 3BDCA 5D14A 1TY2A 2SNMA 2F4IA 5G3LF 3GTJB 5NUCA 3G6JB 1LTAD 2EYPA 4BY7B 4ULLA 1Q90A 2A6HC 1A3TA 3CKIB 1U4RA 1IW7D 3DXJC 1CK1A 1HPCA 3FMCA 2NN6G 5M5YB 2PYKA 5CV9A 4GZYC 2F3WA 2A69D 2K05A 1PDQA 5I6WA 3U9OA 2XSCA 1B50A 1PLFA 1A6XA 2AQ2B 4H44C 2AQ3B 2L5TA 5IT9E 3A8IE 3BVMA 4ME5A 4ZYSA 1K83B 4ABNA 5BN3A 1Z6HA 2R61A 2HUGA 4KMUC 1I4XA 1MI2A 2PPBC 1EWCA 3OPOA 1IKMA 1JOQA 4IN3A 3IL8A 1LACA 1WTRA 3N6RA 5FLXE 4U673 5FK9C 4R8IA 4XIGS 3IFTA 3J7AV 1YNNC 2XRSD 3KBGA 4J8QA 1EY6A 3Q0AA 1EIGA 2PMZB 1TWAB 4IFDG 2WACA 3MTSA 3GTOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0F A;  1F2Z A;  2KHS A;  2SNM A;  2F0W A;  1EY4 A;  3DHQ A;  4K14 A;  5NUC A;  1EY7 A;  3BDL A;  5JOB A;  5KIX A;  4KY6 A;  5KRU A;  1SNO A;  3R3O A;  2F0L A;  3SR1 A;  2SNS A;  4YIJ A;  5M9O A;  2F0Q A;  4K8I A;  5J22 A;  3P1H A;  1EYD A;  5DEH A;  1KAB A;  2EYP A;  3EJI A;  2EXZ A;  1A3U A;  2EYH A;  4KJO A;  1A3T A;  1JOO A;  1SNC A;  4K2K A;  4ZUJ A;  2PW5 A;  4KY7 A;  3TP8 A;  4EQN A;  5IGE A;  2LKV A;  4K5V A;  4B9X A;  5IGB A;  3D4D A;  4KHV A;  5IGG A;  5IOD A;  5IGD A;  5C3X A;  1KDA A;  3MEH A;  3SK8 A;  2F0D A;  1SYD A;  2F0S A;  4KJN A;  3PMF A;  5I6Y A;  5KYL A;  3MVV A;  4KD3 A;  3TME A;  3D6C A;  4K5W A;  2PYK A;  2KQ3 A;  3NK9 A;  4QMG A;  3HEJ A;  3NQT A;  1A3V A;  3D8G A;  3ERQ A;  3QOJ A;  4KTA A;  2F3V A;  4MIU A;  3SK4 A;  5DAU A;  5CV9 A;  2F3W A;  2OEO A;  4KD4 A;  1KDB A;  1SYB A;  2EY2 A;  2F0E A;  3V2T A;  4F7X A;  1SYF A;  3ERO A;  5CV7 A;  4ZQ3 A;  1SNQ A;  2EY5 A;  4QF4 A;  1EY9 A;  3SHL A;  1SND A;  5CR3 A;  3C1E A;  3D4W A;  5EKL A;  1STH A;  5I6W A;  2EY1 A;  2F0U A;  4PMB A;  4WRD A;  1EQV A;  5C4H A;  4E6I A;  5IOC A;  5ISR A;  2F0K A;  3E5S A;  2PZW A;  5EKK A;  4J1M A;  3U9O A;  5E3F A;  3H6M A;  5EGT A;  4RKL A;  4HMJ A;  4WOR A;  3SK6 A;  4K6D A;  2NUC A;  3C1F A;  4TRD A;  5C5M A;  5HGT A;  3SK5 A;  5I9O A;  5CV6 A;  5C5L A;  1NSN S;  3QB3 A;  4QB4 A;  2F0J A;  2PW7 A;  1A2U A;  1STG A;  4HTH A;  3VA5 A;  4KV6 A;  4ZUI A;  2RKS A;  1EZ6 A;  2PZT A;  3NXW A;  4ME5 A;  1AEX A;  1SYG A;  2EYO A;  2EYM A;  3MXP A;  4DFA A;  4EQP A;  4EQO A;  4NKL A;  5J1Z A;  5CV5 A;  5E1F A;  4F8M A;  1EYC A;  3P75 A;  4DF7 A;  2EYF A;  5C3W A;  1EY8 A;  1II3 A;  4DGZ A;  5K5P A;  2HQE A;  5HUR A;  4NP5 A;  4K2L A;  4NDX A;  4PMC A;  5I9P A;  1EZ8 A;  4NMZ A;  2F0O A;  1A2T A;  2O4X A;  4K5X A;  1TQO A;  1TR5 A;  2ENB A;  1ENA A;  4LAA A;  3HZX A;  1U9R A;  2F0I A;  1SNM A;  5CGK A;  5KEE A;  2M00 A;  5KGU A;  1SNP A;  2EYL A;  4DU9 A;  2F0P A;  4H7B A;  4HMI A;  2RDF A;  3RUZ A;  1JOQ A;  2QDB A;  2OXP A;  4PNY A;  3EVQ A;  3TP6 A;  1F2M A;  5IGC A;  1F2Y A;  1EY5 A;  3TP7 A;  1STA A;  2RBM A;  3OWF A;  2F0G A;  3OMG A;  1JOK A;  2PZU A;  2SOB A;  4K8J A;  3T13 A;  5JAV A;  3LX0 A;  1NUC A;  4S3S A;  4IAL A;  1SYE A;  4OL7 A;  1TT2 A;  1SYC A;  5CV8 A;  2EYJ A;  5KYI A;  4B9W A;  1JOR A;  4G57 A;  4ODG A;  4R8N A;  4IUN A;  1STB A;  1STN A;  4EVO A;  3NHH A;  3ITP A;  3MZ5 A;  2F0N A;  3NUC A;  4N9P A;  5CV4 A;  3DMU A;  4J6H A;  3T16 A;  5IIF A;  5F2D A;  1EY0 A;  5C4Z A;  2EY6 A;  2PQE A;  4KY5 A;  1EY6 A;  1EYA A;  2F0T A;  2F0M A;  2OF1 A;  2F0H A;  3NP8 A;  3OMC A;  4I65 A;  4ID6 A;  3TP5 A;  1STY A;  3QOL A;  5C6A A;  3SXH A;  5CC4 A;  4N9T A;  5IGF A;  5J39 A;  3MHB A;  3S9W A;  3OSO A;  1RKN A;  1IHZ A;  2F0V A;  1KAA A;  1KDC A;  4IZ8 A;  2WAC A;  4RKB A;  3BDC A;  1ENC A; 
#chains in the Genus database with same CATH topology
 4MHE A;  1EEI D;  2PCF B;  3PO2 G;  5KIX A;  2VL6 A;  3MA2 B;  5A35 A;  1X65 A;  3R2T A;  2Q8I B;  4A93 B;  4R4O A;  5M9O A;  1B4O A;  3CRK C;  2JXM B;  5CYU A;  4ZUJ A;  4C1N I;  4KY7 A;  2MUY A;  1BBU A;  5IGE A;  2RDG A;  5G3L D;  1AH9 A;  3EN2 A;  3RLN A;  1IBK Q;  5IGG A;  4LFC Q;  3M4P A;  1YIJ A;  2RCN A;  2IL8 A;  2MNA A;  2K50 A;  3J80 c;  2NTS A;  3TME A;  2MQH A;  5K36 H;  3J7A F;  2NN6 H;  5DAU A;  5IYD G;  2CVR A;  5IY0 A;  1Y8N B;  1VQ9 A;  4A3M B;  3AMU A;  1ESR A;  1UEA B;  2KED A;  4RHS A;  1EOT A;  1FJG Q;  5C0X I;  1CFM A;  1BXT A;  1PTO H;  2F0U A;  4LUV A;  1LT6 D;  5IOC A;  4GOP A;  5FJ8 H;  2PZW A;  1DJR D;  3H6M A;  3S2H H;  4YY3 L;  2WFW A;  3BDO A;  3PUW A;  2D62 A;  1YNN D;  1Y1W G;  2QDL A;  4FVM A;  3SK5 A;  2JA8 G;  4A3D B;  1RCV D;  2DY8 A;  2QA4 A;  1LYL A;  2F0J A;  1GOZ A;  1HFG A;  4L5Q A;  4KN4 C;  3STB D;  2QGQ A;  3U9S A;  1IL8 A;  5FLM G;  3DUZ A;  3ULJ A;  2EYM A;  4X64 Q;  1HZ9 A;  1VQ8 A;  1TWC H;  4F8M A;  5COY A;  3HS0 C;  4LF7 Q;  4NDX A;  2B2V C;  4A3F G;  2AUJ D;  4KLK A;  2FFK B;  2Y0S E;  1GUN A;  4IPH A;  2F4V L;  1S40 A;  2M00 A;  3NWS A;  1QVF A;  2EYL A;  3TEH B;  2C9O A;  1PYW D;  3K5L A;  3CCR A;  4A3G B;  1MGS A;  5M5W H;  2X6G A;  1JOK A;  4H0L C;  2CW0 C;  1KNA A;  1N9W A;  1QNK A;  5CMD A;  1TT2 A;  3H3V H;  3S15 H;  3MWY W;  1VQM A;  2H5X A;  2KEE A;  4QGU A;  1CI3 M;  3NHH A;  4FP5 D;  4HJ9 A;  1U4L A;  4POG A;  4DXF A;  5F2D A;  2F0T A;  1Q81 C;  2JA9 A;  2B63 B;  3BYY B;  4L5S A;  4LF5 Q;  4JV5 L;  4ZK9 B;  2G9H D;  2R92 B;  4IZ8 A;  4JI5 L;  4DAY B;  2KBN A;  2RHS B;  2PI2 A;  1HFN A;  5C4X G;  1EFI D;  2A5H A;  3HOX G;  1T5X D;  1EU4 A;  2Z1C A;  5KRU A;  4P2C B;  1DON A;  1I4Q A;  2XWB B;  5E4X A;  1L1O B;  1ZYR D;  3TN2 A;  5IGB A;  3I8Z A;  2K1B A;  3A5U A;  3U58 A;  1E1T A;  5IOD A;  1SDF A;  2Z4H A;  1PTO C;  3GDE A;  1J5E Q;  2F0D A;  4KJN A;  1I5F A;  1KHI A;  1VQB A;  3NK9 A;  5IP7 G;  3HEJ A;  3ERQ A;  1YHQ A;  2R6G A;  1P8L A;  3HG9 A;  4APV A;  1F9S A;  2KVM A;  4F7X A;  3DWA A;  3ERO A;  3QJY A;  5K36 G;  4CKC A;  2K14 A;  4Q0F A;  1C48 A;  4CJ2 C;  5LMN L;  1RJT A;  2R7D A;  4WRD A;  5C4H A;  2FJ2 A;  2WIN B;  5GAD C;  3ZYY X;  3TBI B;  5C44 B;  3RLO A;  2K32 A;  1MSH A;  5C0X J;  1AEX A;  5C44 H;  3G6E A;  3SEB A;  4X3S A;  3O13 A;  4LWC A;  5ELC A;  3GTG H;  2HQE A;  3GP7 A;  4CKE A;  2JA5 G;  1QE6 A;  1EZ8 A;  1G8Z D;  4PQX A;  4JI6 Q;  2D0O A;  2H1E A;  3HP3 A;  1O7Y A;  5LMN W;  3FKI G;  2V4D A;  5LL6 X;  3FKI B;  3L7Z C;  3BS1 A;  3H91 A;  4A3E H;  1SR3 A;  4NW2 A;  2JSO A;  2AUK A;  2CFM A;  1I50 B;  2MHV A;  3RD4 A;  3HOY G;  4GLA C;  1B3A A;  4IAL A;  1KRS A;  1J9O A;  3K7U C;  3TZU A;  1GUW A;  2YU9 H;  1NNX A;  2EYJ A;  1STB A;  2BDO A;  1EEF D;  4R4C A;  1J6Q A;  1ET9 A;  1KAW A;  3SGI A;  2BCO A;  3T16 A;  4GOP B;  4F88 A;  3TP8 A;  3NP8 A;  3OMC A;  1MJC A;  5AJ3 Q;  5CC4 A;  1BVS A;  2EJG C;  1X54 A;  3JAM E;  1GM5 A;  1R4Q B;  1D5Z C;  2PI2 E;  1K3R A;  3UDG A;  1ENC A;  1L0Y B;  1YVC A;  4OON A;  4A3K G;  4BY1 B;  1KXL A;  5BN4 A;  2RCF A;  4LNQ A;  2A1A A;  3S1Q B;  4YCV A;  1DYQ A;  4RFB A;  3HRZ C;  5IP9 G;  2UUA L;  4YWL A;  2BH8 A;  2A6E C;  2F03 A;  3HOV B;  2N88 A;  3OW2 A;  1K0S A;  1IW7 C;  4KHP Q;  1LO5 D;  1BQQ T;  4DR6 L;  1SMY D;  2KHJ A;  4QMG A;  3T1Y L;  1A3V A;  4BBR G;  4LF4 Q;  1QB5 D;  2F3V A;  4JI4 L;  4KD4 A;  1PVO A;  3CF5 A;  2F0E A;  4LF6 L;  1CQV A;  2YTY A;  4Z9C B;  2JA6 G;  4ME3 A;  5I4D A;  5CR3 A;  2E2D C;  3CU7 A;  4HSP A;  2DN8 A;  4E6I A;  1KLU D;  2LXJ A;  2K6A A;  2VW9 A;  2UXD Q;  1E2W A;  4WOR A;  2ICE C;  4M8A A;  2NWG A;  5GQO A;  3QB3 A;  3CXC A;  2PW7 A;  3R93 A;  5JVH 3;  3I4N G;  1OXV A;  2MO1 A;  1B8A A;  2EYO A;  4DFA A;  1G6Z A;  4GLX A;  1IL2 A;  3I73 A;  1EU3 A;  4IPG A;  1EY8 A;  5M3M B;  4LFB Q;  1R4P B;  4IQZ A;  5I9P A;  2RVL A;  1JT8 A;  3IKJ A;  2UXC Q;  2DY7 A;  3VR2 A;  1BKB A;  3AYH B;  4DR4 Q;  4CJ1 B;  5KEE A;  1JJC B;  1L1O A;  2JA5 H;  3HKZ G;  4ILW A;  4DU9 A;  4DV2 L;  4PZ6 A;  4IPD A;  5JJZ A;  5IGC A;  4FXK C;  2K5Q A;  3OWF A;  4XT1 B;  1KIX A;  4A3M G;  1QZG A;  5JPM C;  3JC6 6;  1MHW C;  1W2B A;  3RZD H;  2WII B;  1I6H H;  1HQM C;  4GOP C;  5JEA J;  1FD7 D;  1LTI D;  4DR7 Q;  3S9W A;  3ER0 A;  4DV0 L;  4TKO B;  1SE8 A;  4FNF A;  1E0B A;  2F0F A;  2VQF L;  3GTL B;  2WKC A;  1CKN A;  4A3I B;  4C1N K;  4K0K Q;  4O2D A;  5LMU L;  3N52 A;  2FHT A;  5DLQ E;  1ML0 D;  1PZI D;  2JYO A;  1JR0 D;  2NVX B;  3FHW A;  2EXZ A;  1LTL A;  2CQA A;  4NXM Q;  1A62 A;  5D3I B;  3KDF B;  1PH3 A;  2ZM6 Q;  4B3M Q;  4B3R L;  3KLR A;  1PRT F;  2CWA A;  4IFD I;  1N34 Q;  4HR7 B;  2F0S A;  4HED A;  4K5W A;  5IT9 L;  3QOJ A;  1V43 A;  2XN9 C;  1LT4 D;  3FDT A;  1N36 Q;  2JA6 B;  2B39 A;  1DOL A;  1XJV A;  4GN4 B;  2EY2 A;  3BZK A;  1GD7 A;  2MP1 A;  3C1E A;  3GTO H;  4MNO A;  4DR3 Q;  1B2T A;  4JI4 Q;  4AYB B;  2F0K A;  1GJX A;  1DXM A;  3T1Y Q;  2GVB A;  4NXN L;  5BR8 Q;  3PQI A;  1V1P A;  2ZM6 L;  3GTK H;  3NQI A;  1NSN S;  1B1Z A;  5DM6 3;  4HTH A;  2E2J B;  4A76 A;  4FF3 A;  2JA8 H;  3GO5 A;  4BXX H;  4DK6 C;  3I4N H;  5FLM H;  2O2L D;  4DV1 L;  2O4X A;  3G71 A;  1CM9 A;  3S1N B;  1YZ6 A;  2E76 C;  1I4H A;  3J81 j;  2AMC B;  1E2V A;  4LFA L;  1F9R A;  2CH4 A;  4J15 A;  3KF8 B;  1JMC A;  3EVQ A;  3FEW X;  1WOC A;  5FO7 B;  1Z7T A;  2IHE A;  2QF7 A;  2WB1 B;  3NBI A;  1TWC B;  3M7N A;  1SYE A;  1HUN A;  3P20 A;  2LY7 A;  1DOM A;  2ZXP A;  1ILQ A;  3IFD A;  3FPP A;  2NTT A;  3BU2 A;  4B08 A;  5KYI A;  4A3M H;  1JOR A;  5IP9 H;  4QJF A;  2PNR C;  4YCW A;  5CV4 A;  1YBY A;  4A3B H;  3DMU A;  5IIF A;  1ESF A;  4G7Z C;  4DAP A;  2A73 B;  2K5H A;  2PQE A;  3PV0 A;  2OF1 A;  4Y7N B;  3I4L A;  3X3M A;  3QOL A;  2XRQ D;  2QCP X;  5EJW A;  3SXH A;  1WD0 A;  2VB3 X;  2KCN A;  4BBS G;  3GV6 A;  1ET6 A;  2NN6 I;  1YNX A;  5ELD A;  5C4X B;  2B8G A;  4KN7 C;  4B3S Q;  4RWS C;  1G2S A;  4A3F B;  1OXS C;  4JI6 L;  2A8V A;  1SNO A;  3R3O A;  4IUV A;  1WTH A;  4K8I A;  1EYD A;  1FNV A;  3Q6S A;  4A3C H;  1SNC A;  4RGN A;  2JP1 A;  1SJE D;  1EYG A;  1I94 L;  5JJL A;  1ENF A;  3CAM A;  4M1U B;  1CHQ D;  1H9R A;  1XXG A;  3SK8 A;  5KYL A;  2E8G A;  4RKL A;  1ASZ A;  1JQY D;  1QIL A;  2EQS A;  3KOJ A;  4YWK A;  2OEO A;  4GKK Q;  1SYB A;  3T51 B;  5C3E G;  2K03 A;  4QF4 A;  1SND A;  4LF4 L;  1WCM B;  1GVP A;  3PUV A;  3NPP A;  2JA8 B;  4A3D G;  1PH1 A;  5M5X H;  5BN5 A;  4XT3 B;  3SK6 A;  1Q46 A;  5HGT A;  2AWN A;  3S1R B;  1PH9 A;  5C5L A;  4G7H C;  1X3Q A;  5LHY 1;  1OXT A;  1HZC A;  3CCS A;  3C46 A;  1PH6 A;  3C3L A;  4DR4 L;  4DV3 L;  4BS9 A;  5E4W C;  5E1F A;  4A93 G;  1I3Q H;  2Z8L A;  2JE6 I;  1EOV A;  2AWO A;  4ZKB B;  3S2D B;  5IYD H;  1F77 A;  2EPB A;  1PH4 A;  4K5X A;  1HNZ Q;  1M8A A;  4DK1 A;  3CMA A;  1Q3L A;  1SNM A;  5KGU A;  4BY7 H;  1IKL A;  1JCK B;  4N8X 1;  4HID A;  1CA5 A;  3HOV G;  5J3B A;  2BE5 D;  2QDB A;  2OXP A;  3E0J A;  4P72 A;  4JI5 Q;  3TP6 A;  1F2M A;  4DV5 Q;  1EY5 A;  3F2D A;  2BA0 A;  3D6W A;  2SOB A;  3CME A;  1D7Q A;  3C2P A;  4KKU A;  4HJ5 A;  1KQS A;  4ODG A;  5DNF A;  1R9T B;  1CUK A;  1EWH A;  4HJ8 A;  4DN4 M;  3SVM A;  1SSO A;  3KFU A;  1VQG A;  2B2Y A;  1YNJ D;  2Z9H A;  1STY A;  4JK1 C;  1SBB B;  4OEL B;  5D3D A;  1Y1W B;  1CA6 A;  2E5L L;  2LSS A;  1YHA A;  4QIW B;  5C0X G;  3P1H A;  4NXM L;  5IE8 A;  2X69 A;  2K75 A;  2AHO B;  5JOB A;  2DJF C;  3EIV A;  4OX9 L;  1PZJ D;  4LF8 Q;  4C3J B;  1VMC A;  3OWE B;  4DV6 L;  1XWE A;  2C5C A;  5M3F H;  1PFS A;  1A3U A;  1B3Q A;  2AQ1 B;  2JA7 B;  2CW0 D;  1AP0 A;  1Q86 C;  1N33 L;  2L12 A;  1FVI A;  3DEP A;  1TU2 B;  2DGY A;  1BCP D;  1K3B C;  1JWS D;  4KD3 A;  4YY3 Q;  3D6C A;  1PTO D;  3TP5 A;  3NQT A;  1XNR Q;  1TWF B;  4OHJ A;  4DR3 L;  4L8J A;  3H3V C;  3GQB A;  4GKK L;  1G29 1;  2IX1 A;  2XNA C;  4RCN A;  3AU7 A;  3D4W A;  4H02 A;  4CDD C;  3NTK A;  1JE5 A;  1QJO A;  5EKK A;  4A3G H;  1H9K A;  1OXU A;  5FOB B;  1GUT A;  2G9D A;  2J0T D;  1IBM Q;  1E7Z A;  1T5E A;  3S1Q H;  4PZ8 A;  4A3D H;  1R9T H;  2R92 G;  1YNJ C;  4KV6 A;  2UXC L;  2RKS A;  1EIH A;  1HNX L;  4PMC A;  1SRU A;  1L0X B;  1WFQ A;  2D5D A;  3EA6 A;  4X65 Q;  2EJM A;  3BVZ A;  3WDN A;  5T1I A;  3RMH A;  3CHB D;  1VQP A;  1ONL A;  3CD6 A;  1AE2 A;  2MFI A;  1LT5 D;  4XYQ A;  4P74 A;  3HFZ B;  4WJ3 M;  2PQA A;  4DV0 Q;  1F2Y A;  4HCE A;  1SRO A;  3NE5 B;  3UDI A;  3M3Y H;  1IYV A;  3HOW B;  1AW7 A;  5JAV A;  5JEA H;  2Q2T A;  4DR7 L;  1SN8 A;  2DNE A;  4IPC A;  1VQ4 A;  3M4O H;  3MXN A;  4JYA L;  3UE0 A;  1E24 A;  4K6L A;  1ASY A;  1CSQ A;  2M9V A;  4EVO A;  4CHT B;  3CPW A;  4GNX B;  4C3I B;  3GTM H;  1QVC A;  5IYB H;  2R93 H;  4PG3 A;  1W6K A;  2RQX A;  1TWF H;  1EL0 A;  5C6A A;  1HR0 Q;  1K8M A;  1PV4 A;  2EXD A;  1PH7 A;  3OSO A;  1VQC A;  1WI5 A;  2Z6B A;  3FPU B;  3F1Z A;  1Q7Y C;  3HOU G;  5ELO A;  1PHJ A;  1F2Z A;  4I7Z C;  1VMP A;  4DAY A;  1XX8 A;  3HOZ B;  1V9P A;  2SDF A;  2IT1 A;  3KLS X;  2WB1 E;  3AB9 A;  2IWH A;  4XYO A;  1DZ1 A;  1EUJ A;  4LFB L;  4HAE A;  4OWT B;  2BDN A;  4DK0 A;  2XIW A;  4PV1 C;  2PW5 A;  2LKV A;  3J81 i;  3RZD B;  1IXR A;  2CKZ B;  3E9H A;  1LUZ A;  2LS0 1;  4JBK A;  3IRB A;  2VNU D;  2ZXO A;  2VB2 X;  4KKT A;  1H9S B;  4GKJ L;  3DWQ A;  4A3F H;  1YJW A;  1M4V A;  4YHH Q;  1XNQ L;  4U68 A;  1M90 C;  1BCP F;  2B2Y C;  2WV6 D;  1A8V A;  5EKL A;  3QR8 A;  4PMB A;  5ELB A;  2IX3 A;  4JI1 Q;  5D65 A;  5ISR A;  5JJK A;  1X55 A;  3M7G A;  3I90 A;  3PO3 B;  3D31 A;  5E3F A;  4HMJ A;  4JI8 Q;  5EBD A;  3A5Z B;  1VQL A;  2MPM A;  4OIJ A;  4C2M H;  1STG A;  2NB0 A;  3K0Y A;  3FRP B;  1KRT A;  1ZXT A;  2PZT A;  3CCV A;  2Y0S G;  1H9S A;  2TMP A;  5M5Y H;  4NKL A;  1V1P B;  4X3U A;  1PRT B;  2K28 A;  1MD2 D;  5C4J B;  4LF9 L;  1H9J A;  2FXQ A;  5FO9 B;  4K2L A;  3M3Y B;  3KF6 B;  2FMM A;  2A68 C;  1BNZ A;  3HKS A;  4BXX G;  2ZXR A;  2ENB A;  4X64 L;  4FF2 A;  1X3E A;  1JWU D;  2JA6 H;  1CTM A;  2Q2H A;  3GTK B;  1VQD A;  1PFN A;  4JBM A;  3QIA A;  3NEL A;  2L0C A;  4UPA A;  3GTJ H;  5C3E B;  2PZU A;  4WFN 3;  4FXG C;  4XDX A;  4DR1 Q;  1VQI A;  4CKB A;  3S16 H;  4C3H B;  3MAQ A;  4CJ0 B;  2A6H D;  3PGZ A;  4QQB X;  3BJU A;  4G7O C;  2DUD A;  1V1Q A;  4EQ5 A;  4HN7 A;  5L37 A;  2MGS A;  4AQY Q;  1PXU A;  1MSG A;  2D9U A;  2X6L A;  4GKJ Q;  2EY6 A;  4A3I H;  1S3O A;  3HOX H;  4A3J B;  1EQQ A;  1SAP A;  1LTB D;  3S1M H;  1U0L A;  1RL2 A;  1LAB A;  2HIV A;  1RKN A;  4KJO A;  3R8B A;  2BH2 A;  1BO0 A;  4RCO A;  1HR0 W;  2LMC B;  1TY0 A;  1ZEQ X;  2BA1 A;  4NPS A;  3VYT A;  4OO1 H;  3JAM c;  1U4M A;  3NSW A;  1KLG D;  1ROD A;  4TSS A;  1PH5 A;  1T9H A;  3EJI A;  2EYH A;  2K01 A;  3I72 A;  4HCS A;  3STB C;  2EE1 A;  4B9X A;  1Q8K A;  2R92 H;  1L0W A;  1BCP B;  3M4O B;  1DD2 A;  1S4Z A;  4O42 A;  4IUU A;  2HDL A;  3MEF A;  3VYU A;  3OOC A;  1HR0 L;  2RDH A;  2O5J C;  2GVA A;  3Q22 A;  1CSP A;  2R93 B;  3TS2 A;  2IW3 A;  5LMN Q;  2A68 D;  2WP8 J;  3FKI H;  1FR3 A;  3U4Z A;  1RF2 D;  1TS2 A;  5ELN A;  3SHL A;  2WKD A;  4CDF C;  4JYA Q;  2K52 A;  3PF4 A;  1STH A;  1DGS A;  5C3E H;  1DM0 B;  1EQV A;  2I07 B;  2KEN A;  3JAM L;  4JI7 Q;  1B44 D;  3CCE A;  1HHV A;  1JB7 A;  2K33 A;  2FMC A;  5JEA G;  1STE A;  5I2X A;  4A3K B;  4R9W A;  3A55 A;  2B63 G;  5M3M G;  2ZJQ A;  4XQN A;  1PMR A;  4DV1 Q;  1LTT D;  3I91 A;  2GN5 A;  5J1Z A;  1W6J A;  4DF7 A;  1SLJ A;  3HOZ G;  1FYC A;  3HKZ B;  4BY7 G;  3PIP 3;  4RGO S;  3WOF A;  2F0O A;  3VDY A;  2E2H B;  1G51 A;  3EFX D;  1CZG A;  2Z6K C;  1OXX K;  2E5L Q;  1UE5 A;  1JC7 A;  3U50 C;  4HIO A;  1IBM L;  4V0B A;  3G4S A;  1DCZ A;  3OMG A;  2HT1 A;  3E9I A;  4MTK A;  3HOY B;  1NUC A;  1WCM H;  3BYT B;  4GN5 A;  4LUZ A;  1GXD C;  4RGM A;  3GTG B;  5GAG C;  2E2I B;  1I4G A;  5CV8 A;  4B3T Q;  1BF4 A;  2OT2 A;  1LTG D;  4IUN A;  1N36 L;  4RA8 A;  3LWU A;  4BBS B;  1KL9 A;  3QG1 A;  3GD7 A;  1U4P A;  3HOU B;  2HD3 A;  1O7Z A;  4DR1 L;  1TKW B;  3BG3 A;  2YTV A;  3Q8D A;  1IBK L;  1D5M C;  4LUO A;  1JE4 A;  2B3G A;  3E6Z X;  4L5T A;  5CGK A;  4ALP A;  4QUF A;  3HOX B;  2IHF A;  1GUG A;  1HUM A;  4LW1 A;  2F4V Q;  4K14 A;  1WD1 A;  3M4Q A;  1JIC A;  3I4M H;  4ZAI A;  1CT1 D;  1TWG B;  4A3E B;  1I4P A;  3J7Y W;  4OO1 G;  1CKO A;  4LF9 Q;  3TDQ A;  5CBE E;  1X9N A;  1QNU A;  1SEB D;  2B2W C;  1HZB A;  3RZO H;  3D4D A;  5GAH C;  3J80 i;  3J81 E;  1NBW A;  1Q8I A;  5BR8 L;  2UU9 L;  3D8G A;  2G5D A;  4HJ7 A;  3ONA B;  3VR5 A;  4A75 A;  1KDB A;  3ICE A;  3PO2 H;  1YJ9 A;  4JBW A;  2ES2 A;  2K5N A;  1TVX A;  3DLL A;  1FGU A;  5FO8 B;  4DV5 L;  4C3J H;  3PCO B;  4LFC L;  3H09 A;  2I0Q A;  1WTX A;  4IOA A;  4X65 L;  3S1R H;  1EZ6 A;  4Q5V A;  3K7A H;  4HSV A;  1AE3 A;  1V1O A;  4IOC A;  3GTL H;  3H0G H;  3VA7 A;  4MTN A;  1PFB A;  4GNX C;  2R7Z G;  2XTI A;  2TSS A;  4JOI C;  1U9R A;  2A69 C;  4UDU C;  3K57 A;  2OTJ A;  4JPB W;  2F0P A;  2AKW B;  4JV5 Q;  3RUZ A;  3M85 A;  3UE1 A;  1ICF B;  2UXD L;  3S14 H;  4AYB E;  1N8R C;  5EPJ A;  2B2T A;  2F0G A;  1O78 A;  3W2D A;  3FVQ A;  2I5L X;  4FYD A;  3PIO 3;  5M5W B;  1LV9 A;  1EQT A;  3ITP A;  3MXG A;  5IYC G;  1XPU A;  3PUY A;  5FLX c;  4KHP L;  3LNN A;  3K5N A;  5IGF A;  2NVT H;  3KYH C;  1N33 Q;  2L55 A;  1TWH B;  4RKB A;  2EZV A;  1QZH A;  2KHS A;  1TII D;  5I2Y A;  4DV6 Q;  3SR1 A;  1ZKO A;  3I3C A;  2P5Z X;  1Z47 A;  2QW7 A;  1HNX Q;  5DEH A;  4FXD A;  1TWG H;  3X3N A;  1HQR D;  3T56 B;  1A63 A;  2HHH Q;  3F2C A;  1JOO A;  2VUM B;  1X3F A;  4X3K A;  3AEV A;  3A7L A;  2Q2I A;  4JI8 L;  4RH6 A;  3RN5 A;  3Q23 A;  2YTX A;  3GTQ B;  3VR4 A;  3PMF A;  3MVV A;  2UXB Q;  2OTL A;  2N3S A;  2A74 C;  4NB3 A;  1PRT C;  1XNQ Q;  1PZK D;  3WWV A;  2B2T C;  3J81 c;  3CC2 A;  3TQY A;  1GHJ A;  1B9N A;  3V2T A;  1GKH A;  3J80 E;  1F9P A;  5CV7 A;  3RNU A;  1SNQ A;  1Q1B A;  1EFW A;  4BY1 H;  2EJF C;  2RF4 A;  2ZJP A;  1QUQ B;  2JQO A;  3W3A A;  3LGJ A;  2E2I H;  2YV5 A;  4O1N A;  1KTK A;  3E5S A;  2XVS A;  1Y8P B;  1KNE A;  1BCP C;  1I50 H;  3ND8 A;  4GNX A;  1VQJ A;  5I9O A;  3URY A;  4QB4 A;  2XWJ B;  1HNZ L;  2IPK D;  3TZD A;  4ZUI A;  4LFA Q;  1X6O A;  3NXW A;  1UAP A;  1K8A C;  1I3Q B;  5IWA L;  5FLX L;  1HTP A;  1II3 A;  4DGZ A;  1Y1V B;  1TWA H;  2K5V A;  5IP7 H;  4LF7 L;  1I4R A;  1A2T A;  4DXG A;  4JW0 A;  2ID0 A;  3HZX A;  3KK7 A;  3F2U A;  4H7B A;  1AZQ A;  2UUC Q;  2JA7 G;  3S17 B;  2M2L A;  5EPK A;  3TP7 A;  3I4M G;  1STA A;  2RBM A;  2ZT9 C;  5AJ3 L;  1FNW A;  4OWW B;  1PTO F;  1EQR A;  3LX0 A;  1YI2 A;  5C4J H;  3T1H Q;  3V05 A;  3W1B A;  3CPF A;  3RZO B;  4BBR B;  4DV4 L;  4MZ9 A;  3HOW H;  3DM1 A;  2ZJR A;  3BZD B;  1S5F D;  1WJJ A;  4GS3 A;  1STN A;  3D4R A;  3I7F A;  1VQ5 A;  2PO4 A;  1W3S A;  3NUC A;  4ZCK A;  1PRT D;  2KHI A;  5H1S E;  1XMQ Q;  5AFW A;  3LWE A;  3KJP A;  2L9H A;  2IJ0 A;  4N9T A;  1Y8O B;  3MHB A;  3W5O A;  3KLS A;  4A3E G;  1CKM A;  3A54 A;  1TWH H;  1EY4 A;  2F0W A;  1O80 A;  3TS0 A;  4DK3 C;  3QO2 A;  1GO3 E;  4RHR A;  2PNH A;  2RHQ B;  1HNW L;  4N8F A;  1KAB A;  5A2Q E;  4B3S L;  2EOT A;  2KOL A;  3S1N H;  4CBV A;  3EQL C;  4K2K A;  2E2H H;  4RAU C;  2HQL A;  1VQN A;  1NY4 A;  1BBX C;  3ZJY C;  4DUZ Q;  3IAY A;  4KHV A;  4UP9 A;  1KDA A;  3MEH A;  2NBF A;  3H0G G;  3K5M A;  4A93 H;  2F52 A;  2R7F A;  4AQY L;  2NVX H;  3KBX A;  2UUB L;  5EBC A;  3A56 A;  2HDM A;  1XMO Q;  2DJG C;  1D1K A;  3D0F A;  3Q24 A;  4JI3 Q;  3E0E A;  1AZP A;  1XNR L;  1RHP A;  2ZTC A;  4C3I G;  1S5D D;  4UHV A;  2ICI A;  4RMF A;  1UUP A;  4J1M A;  2QEJ C;  2B63 H;  4XXE A;  5ELF A;  3S17 H;  2NUC A;  1PYS B;  1SE3 A;  1I94 Q;  2UUC L;  4X62 Q;  1ICW A;  5HGQ A;  1SYG A;  5IYC H;  4EQO A;  1WTV A;  4LF8 L;  2CHB D;  1EYC A;  3P75 A;  4DPG A;  1SMY C;  5HUR A;  2ALY B;  4L5R C;  2IY5 B;  4JOI A;  4HJA A;  1TQO A;  4LAA A;  4UP8 A;  3I56 A;  2VY3 A;  1N32 L;  2B2V A;  3P7J A;  4PNY A;  1K8G A;  4A4I A;  4LF5 L;  4JI1 L;  4UP7 A;  1PA6 A;  4GLV B;  1YJN A;  3L0O A;  1E2Z A;  3H0G B;  4YHH L;  4B9W A;  4G57 A;  3K59 A;  4OIK A;  4X66 Q;  4IO9 A;  2Q8T A;  3CP0 A;  1EY0 A;  3K6O A;  5JVG 3;  1EYA A;  3PF5 A;  2F0H A;  1L2F A;  4B3M L;  4DR6 Q;  4XTC S;  3S15 B;  2F0V A;  1KAA A;  2LFN A;  4KK7 A;  3NEM A;  4DV7 Q;  3BVG A;  4BY1 G;  2E75 C;  1EY7 A;  2HHH L;  1N32 Q;  4KY6 A;  1O7I A;  2H4O A;  3ULP A;  3DEO A;  5FKA C;  2SNS A;  2B2W A;  1QUQ A;  4F87 A;  1I6H B;  4DNT B;  3FP9 A;  3PO3 H;  2I5M X;  1UE6 A;  2VUM G;  1VQ6 A;  2KCT A;  2WAQ B;  3T4A C;  4IUQ A;  4BBR H;  4OEM B;  3HGB A;  2JK8 A;  2KQ3 A;  3CQZ H;  2N78 A;  2JJQ A;  3DM3 A;  3PIO A;  2E74 C;  1SE2 A;  2GA4 B;  1FJG L;  1E3P A;  1EY9 A;  3M4Y A;  5C4X H;  4X3T A;  1B9M A;  2EY1 A;  1J8I A;  3TRE A;  2NVQ B;  1NE3 A;  2UUB Q;  2J7Z A;  2RSO A;  1S5C D;  5EGT A;  2O5I C;  3C1F A;  3K81 C;  5C5M A;  3V96 A;  1RTO A;  4AYB G;  2Y0S B;  3A0J A;  1I6V C;  1U5K A;  2XGT A;  1WTO A;  2B2U A;  2YYZ A;  4EQP A;  1Y14 B;  5IGD A;  4JBJ A;  1X56 A;  2Q2U A;  4NP5 A;  3I4N B;  1HZA A;  2Z6K A;  1KC8 C;  4K0K L;  4DV7 L;  1SMX A;  5EAY A;  3HOU H;  4R4I A;  1AFP A;  1WTQ A;  3PUZ A;  3RN2 A;  2I46 A;  1MBY A;  1VQA A;  1K8O A;  4EX5 A;  3KF6 A;  1NCV A;  2EVB A;  3VYS A;  4K8J A;  1RTN A;  1IYJ B;  3T13 A;  1UNS A;  3GTQ H;  3UI2 A;  2VS1 A;  4QUC A;  1NMF A;  1XPR A;  3VYR A;  3NBH B;  4LF6 Q;  1XMQ L;  4KHZ A;  4A3C G;  2K5W A;  1Z9F A;  2F0N A;  4ZRZ A;  4HIK A;  1C0A A;  2K5D A;  3PIP A;  4DA2 A;  1O7L A;  3HOZ H;  1GUO A;  4L6T B;  4I65 A;  4IJL A;  1QCB D;  2UU9 Q;  1JJ2 A;  4ID6 A;  3TSS A;  5J39 A;  3NWT A;  2CH4 W;  4L63 B;  2YU9 B;  4OGQ C;  1KDC A;  3OIQ A;  3CCL A;  2F1M A;  3DHQ A;  1TS3 A;  1F9Q A;  1XPO A;  3BDL A;  1K9M C;  2A19 A;  3PSI A;  5LL6 S;  1M1K C;  3A8J E;  4OX9 Q;  2F0L A;  4C3I H;  3GTM B;  2MJ8 A;  1HCZ A;  2MO0 A;  3MC0 B;  3WOE A;  2KA7 A;  1V8Q A;  3KF8 A;  3K0X A;  3KDF A;  2PMZ E;  3D3R A;  3F2B A;  3UDF A;  4EQN A;  4MN3 A;  2CQO A;  1VCI A;  1KD1 C;  4JVZ A;  4Y7N H;  1D5X C;  2VUM H;  1SYD A;  4JI0 Q;  1A0I A;  1BBW A;  1B53 A;  1PH2 A;  3SK4 A;  4KTA A;  1VQF A;  4R4T A;  2NYZ D;  4AH6 A;  1YEZ A;  3B6Y A;  1UEB A;  4CGY B;  3OTO Q;  1WVL A;  1OO9 B;  1K0R A;  1UWV A;  2EY5 A;  2JN4 A;  4OXP A;  5KND A;  3L2P A;  1Y69 U;  4A3J G;  1OTC A;  3W1G A;  4R1J A;  2OQ0 A;  4IUP A;  1N34 L;  2NVT B;  2UXB L;  4B3R Q;  4K6D A;  3I55 A;  4TRD A;  1ZYR C;  2NVY H;  4ZLT F;  3S14 B;  5CV6 A;  1IYU A;  3VA5 A;  4XQQ A;  3F8T A;  1WTP A;  4JC0 A;  4JCV E;  1NTG A;  3K8A A;  4PMW A;  2KCC A;  4X6A H;  1CQF A;  4V19 0;  4DV3 Q;  5IT9 c;  3OIP A;  1ENA A;  2F0I A;  1MIU A;  1NJI C;  1EIF A;  3CCM A;  1HXY D;  3CQZ B;  1C8C A;  3VR3 A;  3NBH A;  4KI0 A;  1JB3 A;  1BOS A;  3HOW G;  1BDO A;  4BA1 I;  1VQK A;  4S3S A;  2L4N A;  3CCQ A;  4QL5 A;  1PFM A;  5M3F G;  1NR2 A;  5E7N A;  1VQE A;  4WJW A;  4R8N A;  1SE4 A;  4JI3 L;  5CBA E;  1XMO L;  3MZ5 A;  1RIP A;  2FIN B;  4A3L G;  4C2M B;  1WYD A;  4CDC C;  1H95 A;  2Z0S A;  2F0M A;  3CCJ A;  1NMG A;  2BOS A;  3S2H B;  4PZ7 A;  2ASB A;  4LK1 C;  4DV2 Q;  2SEB D;  1ILP A;  1SXT A;  2QKI C;  3R2I A;  4DUZ L;  4G4K A;  2BE5 C;  1D2B A;  4RGT A;  4WJ4 A;  2J4X A;  1JWM D;  2ZTE A;  3AQQ A;  2B8F A;  3H3V I;  3I2Z A;  1E22 A;  4YIJ A;  5J22 A;  3J80 L;  2JA5 B;  3I70 A;  2IX0 A;  3GTP H;  3PUX A;  1GUS A;  4LJZ C;  4AIM A;  4C3H H;  4K5V A;  1PTO B;  3T53 B;  1FNU A;  1WTW A;  1MJE A;  3JAM i;  4OO1 I;  3GTP B;  5M3F B;  3RR5 A;  1CZW A;  1HA5 A;  3K7A B;  3KJO A;  2ZTD A;  2WAQ G;  2D2C C;  3E3X A;  1QOH A;  5C0X H;  1D1I A;  2PQA B;  2EIF A;  2HCC A;  3K5O A;  4RG1 A;  2LXK A;  2V1C C;  1SYF A;  4ZQ3 A;  4TQU S;  4GN3 B;  3NTI A;  4FDB A;  4DV4 Q;  3EBE A;  3H15 A;  3RLF A;  3ERS X;  2KCM A;  2NZ1 D;  3HOY H;  1Q1E A;  5EKI A;  3J7Z C;  5KNC A;  2KEC A;  4DR5 L;  1SFO B;  2QIL A;  1J5E L;  2UUA Q;  1GHK A;  1QWY A;  2A6E D;  3QWN A;  4A3B B;  4TVA B;  2NVY B;  2L15 A;  4UY8 C;  1VQ7 A;  3MXP A;  3CRL C;  1D6E C;  2NZO A;  3SDZ A;  5IYB G;  2DNC A;  1S5B D;  2N55 A;  2K04 A;  3PO2 B;  4NMZ A;  5IWA Q;  4JG2 A;  1HRJ A;  1CHP D;  4X62 L;  1FGB D;  4HMI A;  2RDF A;  4A3K H;  2RSN A;  1BR9 A;  2KJX A;  4NXN Q;  3I4M B;  2N49 A;  2WB1 G;  4A3G G;  3ULL A;  2JEA I;  4C56 C;  2Z4I A;  1LTS D;  1VQH A;  2KUM A;  4DNR B;  2ATW A;  4DUY Q;  1QVG A;  2B29 A;  1LM0 A;  1P16 A;  1S72 A;  2OWO A;  3OTO L;  4N9P A;  4B3T L;  4J6H A;  3L9A X;  3CW2 C;  3MFG A;  1EIY B;  1TXY A;  1S5E D;  1LLR D;  1VS0 A;  4JI0 L;  5GRO A;  2NVQ H;  1TS5 A;  2JEB I;  5JPN C;  4A3I G;  3L3O C;  4LMQ D;  1DOK A;  2JA7 H;  3MXN B;  4P73 A;  1HNW Q;  4ZKC B;  1XYI A;  5LMU Q;  1Q12 A;  1VF5 C;  3CCU A;  5EPL A;  4A3J H;  1SJH D;  2R7Z B;  2F0Q A;  3KLW A;  1SFO H;  1Y1V G;  4FF4 A;  3MFY A;  5T1G A;  2K7V A;  2WAQ E;  2VQF Q;  1F2L A;  4P71 A;  5HY6 A;  4C3J G;  1G91 A;  4FO2 A;  5EQ0 A;  1VQO A;  3TRZ A;  1G2T A;  3DWP A;  4YWM A;  5C3X A;  3AFQ A;  1IBL L;  5I6Y A;  4HIM A;  1VDZ A;  4QY7 A;  2VXW A;  1Q82 C;  4BBS H;  4MIU A;  4IUT A;  2R3Z A;  4IFD H;  2L1B A;  5KNB A;  2VQE L;  3KUP A;  1BUV T;  2RA4 A;  3K80 C;  5A2Q L;  1X32 A;  1C9O A;  1C4Q A;  5DM7 3;  1QG7 A;  4XQJ A;  3S2D H;  4I7A A;  1RD9 D;  4H13 C;  4IFD J;  1IBL Q;  4QCL A;  3GV3 A;  3J81 L;  4BA2 I;  1HH2 P;  1NAP A;  3M9B A;  1HJP A;  5C44 G;  1A2U A;  2B2U C;  1XTC D;  4KKS A;  2D0P A;  1NR4 A;  2QEX A;  1HTL D;  3BZC A;  1TS4 A;  4EGV A;  3OYY A;  1H9M A;  5CV5 A;  3K58 A;  5C3W A;  4DR2 L;  1HA6 A;  2EYF A;  4UAI A;  3OW7 A;  3S24 A;  4JI2 L;  5COR A;  1LTR D;  1TR5 A;  3NEN A;  2Q8R E;  1SNP A;  3CC7 A;  3G7L A;  1RDP D;  2L11 A;  3H94 A;  1K83 H;  2EDG A;  3SE0 A;  5M5X B;  3S16 B;  4IUR A;  3CC4 A;  4OL7 A;  3A7A B;  5ELE A;  1SYC A;  4CDE C;  3A8K E;  1VF7 A;  2R93 G;  4BWG B;  4DUY L;  3S1M B;  3ND9 A;  5TSS A;  1AN8 A;  4C3H G;  3MXU A;  2CWP A;  3VR6 A;  3OHX C;  5C4Z A;  1LT3 D;  4KY5 A;  4FF1 A;  1X3P A;  5K5P A;  1PYB A;  3UDX A;  4DAV A;  2N8N A;  1A15 A;  1YHB A;  3NTH A;  1IHZ A;  4R4Q A;  2HCI A;  3BDC A;  5D14 A;  3HOV H;  1TY2 A;  1YIT A;  1D8L A;  2K4K A;  2SNM A;  2F4I A;  5G3L F;  3GTJ B;  2C35 B;  5NUC A;  1IZ6 A;  2VZA A;  3U4V A;  3I4O A;  1UE1 A;  5JJI A;  4OWX B;  3G6J B;  1LTA D;  2EYP A;  4BY7 B;  4ULL A;  4YCU A;  1Q90 A;  2A6H C;  1B7Y B;  2OQK A;  1A3T A;  3CKI B;  1U4R A;  1IW7 D;  3DXJ C;  4DR5 Q;  1CK1 A;  1HPC A;  4DNI A;  5M3M H;  3FMC A;  2NN6 G;  5M5Y B;  4JI7 L;  1X3G A;  2PYK A;  5CV9 A;  4GZY C;  1K28 A;  2F3W A;  1CKN B;  1K73 C;  1B70 B;  1UE7 A;  2A69 D;  2K05 A;  4X66 L;  4POF A;  5FJ8 G;  4Y52 H;  2CCZ A;  1PDQ A;  4DKA C;  5I6W A;  3G48 A;  1L1O C;  1FL0 A;  1Y1W H;  3U9O A;  2NZH A;  2XSC A;  1WCM G;  3PO3 G;  1B50 A;  1PLF A;  1A6X A;  2AQ2 B;  5GAE C;  4H44 C;  2E2J H;  2AQ3 B;  2L5T A;  4O0A A;  1PH8 A;  5IT9 E;  3A8I E;  3BVM A;  4ME5 A;  4IJH A;  4JI2 Q;  4A3B G;  4DR2 Q;  4ZYS A;  1E1O A;  1K83 B;  4ABN A;  5BN3 A;  1Z6H A;  2R61 A;  1C7Y A;  1EWI A;  4KMU C;  2HUG A;  1I4X A;  1MI2 A;  2I5H A;  2OCE A;  2PPB C;  3J7A 5;  1EWC A;  2R7Z H;  3OPO A;  1G6P A;  1IKM A;  1JOQ A;  4IN3 A;  3IL8 A;  1LAC A;  2HIX A;  1WTR A;  3N6R A;  1Y1V H;  5FLX E;  4QIW E;  4A3L H;  4U67 3;  3A74 A;  2VQE Q;  5FK9 C;  4R8I A;  1MKH A;  4XIG S;  3IFT A;  3J7A V;  3T1H L;  3AFP A;  3KBG A;  1YNN C;  2XRS D;  4P75 A;  2F3I A;  4J8Q A;  3HKZ E;  1EY6 A;  1JJG A;  3Q0A A;  1EIG A;  2PMZ B;  1TWA B;  1XTD A;  4IFD G;  2WAC A;  3MTS A;  4DAM A;  3GTO B; 
#chains in the Genus database with same CATH homology
 4MHE A;  1EEI D;  2PCF B;  5KIX A;  3MA2 B;  5A35 A;  3R2T A;  2Q8I B;  4A93 B;  5M9O A;  1B4O A;  3CRK C;  2JXM B;  5CYU A;  4ZUJ A;  4C1N I;  4KY7 A;  2MUY A;  5IGE A;  2RDG A;  5G3L D;  5IGG A;  2IL8 A;  2NTS A;  3TME A;  5K36 H;  3J7A F;  2NN6 H;  5DAU A;  2CVR A;  1Y8N B;  4A3M B;  3AMU A;  1ESR A;  1UEA B;  2KED A;  4RHS A;  1EOT A;  5C0X I;  1CFM A;  1BXT A;  1PTO H;  2F0U A;  1LT6 D;  5IOC A;  2PZW A;  1DJR D;  3H6M A;  3PUW A;  3BDO A;  2D62 A;  1YNN D;  4FVM A;  3SK5 A;  4A3D B;  1RCV D;  2DY8 A;  2F0J A;  3U9S A;  1GOZ A;  1HFG A;  4KN4 C;  1IL8 A;  3DUZ A;  2EYM A;  4F8M A;  5COY A;  3HS0 C;  4NDX A;  2B2V C;  2AUJ D;  2FFK B;  1GUN A;  2M00 A;  3NWS A;  2EYL A;  2C9O A;  1PYW D;  3K5L A;  4A3G B;  1MGS A;  2X6G A;  1JOK A;  4H0L C;  2CW0 C;  1KNA A;  1QNK A;  5CMD A;  1TT2 A;  3MWY W;  2KEE A;  1CI3 M;  3NHH A;  4FP5 D;  1U4L A;  4DXF A;  5F2D A;  2F0T A;  2B63 B;  3BYY B;  4ZK9 B;  2G9H D;  2R92 B;  4IZ8 A;  1HFN A;  1EFI D;  2A5H A;  1T5X D;  1EU4 A;  2Z1C A;  5KRU A;  4P2C B;  1DON A;  1I4Q A;  2XWB B;  5E4X A;  1ZYR D;  3TN2 A;  5IGB A;  3I8Z A;  2K1B A;  5IOD A;  1SDF A;  2Z4H A;  1PTO C;  2F0D A;  4KJN A;  3NK9 A;  3HEJ A;  3ERQ A;  2R6G A;  3HG9 A;  1F9S A;  2KVM A;  4F7X A;  3DWA A;  3ERO A;  3QJY A;  5K36 G;  4CKC A;  4Q0F A;  1C48 A;  4CJ2 C;  1RJT A;  4WRD A;  5C4H A;  2FJ2 A;  2WIN B;  3ZYY X;  3TBI B;  5C44 B;  2K32 A;  1MSH A;  5C0X J;  1AEX A;  3SEB A;  4X3S A;  3O13 A;  5ELC A;  2HQE A;  3GP7 A;  4CKE A;  1QE6 A;  1EZ8 A;  1G8Z D;  4PQX A;  2H1E A;  3HP3 A;  1O7Y A;  2V4D A;  5LL6 X;  3FKI B;  3L7Z C;  3BS1 A;  3H91 A;  4NW2 A;  2JSO A;  2AUK A;  2MHV A;  1I50 B;  3RD4 A;  1B3A A;  4IAL A;  1J9O A;  3TZU A;  1GUW A;  2EYJ A;  1STB A;  2BDO A;  1EEF D;  1ET9 A;  2BCO A;  3T16 A;  4F88 A;  3TP8 A;  3NP8 A;  3OMC A;  5CC4 A;  2EJG C;  3JAM E;  1R4Q B;  1D5Z C;  1ENC A;  1L0Y B;  4BY1 B;  5BN4 A;  3S1Q B;  1DYQ A;  4RFB A;  3HRZ C;  2A6E C;  2F03 A;  3HOV B;  2N88 A;  1IW7 C;  1LO5 D;  1BQQ T;  1SMY D;  4QMG A;  1A3V A;  1QB5 D;  2F3V A;  4KD4 A;  2F0E A;  1CQV A;  4Z9C B;  5I4D A;  5CR3 A;  2E2D C;  3CU7 A;  4HSP A;  2DN8 A;  4E6I A;  1KLU D;  2K6A A;  1E2W A;  4WOR A;  2ICE C;  4M8A A;  2NWG A;  3QB3 A;  2PW7 A;  3R93 A;  5JVH 3;  1OXV A;  4DFA A;  2EYO A;  1G6Z A;  3I73 A;  1EU3 A;  5M3M B;  1EY8 A;  1R4P B;  4IQZ A;  5I9P A;  2RVL A;  3IKJ A;  2DY7 A;  3VR2 A;  4CJ1 B;  5KEE A;  4ILW A;  4DU9 A;  5JJZ A;  5IGC A;  4FXK C;  2K5Q A;  3OWF A;  4XT1 B;  5JPM C;  2WII B;  1HQM C;  5JEA J;  1FD7 D;  1LTI D;  3S9W A;  4TKO B;  4FNF A;  1E0B A;  2F0F A;  3GTL B;  2WKC A;  4A3I B;  4C1N K;  3N52 A;  2FHT A;  1ML0 D;  1PZI D;  2JYO A;  1JR0 D;  2NVX B;  2EXZ A;  2CQA A;  5D3I B;  3KLR A;  1PRT F;  4IFD I;  4HR7 B;  2F0S A;  4HED A;  4K5W A;  5IT9 L;  3QOJ A;  1V43 A;  2XN9 C;  1LT4 D;  3FDT A;  2JA6 B;  2B39 A;  1DOL A;  2EY2 A;  2MP1 A;  3C1E A;  1B2T A;  4AYB B;  2F0K A;  1GJX A;  1DXM A;  1V1P A;  3NQI A;  1NSN S;  1B1Z A;  5DM6 3;  4HTH A;  2E2J B;  4FF3 A;  3GO5 A;  2O2L D;  2O4X A;  1CM9 A;  3S1N B;  2E76 C;  1I4H A;  1E2V A;  1F9R A;  3EVQ A;  3FEW X;  5FO7 B;  1Z7T A;  3NBI A;  2QF7 A;  2WB1 B;  1HUN A;  1TWC B;  3M7N A;  1SYE A;  2LY7 A;  1DOM A;  2ZXP A;  3P20 A;  1ILQ A;  3IFD A;  3FPP A;  2NTT A;  4B08 A;  5KYI A;  1JOR A;  2PNR C;  5CV4 A;  3DMU A;  5IIF A;  1ESF A;  4G7Z C;  4DAP A;  2A73 B;  2PQE A;  3PV0 A;  2OF1 A;  4Y7N B;  3I4L A;  3X3M A;  3QOL A;  2XRQ D;  2QCP X;  5EJW A;  3SXH A;  1WD0 A;  2VB3 X;  2KCN A;  3GV6 A;  1ET6 A;  2NN6 I;  5ELD A;  5C4X B;  2B8G A;  4KN7 C;  4RWS C;  1G2S A;  4A3F B;  1OXS C;  1SNO A;  3R3O A;  4IUV A;  4K8I A;  1EYD A;  1FNV A;  3Q6S A;  1SNC A;  4RGN A;  2JP1 A;  1SJE D;  1ENF A;  4M1U B;  1CHQ D;  1H9R A;  1XXG A;  3SK8 A;  5KYL A;  4RKL A;  1JQY D;  1QIL A;  2OEO A;  1SYB A;  3T51 B;  2K03 A;  4QF4 A;  1SND A;  1WCM B;  3PUV A;  3NPP A;  2JA8 B;  5BN5 A;  4XT3 B;  3SK6 A;  5HGT A;  2AWN A;  3S1R B;  5C5L A;  4G7H C;  1X3Q A;  5LHY 1;  1OXT A;  3C46 A;  3C3L A;  4BS9 A;  5E4W C;  5E1F A;  2Z8L A;  2JE6 I;  2AWO A;  4ZKB B;  3S2D B;  1F77 A;  2EPB A;  4K5X A;  1M8A A;  4DK1 A;  1Q3L A;  1SNM A;  5KGU A;  1IKL A;  1JCK B;  1CA5 A;  2BE5 D;  2QDB A;  2OXP A;  3E0J A;  3TP6 A;  1F2M A;  1EY5 A;  2BA0 A;  3D6W A;  2SOB A;  3C2P A;  4KKU A;  4ODG A;  5DNF A;  1R9T B;  1EWH A;  4DN4 M;  3SVM A;  1SSO A;  2B2Y A;  1YNJ D;  4JK1 C;  1STY A;  5D3D A;  1SBB B;  1Y1W B;  1CA6 A;  4QIW B;  5C0X G;  3P1H A;  2X69 A;  5JOB A;  1PZJ D;  4C3J B;  1VMC A;  3OWE B;  1XWE A;  2C5C A;  1A3U A;  2AQ1 B;  2JA7 B;  2CW0 D;  1AP0 A;  2L12 A;  3DEP A;  1TU2 B;  1BCP D;  1JWS D;  4KD3 A;  3D6C A;  1PTO D;  3TP5 A;  3NQT A;  1TWF B;  4OHJ A;  4L8J A;  3H3V C;  3GQB A;  1G29 1;  2IX1 A;  2XNA C;  4RCN A;  3AU7 A;  3D4W A;  3NTK A;  1QJO A;  5EKK A;  1H9K A;  1OXU A;  5FOB B;  1GUT A;  2G9D A;  2J0T D;  1T5E A;  1YNJ C;  4KV6 A;  2RKS A;  1EIH A;  4PMC A;  1L0X B;  2D5D A;  3EA6 A;  2EJM A;  3BVZ A;  3WDN A;  5T1I A;  3RMH A;  3CHB D;  1ONL A;  1LT5 D;  4XYQ A;  1F2Y A;  4HCE A;  3NE5 B;  1IYV A;  3HOW B;  1AW7 A;  5JAV A;  5JEA H;  2DNE A;  3MXN A;  4K6L A;  2M9V A;  4EVO A;  4CHT B;  4C3I B;  1W6K A;  2RQX A;  1EL0 A;  5C6A A;  1K8M A;  3OSO A;  3FPU B;  1F2Z A;  4I7Z C;  1VMP A;  4DAY A;  1XX8 A;  3HOZ B;  2SDF A;  2IT1 A;  3KLS X;  2IWH A;  3AB9 A;  4XYO A;  1DZ1 A;  4HAE A;  2BDN A;  4DK0 A;  2XIW A;  4PV1 C;  2PW5 A;  2LKV A;  3RZD B;  2LS0 1;  2VNU D;  2ZXO A;  2VB2 X;  4KKT A;  1H9S B;  3DWQ A;  1M4V A;  4U68 A;  1BCP F;  2B2Y C;  2WV6 D;  5EKL A;  4PMB A;  5ELB A;  2IX3 A;  5ISR A;  5D65 A;  3M7G A;  3I90 A;  3PO3 B;  3D31 A;  5E3F A;  4HMJ A;  5EBD A;  2MPM A;  4OIJ A;  1STG A;  2NB0 A;  3K0Y A;  3FRP B;  1ZXT A;  2PZT A;  1H9S A;  2TMP A;  4NKL A;  5C4J B;  4X3U A;  1V1P B;  1PRT B;  1MD2 D;  2K28 A;  1H9J A;  5FO9 B;  4K2L A;  3M3Y B;  2FMM A;  2A68 C;  1BNZ A;  2ZXR A;  2ENB A;  4FF2 A;  1JWU D;  1CTM A;  3GTK B;  1PFN A;  3QIA A;  2L0C A;  5C3E B;  2PZU A;  4WFN 3;  4FXG C;  4XDX A;  4CKB A;  4C3H B;  3MAQ A;  4CJ0 B;  2A6H D;  4G7O C;  4HN7 A;  2MGS A;  1PXU A;  1MSG A;  2D9U A;  2X6L A;  2EY6 A;  4A3J B;  1SAP A;  1LTB D;  1LAB A;  1RKN A;  4KJO A;  3R8B A;  1BO0 A;  4RCO A;  2LMC B;  1TY0 A;  1ZEQ X;  2BA1 A;  3VYT A;  4OO1 H;  1U4M A;  3NSW A;  1KLG D;  1ROD A;  4TSS A;  3EJI A;  2EYH A;  2K01 A;  3I72 A;  4HCS A;  2EE1 A;  4B9X A;  1BCP B;  3M4O B;  1DD2 A;  1S4Z A;  4O42 A;  4IUU A;  2HDL A;  3VYU A;  3OOC A;  2RDH A;  2O5J C;  3Q22 A;  2R93 B;  2IW3 A;  2A68 D;  2WP8 J;  1FR3 A;  1RF2 D;  1TS2 A;  3SHL A;  2WKD A;  1STH A;  1DM0 B;  1EQV A;  2I07 B;  3JAM L;  1B44 D;  1HHV A;  2K33 A;  2FMC A;  5JEA G;  1STE A;  5I2X A;  4A3K B;  4R9W A;  3A55 A;  4XQN A;  1PMR A;  1LTT D;  3I91 A;  5J1Z A;  1W6J A;  4DF7 A;  1FYC A;  3HKZ B;  3PIP 3;  4RGO S;  3WOF A;  2F0O A;  2E2H B;  3EFX D;  1CZG A;  1OXX K;  1JC7 A;  4V0B A;  1DCZ A;  3OMG A;  3HOY B;  1NUC A;  3BYT B;  4RGM A;  1GXD C;  3GTG B;  2E2I B;  1I4G A;  5CV8 A;  1BF4 A;  2OT2 A;  1LTG D;  4IUN A;  4RA8 A;  3LWU A;  4BBS B;  3QG1 A;  3GD7 A;  1U4P A;  3HOU B;  1O7Z A;  1TKW B;  3BG3 A;  1D5M C;  1JE4 A;  3E6Z X;  5CGK A;  3HOX B;  4QUF A;  1GUG A;  1HUM A;  4K14 A;  1WD1 A;  1JIC A;  4ZAI A;  1CT1 D;  1TWG B;  4A3E B;  1I4P A;  3J7Y W;  4OO1 G;  3TDQ A;  5CBE E;  1QNU A;  1SEB D;  2B2W C;  3D4D A;  3J81 E;  1Q8I A;  3D8G A;  3ONA B;  3VR5 A;  1KDB A;  4JBW A;  1TVX A;  5FO8 B;  3H09 A;  1WTX A;  1EZ6 A;  4Q5V A;  4HSV A;  1V1O A;  3VA7 A;  1PFB A;  2TSS A;  1U9R A;  2A69 C;  4UDU C;  3K57 A;  2F0P A;  3RUZ A;  3M85 A;  5EPJ A;  2B2T A;  2F0G A;  1O78 A;  3W2D A;  3FVQ A;  4FYD A;  3PIO 3;  5M5W B;  1LV9 A;  1EQT A;  3ITP A;  3MXG A;  3PUY A;  3LNN A;  3K5N A;  5IGF A;  2L55 A;  1TWH B;  4RKB A;  2EZV A;  2KHS A;  1TII D;  5I2Y A;  3SR1 A;  1ZKO A;  3I3C A;  1Z47 A;  5DEH A;  4FXD A;  3X3N A;  1HQR D;  3T56 B;  2VUM B;  1JOO A;  4X3K A;  3A7L A;  4RH6 A;  3Q23 A;  3GTQ B;  3VR4 A;  3PMF A;  3MVV A;  2A74 C;  1PRT C;  1PZK D;  2B2T C;  1GHJ A;  1B9N A;  3V2T A;  3J80 E;  1F9P A;  5CV7 A;  1SNQ A;  1Q1B A;  2EJF C;  3W3A A;  4O1N A;  1KTK A;  3E5S A;  2XVS A;  1Y8P B;  1KNE A;  1BCP C;  3ND8 A;  5I9O A;  3URY A;  4QB4 A;  2XWJ B;  2IPK D;  3TZD A;  4ZUI A;  3NXW A;  1UAP A;  1I3Q B;  5FLX L;  1HTP A;  1II3 A;  4DGZ A;  1Y1V B;  1I4R A;  1A2T A;  4DXG A;  2ID0 A;  3HZX A;  3KK7 A;  3F2U A;  4H7B A;  1AZQ A;  3S17 B;  2M2L A;  5EPK A;  3TP7 A;  1STA A;  2RBM A;  2ZT9 C;  1FNW A;  1PTO F;  3LX0 A;  3RZO B;  3V05 A;  4BBR B;  3DM1 A;  3BZD B;  1S5F D;  1STN A;  3D4R A;  2PO4 A;  3NUC A;  1PRT D;  5AFW A;  3LWE A;  2L9H A;  2IJ0 A;  4N9T A;  1Y8O B;  3MHB A;  3KLS A;  3A54 A;  2F0W A;  1EY4 A;  1O80 A;  3QO2 A;  4RHR A;  1KAB A;  5A2Q E;  2EOT A;  2KOL A;  4CBV A;  3EQL C;  4K2K A;  4RAU C;  1BBX C;  3IAY A;  4KHV A;  1KDA A;  3MEH A;  2NBF A;  3K5M A;  3KBX A;  5EBC A;  3A56 A;  2HDM A;  1D1K A;  3Q24 A;  1AZP A;  1RHP A;  4C3I G;  1S5D D;  2ICI A;  1UUP A;  4J1M A;  2QEJ C;  4XXE A;  5ELF A;  2NUC A;  1SE3 A;  1ICW A;  1SYG A;  4EQO A;  1WTV A;  2CHB D;  1EYC A;  3P75 A;  1SMY C;  5HUR A;  1TQO A;  4LAA A;  2B2V A;  3P7J A;  4PNY A;  1E2Z A;  3H0G B;  4B9W A;  4G57 A;  3K59 A;  4OIK A;  2Q8T A;  1EY0 A;  3K6O A;  5JVG 3;  1EYA A;  2F0H A;  4XTC S;  3S15 B;  2F0V A;  1KAA A;  2LFN A;  4KK7 A;  3BVG A;  2E75 C;  1EY7 A;  4KY6 A;  2H4O A;  3DEO A;  5FKA C;  2SNS A;  2B2W A;  4F87 A;  1I6H B;  4DNT B;  2WAQ B;  3T4A C;  4IUQ A;  3HGB A;  2KQ3 A;  2E74 C;  1SE2 A;  2GA4 B;  1EY9 A;  3M4Y A;  4X3T A;  1B9M A;  2EY1 A;  1J8I A;  2NVQ B;  2J7Z A;  2RSO A;  2O5I C;  1S5C D;  5EGT A;  3C1F A;  5C5M A;  3V96 A;  1RTO A;  2Y0S B;  1I6V C;  1WTO A;  2B2U A;  2YYZ A;  4EQP A;  5IGD A;  3I4N B;  4NP5 A;  1AFP A;  1WTQ A;  3PUZ A;  2I46 A;  1MBY A;  1K8O A;  1NCV A;  2EVB A;  3VYS A;  3T13 A;  1RTN A;  4K8J A;  1UNS A;  3UI2 A;  4QUC A;  3VYR A;  4KHZ A;  2K5W A;  2F0N A;  4ZRZ A;  2K5D A;  4DA2 A;  1O7L A;  1GUO A;  4I65 A;  4L6T B;  1QCB D;  4ID6 A;  3TSS A;  5J39 A;  3NWT A;  2YU9 B;  4L63 B;  4OGQ C;  1KDC A;  3OIQ A;  2F1M A;  3DHQ A;  1TS3 A;  1F9Q A;  3BDL A;  5LL6 S;  3A8J E;  2F0L A;  3GTM B;  2MJ8 A;  1HCZ A;  3MC0 B;  3WOE A;  2KA7 A;  1V8Q A;  3KF8 A;  3D3R A;  4EQN A;  4MN3 A;  1VCI A;  1D5X C;  1SYD A;  1B53 A;  3SK4 A;  4KTA A;  2NYZ D;  4CGY B;  1WVL A;  1OO9 B;  2EY5 A;  5KND A;  1Y69 U;  4IUP A;  2NVT B;  4K6D A;  4TRD A;  1ZYR C;  4ZLT F;  3S14 B;  5CV6 A;  1IYU A;  3VA5 A;  4XQQ A;  1WTP A;  4PMW A;  2KCC A;  1CQF A;  4V19 0;  3OIP A;  1ENA A;  2F0I A;  1HXY D;  3CQZ B;  1C8C A;  3VR3 A;  3NBH A;  4KI0 A;  1JB3 A;  1BOS A;  1BDO A;  4BA1 I;  4S3S A;  2L4N A;  1PFM A;  1NR2 A;  4WJW A;  4R8N A;  1SE4 A;  5CBA E;  3MZ5 A;  2FIN B;  4C2M B;  2F0M A;  2BOS A;  3S2H B;  4LK1 C;  2SEB D;  1ILP A;  1SXT A;  2QKI C;  3R2I A;  4G4K A;  2BE5 C;  1D2B A;  4RGT A;  2J4X A;  1JWM D;  2B8F A;  4YIJ A;  5J22 A;  3J80 L;  2JA5 B;  3I70 A;  2IX0 A;  3PUX A;  1GUS A;  4LJZ C;  4K5V A;  1PTO B;  3T53 B;  1FNU A;  1WTW A;  4OO1 I;  3GTP B;  5M3F B;  1CZW A;  1HA5 A;  3K7A B;  2D2C C;  1QOH A;  5C0X H;  1D1I A;  2HCC A;  3K5O A;  1SYF A;  4ZQ3 A;  4TQU S;  3NTI A;  3RLF A;  2NZ1 D;  1Q1E A;  5EKI A;  1GHK A;  5KNC A;  2KEC A;  1SFO B;  2QIL A;  1QWY A;  2A6E D;  3QWN A;  4A3B B;  2NVY B;  3MXP A;  3CRL C;  1D6E C;  3SDZ A;  2DNC A;  1S5B D;  2N55 A;  2K04 A;  3PO2 B;  4NMZ A;  1HRJ A;  1CHP D;  1FGB D;  4HMI A;  2RDF A;  2RSN A;  1BR9 A;  2KJX A;  3I4M B;  2JEA I;  4C56 C;  2Z4I A;  1LTS D;  2KUM A;  4DNR B;  4N9P A;  4J6H A;  3L9A X;  3MFG A;  1S5E D;  1LLR D;  1TS5 A;  2JEB I;  5JPN C;  3L3O C;  4LMQ D;  1DOK A;  4ZKC B;  1XYI A;  1Q12 A;  1VF5 C;  5EPL A;  1SJH D;  2R7Z B;  2F0Q A;  4FF4 A;  3MFY A;  5T1G A;  2K7V A;  1F2L A;  4C3J G;  1G91 A;  4FO2 A;  5EQ0 A;  1G2T A;  3DWP A;  5C3X A;  5I6Y A;  1VDZ A;  2VXW A;  4MIU A;  4IUT A;  2R3Z A;  4IFD H;  2L1B A;  5KNB A;  3KUP A;  1BUV T;  2RA4 A;  5A2Q L;  1X32 A;  1C4Q A;  5DM7 3;  1QG7 A;  4XQJ A;  1RD9 D;  4H13 C;  4IFD J;  4QCL A;  3GV3 A;  3J81 L;  4BA2 I;  1NAP A;  1A2U A;  2B2U C;  1XTC D;  4KKS A;  1NR4 A;  1HTL D;  1TS4 A;  4EGV A;  1H9M A;  5CV5 A;  3K58 A;  5C3W A;  1HA6 A;  2EYF A;  4UAI A;  3OW7 A;  5COR A;  1LTR D;  1TR5 A;  2Q8R E;  1SNP A;  3G7L A;  1RDP D;  2L11 A;  3H94 A;  2EDG A;  3SE0 A;  5M5X B;  3S16 B;  4IUR A;  4OL7 A;  3A7A B;  5ELE A;  1SYC A;  3A8K E;  1VF7 A;  4BWG B;  3S1M B;  3ND9 A;  5TSS A;  1AN8 A;  4C3H G;  3MXU A;  3VR6 A;  3OHX C;  5C4Z A;  1LT3 D;  4KY5 A;  4FF1 A;  1X3P A;  5K5P A;  4DAV A;  1A15 A;  3NTH A;  1IHZ A;  2HCI A;  3BDC A;  5D14 A;  1TY2 A;  2SNM A;  2F4I A;  5G3L F;  3GTJ B;  5NUC A;  3G6J B;  1LTA D;  2EYP A;  4BY7 B;  4ULL A;  1Q90 A;  2A6H C;  1A3T A;  3CKI B;  1U4R A;  1IW7 D;  3DXJ C;  1CK1 A;  1HPC A;  3FMC A;  2NN6 G;  5M5Y B;  2PYK A;  5CV9 A;  4GZY C;  2F3W A;  2A69 D;  2K05 A;  1PDQ A;  5I6W A;  3U9O A;  2XSC A;  1B50 A;  1PLF A;  1A6X A;  2AQ2 B;  4H44 C;  2AQ3 B;  2L5T A;  5IT9 E;  3A8I E;  3BVM A;  4ME5 A;  4ZYS A;  1K83 B;  4ABN A;  5BN3 A;  1Z6H A;  2R61 A;  2HUG A;  4KMU C;  1I4X A;  1MI2 A;  2PPB C;  1EWC A;  3OPO A;  1IKM A;  1JOQ A;  4IN3 A;  3IL8 A;  1LAC A;  1WTR A;  3N6R A;  5FLX E;  4U67 3;  5FK9 C;  4R8I A;  4XIG S;  3IFT A;  3J7A V;  1YNN C;  2XRS D;  3KBG A;  4J8Q A;  1EY6 A;  3Q0A A;  1EIG A;  2PMZ B;  1TWA B;  4IFD G;  2WAC A;  3MTS A;  3GTO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...