4NKLA

Crystal structure of staphylococcal nuclease variant delta+phs v66a/i92q at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYQYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4nklA00
1STYA 2EYMA 2ENBA 1KDAA 2EYJA 4PMBA 5CC4A 3NXWA 1A2TA 4KD3A 4RKBA 3NUCA 2RBMA 2M00A 3DMUA 3TP6A 3EJIA 4E6IA 5IIFA 5ISRA 3OMCA 1A2UA 5I9OA 1KDCA 3C1FA 3S9WA 3NK9A 4KJNA 3SHLA 2EYOA 2F0JA 2F0NA 3OMGA 2F0EA 4DFAA 5J1ZA 1SNDA 3BDLA 3SK5A 4KHVA 2OEOA 5IGFA 4ME5A 3U9OA 2NUCA 2OF1A 5CV8A 3C1EA 4KY7A 4K5VA 3TP7A 5CGKA 5I9PA 1IHZA 3RUZA 4K2LA 4B9WA 5JAVA 3MEHA 2F0DA 3MHBA 2F0GA 1SNMA 4EVOA 3QOJA 4ZQ3A 4IUNA 1SYGA 2F0TA 2EYLA 2LKVA 1JOKA 4IZ8A 4QF4A 5F2DA 1SNCA 3D4WA 4N9PA 3D6CA 3P1HA 5KGUA 5CR3A 2EYPA 1EY7A 2EYFA 4J1MA 4K2KA 1EY6A 2SNMA 4HMJA 4WORA 4EQPA 5C4ZA 5J39A 4HMIA 1SYDA 2F0QA 5HGTA 4NP5A 2HQEA 5CV9A 1SYBA 4PMCA 1SYEA 4ZUIA 1TT2A 1KDBA 4KY5A 4RKLA 4J6HA 3T13A 3ITPA 1KABA 3MVVA 4F7XA 2F0WA 4K14A 3VA5A 3V2TA 1EYCA 1STAA 2EXZA 2OXPA 3BDCA 3EROA 1EZ8A 4I65A 3ERQA 4NDXA 1SNQA 3HZXA 3LX0A 5C5MA 4B9XA 5KIXA 5KYLA 5KYIA 3P75A 3E5SA 1TQOA 2F0SA 5C3XA 5CV5A 5I6YA 5KRUA 4NMZA 2PZUA 2PYKA 3OWFA 4KJOA 4MIUA 4IALA 3HEJA 1EQVA 5IOCA 1F2YA 2SNSA 3H6MA 3D8GA 3SK8A 5M9OA 1TR5A 1EYDA 3SK4A 5E3FA 5JOBA 4ZUJA 4QB4A 1SYCA 3PMFA 2PW5A 2SOBA 4K8JA 5IGDA 1A3TA 1JOOA 1RKNA 3D4DA 5CV6A 4HTHA 4S3SA 2PW7A 5DEHA 1EZ6A 1EY9A 1SNPA 2O4XA 3MZ5A 4G57A 2F0VA 4ODGA 5E1FA 1JORA 5CV7A 5EKKA 1II3A 2F0FA 3QOLA 5IGEA 4PNYA 2EY2A 5NUCA 2F0PA 5IGBA 5C5LA 2RKSA 4EQOA 5J22A 4TRDA 3TMEA 1EYAA 4KD4A 5IGCA 2F0OA 4KY6A 1NSNS 1F2MA 4NKLA 5C6AA 2PQEA 3SXHA 3QB3A 3SR1A 1NUCA 5DAUA 5K5PA 2EY5A 2F0MA 2KHSA 1EY5A 2KQ3A 3NHHA 4EQNA 1EY8A 1EY4A 5IGGA 1STGA 1JOQA 1SYFA 1F2ZA 4DU9A 3OSOA 4QMGA 5IODA 4H7BA 4ID6A 2F0LA 5HURA 2F0IA 1U9RA 3NP8A 3R3OA 4KV6A 1A3VA 4R8NA 3TP8A 5I6WA 3EVQA 4N9TA 1SNOA 1STHA 1AEXA 4K6DA 1EY0A 2F0KA 2F0HA 4K5WA 4K8IA 5EGTA 5C4HA 2PZTA 5C3WA 2WACA 2F3VA 3NQTA 3DHQA 5EKLA 2EY1A 3TP5A 2RDFA 3T16A 5KEEA 1ENCA 2EY6A 5CV4A 2QDBA 4LAAA 4OL7A 2F0UA 4DF7A 4F8MA 1KAAA 3MXPA 4K5XA 4DGZA 1ENAA 1A3UA 4YIJA 2PZWA 1STNA 4WRDA 2EYHA 1STBA 4KTAA 3SK6A 2F3WA
chains in the Genus database with same CATH superfamily
4LW1A 1OTCA 1N33Q 1XMQL 3M85A 3NUCA 2A69D 3GV6A 3MXNA 1X6OA 5ISRA 3AEVA 3T4AC 5HGQA 1F9RA 2KA7A 1TKWB 3HOXG 1VQCA 1DD2A 5H1SE 2OEOA 1MSGA 5CV8A 3N6RA 1BXTA 5FKAC 1MJEA 1ZXTA 3I91A 3GTJB 1E1TA 3MEFA 4WJ4A 4BY1G 2E2HH 1O7YA 3V96A 1Q90A 4UP8A 3NQIA 4J8QA 3S1RH 1ASYA 4A3GG 1OXXK 2E2IB 5I2XA 2NVQH 1KRTA 1E3PA 2ZM6L 4P73A 4R4CA 1H9MA 1B53A 1CI3M 4JI8Q 4Q0FA 3ONAB 2L0CA 3JAML 4BBSB 3K5NA 2BA0A 3AQQA 4RKLA 2NVYB 4C3IB 3MTSA 4A3EB 4PZ6A 2CVRA 2NN6I 5M5YB 2WV6D 2Q2HA 3VYUA 1VQ7A 3W2DA 1PRTF 2F0SA 3E5SA 4HJ9A 2JA5B 1PH7A 2L12A 1MGSA 4NMZA 3NEMA 4MHEA 4DNRB 3DXJC 1IBMQ 1U4PA 1TR5A 1N32Q 3S15B 1HA5A 1UAPA 4R1JA 4RGTA 3D3RA 4K8JA 4LF6Q 1ILPA 3HOYB 2NVTH 2KCMA 1PRTD 1DONA 2GVBA 2R7DA 2PW7A 3KBGA 5CV7A 2YU9H 3HOVH 2FFKB 2IX1A 4J15A 1KL9A 5C5LA 2C5CA 3CCMA 2ZXRA 4BA2I 3QB3A 1Y14B 1HNZQ 2J7ZA 3DM1A 2O5JC 1T5EA 3CC4A 4A93B 2NVXH 3RMHA 1E0BA 3A54A 4C2MH 3TBIB 1WTPA 1KLUD 3NELA 1PZKD 3HOXH 1IBLQ 3FPUB 5EPJA 2F3VA 4BY7G 4OL7A 4CDEC 3E3XA 4A3KB 4FDBA 5G3LF 1ML0D 5FOBB 1O78A 3S1MH 5I6YA 1IBKQ 1EYGA 4A3GH 2JXMB 5KNBA 2A6ED 1HQRD 2ENBA 3TREA 4HEDA 1PRTB 1ZEQX 2IX0A 1KLGD 4DK1A 2KECA 3TDQA 4EX5A 1X3GA 1G91A 1DXMA 1GUGA 1EEID 1MJCA 4B3SQ 1QCBD 3U4ZA 2JSOA 5G3LD 3L9AX 3GTKB 4H02A 2XWJB 3LGJA 1BDOA 3RLNA 1PH9A 5BR8Q 1TWAB 2CFMA 4POFA 2F0GA 2B39A 1WTOA 4JI3L 5D3DA 3E9HA 4DAYA 4FYDA 3IFTA 1PTOF 5GAGC 1E7ZA 1I4GA 1LABA 4DR1L 1PVOA 2VW9A 2M2LA 5J39A 4QIWE 1HCZA 2K32A 4HMIA 1LYLA 2NN6G 4QGUA 1BKBA 1WVLA 2A5HA 1K73C 4CJ2C 3UDIA 1PTOD 2DGYA 4L5RC 4IUUA 1RTOA 5CBAE 1QVFA 3ZYYX 2C9OA 2F03A 2RDGA 4A3KG 4LFCQ 2WAQB 3VR6A 1EQVA 1CUKA 4L5TA 5CMDA 3VR4A 5M9OA 4JCVE 4BXXG 5JOBA 2AWNA 1ET9A 2SOBA 5ELDA 3PGZA 1GKHA 5IWAL 3HOWB 1EZ6A 4U673 1PH2A 3RD4A 1YNNC 5C44G 1II3A 4GNXC 3KF6A 2EY2A 1Y1VB 4G7ZC 1HR0L 2DNEA 2H5XA 2HUGA 2E75C 2R93B 4KD4A 1VQ8A 3CP0A 1H9RA 5ELFA 2GN5A 4DV3Q 1EY5A 3PSIA 4B3ML 2JA8H 3URYA 3TQYA 4ID6A 1NR2A 2L9HA 4QL5A 5FJ8H 3PIO3 4HN7A 1PTOB 3QR8A 2CH4A 1CKNB 3GTQH 2F0HA 3PV0A 3LNNA 1IW7C 5IP7G 3X3NA 2B2VA 5IYBH 2JA6G 4K5XA 1LO5D 1SJED 1LTID 3I70A 4GN3B 2XNAC 1PFSA 1NY4A 1G2SA 4I7ZC 1WD1A 3PF4A 1VQFA 2B8GA 4DR2Q 2Q8RE 3DMUA 5D14A 1Q1EA 1J9OA 3C1FA 5FLXc 2NN6H 5M3MB 1IKLA 1A62A 5I2YA 2G9HD 4A3CH 1N34Q 2E5LQ 1AP0A 3HOUG 2K52A 1RL2A 3J81i 5BN4A 4GOPB 2XVSA 1FVIA 1K8OA 3TRZA 1BCPC 3S2DH 5DLQE 1B70B 4GKKL 2HT1A 1JOKA 4XQQA 3NBHB 4BXXH 3GTLB 1Q1BA 1SR3A 4FF2A 2SDFA 4X66Q 5FO7B 2RSOA 4WORA 1LTSD 4EQPA 4DNTB 3CRLC 2F0QA 3SEBA 1BR9A 1WJJA 1DM0B 2R92G 4IPGA 3R93A 4RFBA 1N33L 5KYIA 5GAEC 3MFYA 4YWMA 1YHAA 3FPPA 1F2LA 1WTRA 1M1KC 1W6JA 1TQOA 5M3FG 4RMFA 2DY7A 2E2JB 2XWBB 1I4HA 3PUVA 2HCCA 4XT3B 1BO0A 4C3HG 1P16A 2PNHA 2CCZA 1UEAB 3U9SA 4BBRG 4OWTB 3CU7A 1S40A 2EJGC 2B2VC 2HIXA 4MTNA 4KLKA 3WWVA 1N36Q 3I3CA 1D1IA 4R4QA 5IP7H 5NUCA 4JI8L 3VR3A 2JA6H 1TXYA 4DV1Q 3H0GG 4KKTA 4FNFA 1NMFA 4KY6A 1LTBD 4G7OC 4JI5Q 1AFPA 3L3OC 1MBYA 3QG1A 1VQIA 1YITA 1PA6A 5E4WC 1QNKA 2WB1B 4R4OA 2Q8TA 1I94L 2PMZE 3DEPA 1WYDA 1NMGA 3RZOH 4KV6A 1L1OC 4R8NA 3S1NH 1STHA 1AEXA 3V05A 2F0KA 1F9QA 4KI0A 1VQNA 5FO8B 5E7NA 3NQTA 1N32L 3BYTB 2BE5D 3HOUH 4LF6L 3N52A 4RG1A 5GADC 5D3IB 3MA2B 3P7JA 3D8GA 2F3WA 4H0LC 2D62A 2A6HC 3HKZG 3A56A 4LK1C 1LT5D 1TU2B 1YZ6A 1D5MC 3KLSX 4GZYC 1HUNA 2LMCB 1VS0A 4XIGS 4DV4Q 4DFAA 2X69A 1QUQB 3RZDB 4IFDI 2KEEA 3A8IE 4BWGB 1GUWA 1HUMA 2N8NA 2Z6KC 2WINB 4JI2L 1B2TA 2Z8LA 2F0DA 3M4QA 1CA6A 5M3FH 3S2HB 3G7LA 1SXTA 1L0XB 1U0LA 1X32A 1E2VA 2LKVA 3FDTA 5AJ3L 5JPNC 5F2DA 1Y8PB 5LL6X 5CR3A 2EYPA 4C3HH 1NJIC 3HP3A 4OX9L 2B2YA 1YNND 3TS2A 5HGTA 5IY0A 1EEFD 2RDHA 4ZRZA 4A3MB 1F9PA 1IBKL 4LF4L 4FVMA 3JAMc 1I50B 1H9SA 2K6AA 1I6HB 2QKIC 1TWGH 3D31A 2OXPA 2KEDA 3EROA 2KENA 3D0FA 1S5BD 1TWFH 3H0GH 2BOSA 4CJ0B 4QIWB 2VS1A 2D2CC 1PH8A 4IQZA 3KUPA 3I4NH 3PMFA 4YHHL 1HXYD 1PXUA 1IW7D 2KCCA 2O4XA 1LACA 2F0VA 3HRZC 1OO9B 1FYCA 3J7A5 2RSNA 3I4MG 1A6XA 3TZUA 1VQJA 1PYSB 3KOJA 4BS9A 1MIUA 3SXHA 1AH9A 3K7UC 3E0EA 3GTMB 1NBWA 1BCPF 4DV2L 2JEBI 3S14B 4GNXB 4XYQA 1H9KA 3M7NA 1WCMG 4LFCL 4JOIA 1OXUA 1V1PA 3GTOH 1NE3A 1EWIA 3HOZG 1IYUA 1B3QA 2NB0A 2OTJA 1BCPD 3QIAA 4DF7A 1N8RC 3C2PA 1XPRA 1R9TH 1EOVA 4JYAQ 1I4RA 1SMYC 3FEWX 1I4XA 4L5SA 2EQSA 2EJMA 3GTPH 1XNQQ 2VB2X 2OQ0A 1ESFA 4ZYSA 1CHPD 4C3JB 5I9OA 1KDCA 4N8X1 1Q12A 1CQVA 3KFUA 4NW2A 4JI3Q 1WI5A 3G4SA 4IFDG 3TN2A 4RCOA 1Q8KA 1Y8NB 1KNEA 1VQLA 5M5XH 1U4MA 4LUVA 4DR1Q 4JG2A 1I4PA 2UUCQ 5JAVA 1X56A 5EPKA 4A3JB 3S16H 3QOJA 1Y69U 4JI0Q 1B7YB 1STEA 4P2CB 3J7AF 2AMCB 4HCEA 3KBXA 4X3UA 1JT8A 2SNMA 3VYRA 2KHJA 1SYBA 4DA2A 3LWEA 1BVSA 1X65A 1BCPB 3T56B 3VA5A 3EFXD 1SNQA 1PH4A 1DCZA 1JICA 4JBWA 3S1RB 2IW3A 2NVQB 4KJOA 4XDXA 5D65A 4DR4L 3IFDA 2ZJRA 2EJFC 1EUJA 4QB4A 2PW5A 4CDFC 1A3TA 1UE5A 1JOOA 4OIKA 1SMXA 4S3SA 5AFWA 1CKOA 1JB3A 2EE1A 1DOKA 4G57A 4IUPA 3M4OB 3F2BA 3RR5A 5IT9E 2XRSD 4A3BH 1O7IA 5IGEA 1JMCA 1B8AA 1D5XC 3G6EA 1B3AA 4X66L 1XYIA 2VL6A 3B6YA 3FKIB 4JVZA 3IAYA 2MQHA 2GA4B 3EIVA 3ER0A 1JE5A 1UE1A 2Z6BA 1EIFA 3ND8A 1EY4A 5IGGA 2MNAA 1PYWD 3AB9A 3STBC 2HIVA 1ZYRC 4ZLTF 3HOVB 3I90A 4P71A 1SN8A 3SVMA 3KF8B 5EKLA 1XPUA 1GVPA 2PMZB 2QEJC 4O42A 1ENAA 4R8IA 2VUMH 3E6ZX 2EYHA 1GM5A 2VZAA 4C2MB 5EPLA 4AYBB 4CDCC 3H15A 1N36L 1A2TA 5JJIA 2RBMA 2M00A 3CPFA 4DAVA 4A3LG 4E6IA 1Y1WH 4DV1L 3OMCA 3PCOB 1U4LA 4V190 2F0NA 4A3IB 4A3FB 2A1AA 3BDLA 3SDZA 1AE2A 3DUZA 3HGBA 4IO9A 1PZID 4KY7A 3S1MB 1E2ZA 1SE2A 3RUZA 3NBIA 1IYJB 2QDLA 3MXGA 1BOSA 4IN3A 1MI2A 2B63B 1C4QA 1TWCH 1NR4A 3WDNA 5KGUA 1IXRA 3VR2A 4J1MA 1V1OA 1HHVA 2B2UC 3CCUA 2SEBD 4HIDA 4PMCA 2A19A 1V9PA 3H94A 1KDBA 3A7AB 4UPAA 3ITPA 4F7XA 5IT9L 2WKDA 2HDMA 2K33A 4I65A 5E4XA 5KIXA 5C5MA 4X64Q 3ICEA 4Y7NB 5CV5A 4CDDC 4DN4M 2FINB 3CF5A 4IUQA 4C1NI 2LY7A 4DV4L 1A15A 3CRKC 2BDNA 2SNSA 2Z4IA 3SK4A 5C4XG 3U50C 5C4JH 1RF2D 2D0OA 2DY8A 5DEHA 3F2UA 3U9OA 2G9DA 4DR3Q 3A7LA 1PFBA 2NZ1D 3A5ZB 5KNDA 3AMUA 2L15A 4OIJA 3OIPA 1NAPA 1FJGQ 2I5LX 1SMYD 2ID0A 1I94Q 1FR3A 3M3YH 2EOTA 1NSNS 2F52A 2X6GA 5COYA 3UDXA 1IKMA 2Y0SG 2XTIA 1JJ2A 4A3LH 1EU3A 1GXDC 3BYYB 3GTGB 3NP8A 3H3VI 3HKZE 2VQEQ 1XJVA 3W1GA 4GKJL 4CHTB 5KNCA 5C3WA 5M5WH 1YVCA 5A35A 1XNRL 2RDFA 3T16A 1HH2P 1BBXC 4KHPQ 1STNA 4JBKA 2A68C 2JA8B 1CZWA 1K3RA 1D1KA 1KDAA 5CC4A 3NXWA 3RLOA 3GTQB 4LF5Q 4JI2Q 4BBSG 2EYOA 2FJ2A 4IOAA 3BS1A 5AJ3Q 4C3IG 4LF9Q 4A3EG 3A55A 4DKAC 5I9PA 2BH2A 3MEHA 3JAMi 4OX9Q 4BY1H 1FGUA 2JJQA 3KYHC 4LF4Q 2JA5G 4QF4A 2D0PA 1VF7A 3BG3A 3WOFA 2R3ZA 2I46A 1EY6A 1HRJA 3MC0B 4PG3A 2ZJPA 2RQXA 3HOYG 4JYAL 4JI4L 2Z4HA 1XNQL 1QILA 4HIKA 1HZCA 2MO1A 4LF8Q 3ERQA 4YCWA 4JV5Q 3S2DB 4YHHQ 1PLFA 1SBBB 3STBD 2EPBA 1ZYRD 1K8MA 1FNWA 4A93G 4G4KA 2UUCL 1AN8A 3K59A 3GP7A 5E1FA 1TS2A 4JI0L 4LF7Q 1S72A 3E9IA 2HHHL 1VQDA 4DV2Q 1ICFB 1CSQA 4FF3A 1ET6A 4OWXB 3W1BA 3I55A 1C7YA 3A8JE 3O13A 3GTJH 3PO3B 2ALYB 3SR1A 2B2TA 5DAUA 4YCVA 3K6OA 2R7ZB 2E2IH 4IJLA 3BVZA 1LLRD 2YTXA 4DUZQ 2BCOA 4N9TA 1HR0W 1VQMA 3K7AH 4XQJA 1EY0A 3FRPB 3MFGA 5EGTA 2PZTA 5IP9G 1D6EC 2NVYH 4C3IH 1FD7D 2IY5B 4BY7H 1F77A 5CV4A 3K81C 4FXKC 3MXPA 4KN4C 1ASZA 2RVLA 3K0XA 1K3BC 4B3RL 2ICEC 3HS0C 1KQSA 2JA5H 4PMBA 1EWHA 3S1NB 2Q2TA 3Q24A 4QCLA 3EJIA 5LMNW 1A2UA 4K0KQ 3SHLA 1KD1C 3HOYH 3BJUA 2KJXA 2QILA 1B4OA 1YJNA 1PDQA 1QWYA 3TP7A 3A74A 1IHZA 1JWSD 3T1HQ 3I2ZA 1XTDA 1LTGD 2K04A 3NTHA 3PO2B 2KBNA 1GHJA 3UI2A 3S1QB 2G5DA 1JC7A 5EBCA 4N9PA 3PIOA 2WAQG 2EYFA 3VDYA 2VY3A 3IRBA 4NXMQ 2K03A 1SYDA 2J4XA 2PCFB 3G48A 5CV9A 2B29A 1X9NA 4KY5A 4LUOA 1X3FA 1KABA 1FGBD 2L5TA 4DR4Q 1ESRA 3HOWG 3V2TA 1STAA 4XXEA 3LX0A 4RGNA 3P75A 1Y1VG 5KRUA 1UWVA 4PZ8A 4ZCKA 2Q2UA 1CHQD 4A3KH 2R93G 2Z0SA 4HIOA 2UXBL 5E3FA 3H3VH 1SYCA 1HPCA 3Q22A 3FVQA 3UDGA 5IGDA 4RA8A 1EY9A 1SNPA 4ODGA 5IYDG 4GLVB 1DOMA 5IP9H 4DR5L 5C44H 1LT4D 4CGYB 2OQKA 1G6PA 4IPDA 3CHBD 1SDFA 5FLMG 2JYOA 2MPMA 5BN5A 3I4NB 3KLSA 2M9VA 2ZTEA 2ZTCA 3BZCA 1KRSA 2R7FA 3OSOA 5LHY1 4X64L 2HQLA 5HURA 2K75A 3TP8A 1KXLA 1HQMC 1XXGA 1AZQA 2LXKA 3U58A 4C56C 5M3MG 1KHIA 1YNJC 4P74A 4HSVA 5C0XI 1UNSA 2QDBA 4LAAA 5DM63 4A76A 3NE5B 4IURA 4O0AA 1HTLD 3SK6A 2JP1A 4DR3L 2F4VL 1FJGL 3K0YA 1WTQA 3ULJA 3CCJA 3GTOB 4KJNA 5ELBA 4TKOB 2F0EA 3BU2A 1SNDA 1GJXA 4OHJA 3HOWH 1LTTD 3MXNB 1HA6A 1Y1VH 5ELNA 2VQEL 1TY0A 2ATWA 3CAMA 4HJ5A 1B9MA 2R93H 3I56A 3D4WA 2RHQB 2K5VA 4K2KA 4DPGA 4DXFA 1K8GA 1CKMA 1PZJD 2FHTA 4KHPL 1RHPA 5JJKA 4Y52H 1M8AA 1TT2A 3T13A 2R92H 1PTOH 4XQNA 3I73A 1K83B 4DAPA 2EXZA 1MKHA 3EA6A 4YWLA 3HZXA 2RCNA 4LMQD 3S24A 5IT9c 4LF5L 1ICWA 1HNXQ 1EIGA 3K58A 2JA7B 3KJPA 3CCEA 2H4OA 3H6MA 3GO5A 2DN8A 4A3DB 1YBYA 4LF9L 2OCEA 4OEMB 2CQAA 5TSSA 2Y0SE 4POGA 1PFNA 1VQBA 3K8AA 1SSOA 1RKNA 3D4DA 2WB1G 4BBRH 1EFWA 1H95A 1IL2A 1E22A 2KOLA 1VQPA 3AFQA 1ZKOA 4UY8C 5M3MH 2F0FA 2HCIA 1HZBA 1SE8A 4A4IA 1G291 2L11A 5LMUL 3J7AV 3G71A 1DGSA 4NKLA 3I7FA 2PNRC 1XWEA 2BDOA 3BDOA 2A73B 3R2IA 4NPSA 2R6GA 4GKJQ 1YHBA 1I3QB 4ULLA 4CKBA 3U4VA 1Q46A 4LF8L 1QZHA 4JV5L 1XNRQ 1IYVA 5JVH3 3GV3A 1Z7TA 1DZ1A 1U9RA 1PMRA 4KHZA 3GTLH 1SJHD 3CPWA 4A3BB 3EVQA 1G8ZD 1RJTA 3PIP3 3OYYA 1TWHB 1Z47A 3AYHB 3UE0A 2Q2IA 1S3OA 5C0XG 1QG7A 5KEEA 4UP7A 3M4YA 4RH6A 4YWKA 2ICIA 3OTOL 4LF7L 2K5WA 3KJOA 3DEOA 2E2JH 4KKUA 5A2QL 1B1ZA 2FMCA 3NSWA 1TS5A 1QVCA 3S17H 1VQHA 1KAWA 2P5ZX 5IGFA 2AQ2B 4ALPA 4A3MG 2BA1A 2VUMB 5CGKA 1WD0A 3MWYW 1L2FA 4DUZL 4LFAQ 1LV9A 4B3TL 4JI4Q 1Y1WB 1C9OA 4FP5D 3CD6A 3D6CA 4U68A 2B2YC 1VQGA 1HFGA 4HMJA 1E24A 2A74C 2QGQA 4DAYB 5DNFA 1LT3D 3TEHB 5J3BA 2F0WA 2E8GA 2ZTDA 4LFBL 3K57A 4PZ7A 3NWTA 1VDZA 5C3EB 2QEXA 2PO4A 1Q8IA 5L37A 3Q0AA 4K0KL 3ULLA 3MXUA 3CCSA 5ELOA 4R9WA 5EAYA 1RCVD 2HHHQ 3T1HL 2OT2A 4B08A 4MTKA 1B50A 1YNJD 3H3VC 2PPBC 5C0XH 2O2LD 3QOLA 3I4MH 2E2HB 3BZKA 4NXML 1RDPD 5BN3A 2HDLA 1LM0A 3TMEA 1HNWL 5JJLA 1BF4A 1CKNA 5C4JB 1DJRD 2AUKA 1R4PB 2KHSA 3W3AA 2UU9L 1JWUD 4BA1I 1CSPA 2RA4A 2LS01 1O80A 1JOQA 1SYFA 4GN5A 4H13C 4P72A 5FO9B 2UXDL 1GUNA 1HFNA 2F0IA 3CC2A 1MD2D 4JOIC 4QY7A 4C3JG 1WCMH 4K5WA 2HD3A 5C4HA 2OTLA 4B3RQ 4X6AH 3M7GA 2EY1A 1I50H 3HOZH 1ENCA 2WIIB 4F8MA 3A5UA 4FXDA 1I6HH 1KAAA 4DV7L 1M4VA 4YIJA 2A6HD 4A3JG 1STYA 1PH1A 3ULPA 4N8FA 4RAUC 2NVTB 2A6EC 1YNXA 3TP6A 1WTWA 3PF5A 1ILQA 2YYZA 4X65L 4GOPA 2WAQE 5M5WB 1JJCB 4QJFA 3F1ZA 5ELEA 3RNUA 1D8LA 2YU9B 2K5QA 4IFDH 3K5OA 2NTTA 1GUTA 1K28A 2NUCA 3NBHA 3C1EA 2IHEA 1M90C 3EQLC 4IUVA 2N3SA 1BUVT 2K50A 5EJWA 3MHBA 2CQOA 1PHJA 1QZGA 1G51A 1SYGA 2RF4A 4L5QA 1L1OB 2NVXB 4IZ8A 4DK3C 2K28A 1GUSA 1EY7A 4DK0A 3GTMH 1I5FA 3HOXB 2HQEA 4KKSA 1CQFA 3PUZA 1XMOQ 2UXBQ 4DV0L 4BY1B 4NDXA 4B9XA 2K5DA 2EVBA 1WFQA 3OW7A 1PTOC 1G6ZA 1LTRD 2E76C 4A3GB 4KK7A 4IPHA 1YJ9A 3HFZB 2PZUA 2IT1A 5GROA 2DUDA 2K14A 3IL8A 3FKIG 4DNIA 3Q6SA 4DR5Q 1QOHA 4HAEA 3Q8DA 3L2PA 1DYQA 2LXJA 4C3JH 1FNVA 3CKIB 3CQZH 3HOVG 2KCTA 1WTHA 2F0PA 2NZHA 4FO2A 1OXSC 4DR6Q 1FNUA 4GLXA 3T51B 5C6AA 1J5EL 4A3JH 1NUCA 2AHOB 1D7QA 2KQ3A 3NHHA 5T1GA 1VMPA 4RWSC 3D6WA 4GOPC 1KNAA 4AYBG 4H7BA 2Q8IB 3R3OA 5CBEE 1HNXL 5C0XJ 2N49A 2ZT9C 4K6DA 2CW0C 4L8JA 2NWGA 3UDFA 4C1NK 4UAIA 4A3IG 4A3FG 1ENFA 2F4VQ 3QJYA 4JW0A 2WKCA 2MO0A 4DGZA 1R4QB 1KC8C 3L0OA 2VQFQ 2IL8A 3UE1A 2UUAQ 4DV6L 2AWOA 1QUQA 2B63G 1BBWA 4FF1A 1P8LA 1E2WA 2F3IA 2NYZD 4DUYL 1Q3LA 2B8FA 3K7AB 5IIFA 3C3LA 2KVMA 5JVG3 3OMGA 4BY7B 2VXWA 2I5HA 3D4RA 3M4OH 2ZXPA 5IE8A 4X3SA 1JJGA 4ZKBB 2XN9C 2EYLA 1DOLA 1J6QA 1SFOH 2YV5A 1SNCA 4KN7C 3FKIH 4Q5VA 3P1HA 1EIYB 1X3PA 1S5DD 3I8ZA 4L63B 3H91A 4XYOA 1AZPA 4IFDJ 3J80E 1SYEA 2GVAA 3MVVA 2VB3X 1OXVA 2I5MX 2WB1E 4K14A 3BDCA 1HJPA 1CK1A 3T53B 1UUPA 1C0AA 1LTAD 3CMEA 1VQ5A 2XRQD 1RD9D 2RCFA 1H9SB 3Q23A 2ES2A 4JI7Q 1S5ED 5C4XH 2FMMA 2N78A 2IJ0A 2AUJD 3J81E 1TY2A 3W5OA 5I6WA 5LMUQ 1EQRA 4LFAL 1JORA 2OWOA 1GHKA 4Z9CB 3M4PA 3K5LA 4JI6Q 1WOCA 4A3IH 4PMWA 4A3FH 5IGBA 3TS0A 1VQKA 4JC0A 4GNXA 5EKIA 2E74C 2F4IA 4AIMA 2F0OA 1AE3A 2K05A 1F2MA 4PV1C 3SGIA 4NXNQ 2JQOA 2B63H 5DM73 2JA8G 1X3QA 4IUTA 1VQ9A 1XPOA 4OO1I 2F0LA 1JR0D 4UDUC 5I4DA 5FJ8G 5C44B 1A3VA 2TMPA 5HY6A 3OTOQ 2MJ8A 3FHWA 4HJAA 4HSPA 4K8IA 1WTXA 1QE6A 3VYSA 5IYBG 1YEZA 2DJFC 2CKZB 2I0QA 2BE5C 3EBEA 2XGTA 3PUXA 4Y7NH 5K36G 1V1PB 1A63A 1PH5A 1C48A 3DWPA 4TVAB 1JCKB 4JI1Q 3QO2A 1VQAA 3KLRA 1EIHA 3AFPA 3S9WA 1W3SA 3J80L 4HJ8A 4A3CG 1GOZA 2UXCQ 4BBSH 4GS3A 5J1ZA 3J7YW 1PH6A 1XX8A 4B3TQ 3QWNA 2JA6B 4XTCS 2OF1A 4P75A 2RHSB 1U4RA 1TS3A 5GAHC 4AQYQ 4A3EH 5M5YH 2KUMA 2ZXOA 1LUZA 4IPCA 4LFBQ 3RZOB 3TZDA 1C8CA 1X3EA 2DJGC 5C4ZA 2MGSA 2B3GA 3J81L 3F8TA 1SE3A 3S15H 3AU7A 4XT1B 4X62Q 4CKEA 3GTGH 1LTLA 3HOUB 1UE7A 2AKWB 4EGVA 1ONLA 1EZ8A 2E2DC 5IYCG 1V8QA 4R4TA 3PQIA 3CXCA 1S5CD 2K01A 3FMCA 2QW7A 3CCQA 3SK8A 3PO3G 3DLLA 2WP8J 4NB3A 2CW0D 4UP9A 2N55A 2R7ZG 4A93H 2R92B 3RLFA 5CV6A 3MZ5A 4LUZA 3KDFB 1HNWQ 5LMNL 1YHQA 4APVA 3PUWA 1CM9A 2V4DA 2UU9Q 1K0SA 4PNYA 2MP1A 5M3FB 1JQYD 4JK1C 2UXDQ 1S4ZA 4DV5L 1EYAA 4HJ7A 2B2TC 2PQAB 3FP9A 3J80i 1BBUA 5K36H 2JE6I 4C3HB 2YTVA 2EY5A 1XMOL 4DR7L 1A0IA 3KF8A 4OO1G 4BBRB 1EU4A 1F2ZA 2NZOA 4DU9A 2FXQA 2CWAA 4ZK9B 1D5ZC 4DV7Q 1TWGB 1SNOA 1L1OA 4RGMA 2MUYA 3E0JA 1FL0A 1TWFB 3H0GB 1JB7A 1NTGA 3DHQA 3TP5A 1VQ6A 2EY6A 3GTKH 1EFID 2A68D 4YY3Q 1A3UA 4F88A 4X65Q 1WTVA 3JC66 4CBVA 1Q81C 1VQOA 1TWAH 3PO2G 4RHSA 2EYJA 2VNUD 4O2DA 4PQXA 5GQOA 1EOTA 2DNCA 3C46A 4DR6L 4H44C 4V0BA 3G6JB 3NK9A 2ASBA 2Z9HA 3SK5A 1D2BA 5IYCH 4ME3A 4JPBW 1NNXA 1HTPA 2Z6KA 4I7AA 1EL0A 3HKZB 4OXPA 4K6LA 4L6TB 3PO3H 4DV0Q 3A8KE 1O7ZA 2PI2A 3T1YQ 3S17B 1W2BA 2R7ZH 2UUBQ 2VQFL 4ZUIA 5ELCA 4J6HA 2UUAL 1CT1D 2IX3A 2LFNA 1I6VC 5EBDA 5JPMC 2V1CC 1R9TB 5KYLA 1IZ6A 2JEAI 2EIFA 3GTPB 2JK8A 4OGQC 1OXTA 4O1NA 1YJWA 4GN4B 1EYDA 4OO1H 1B44D 2CHBD 3I4NG 4OWWB 1F9SA 5A2QE 4HR7B 1K8AC 3CC7A 1VQEA 3K5MA 3I4OA 2LSSA 4HTHA 1GUOA 1N9WA 1JE4A 1Y8OB 3VYTA 5M5XB 1IBML 4AYBE 5IYDH 1J5EQ 2EDGA 3DWQA 2TSSA 5EKKA 3GQBA 1XMQQ 3S16B 3OW2A 1GO3E 3BVGA 1RIPA 2F1MA 3LWUA 2EXDA 1TIID 2KHIA 4TRDA 3VR5A 1E1OA 4AH6A 5FLMH 3PO2H 2F0MA 2CH4W 3S1QH 3R8BA 1EY8A 3CCRA 1STGA 4QMGA 3BZDB 4X3TA 3NENA 5T1IA 3CCVA 3I4MB 2BH8A 1HNZL 1TS4A 1SAPA 1LT6D 1YIJA 2YTYA 4RCNA 4DV6Q 4FF4A 2WACA 4YCUA 1BQQT 5JEAG 2ZM6Q 4JI7L 2JA9A 2A8VA 1U5KA 1G2TA 1CFMA 4DUYQ 1S5FD 1VF5C 1BNZA 4GLAC 4LJZC 2PZWA 4MNOA 4WRDA 3KLWA 1IBLL 3K80C 1VQ4A 2EYMA 2PI2E 1HZAA 4ZKCB 3CMAA 2QA4A 4JI6L 2IWHA 4KD3A 1EWCA 1A8VA 1WCMB 2D5DA 5JJZA 1H9JA 3HOZB 4NXNL 2K5NA 4G7HC 1VMCA 4KHVA 1Q7YC 4ME5A 4WJWA 1SRUA 4K5VA 4HIMA 4K2LA 1PYBA 4B3SL 4EVOA 1SNMA 3ND9A 4JBJA 4ZQ3A 4MZ9A 5EQ0A 4WFN3 2JA7G 5FLXE 1QJOA 2X6LA 5BR8L 3PIPA 4A3DG 3OOCA 4DAMA 4RGOS 2A69C 2R61A 1GD7A 1EYCA 3EN2A 1K0RA 4JI1L 2B2WA 1Q86C 1SEBD 3I72A 1YI2A 3CW2C 3OWFA 1NCVA 2PYKA 2UXCL 4MIUA 3NWSA 5IOCA 2Z1CA 2QCPX 3WOEA 3PUYA 1RTNA 4ZUJA 3F2DA 4AQYL 2EZVA 1MSHA 3IKJA 4EQ5A 2N88A 1IL8A 3DWAA 4QUCA 2IHFA 2H1EA 3ZJYC 2J0TD 1T9HA 2MFIA 4MN3A 3OPOA 4A3BG 5JEAH 2L4NA 4QUFA 2RKSA 4EQOA 5J22A 1EQQA 1L0WA 1T5XD 3MAQA 1TWCB 4X62L 1K9MC 5K5PA 3NTIA 4LNQA 4EQNA 1TVXA 3GD7A 4OONA 1SLJA 4F87A 4FXGC 3CQZB 3RN5A 1X54A 3KK7A 2I07B 2D9UA 2IPKD 4TQUS 4DV3L 4RHRA 3A0JA 1PRTC 1SROA 1UEBA 2C35B 1W6KA 2K5HA 4X3KA 2F0UA 1K83H 3RZDH 1PH3A 2VUMG 4ZAIA 1Z9FA 2L55A 1STBA 4KTAA 2K7VA 5CORA 2L1BA 1CA5A 2WFWA 3SE0A 2JA7H 2AQ3B 5FLXL 3S2HH 4QQBX 4RKBA 3R2TA 3KF6B 1XTCD 3F2CA 1Y1WG 4A3DH 1JWMD 4M8AA 2F0JA 3CCLA 2B2WC 3I4LA 4TSSA 4DR2L 4JBMA 3M3YB 3J80c 4A3MH 1KTKA 1PV4A 4B9WA 1VCIA 4CKCA 1X55A 5C3EG 3KDFA 5IWAQ 4IUNA 2F0TA 1N34L 5LL6S 3P20A 1Z6HA 1QB5D 2E5LL 1QVGA 4UHVA 1EQTA 3TSSA 2XIWA 1HR0Q 3NTKA 4DK6C 1Q82C 1I3QH 1HZ9A 1CZGA 4YY3L 4HCSA 3ERSX 2B2UA 1V43A 2PQAA 4NP5A 2O5IC 3J81c 1J8IA 2XSCA 4B3MQ 4ILWA 4LWCA 1TWHH 3OHXC 3M9BA 3NPPA 5C3XA 1SFOB 1KIXA 3X3MA 1UE6A 1B9NA 1AW7A 2QF7A 2KCNA 4IALA 2NTSA 3HEJA 3VA7A 1F2YA 5LMNQ 5CYUA 5FK9C 2K1BA 3OWEB 2K4KA 3J81j 3JAME 3S14H 4DV5Q 2CWPA 4A75A 3J7ZC 1I4QA 4OELB 4M1UB 4ABNA 1O7LA 1QNUA 4CJ1B 4DR7Q 3T1YL 3OIQA 4KMUC 4DXGA 2UUBL 5IGCA 1RODA 1CTMA 2PQEA 5C4XB 4WJ3M 2ZJQA 3BVMA 5IODA 1SE4A 3H09A 4JI5L 5JEAJ 1L0YB 3RN2A 2MHVA 4GKKQ 3HKSA 1MHWC 2JN4A 4IOCA 4IJHA 1V1QA 2AQ1B 3GDEA 3DM3A 3HG9A 4R4IA 5C3EH 2Y0SB 2NBFA 3L7ZC 1PFMA
chains in the Genus database with same CATH topology
3M85A 3NUCA 2A69D 3GV6A 3MXNA 5ISRA 3T4AC 1F9RA 2KA7A 1TKWB 1DD2A 2OEOA 1MSGA 5CV8A 3N6RA 1BXTA 5FKAC 1ZXTA 3I91A 3GTJB 1O7YA 3V96A 1Q90A 3NQIA 4J8QA 2E2IB 1OXXK 5I2XA 1H9MA 1B53A 1CI3M 4Q0FA 3ONAB 2L0CA 3JAML 4BBSB 3K5NA 2BA0A 4RKLA 4C3IB 2NVYB 3MTSA 4A3EB 2CVRA 2NN6I 5M5YB 2WV6D 3VYUA 3W2DA 1PRTF 2F0SA 3E5SA 2JA5B 2L12A 1MGSA 4NMZA 4MHEA 4DNRB 3DXJC 1U4PA 1TR5A 3S15B 1HA5A 1UAPA 4RGTA 3D3RA 4K8JA 1ILPA 3HOYB 1PRTD 1DONA 2PW7A 3KBGA 5CV7A 2FFKB 2IX1A 5C5LA 2C5CA 2ZXRA 4BA2I 3QB3A 2J7ZA 3DM1A 2O5JC 1T5EA 4A93B 3RMHA 1E0BA 3A54A 3TBIB 1WTPA 1KLUD 1PZKD 3FPUB 5EPJA 2F3VA 4OL7A 4A3KB 5G3LF 1ML0D 5FOBB 1O78A 5I6YA 2JXMB 5KNBA 2A6ED 1HQRD 2ENBA 4HEDA 1PRTB 1ZEQX 2IX0A 1KLGD 4DK1A 2KECA 3TDQA 1G91A 1DXMA 1GUGA 1EEID 1QCBD 2JSOA 5G3LD 3L9AX 3GTKB 2XWJB 1BDOA 1TWAB 2F0GA 2B39A 1WTOA 5D3DA 4DAYA 4FYDA 3IFTA 1PTOF 1I4GA 1LABA 2M2LA 5J39A 1HCZA 2K32A 4HMIA 2NN6G 1WVLA 2A5HA 4CJ2C 1PTOD 4IUUA 1RTOA 5CBAE 3ZYYX 2C9OA 2F03A 2RDGA 2WAQB 3VR6A 1EQVA 5CMDA 3VR4A 5M9OA 5JOBA 2AWNA 1ET9A 2SOBA 5ELDA 3HOWB 1EZ6A 4U673 3RD4A 1YNNC 1II3A 2EY2A 1Y1VB 4G7ZC 2DNEA 2HUGA 2E75C 2R93B 4KD4A 1H9RA 5ELFA 1EY5A 3URYA 4ID6A 1NR2A 2L9HA 3PIO3 4HN7A 1PTOB 2F0HA 3PV0A 3LNNA 1IW7C 3X3NA 2B2VA 4K5XA 1LO5D 1SJED 1LTID 3I70A 2XNAC 1G2SA 4I7ZC 1WD1A 2B8GA 2Q8RE 3DMUA 5D14A 1Q1EA 1J9OA 3C1FA 2NN6H 5M3MB 1IKLA 5I2YA 2G9HD 1AP0A 5BN4A 2XVSA 1K8OA 1BCPC 1JOKA 4XQQA 3GTLB 1Q1BA 4FF2A 2SDFA 5FO7B 2RSOA 4WORA 1LTSD 4EQPA 4DNTB 3CRLC 2F0QA 3SEBA 1BR9A 1DM0B 3R93A 4RFBA 5KYIA 3MFYA 3FPPA 1F2LA 1WTRA 1W6JA 1TQOA 2DY7A 2E2JB 2XWBB 1I4HA 3PUVA 2HCCA 4XT3B 1BO0A 4C3HG 1UEAB 3U9SA 3CU7A 2EJGC 2B2VC 3I3CA 1D1IA 5NUCA 3VR3A 4KKTA 4FNFA 4KY6A 1LTBD 4G7OC 1AFPA 3L3OC 1MBYA 3QG1A 5E4WC 1QNKA 2WB1B 2Q8TA 3DEPA 4KV6A 4R8NA 1STHA 1AEXA 3V05A 2F0KA 1F9QA 4KI0A 5FO8B 3NQTA 3BYTB 2BE5D 3N52A 5D3IB 3MA2B 3P7JA 3D8GA 2F3WA 4H0LC 2D62A 2A6HC 3A56A 4LK1C 1LT5D 1TU2B 1D5MC 3KLSX 4GZYC 1HUNA 2LMCB 4XIGS 4DFAA 2X69A 3RZDB 4IFDI 2KEEA 3A8IE 4BWGB 1GUWA 1HUMA 2WINB 1B2TA 2Z8LA 2F0DA 1CA6A 3S2HB 3G7LA 1SXTA 1L0XB 1X32A 1E2VA 2LKVA 3FDTA 5JPNC 5F2DA 1Y8PB 5LL6X 5CR3A 2EYPA 3HP3A 2B2YA 1YNND 5HGTA 1EEFD 2RDHA 4ZRZA 4A3MB 1F9PA 4FVMA 1I50B 1H9SA 2K6AA 1I6HB 2QKIC 3D31A 2OXPA 2KEDA 3EROA 1S5BD 4CJ0B 2BOSA 4QIWB 2D2CC 4IQZA 3KUPA 3PMFA 1HXYD 1PXUA 1IW7D 2KCCA 2O4XA 1LACA 2F0VA 3HRZC 1OO9B 1FYCA 2RSNA 1A6XA 3TZUA 4BS9A 3SXHA 3GTMB 1BCPF 2JEBI 3S14B 4XYQA 1H9KA 3M7NA 1OXUA 1V1PA 1IYUA 2NB0A 1BCPD 3QIAA 4DF7A 3C2PA 1I4RA 1SMYC 3FEWX 1I4XA 2EJMA 2VB2X 1ESFA 4ZYSA 1CHPD 4C3JB 5I9OA 1KDCA 1Q12A 1CQVA 4IFDG 4NW2A 3TN2A 4RCOA 1Y8NB 1KNEA 1U4MA 1I4PA 5JAVA 4A3JB 5EPKA 3QOJA 1Y69U 1STEA 4P2CB 3J7AF 4HCEA 3KBXA 4X3UA 2SNMA 3VYRA 1SYBA 4DA2A 3LWEA 1BCPB 3T56B 3VA5A 3EFXD 1SNQA 1DCZA 1JICA 4JBWA 3S1RB 2IW3A 2NVQB 4KJOA 4XDXA 5D65A 3IFDA 2EJFC 4QB4A 2PW5A 1A3TA 1JOOA 4OIKA 4S3SA 5AFWA 1JB3A 2EE1A 4G57A 1DOKA 4IUPA 3M4OB 5IT9E 2XRSD 5IGEA 1D5XC 1B3AA 1XYIA 3FKIB 3IAYA 2GA4B 3ND8A 1EY4A 5IGGA 1PYWD 3AB9A 1ZYRC 4ZLTF 3HOVB 3I90A 3SVMA 5EKLA 2PMZB 2QEJC 4O42A 1ENAA 4R8IA 3E6ZX 2EYHA 4C2MB 5EPLA 4AYBB 1A2TA 2RBMA 2M00A 4DAVA 4E6IA 3OMCA 1U4LA 4V190 2F0NA 4A3IB 4A3FB 3BDLA 3SDZA 3DUZA 3HGBA 1PZID 4KY7A 3S1MB 1E2ZA 1SE2A 3RUZA 3NBIA 3MXGA 1BOSA 4IN3A 1MI2A 2B63B 1C4QA 1NR4A 3WDNA 5KGUA 3VR2A 4J1MA 1V1OA 1HHVA 2B2UC 2SEBD 4PMCA 3H94A 1KDBA 3A7AB 3ITPA 4F7XA 5IT9L 2WKDA 2HDMA 2K33A 4I65A 5E4XA 5KIXA 5C5MA 4Y7NB 5CV5A 4DN4M 2FINB 4IUQA 4C1NI 2LY7A 1A15A 3CRKC 2BDNA 2SNSA 2Z4IA 3SK4A 1RF2D 2DY8A 5DEHA 3F2UA 3U9OA 2G9DA 3A7LA 1PFBA 2NZ1D 5KNDA 3AMUA 4OIJA 3OIPA 1NAPA 1SMYD 2ID0A 1FR3A 2EOTA 1NSNS 2X6GA 5COYA 1IKMA 1EU3A 1GXDC 3BYYB 3GTGB 3NP8A 4CHTB 5KNCA 5C3WA 5A35A 2RDFA 3T16A 1BBXC 1STNA 2A68C 2JA8B 1CZWA 1D1KA 1KDAA 5CC4A 3NXWA 3GTQB 2EYOA 2FJ2A 3BS1A 4C3IG 3A55A 5I9PA 3MEHA 4QF4A 1VF7A 3BG3A 3WOFA 2R3ZA 2I46A 1EY6A 1HRJA 3MC0B 2RQXA 2Z4HA 1QILA 3ERQA 3S2DB 1PLFA 1SBBB 2EPBA 1ZYRD 1K8MA 1FNWA 4G4KA 1AN8A 3K59A 3GP7A 5E1FA 1TS2A 4FF3A 1ET6A 3A8JE 3O13A 3PO3B 3SR1A 2B2TA 5DAUA 3K6OA 2R7ZB 3BVZA 1LLRD 2BCOA 4N9TA 4XQJA 1EY0A 3FRPB 3MFGA 5EGTA 2PZTA 1D6EC 1FD7D 1F77A 5CV4A 4FXKC 3MXPA 4KN4C 2RVLA 2ICEC 3HS0C 4PMBA 1EWHA 3S1NB 3Q24A 4QCLA 3EJIA 1A2UA 3SHLA 2KJXA 2QILA 1B4OA 1PDQA 1QWYA 3TP7A 1IHZA 1JWSD 1LTGD 2K04A 3NTHA 3PO2B 1GHJA 3UI2A 3S1QB 1JC7A 5EBCA 4N9PA 2EYFA 2K03A 1SYDA 2J4XA 2PCFB 5CV9A 4KY5A 1KABA 1FGBD 2L5TA 1ESRA 3V2TA 1STAA 4XXEA 3LX0A 4RGNA 3P75A 5KRUA 1CHQD 5E3FA 1SYCA 1HPCA 3Q22A 3FVQA 5IGDA 4RA8A 1EY9A 1SNPA 4ODGA 1DOMA 1LT4D 4CGYB 3CHBD 1SDFA 2JYOA 2MPMA 5BN5A 3I4NB 3KLSA 2M9VA 3OSOA 5LHY1 5HURA 3TP8A 1HQMC 1XXGA 1AZQA 4C56C 1YNJC 4HSVA 5C0XI 1UNSA 2QDBA 4LAAA 5DM63 3NE5B 4IURA 1HTLD 3SK6A 2JP1A 3K0YA 1WTQA 3GTOB 4KJNA 5ELBA 4TKOB 2F0EA 1SNDA 1GJXA 4OHJA 1LTTD 1HA6A 1TY0A 1B9MA 3D4WA 4K2KA 4DXFA 1PZJD 2FHTA 1RHPA 1M8AA 1TT2A 3T13A 1PTOH 4XQNA 3I73A 1K83B 4DAPA 2EXZA 3EA6A 3HZXA 4LMQD 1ICWA 1EIGA 3K58A 2JA7B 2H4OA 3H6MA 3GO5A 2DN8A 4A3DB 2CQAA 5TSSA 1PFNA 1SSOA 1RKNA 3D4DA 2KOLA 1ZKOA 2F0FA 2HCIA 1G291 2L11A 3J7AV 4NKLA 2PNRC 1XWEA 2BDOA 3BDOA 2A73B 3R2IA 2R6GA 4ULLA 1I3QB 4CKBA 1IYVA 5JVH3 3GV3A 1Z7TA 1DZ1A 1U9RA 1PMRA 4KHZA 1SJHD 4A3BB 3EVQA 1G8ZD 1RJTA 3PIP3 1TWHB 1Z47A 5C0XG 1QG7A 5KEEA 3M4YA 4RH6A 2ICIA 2K5WA 3DEOA 4KKUA 5A2QL 1B1ZA 2FMCA 3NSWA 1TS5A 5IGFA 2AQ2B 2BA1A 2VUMB 5CGKA 1WD0A 3MWYW 1LV9A 1Y1WB 4FP5D 3D6CA 4U68A 2B2YC 1HFGA 4HMJA 2A74C 5DNFA 1LT3D 2F0WA 3K57A 3NWTA 1VDZA 5C3EB 2PO4A 1Q8IA 3Q0AA 3MXUA 4R9WA 1RCVD 2OT2A 4B08A 1B50A 1YNJD 3H3VC 2PPBC 5C0XH 2O2LD 3QOLA 2E2HB 1RDPD 5BN3A 2HDLA 3TMEA 1BF4A 5C4JB 1DJRD 2AUKA 1R4PB 2KHSA 3W3AA 1JWUD 4BA1I 2RA4A 2LS01 1O80A 1JOQA 1SYFA 5FO9B 4H13C 1GUNA 1HFNA 2F0IA 1MD2D 4C3JG 4K5WA 5C4HA 3M7GA 2EY1A 1ENCA 2WIIB 4F8MA 4FXDA 1KAAA 1M4VA 4YIJA 2A6HD 1STYA 4RAUC 2NVTB 2A6EC 3TP6A 1WTWA 1ILQA 2YYZA 5M5WB 2YU9B 5ELEA 2K5QA 4IFDH 3K5OA 2NTTA 1GUTA 2NUCA 3NBHA 3C1EA 3EQLC 4IUVA 1BUVT 5EJWA 3MHBA 1SYGA 2NVXB 4IZ8A 2K28A 1GUSA 1EY7A 4DK0A 3HOXB 2HQEA 4KKSA 1CQFA 3PUZA 4BY1B 4NDXA 4B9XA 2K5DA 2EVBA 3OW7A 1PTOC 1G6ZA 1LTRD 2E76C 4A3GB 4KK7A 2PZUA 2IT1A 3IL8A 3Q6SA 1QOHA 4HAEA 1DYQA 1FNVA 3CKIB 2F0PA 4FO2A 1OXSC 1FNUA 3T51B 5C6AA 1NUCA 2KQ3A 3NHHA 5T1GA 1VMPA 4RWSC 3D6WA 1KNAA 4H7BA 2Q8IB 3R3OA 5CBEE 5C0XJ 2ZT9C 4K6DA 2CW0C 4L8JA 2NWGA 4C1NK 4UAIA 1ENFA 3QJYA 2WKCA 4DGZA 1R4QB 2IL8A 2AWOA 4FF1A 1E2WA 2NYZD 1Q3LA 2B8FA 3K7AB 5IIFA 3C3LA 2KVMA 5JVG3 3OMGA 4BY7B 2VXWA 3D4RA 2ZXPA 4X3SA 4ZKBB 2XN9C 2EYLA 1DOLA 1SNCA 4KN7C 4Q5VA 3P1HA 1X3PA 1S5DD 3I8ZA 4L63B 3H91A 4XYOA 1AZPA 4IFDJ 3J80E 1SYEA 2VB3X 3MVVA 1OXVA 4K14A 3BDCA 1CK1A 3T53B 1UUPA 1LTAD 2XRQD 1RD9D 1H9SB 3Q23A 1S5ED 2FMMA 2IJ0A 2AUJD 3J81E 1TY2A 5I6WA 1JORA 1GHKA 4Z9CB 3K5LA 4PMWA 5IGBA 5EKIA 2E74C 2F4IA 2F0OA 2K05A 1F2MA 4PV1C 5DM73 1X3QA 4IUTA 4OO1I 2F0LA 1JR0D 4UDUC 5I4DA 5C44B 1A3VA 2TMPA 2MJ8A 4HSPA 4K8IA 1WTXA 1QE6A 3VYSA 2BE5C 3PUXA 5K36G 1V1PB 1C48A 3DWPA 1JCKB 3QO2A 3KLRA 1EIHA 3S9WA 3J80L 1GOZA 3J7YW 5J1ZA 1XX8A 3QWNA 2JA6B 4XTCS 2OF1A 1U4RA 1TS3A 2KUMA 2ZXOA 3RZOB 3TZDA 1C8CA 5C4ZA 2MGSA 3J81L 1SE3A 3AU7A 4XT1B 4CKEA 3HOUB 4EGVA 1ONLA 1EZ8A 2E2DC 1V8QA 1S5CD 2K01A 3FMCA 3SK8A 2WP8J 2CW0D 2N55A 2R92B 3RLFA 5CV6A 3MZ5A 3PUWA 1CM9A 2V4DA 4PNYA 2MP1A 5M3FB 1JQYD 4JK1C 1S4ZA 1EYAA 2B2TC 5K36H 2JE6I 4C3HB 2EY5A 3KF8A 4OO1G 4BBRB 1EU4A 1F2ZA 4DU9A 4ZK9B 1D5ZC 1TWGB 1SNOA 4RGMA 2MUYA 3E0JA 1TWFB 3H0GB 3DHQA 3TP5A 2EY6A 1EFID 2A68D 1A3UA 4F88A 1WTVA 4CBVA 4RHSA 2EYJA 2VNUD 4PQXA 1EOTA 2DNCA 3C46A 4H44C 4V0BA 3G6JB 3NK9A 3SK5A 1D2BA 1HTPA 1EL0A 3HKZB 4K6LA 4L6TB 3A8KE 1O7ZA 3S17B 4ZUIA 5ELCA 4J6HA 1CT1D 2IX3A 2LFNA 1I6VC 5EBDA 5JPMC 1R9TB 5KYLA 2JEAI 3GTPB 4OGQC 1OXTA 4O1NA 1EYDA 4OO1H 1B44D 2CHBD 1F9SA 5A2QE 4HR7B 3K5MA 4HTHA 1GUOA 3VYTA 1JE4A 1Y8OB 5M5XB 2EDGA 3DWQA 2TSSA 5EKKA 3GQBA 3S16B 3BVGA 2F1MA 3LWUA 1TIID 4TRDA 3VR5A 2F0MA 3R8BA 1EY8A 1STGA 4QMGA 3BZDB 4X3TA 5T1IA 3I4MB 1TS4A 1SAPA 1LT6D 4RCNA 4FF4A 2WACA 5JEAG 1BQQT 1G2TA 1CFMA 1S5FD 1VF5C 1BNZA 4LJZC 2PZWA 4WRDA 2EYMA 4ZKCB 2IWHA 4KD3A 1EWCA 1WCMB 2D5DA 5JJZA 1H9JA 3HOZB 4G7HC 1VMCA 4KHVA 4ME5A 4WJWA 4K5VA 4K2LA 4EVOA 1SNMA 3ND9A 4ZQ3A 5EQ0A 4WFN3 5FLXE 1QJOA 2X6LA 3OOCA 4RGOS 2A69C 2R61A 1EYCA 2B2WA 1SEBD 3I72A 3OWFA 1NCVA 2PYKA 4MIUA 3NWSA 5IOCA 2Z1CA 2QCPX 3WOEA 3PUYA 1RTNA 4ZUJA 2EZVA 1MSHA 3IKJA 2N88A 1IL8A 3DWAA 4QUCA 2H1EA 2J0TD 4MN3A 3OPOA 5JEAH 2L4NA 4QUFA 2RKSA 4EQOA 5J22A 1T5XD 3MAQA 1TWCB 5K5PA 3NTIA 4EQNA 1TVXA 3GD7A 4F87A 4FXGC 3CQZB 3KK7A 2I07B 2D9UA 2IPKD 4TQUS 4RHRA 1PRTC 1W6KA 4X3KA 2F0UA 4ZAIA 2L55A 1STBA 4KTAA 2K7VA 5CORA 2L1BA 1CA5A 3SE0A 2AQ3B 5FLXL 4RKBA 3R2TA 1XTCD 1JWMD 4M8AA 2F0JA 2B2WC 3I4LA 4TSSA 3M3YB 1KTKA 4B9WA 1VCIA 4CKCA 4IUNA 2F0TA 5LL6S 3P20A 1Z6HA 1QB5D 1EQTA 3TSSA 2XIWA 3NTKA 1CZGA 4HCSA 2B2UA 1V43A 4NP5A 2O5IC 1J8IA 2XSCA 4ILWA 3OHXC 3NPPA 5C3XA 1SFOB 3X3MA 1B9NA 1AW7A 2QF7A 2KCNA 4IALA 2NTSA 3HEJA 3VA7A 1F2YA 5CYUA 5FK9C 2K1BA 3OWEB 3JAME 1I4QA 4M1UB 4ABNA 1O7LA 1QNUA 4CJ1B 3OIQA 4KMUC 4DXGA 5IGCA 1RODA 1CTMA 2PQEA 5C4XB 3BVMA 5IODA 1SE4A 3H09A 5JEAJ 1L0YB 2MHVA 2AQ1B 3HG9A 2Y0SB 2NBFA 3L7ZC 1PFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STY A;  2EYM A;  2ENB A;  1KDA A;  2EYJ A;  4PMB A;  5CC4 A;  3NXW A;  1A2T A;  4KD3 A;  4RKB A;  3NUC A;  2RBM A;  2M00 A;  3DMU A;  3TP6 A;  3EJI A;  4E6I A;  5IIF A;  5ISR A;  3OMC A;  1A2U A;  5I9O A;  1KDC A;  3C1F A;  3S9W A;  3NK9 A;  4KJN A;  3SHL A;  2EYO A;  2F0J A;  2F0N A;  3OMG A;  2F0E A;  4DFA A;  5J1Z A;  1SND A;  3BDL A;  3SK5 A;  4KHV A;  2OEO A;  5IGF A;  4ME5 A;  3U9O A;  2NUC A;  2OF1 A;  5CV8 A;  3C1E A;  4KY7 A;  4K5V A;  3TP7 A;  5CGK A;  5I9P A;  1IHZ A;  3RUZ A;  4K2L A;  4B9W A;  5JAV A;  3MEH A;  2F0D A;  3MHB A;  2F0G A;  1SNM A;  4EVO A;  3QOJ A;  4ZQ3 A;  4IUN A;  1SYG A;  2F0T A;  2EYL A;  2LKV A;  1JOK A;  4IZ8 A;  4QF4 A;  5F2D A;  1SNC A;  3D4W A;  4N9P A;  3D6C A;  3P1H A;  5KGU A;  5CR3 A;  2EYP A;  1EY7 A;  2EYF A;  4J1M A;  4K2K A;  1EY6 A;  2SNM A;  4HMJ A;  4WOR A;  4EQP A;  5C4Z A;  5J39 A;  4HMI A;  1SYD A;  2F0Q A;  5HGT A;  4NP5 A;  2HQE A;  5CV9 A;  1SYB A;  4PMC A;  1SYE A;  4ZUI A;  1TT2 A;  1KDB A;  4KY5 A;  4RKL A;  4J6H A;  3T13 A;  3ITP A;  1KAB A;  3MVV A;  4F7X A;  2F0W A;  4K14 A;  3VA5 A;  3V2T A;  1EYC A;  1STA A;  2EXZ A;  2OXP A;  3BDC A;  3ERO A;  1EZ8 A;  4I65 A;  3ERQ A;  4NDX A;  1SNQ A;  3HZX A;  3LX0 A;  5C5M A;  4B9X A;  5KIX A;  5KYL A;  5KYI A;  3P75 A;  3E5S A;  1TQO A;  2F0S A;  5C3X A;  5CV5 A;  5I6Y A;  5KRU A;  4NMZ A;  2PZU A;  2PYK A;  3OWF A;  4KJO A;  4MIU A;  4IAL A;  3HEJ A;  1EQV A;  5IOC A;  1F2Y A;  2SNS A;  3H6M A;  3D8G A;  3SK8 A;  5M9O A;  1TR5 A;  1EYD A;  3SK4 A;  5E3F A;  5JOB A;  4ZUJ A;  4QB4 A;  1SYC A;  3PMF A;  2PW5 A;  2SOB A;  4K8J A;  5IGD A;  1A3T A;  1JOO A;  1RKN A;  3D4D A;  5CV6 A;  4HTH A;  4S3S A;  2PW7 A;  5DEH A;  1EZ6 A;  1EY9 A;  1SNP A;  2O4X A;  3MZ5 A;  4G57 A;  2F0V A;  4ODG A;  5E1F A;  1JOR A;  5CV7 A;  5EKK A;  1II3 A;  2F0F A;  3QOL A;  5IGE A;  4PNY A;  2EY2 A;  5NUC A;  2F0P A;  5IGB A;  5C5L A;  2RKS A;  4EQO A;  5J22 A;  4TRD A;  3TME A;  1EYA A;  4KD4 A;  5IGC A;  2F0O A;  4KY6 A;  1NSN S;  1F2M A;  4NKL A;  5C6A A;  2PQE A;  3SXH A;  3QB3 A;  3SR1 A;  1NUC A;  5DAU A;  5K5P A;  2EY5 A;  2F0M A;  2KHS A;  1EY5 A;  2KQ3 A;  3NHH A;  4EQN A;  1EY8 A;  1EY4 A;  5IGG A;  1STG A;  1JOQ A;  1SYF A;  1F2Z A;  4DU9 A;  3OSO A;  4QMG A;  5IOD A;  4H7B A;  4ID6 A;  2F0L A;  5HUR A;  2F0I A;  1U9R A;  3NP8 A;  3R3O A;  4KV6 A;  1A3V A;  4R8N A;  3TP8 A;  5I6W A;  3EVQ A;  4N9T A;  1SNO A;  1STH A;  1AEX A;  4K6D A;  1EY0 A;  2F0K A;  2F0H A;  4K5W A;  4K8I A;  5EGT A;  5C4H A;  2PZT A;  5C3W A;  2WAC A;  2F3V A;  3NQT A;  3DHQ A;  5EKL A;  2EY1 A;  3TP5 A;  2RDF A;  3T16 A;  5KEE A;  1ENC A;  2EY6 A;  5CV4 A;  2QDB A;  4LAA A;  4OL7 A;  2F0U A;  4DF7 A;  4F8M A;  1KAA A;  3MXP A;  4K5X A;  4DGZ A;  1ENA A;  1A3U A;  4YIJ A;  2PZW A;  1STN A;  4WRD A;  2EYH A;  1STB A;  4KTA A;  3SK6 A;  2F3W A; 
#chains in the Genus database with same CATH topology
 4LW1 A;  1OTC A;  1N33 Q;  1XMQ L;  3M85 A;  3NUC A;  2A69 D;  3GV6 A;  3MXN A;  1X6O A;  5ISR A;  3AEV A;  3T4A C;  5HGQ A;  1F9R A;  2KA7 A;  1TKW B;  3HOX G;  1VQC A;  1DD2 A;  5H1S E;  2OEO A;  1MSG A;  5CV8 A;  3N6R A;  1BXT A;  5FKA C;  1MJE A;  1ZXT A;  3I91 A;  3GTJ B;  1E1T A;  3MEF A;  4WJ4 A;  4BY1 G;  2E2H H;  1O7Y A;  3V96 A;  1Q90 A;  4UP8 A;  3NQI A;  4J8Q A;  3S1R H;  1ASY A;  4A3G G;  1OXX K;  2E2I B;  5I2X A;  2NVQ H;  1KRT A;  1E3P A;  2ZM6 L;  4P73 A;  4R4C A;  1H9M A;  1B53 A;  1CI3 M;  4JI8 Q;  4Q0F A;  3ONA B;  2L0C A;  3JAM L;  4BBS B;  3K5N A;  2BA0 A;  3AQQ A;  4RKL A;  2NVY B;  4C3I B;  3MTS A;  4A3E B;  4PZ6 A;  2CVR A;  2NN6 I;  5M5Y B;  2WV6 D;  2Q2H A;  3VYU A;  1VQ7 A;  3W2D A;  1PRT F;  2F0S A;  3E5S A;  4HJ9 A;  2JA5 B;  1PH7 A;  2L12 A;  1MGS A;  4NMZ A;  3NEM A;  4MHE A;  4DNR B;  3DXJ C;  1IBM Q;  1U4P A;  1TR5 A;  1N32 Q;  3S15 B;  1HA5 A;  1UAP A;  4R1J A;  4RGT A;  3D3R A;  4K8J A;  4LF6 Q;  1ILP A;  3HOY B;  2NVT H;  2KCM A;  1PRT D;  1DON A;  2GVB A;  2R7D A;  2PW7 A;  3KBG A;  5CV7 A;  2YU9 H;  3HOV H;  2FFK B;  2IX1 A;  4J15 A;  1KL9 A;  5C5L A;  2C5C A;  3CCM A;  2ZXR A;  4BA2 I;  3QB3 A;  1Y14 B;  1HNZ Q;  2J7Z A;  3DM1 A;  2O5J C;  1T5E A;  3CC4 A;  4A93 B;  2NVX H;  3RMH A;  1E0B A;  3A54 A;  4C2M H;  3TBI B;  1WTP A;  1KLU D;  3NEL A;  1PZK D;  3HOX H;  1IBL Q;  3FPU B;  5EPJ A;  2F3V A;  4BY7 G;  4OL7 A;  4CDE C;  3E3X A;  4A3K B;  4FDB A;  5G3L F;  1ML0 D;  5FOB B;  1O78 A;  3S1M H;  5I6Y A;  1IBK Q;  1EYG A;  4A3G H;  2JXM B;  5KNB A;  2A6E D;  1HQR D;  2ENB A;  3TRE A;  4HED A;  1PRT B;  1ZEQ X;  2IX0 A;  1KLG D;  4DK1 A;  2KEC A;  3TDQ A;  4EX5 A;  1X3G A;  1G91 A;  1DXM A;  1GUG A;  1EEI D;  1MJC A;  4B3S Q;  1QCB D;  3U4Z A;  2JSO A;  5G3L D;  3L9A X;  3GTK B;  4H02 A;  2XWJ B;  3LGJ A;  1BDO A;  3RLN A;  1PH9 A;  5BR8 Q;  1TWA B;  2CFM A;  4POF A;  2F0G A;  2B39 A;  1WTO A;  4JI3 L;  5D3D A;  3E9H A;  4DAY A;  4FYD A;  3IFT A;  1PTO F;  5GAG C;  1E7Z A;  1I4G A;  1LAB A;  4DR1 L;  1PVO A;  2VW9 A;  2M2L A;  5J39 A;  4QIW E;  1HCZ A;  2K32 A;  4HMI A;  1LYL A;  2NN6 G;  4QGU A;  1BKB A;  1WVL A;  2A5H A;  1K73 C;  4CJ2 C;  3UDI A;  1PTO D;  2DGY A;  4L5R C;  4IUU A;  1RTO A;  5CBA E;  1QVF A;  3ZYY X;  2C9O A;  2F03 A;  2RDG A;  4A3K G;  4LFC Q;  2WAQ B;  3VR6 A;  1EQV A;  1CUK A;  4L5T A;  5CMD A;  3VR4 A;  5M9O A;  4JCV E;  4BXX G;  5JOB A;  2AWN A;  1ET9 A;  2SOB A;  5ELD A;  3PGZ A;  1GKH A;  5IWA L;  3HOW B;  1EZ6 A;  4U67 3;  1PH2 A;  3RD4 A;  1YNN C;  5C44 G;  1II3 A;  4GNX C;  3KF6 A;  2EY2 A;  1Y1V B;  4G7Z C;  1HR0 L;  2DNE A;  2H5X A;  2HUG A;  2E75 C;  2R93 B;  4KD4 A;  1VQ8 A;  3CP0 A;  1H9R A;  5ELF A;  2GN5 A;  4DV3 Q;  1EY5 A;  3PSI A;  4B3M L;  2JA8 H;  3URY A;  3TQY A;  4ID6 A;  1NR2 A;  2L9H A;  4QL5 A;  5FJ8 H;  3PIO 3;  4HN7 A;  1PTO B;  3QR8 A;  2CH4 A;  1CKN B;  3GTQ H;  2F0H A;  3PV0 A;  3LNN A;  1IW7 C;  5IP7 G;  3X3N A;  2B2V A;  5IYB H;  2JA6 G;  4K5X A;  1LO5 D;  1SJE D;  1LTI D;  3I70 A;  4GN3 B;  2XNA C;  1PFS A;  1NY4 A;  1G2S A;  4I7Z C;  1WD1 A;  3PF4 A;  1VQF A;  2B8G A;  4DR2 Q;  2Q8R E;  3DMU A;  5D14 A;  1Q1E A;  1J9O A;  3C1F A;  5FLX c;  2NN6 H;  5M3M B;  1IKL A;  1A62 A;  5I2Y A;  2G9H D;  4A3C H;  1N34 Q;  2E5L Q;  1AP0 A;  3HOU G;  2K52 A;  1RL2 A;  3J81 i;  5BN4 A;  4GOP B;  2XVS A;  1FVI A;  1K8O A;  3TRZ A;  1BCP C;  3S2D H;  5DLQ E;  1B70 B;  4GKK L;  2HT1 A;  1JOK A;  4XQQ A;  3NBH B;  4BXX H;  3GTL B;  1Q1B A;  1SR3 A;  4FF2 A;  2SDF A;  4X66 Q;  5FO7 B;  2RSO A;  4WOR A;  1LTS D;  4EQP A;  4DNT B;  3CRL C;  2F0Q A;  3SEB A;  1BR9 A;  1WJJ A;  1DM0 B;  2R92 G;  4IPG A;  3R93 A;  4RFB A;  1N33 L;  5KYI A;  5GAE C;  3MFY A;  4YWM A;  1YHA A;  3FPP A;  1F2L A;  1WTR A;  1M1K C;  1W6J A;  1TQO A;  5M3F G;  4RMF A;  2DY7 A;  2E2J B;  2XWB B;  1I4H A;  3PUV A;  2HCC A;  4XT3 B;  1BO0 A;  4C3H G;  1P16 A;  2PNH A;  2CCZ A;  1UEA B;  3U9S A;  4BBR G;  4OWT B;  3CU7 A;  1S40 A;  2EJG C;  2B2V C;  2HIX A;  4MTN A;  4KLK A;  3WWV A;  1N36 Q;  3I3C A;  1D1I A;  4R4Q A;  5IP7 H;  5NUC A;  4JI8 L;  3VR3 A;  2JA6 H;  1TXY A;  4DV1 Q;  3H0G G;  4KKT A;  4FNF A;  1NMF A;  4KY6 A;  1LTB D;  4G7O C;  4JI5 Q;  1AFP A;  3L3O C;  1MBY A;  3QG1 A;  1VQI A;  1YIT A;  1PA6 A;  5E4W C;  1QNK A;  2WB1 B;  4R4O A;  2Q8T A;  1I94 L;  2PMZ E;  3DEP A;  1WYD A;  1NMG A;  3RZO H;  4KV6 A;  1L1O C;  4R8N A;  3S1N H;  1STH A;  1AEX A;  3V05 A;  2F0K A;  1F9Q A;  4KI0 A;  1VQN A;  5FO8 B;  5E7N A;  3NQT A;  1N32 L;  3BYT B;  2BE5 D;  3HOU H;  4LF6 L;  3N52 A;  4RG1 A;  5GAD C;  5D3I B;  3MA2 B;  3P7J A;  3D8G A;  2F3W A;  4H0L C;  2D62 A;  2A6H C;  3HKZ G;  3A56 A;  4LK1 C;  1LT5 D;  1TU2 B;  1YZ6 A;  1D5M C;  3KLS X;  4GZY C;  1HUN A;  2LMC B;  1VS0 A;  4XIG S;  4DV4 Q;  4DFA A;  2X69 A;  1QUQ B;  3RZD B;  4IFD I;  2KEE A;  3A8I E;  4BWG B;  1GUW A;  1HUM A;  2N8N A;  2Z6K C;  2WIN B;  4JI2 L;  1B2T A;  2Z8L A;  2F0D A;  3M4Q A;  1CA6 A;  5M3F H;  3S2H B;  3G7L A;  1SXT A;  1L0X B;  1U0L A;  1X32 A;  1E2V A;  2LKV A;  3FDT A;  5AJ3 L;  5JPN C;  5F2D A;  1Y8P B;  5LL6 X;  5CR3 A;  2EYP A;  4C3H H;  1NJI C;  3HP3 A;  4OX9 L;  2B2Y A;  1YNN D;  3TS2 A;  5HGT A;  5IY0 A;  1EEF D;  2RDH A;  4ZRZ A;  4A3M B;  1F9P A;  1IBK L;  4LF4 L;  4FVM A;  3JAM c;  1I50 B;  1H9S A;  2K6A A;  1I6H B;  2QKI C;  1TWG H;  3D31 A;  2OXP A;  2KED A;  3ERO A;  2KEN A;  3D0F A;  1S5B D;  1TWF H;  3H0G H;  2BOS A;  4CJ0 B;  4QIW B;  2VS1 A;  2D2C C;  1PH8 A;  4IQZ A;  3KUP A;  3I4N H;  3PMF A;  4YHH L;  1HXY D;  1PXU A;  1IW7 D;  2KCC A;  2O4X A;  1LAC A;  2F0V A;  3HRZ C;  1OO9 B;  1FYC A;  3J7A 5;  2RSN A;  3I4M G;  1A6X A;  3TZU A;  1VQJ A;  1PYS B;  3KOJ A;  4BS9 A;  1MIU A;  3SXH A;  1AH9 A;  3K7U C;  3E0E A;  3GTM B;  1NBW A;  1BCP F;  4DV2 L;  2JEB I;  3S14 B;  4GNX B;  4XYQ A;  1H9K A;  3M7N A;  1WCM G;  4LFC L;  4JOI A;  1OXU A;  1V1P A;  3GTO H;  1NE3 A;  1EWI A;  3HOZ G;  1IYU A;  1B3Q A;  2NB0 A;  2OTJ A;  1BCP D;  3QIA A;  4DF7 A;  1N8R C;  3C2P A;  1XPR A;  1R9T H;  1EOV A;  4JYA Q;  1I4R A;  1SMY C;  3FEW X;  1I4X A;  4L5S A;  2EQS A;  2EJM A;  3GTP H;  1XNQ Q;  2VB2 X;  2OQ0 A;  1ESF A;  4ZYS A;  1CHP D;  4C3J B;  5I9O A;  1KDC A;  4N8X 1;  1Q12 A;  1CQV A;  3KFU A;  4NW2 A;  4JI3 Q;  1WI5 A;  3G4S A;  4IFD G;  3TN2 A;  4RCO A;  1Q8K A;  1Y8N B;  1KNE A;  1VQL A;  5M5X H;  1U4M A;  4LUV A;  4DR1 Q;  4JG2 A;  1I4P A;  2UUC Q;  5JAV A;  1X56 A;  5EPK A;  4A3J B;  3S16 H;  3QOJ A;  1Y69 U;  4JI0 Q;  1B7Y B;  1STE A;  4P2C B;  3J7A F;  2AMC B;  4HCE A;  3KBX A;  4X3U A;  1JT8 A;  2SNM A;  3VYR A;  2KHJ A;  1SYB A;  4DA2 A;  3LWE A;  1BVS A;  1X65 A;  1BCP B;  3T56 B;  3VA5 A;  3EFX D;  1SNQ A;  1PH4 A;  1DCZ A;  1JIC A;  4JBW A;  3S1R B;  2IW3 A;  2NVQ B;  4KJO A;  4XDX A;  5D65 A;  4DR4 L;  3IFD A;  2ZJR A;  2EJF C;  1EUJ A;  4QB4 A;  2PW5 A;  4CDF C;  1A3T A;  1UE5 A;  1JOO A;  4OIK A;  1SMX A;  4S3S A;  5AFW A;  1CKO A;  1JB3 A;  2EE1 A;  1DOK A;  4G57 A;  4IUP A;  3M4O B;  3F2B A;  3RR5 A;  5IT9 E;  2XRS D;  4A3B H;  1O7I A;  5IGE A;  1JMC A;  1B8A A;  1D5X C;  3G6E A;  1B3A A;  4X66 L;  1XYI A;  2VL6 A;  3B6Y A;  3FKI B;  4JVZ A;  3IAY A;  2MQH A;  2GA4 B;  3EIV A;  3ER0 A;  1JE5 A;  1UE1 A;  2Z6B A;  1EIF A;  3ND8 A;  1EY4 A;  5IGG A;  2MNA A;  1PYW D;  3AB9 A;  3STB C;  2HIV A;  1ZYR C;  4ZLT F;  3HOV B;  3I90 A;  4P71 A;  1SN8 A;  3SVM A;  3KF8 B;  5EKL A;  1XPU A;  1GVP A;  2PMZ B;  2QEJ C;  4O42 A;  1ENA A;  4R8I A;  2VUM H;  3E6Z X;  2EYH A;  1GM5 A;  2VZA A;  4C2M B;  5EPL A;  4AYB B;  4CDC C;  3H15 A;  1N36 L;  1A2T A;  5JJI A;  2RBM A;  2M00 A;  3CPF A;  4DAV A;  4A3L G;  4E6I A;  1Y1W H;  4DV1 L;  3OMC A;  3PCO B;  1U4L A;  4V19 0;  2F0N A;  4A3I B;  4A3F B;  2A1A A;  3BDL A;  3SDZ A;  1AE2 A;  3DUZ A;  3HGB A;  4IO9 A;  1PZI D;  4KY7 A;  3S1M B;  1E2Z A;  1SE2 A;  3RUZ A;  3NBI A;  1IYJ B;  2QDL A;  3MXG A;  1BOS A;  4IN3 A;  1MI2 A;  2B63 B;  1C4Q A;  1TWC H;  1NR4 A;  3WDN A;  5KGU A;  1IXR A;  3VR2 A;  4J1M A;  1V1O A;  1HHV A;  2B2U C;  3CCU A;  2SEB D;  4HID A;  4PMC A;  2A19 A;  1V9P A;  3H94 A;  1KDB A;  3A7A B;  4UPA A;  3ITP A;  4F7X A;  5IT9 L;  2WKD A;  2HDM A;  2K33 A;  4I65 A;  5E4X A;  5KIX A;  5C5M A;  4X64 Q;  3ICE A;  4Y7N B;  5CV5 A;  4CDD C;  4DN4 M;  2FIN B;  3CF5 A;  4IUQ A;  4C1N I;  2LY7 A;  4DV4 L;  1A15 A;  3CRK C;  2BDN A;  2SNS A;  2Z4I A;  3SK4 A;  5C4X G;  3U50 C;  5C4J H;  1RF2 D;  2D0O A;  2DY8 A;  5DEH A;  3F2U A;  3U9O A;  2G9D A;  4DR3 Q;  3A7L A;  1PFB A;  2NZ1 D;  3A5Z B;  5KND A;  3AMU A;  2L15 A;  4OIJ A;  3OIP A;  1NAP A;  1FJG Q;  2I5L X;  1SMY D;  2ID0 A;  1I94 Q;  1FR3 A;  3M3Y H;  2EOT A;  1NSN S;  2F52 A;  2X6G A;  5COY A;  3UDX A;  1IKM A;  2Y0S G;  2XTI A;  1JJ2 A;  4A3L H;  1EU3 A;  1GXD C;  3BYY B;  3GTG B;  3NP8 A;  3H3V I;  3HKZ E;  2VQE Q;  1XJV A;  3W1G A;  4GKJ L;  4CHT B;  5KNC A;  5C3W A;  5M5W H;  1YVC A;  5A35 A;  1XNR L;  2RDF A;  3T16 A;  1HH2 P;  1BBX C;  4KHP Q;  1STN A;  4JBK A;  2A68 C;  2JA8 B;  1CZW A;  1K3R A;  1D1K A;  1KDA A;  5CC4 A;  3NXW A;  3RLO A;  3GTQ B;  4LF5 Q;  4JI2 Q;  4BBS G;  2EYO A;  2FJ2 A;  4IOA A;  3BS1 A;  5AJ3 Q;  4C3I G;  4LF9 Q;  4A3E G;  3A55 A;  4DKA C;  5I9P A;  2BH2 A;  3MEH A;  3JAM i;  4OX9 Q;  4BY1 H;  1FGU A;  2JJQ A;  3KYH C;  4LF4 Q;  2JA5 G;  4QF4 A;  2D0P A;  1VF7 A;  3BG3 A;  3WOF A;  2R3Z A;  2I46 A;  1EY6 A;  1HRJ A;  3MC0 B;  4PG3 A;  2ZJP A;  2RQX A;  3HOY G;  4JYA L;  4JI4 L;  2Z4H A;  1XNQ L;  1QIL A;  4HIK A;  1HZC A;  2MO1 A;  4LF8 Q;  3ERQ A;  4YCW A;  4JV5 Q;  3S2D B;  4YHH Q;  1PLF A;  1SBB B;  3STB D;  2EPB A;  1ZYR D;  1K8M A;  1FNW A;  4A93 G;  4G4K A;  2UUC L;  1AN8 A;  3K59 A;  3GP7 A;  5E1F A;  1TS2 A;  4JI0 L;  4LF7 Q;  1S72 A;  3E9I A;  2HHH L;  1VQD A;  4DV2 Q;  1ICF B;  1CSQ A;  4FF3 A;  1ET6 A;  4OWX B;  3W1B A;  3I55 A;  1C7Y A;  3A8J E;  3O13 A;  3GTJ H;  3PO3 B;  2ALY B;  3SR1 A;  2B2T A;  5DAU A;  4YCV A;  3K6O A;  2R7Z B;  2E2I H;  4IJL A;  3BVZ A;  1LLR D;  2YTX A;  4DUZ Q;  2BCO A;  4N9T A;  1HR0 W;  1VQM A;  3K7A H;  4XQJ A;  1EY0 A;  3FRP B;  3MFG A;  5EGT A;  2PZT A;  5IP9 G;  1D6E C;  2NVY H;  4C3I H;  1FD7 D;  2IY5 B;  4BY7 H;  1F77 A;  5CV4 A;  3K81 C;  4FXK C;  3MXP A;  4KN4 C;  1ASZ A;  2RVL A;  3K0X A;  1K3B C;  4B3R L;  2ICE C;  3HS0 C;  1KQS A;  2JA5 H;  4PMB A;  1EWH A;  3S1N B;  2Q2T A;  3Q24 A;  4QCL A;  3EJI A;  5LMN W;  1A2U A;  4K0K Q;  3SHL A;  1KD1 C;  3HOY H;  3BJU A;  2KJX A;  2QIL A;  1B4O A;  1YJN A;  1PDQ A;  1QWY A;  3TP7 A;  3A74 A;  1IHZ A;  1JWS D;  3T1H Q;  3I2Z A;  1XTD A;  1LTG D;  2K04 A;  3NTH A;  3PO2 B;  2KBN A;  1GHJ A;  3UI2 A;  3S1Q B;  2G5D A;  1JC7 A;  5EBC A;  4N9P A;  3PIO A;  2WAQ G;  2EYF A;  3VDY A;  2VY3 A;  3IRB A;  4NXM Q;  2K03 A;  1SYD A;  2J4X A;  2PCF B;  3G48 A;  5CV9 A;  2B29 A;  1X9N A;  4KY5 A;  4LUO A;  1X3F A;  1KAB A;  1FGB D;  2L5T A;  4DR4 Q;  1ESR A;  3HOW G;  3V2T A;  1STA A;  4XXE A;  3LX0 A;  4RGN A;  3P75 A;  1Y1V G;  5KRU A;  1UWV A;  4PZ8 A;  4ZCK A;  2Q2U A;  1CHQ D;  4A3K H;  2R93 G;  2Z0S A;  4HIO A;  2UXB L;  5E3F A;  3H3V H;  1SYC A;  1HPC A;  3Q22 A;  3FVQ A;  3UDG A;  5IGD A;  4RA8 A;  1EY9 A;  1SNP A;  4ODG A;  5IYD G;  4GLV B;  1DOM A;  5IP9 H;  4DR5 L;  5C44 H;  1LT4 D;  4CGY B;  2OQK A;  1G6P A;  4IPD A;  3CHB D;  1SDF A;  5FLM G;  2JYO A;  2MPM A;  5BN5 A;  3I4N B;  3KLS A;  2M9V A;  2ZTE A;  2ZTC A;  3BZC A;  1KRS A;  2R7F A;  3OSO A;  5LHY 1;  4X64 L;  2HQL A;  5HUR A;  2K75 A;  3TP8 A;  1KXL A;  1HQM C;  1XXG A;  1AZQ A;  2LXK A;  3U58 A;  4C56 C;  5M3M G;  1KHI A;  1YNJ C;  4P74 A;  4HSV A;  5C0X I;  1UNS A;  2QDB A;  4LAA A;  5DM6 3;  4A76 A;  3NE5 B;  4IUR A;  4O0A A;  1HTL D;  3SK6 A;  2JP1 A;  4DR3 L;  2F4V L;  1FJG L;  3K0Y A;  1WTQ A;  3ULJ A;  3CCJ A;  3GTO B;  4KJN A;  5ELB A;  4TKO B;  2F0E A;  3BU2 A;  1SND A;  1GJX A;  4OHJ A;  3HOW H;  1LTT D;  3MXN B;  1HA6 A;  1Y1V H;  5ELN A;  2VQE L;  1TY0 A;  2ATW A;  3CAM A;  4HJ5 A;  1B9M A;  2R93 H;  3I56 A;  3D4W A;  2RHQ B;  2K5V A;  4K2K A;  4DPG A;  4DXF A;  1K8G A;  1CKM A;  1PZJ D;  2FHT A;  4KHP L;  1RHP A;  5JJK A;  4Y52 H;  1M8A A;  1TT2 A;  3T13 A;  2R92 H;  1PTO H;  4XQN A;  3I73 A;  1K83 B;  4DAP A;  2EXZ A;  1MKH A;  3EA6 A;  4YWL A;  3HZX A;  2RCN A;  4LMQ D;  3S24 A;  5IT9 c;  4LF5 L;  1ICW A;  1HNX Q;  1EIG A;  3K58 A;  2JA7 B;  3KJP A;  3CCE A;  2H4O A;  3H6M A;  3GO5 A;  2DN8 A;  4A3D B;  1YBY A;  4LF9 L;  2OCE A;  4OEM B;  2CQA A;  5TSS A;  2Y0S E;  4POG A;  1PFN A;  1VQB A;  3K8A A;  1SSO A;  1RKN A;  3D4D A;  2WB1 G;  4BBR H;  1EFW A;  1H95 A;  1IL2 A;  1E22 A;  2KOL A;  1VQP A;  3AFQ A;  1ZKO A;  4UY8 C;  5M3M H;  2F0F A;  2HCI A;  1HZB A;  1SE8 A;  4A4I A;  1G29 1;  2L11 A;  5LMU L;  3J7A V;  3G71 A;  1DGS A;  4NKL A;  3I7F A;  2PNR C;  1XWE A;  2BDO A;  3BDO A;  2A73 B;  3R2I A;  4NPS A;  2R6G A;  4GKJ Q;  1YHB A;  1I3Q B;  4ULL A;  4CKB A;  3U4V A;  1Q46 A;  4LF8 L;  1QZH A;  4JV5 L;  1XNR Q;  1IYV A;  5JVH 3;  3GV3 A;  1Z7T A;  1DZ1 A;  1U9R A;  1PMR A;  4KHZ A;  3GTL H;  1SJH D;  3CPW A;  4A3B B;  3EVQ A;  1G8Z D;  1RJT A;  3PIP 3;  3OYY A;  1TWH B;  1Z47 A;  3AYH B;  3UE0 A;  2Q2I A;  1S3O A;  5C0X G;  1QG7 A;  5KEE A;  4UP7 A;  3M4Y A;  4RH6 A;  4YWK A;  2ICI A;  3OTO L;  4LF7 L;  2K5W A;  3KJO A;  3DEO A;  2E2J H;  4KKU A;  5A2Q L;  1B1Z A;  2FMC A;  3NSW A;  1TS5 A;  1QVC A;  3S17 H;  1VQH A;  1KAW A;  2P5Z X;  5IGF A;  2AQ2 B;  4ALP A;  4A3M G;  2BA1 A;  2VUM B;  5CGK A;  1WD0 A;  3MWY W;  1L2F A;  4DUZ L;  4LFA Q;  1LV9 A;  4B3T L;  4JI4 Q;  1Y1W B;  1C9O A;  4FP5 D;  3CD6 A;  3D6C A;  4U68 A;  2B2Y C;  1VQG A;  1HFG A;  4HMJ A;  1E24 A;  2A74 C;  2QGQ A;  4DAY B;  5DNF A;  1LT3 D;  3TEH B;  5J3B A;  2F0W A;  2E8G A;  2ZTD A;  4LFB L;  3K57 A;  4PZ7 A;  3NWT A;  1VDZ A;  5C3E B;  2QEX A;  2PO4 A;  1Q8I A;  5L37 A;  3Q0A A;  4K0K L;  3ULL A;  3MXU A;  3CCS A;  5ELO A;  4R9W A;  5EAY A;  1RCV D;  2HHH Q;  3T1H L;  2OT2 A;  4B08 A;  4MTK A;  1B50 A;  1YNJ D;  3H3V C;  2PPB C;  5C0X H;  2O2L D;  3QOL A;  3I4M H;  2E2H B;  3BZK A;  4NXM L;  1RDP D;  5BN3 A;  2HDL A;  1LM0 A;  3TME A;  1HNW L;  5JJL A;  1BF4 A;  1CKN A;  5C4J B;  1DJR D;  2AUK A;  1R4P B;  2KHS A;  3W3A A;  2UU9 L;  1JWU D;  4BA1 I;  1CSP A;  2RA4 A;  2LS0 1;  1O80 A;  1JOQ A;  1SYF A;  4GN5 A;  4H13 C;  4P72 A;  5FO9 B;  2UXD L;  1GUN A;  1HFN A;  2F0I A;  3CC2 A;  1MD2 D;  4JOI C;  4QY7 A;  4C3J G;  1WCM H;  4K5W A;  2HD3 A;  5C4H A;  2OTL A;  4B3R Q;  4X6A H;  3M7G A;  2EY1 A;  1I50 H;  3HOZ H;  1ENC A;  2WII B;  4F8M A;  3A5U A;  4FXD A;  1I6H H;  1KAA A;  4DV7 L;  1M4V A;  4YIJ A;  2A6H D;  4A3J G;  1STY A;  1PH1 A;  3ULP A;  4N8F A;  4RAU C;  2NVT B;  2A6E C;  1YNX A;  3TP6 A;  1WTW A;  3PF5 A;  1ILQ A;  2YYZ A;  4X65 L;  4GOP A;  2WAQ E;  5M5W B;  1JJC B;  4QJF A;  3F1Z A;  5ELE A;  3RNU A;  1D8L A;  2YU9 B;  2K5Q A;  4IFD H;  3K5O A;  2NTT A;  1GUT A;  1K28 A;  2NUC A;  3NBH A;  3C1E A;  2IHE A;  1M90 C;  3EQL C;  4IUV A;  2N3S A;  1BUV T;  2K50 A;  5EJW A;  3MHB A;  2CQO A;  1PHJ A;  1QZG A;  1G51 A;  1SYG A;  2RF4 A;  4L5Q A;  1L1O B;  2NVX B;  4IZ8 A;  4DK3 C;  2K28 A;  1GUS A;  1EY7 A;  4DK0 A;  3GTM H;  1I5F A;  3HOX B;  2HQE A;  4KKS A;  1CQF A;  3PUZ A;  1XMO Q;  2UXB Q;  4DV0 L;  4BY1 B;  4NDX A;  4B9X A;  2K5D A;  2EVB A;  1WFQ A;  3OW7 A;  1PTO C;  1G6Z A;  1LTR D;  2E76 C;  4A3G B;  4KK7 A;  4IPH A;  1YJ9 A;  3HFZ B;  2PZU A;  2IT1 A;  5GRO A;  2DUD A;  2K14 A;  3IL8 A;  3FKI G;  4DNI A;  3Q6S A;  4DR5 Q;  1QOH A;  4HAE A;  3Q8D A;  3L2P A;  1DYQ A;  2LXJ A;  4C3J H;  1FNV A;  3CKI B;  3CQZ H;  3HOV G;  2KCT A;  1WTH A;  2F0P A;  2NZH A;  4FO2 A;  1OXS C;  4DR6 Q;  1FNU A;  4GLX A;  3T51 B;  5C6A A;  1J5E L;  4A3J H;  1NUC A;  2AHO B;  1D7Q A;  2KQ3 A;  3NHH A;  5T1G A;  1VMP A;  4RWS C;  3D6W A;  4GOP C;  1KNA A;  4AYB G;  4H7B A;  2Q8I B;  3R3O A;  5CBE E;  1HNX L;  5C0X J;  2N49 A;  2ZT9 C;  4K6D A;  2CW0 C;  4L8J A;  2NWG A;  3UDF A;  4C1N K;  4UAI A;  4A3I G;  4A3F G;  1ENF A;  2F4V Q;  3QJY A;  4JW0 A;  2WKC A;  2MO0 A;  4DGZ A;  1R4Q B;  1KC8 C;  3L0O A;  2VQF Q;  2IL8 A;  3UE1 A;  2UUA Q;  4DV6 L;  2AWO A;  1QUQ A;  2B63 G;  1BBW A;  4FF1 A;  1P8L A;  1E2W A;  2F3I A;  2NYZ D;  4DUY L;  1Q3L A;  2B8F A;  3K7A B;  5IIF A;  3C3L A;  2KVM A;  5JVG 3;  3OMG A;  4BY7 B;  2VXW A;  2I5H A;  3D4R A;  3M4O H;  2ZXP A;  5IE8 A;  4X3S A;  1JJG A;  4ZKB B;  2XN9 C;  2EYL A;  1DOL A;  1J6Q A;  1SFO H;  2YV5 A;  1SNC A;  4KN7 C;  3FKI H;  4Q5V A;  3P1H A;  1EIY B;  1X3P A;  1S5D D;  3I8Z A;  4L63 B;  3H91 A;  4XYO A;  1AZP A;  4IFD J;  3J80 E;  1SYE A;  2GVA A;  3MVV A;  2VB3 X;  1OXV A;  2I5M X;  2WB1 E;  4K14 A;  3BDC A;  1HJP A;  1CK1 A;  3T53 B;  1UUP A;  1C0A A;  1LTA D;  3CME A;  1VQ5 A;  2XRQ D;  1RD9 D;  2RCF A;  1H9S B;  3Q23 A;  2ES2 A;  4JI7 Q;  1S5E D;  5C4X H;  2FMM A;  2N78 A;  2IJ0 A;  2AUJ D;  3J81 E;  1TY2 A;  3W5O A;  5I6W A;  5LMU Q;  1EQR A;  4LFA L;  1JOR A;  2OWO A;  1GHK A;  4Z9C B;  3M4P A;  3K5L A;  4JI6 Q;  1WOC A;  4A3I H;  4PMW A;  4A3F H;  5IGB A;  3TS0 A;  1VQK A;  4JC0 A;  4GNX A;  5EKI A;  2E74 C;  2F4I A;  4AIM A;  2F0O A;  1AE3 A;  2K05 A;  1F2M A;  4PV1 C;  3SGI A;  4NXN Q;  2JQO A;  2B63 H;  5DM7 3;  2JA8 G;  1X3Q A;  4IUT A;  1VQ9 A;  1XPO A;  4OO1 I;  2F0L A;  1JR0 D;  4UDU C;  5I4D A;  5FJ8 G;  5C44 B;  1A3V A;  2TMP A;  5HY6 A;  3OTO Q;  2MJ8 A;  3FHW A;  4HJA A;  4HSP A;  4K8I A;  1WTX A;  1QE6 A;  3VYS A;  5IYB G;  1YEZ A;  2DJF C;  2CKZ B;  2I0Q A;  2BE5 C;  3EBE A;  2XGT A;  3PUX A;  4Y7N H;  5K36 G;  1V1P B;  1A63 A;  1PH5 A;  1C48 A;  3DWP A;  4TVA B;  1JCK B;  4JI1 Q;  3QO2 A;  1VQA A;  3KLR A;  1EIH A;  3AFP A;  3S9W A;  1W3S A;  3J80 L;  4HJ8 A;  4A3C G;  1GOZ A;  2UXC Q;  4BBS H;  4GS3 A;  5J1Z A;  3J7Y W;  1PH6 A;  1XX8 A;  4B3T Q;  3QWN A;  2JA6 B;  4XTC S;  2OF1 A;  4P75 A;  2RHS B;  1U4R A;  1TS3 A;  5GAH C;  4AQY Q;  4A3E H;  5M5Y H;  2KUM A;  2ZXO A;  1LUZ A;  4IPC A;  4LFB Q;  3RZO B;  3TZD A;  1C8C A;  1X3E A;  2DJG C;  5C4Z A;  2MGS A;  2B3G A;  3J81 L;  3F8T A;  1SE3 A;  3S15 H;  3AU7 A;  4XT1 B;  4X62 Q;  4CKE A;  3GTG H;  1LTL A;  3HOU B;  1UE7 A;  2AKW B;  4EGV A;  1ONL A;  1EZ8 A;  2E2D C;  5IYC G;  1V8Q A;  4R4T A;  3PQI A;  3CXC A;  1S5C D;  2K01 A;  3FMC A;  2QW7 A;  3CCQ A;  3SK8 A;  3PO3 G;  3DLL A;  2WP8 J;  4NB3 A;  2CW0 D;  4UP9 A;  2N55 A;  2R7Z G;  4A93 H;  2R92 B;  3RLF A;  5CV6 A;  3MZ5 A;  4LUZ A;  3KDF B;  1HNW Q;  5LMN L;  1YHQ A;  4APV A;  3PUW A;  1CM9 A;  2V4D A;  2UU9 Q;  1K0S A;  4PNY A;  2MP1 A;  5M3F B;  1JQY D;  4JK1 C;  2UXD Q;  1S4Z A;  4DV5 L;  1EYA A;  4HJ7 A;  2B2T C;  2PQA B;  3FP9 A;  3J80 i;  1BBU A;  5K36 H;  2JE6 I;  4C3H B;  2YTV A;  2EY5 A;  1XMO L;  4DR7 L;  1A0I A;  3KF8 A;  4OO1 G;  4BBR B;  1EU4 A;  1F2Z A;  2NZO A;  4DU9 A;  2FXQ A;  2CWA A;  4ZK9 B;  1D5Z C;  4DV7 Q;  1TWG B;  1SNO A;  1L1O A;  4RGM A;  2MUY A;  3E0J A;  1FL0 A;  1TWF B;  3H0G B;  1JB7 A;  1NTG A;  3DHQ A;  3TP5 A;  1VQ6 A;  2EY6 A;  3GTK H;  1EFI D;  2A68 D;  4YY3 Q;  1A3U A;  4F88 A;  4X65 Q;  1WTV A;  3JC6 6;  4CBV A;  1Q81 C;  1VQO A;  1TWA H;  3PO2 G;  4RHS A;  2EYJ A;  2VNU D;  4O2D A;  4PQX A;  5GQO A;  1EOT A;  2DNC A;  3C46 A;  4DR6 L;  4H44 C;  4V0B A;  3G6J B;  3NK9 A;  2ASB A;  2Z9H A;  3SK5 A;  1D2B A;  5IYC H;  4ME3 A;  4JPB W;  1NNX A;  1HTP A;  2Z6K A;  4I7A A;  1EL0 A;  3HKZ B;  4OXP A;  4K6L A;  4L6T B;  3PO3 H;  4DV0 Q;  3A8K E;  1O7Z A;  2PI2 A;  3T1Y Q;  3S17 B;  1W2B A;  2R7Z H;  2UUB Q;  2VQF L;  4ZUI A;  5ELC A;  4J6H A;  2UUA L;  1CT1 D;  2IX3 A;  2LFN A;  1I6V C;  5EBD A;  5JPM C;  2V1C C;  1R9T B;  5KYL A;  1IZ6 A;  2JEA I;  2EIF A;  3GTP B;  2JK8 A;  4OGQ C;  1OXT A;  4O1N A;  1YJW A;  4GN4 B;  1EYD A;  4OO1 H;  1B44 D;  2CHB D;  3I4N G;  4OWW B;  1F9S A;  5A2Q E;  4HR7 B;  1K8A C;  3CC7 A;  1VQE A;  3K5M A;  3I4O A;  2LSS A;  4HTH A;  1GUO A;  1N9W A;  1JE4 A;  1Y8O B;  3VYT A;  5M5X B;  1IBM L;  4AYB E;  5IYD H;  1J5E Q;  2EDG A;  3DWQ A;  2TSS A;  5EKK A;  3GQB A;  1XMQ Q;  3S16 B;  3OW2 A;  1GO3 E;  3BVG A;  1RIP A;  2F1M A;  3LWU A;  2EXD A;  1TII D;  2KHI A;  4TRD A;  3VR5 A;  1E1O A;  4AH6 A;  5FLM H;  3PO2 H;  2F0M A;  2CH4 W;  3S1Q H;  3R8B A;  1EY8 A;  3CCR A;  1STG A;  4QMG A;  3BZD B;  4X3T A;  3NEN A;  5T1I A;  3CCV A;  3I4M B;  2BH8 A;  1HNZ L;  1TS4 A;  1SAP A;  1LT6 D;  1YIJ A;  2YTY A;  4RCN A;  4DV6 Q;  4FF4 A;  2WAC A;  4YCU A;  1BQQ T;  5JEA G;  2ZM6 Q;  4JI7 L;  2JA9 A;  2A8V A;  1U5K A;  1G2T A;  1CFM A;  4DUY Q;  1S5F D;  1VF5 C;  1BNZ A;  4GLA C;  4LJZ C;  2PZW A;  4MNO A;  4WRD A;  3KLW A;  1IBL L;  3K80 C;  1VQ4 A;  2EYM A;  2PI2 E;  1HZA A;  4ZKC B;  3CMA A;  2QA4 A;  4JI6 L;  2IWH A;  4KD3 A;  1EWC A;  1A8V A;  1WCM B;  2D5D A;  5JJZ A;  1H9J A;  3HOZ B;  4NXN L;  2K5N A;  4G7H C;  1VMC A;  4KHV A;  1Q7Y C;  4ME5 A;  4WJW A;  1SRU A;  4K5V A;  4HIM A;  4K2L A;  1PYB A;  4B3S L;  4EVO A;  1SNM A;  3ND9 A;  4JBJ A;  4ZQ3 A;  4MZ9 A;  5EQ0 A;  4WFN 3;  2JA7 G;  5FLX E;  1QJO A;  2X6L A;  5BR8 L;  3PIP A;  4A3D G;  3OOC A;  4DAM A;  4RGO S;  2A69 C;  2R61 A;  1GD7 A;  1EYC A;  3EN2 A;  1K0R A;  4JI1 L;  2B2W A;  1Q86 C;  1SEB D;  3I72 A;  1YI2 A;  3CW2 C;  3OWF A;  1NCV A;  2PYK A;  2UXC L;  4MIU A;  3NWS A;  5IOC A;  2Z1C A;  2QCP X;  3WOE A;  3PUY A;  1RTN A;  4ZUJ A;  3F2D A;  4AQY L;  2EZV A;  1MSH A;  3IKJ A;  4EQ5 A;  2N88 A;  1IL8 A;  3DWA A;  4QUC A;  2IHF A;  2H1E A;  3ZJY C;  2J0T D;  1T9H A;  2MFI A;  4MN3 A;  3OPO A;  4A3B G;  5JEA H;  2L4N A;  4QUF A;  2RKS A;  4EQO A;  5J22 A;  1EQQ A;  1L0W A;  1T5X D;  3MAQ A;  1TWC B;  4X62 L;  1K9M C;  5K5P A;  3NTI A;  4LNQ A;  4EQN A;  1TVX A;  3GD7 A;  4OON A;  1SLJ A;  4F87 A;  4FXG C;  3CQZ B;  3RN5 A;  1X54 A;  3KK7 A;  2I07 B;  2D9U A;  2IPK D;  4TQU S;  4DV3 L;  4RHR A;  3A0J A;  1PRT C;  1SRO A;  1UEB A;  2C35 B;  1W6K A;  2K5H A;  4X3K A;  2F0U A;  1K83 H;  3RZD H;  1PH3 A;  2VUM G;  4ZAI A;  1Z9F A;  2L55 A;  1STB A;  4KTA A;  2K7V A;  5COR A;  2L1B A;  1CA5 A;  2WFW A;  3SE0 A;  2JA7 H;  2AQ3 B;  5FLX L;  3S2H H;  4QQB X;  4RKB A;  3R2T A;  3KF6 B;  1XTC D;  3F2C A;  1Y1W G;  4A3D H;  1JWM D;  4M8A A;  2F0J A;  3CCL A;  2B2W C;  3I4L A;  4TSS A;  4DR2 L;  4JBM A;  3M3Y B;  3J80 c;  4A3M H;  1KTK A;  1PV4 A;  4B9W A;  1VCI A;  4CKC A;  1X55 A;  5C3E G;  3KDF A;  5IWA Q;  4IUN A;  2F0T A;  1N34 L;  5LL6 S;  3P20 A;  1Z6H A;  1QB5 D;  2E5L L;  1QVG A;  4UHV A;  1EQT A;  3TSS A;  2XIW A;  1HR0 Q;  3NTK A;  4DK6 C;  1Q82 C;  1I3Q H;  1HZ9 A;  1CZG A;  4YY3 L;  4HCS A;  3ERS X;  2B2U A;  1V43 A;  2PQA A;  4NP5 A;  2O5I C;  3J81 c;  1J8I A;  2XSC A;  4B3M Q;  4ILW A;  4LWC A;  1TWH H;  3OHX C;  3M9B A;  3NPP A;  5C3X A;  1SFO B;  1KIX A;  3X3M A;  1UE6 A;  1B9N A;  1AW7 A;  2QF7 A;  2KCN A;  4IAL A;  2NTS A;  3HEJ A;  3VA7 A;  1F2Y A;  5LMN Q;  5CYU A;  5FK9 C;  2K1B A;  3OWE B;  2K4K A;  3J81 j;  3JAM E;  3S14 H;  4DV5 Q;  2CWP A;  4A75 A;  3J7Z C;  1I4Q A;  4OEL B;  4M1U B;  4ABN A;  1O7L A;  1QNU A;  4CJ1 B;  4DR7 Q;  3T1Y L;  3OIQ A;  4KMU C;  4DXG A;  2UUB L;  5IGC A;  1ROD A;  1CTM A;  2PQE A;  5C4X B;  4WJ3 M;  2ZJQ A;  3BVM A;  5IOD A;  1SE4 A;  3H09 A;  4JI5 L;  5JEA J;  1L0Y B;  3RN2 A;  2MHV A;  4GKK Q;  3HKS A;  1MHW C;  2JN4 A;  4IOC A;  4IJH A;  1V1Q A;  2AQ1 B;  3GDE A;  3DM3 A;  3HG9 A;  4R4I A;  5C3E H;  2Y0S B;  2NBF A;  3L7Z C;  1PFM A; 
#chains in the Genus database with same CATH homology
 3M85 A;  3NUC A;  2A69 D;  3GV6 A;  3MXN A;  5ISR A;  3T4A C;  1F9R A;  2KA7 A;  1TKW B;  1DD2 A;  2OEO A;  1MSG A;  5CV8 A;  3N6R A;  1BXT A;  5FKA C;  1ZXT A;  3I91 A;  3GTJ B;  1O7Y A;  3V96 A;  1Q90 A;  3NQI A;  4J8Q A;  2E2I B;  1OXX K;  5I2X A;  1H9M A;  1B53 A;  1CI3 M;  4Q0F A;  3ONA B;  2L0C A;  3JAM L;  4BBS B;  3K5N A;  2BA0 A;  4RKL A;  4C3I B;  2NVY B;  3MTS A;  4A3E B;  2CVR A;  2NN6 I;  5M5Y B;  2WV6 D;  3VYU A;  3W2D A;  1PRT F;  2F0S A;  3E5S A;  2JA5 B;  2L12 A;  1MGS A;  4NMZ A;  4MHE A;  4DNR B;  3DXJ C;  1U4P A;  1TR5 A;  3S15 B;  1HA5 A;  1UAP A;  4RGT A;  3D3R A;  4K8J A;  1ILP A;  3HOY B;  1PRT D;  1DON A;  2PW7 A;  3KBG A;  5CV7 A;  2FFK B;  2IX1 A;  5C5L A;  2C5C A;  2ZXR A;  4BA2 I;  3QB3 A;  2J7Z A;  3DM1 A;  2O5J C;  1T5E A;  4A93 B;  3RMH A;  1E0B A;  3A54 A;  3TBI B;  1WTP A;  1KLU D;  1PZK D;  3FPU B;  5EPJ A;  2F3V A;  4OL7 A;  4A3K B;  5G3L F;  1ML0 D;  5FOB B;  1O78 A;  5I6Y A;  2JXM B;  5KNB A;  2A6E D;  1HQR D;  2ENB A;  4HED A;  1PRT B;  1ZEQ X;  2IX0 A;  1KLG D;  4DK1 A;  2KEC A;  3TDQ A;  1G91 A;  1DXM A;  1GUG A;  1EEI D;  1QCB D;  2JSO A;  5G3L D;  3L9A X;  3GTK B;  2XWJ B;  1BDO A;  1TWA B;  2F0G A;  2B39 A;  1WTO A;  5D3D A;  4DAY A;  4FYD A;  3IFT A;  1PTO F;  1I4G A;  1LAB A;  2M2L A;  5J39 A;  1HCZ A;  2K32 A;  4HMI A;  2NN6 G;  1WVL A;  2A5H A;  4CJ2 C;  1PTO D;  4IUU A;  1RTO A;  5CBA E;  3ZYY X;  2C9O A;  2F03 A;  2RDG A;  2WAQ B;  3VR6 A;  1EQV A;  5CMD A;  3VR4 A;  5M9O A;  5JOB A;  2AWN A;  1ET9 A;  2SOB A;  5ELD A;  3HOW B;  1EZ6 A;  4U67 3;  3RD4 A;  1YNN C;  1II3 A;  2EY2 A;  1Y1V B;  4G7Z C;  2DNE A;  2HUG A;  2E75 C;  2R93 B;  4KD4 A;  1H9R A;  5ELF A;  1EY5 A;  3URY A;  4ID6 A;  1NR2 A;  2L9H A;  3PIO 3;  4HN7 A;  1PTO B;  2F0H A;  3PV0 A;  3LNN A;  1IW7 C;  3X3N A;  2B2V A;  4K5X A;  1LO5 D;  1SJE D;  1LTI D;  3I70 A;  2XNA C;  1G2S A;  4I7Z C;  1WD1 A;  2B8G A;  2Q8R E;  3DMU A;  5D14 A;  1Q1E A;  1J9O A;  3C1F A;  2NN6 H;  5M3M B;  1IKL A;  5I2Y A;  2G9H D;  1AP0 A;  5BN4 A;  2XVS A;  1K8O A;  1BCP C;  1JOK A;  4XQQ A;  3GTL B;  1Q1B A;  4FF2 A;  2SDF A;  5FO7 B;  2RSO A;  4WOR A;  1LTS D;  4EQP A;  4DNT B;  3CRL C;  2F0Q A;  3SEB A;  1BR9 A;  1DM0 B;  3R93 A;  4RFB A;  5KYI A;  3MFY A;  3FPP A;  1F2L A;  1WTR A;  1W6J A;  1TQO A;  2DY7 A;  2E2J B;  2XWB B;  1I4H A;  3PUV A;  2HCC A;  4XT3 B;  1BO0 A;  4C3H G;  1UEA B;  3U9S A;  3CU7 A;  2EJG C;  2B2V C;  3I3C A;  1D1I A;  5NUC A;  3VR3 A;  4KKT A;  4FNF A;  4KY6 A;  1LTB D;  4G7O C;  1AFP A;  3L3O C;  1MBY A;  3QG1 A;  5E4W C;  1QNK A;  2WB1 B;  2Q8T A;  3DEP A;  4KV6 A;  4R8N A;  1STH A;  1AEX A;  3V05 A;  2F0K A;  1F9Q A;  4KI0 A;  5FO8 B;  3NQT A;  3BYT B;  2BE5 D;  3N52 A;  5D3I B;  3MA2 B;  3P7J A;  3D8G A;  2F3W A;  4H0L C;  2D62 A;  2A6H C;  3A56 A;  4LK1 C;  1LT5 D;  1TU2 B;  1D5M C;  3KLS X;  4GZY C;  1HUN A;  2LMC B;  4XIG S;  4DFA A;  2X69 A;  3RZD B;  4IFD I;  2KEE A;  3A8I E;  4BWG B;  1GUW A;  1HUM A;  2WIN B;  1B2T A;  2Z8L A;  2F0D A;  1CA6 A;  3S2H B;  3G7L A;  1SXT A;  1L0X B;  1X32 A;  1E2V A;  2LKV A;  3FDT A;  5JPN C;  5F2D A;  1Y8P B;  5LL6 X;  5CR3 A;  2EYP A;  3HP3 A;  2B2Y A;  1YNN D;  5HGT A;  1EEF D;  2RDH A;  4ZRZ A;  4A3M B;  1F9P A;  4FVM A;  1I50 B;  1H9S A;  2K6A A;  1I6H B;  2QKI C;  3D31 A;  2OXP A;  2KED A;  3ERO A;  1S5B D;  4CJ0 B;  2BOS A;  4QIW B;  2D2C C;  4IQZ A;  3KUP A;  3PMF A;  1HXY D;  1PXU A;  1IW7 D;  2KCC A;  2O4X A;  1LAC A;  2F0V A;  3HRZ C;  1OO9 B;  1FYC A;  2RSN A;  1A6X A;  3TZU A;  4BS9 A;  3SXH A;  3GTM B;  1BCP F;  2JEB I;  3S14 B;  4XYQ A;  1H9K A;  3M7N A;  1OXU A;  1V1P A;  1IYU A;  2NB0 A;  1BCP D;  3QIA A;  4DF7 A;  3C2P A;  1I4R A;  1SMY C;  3FEW X;  1I4X A;  2EJM A;  2VB2 X;  1ESF A;  4ZYS A;  1CHP D;  4C3J B;  5I9O A;  1KDC A;  1Q12 A;  1CQV A;  4IFD G;  4NW2 A;  3TN2 A;  4RCO A;  1Y8N B;  1KNE A;  1U4M A;  1I4P A;  5JAV A;  4A3J B;  5EPK A;  3QOJ A;  1Y69 U;  1STE A;  4P2C B;  3J7A F;  4HCE A;  3KBX A;  4X3U A;  2SNM A;  3VYR A;  1SYB A;  4DA2 A;  3LWE A;  1BCP B;  3T56 B;  3VA5 A;  3EFX D;  1SNQ A;  1DCZ A;  1JIC A;  4JBW A;  3S1R B;  2IW3 A;  2NVQ B;  4KJO A;  4XDX A;  5D65 A;  3IFD A;  2EJF C;  4QB4 A;  2PW5 A;  1A3T A;  1JOO A;  4OIK A;  4S3S A;  5AFW A;  1JB3 A;  2EE1 A;  4G57 A;  1DOK A;  4IUP A;  3M4O B;  5IT9 E;  2XRS D;  5IGE A;  1D5X C;  1B3A A;  1XYI A;  3FKI B;  3IAY A;  2GA4 B;  3ND8 A;  1EY4 A;  5IGG A;  1PYW D;  3AB9 A;  1ZYR C;  4ZLT F;  3HOV B;  3I90 A;  3SVM A;  5EKL A;  2PMZ B;  2QEJ C;  4O42 A;  1ENA A;  4R8I A;  3E6Z X;  2EYH A;  4C2M B;  5EPL A;  4AYB B;  1A2T A;  2RBM A;  2M00 A;  4DAV A;  4E6I A;  3OMC A;  1U4L A;  4V19 0;  2F0N A;  4A3I B;  4A3F B;  3BDL A;  3SDZ A;  3DUZ A;  3HGB A;  1PZI D;  4KY7 A;  3S1M B;  1E2Z A;  1SE2 A;  3RUZ A;  3NBI A;  3MXG A;  1BOS A;  4IN3 A;  1MI2 A;  2B63 B;  1C4Q A;  1NR4 A;  3WDN A;  5KGU A;  3VR2 A;  4J1M A;  1V1O A;  1HHV A;  2B2U C;  2SEB D;  4PMC A;  3H94 A;  1KDB A;  3A7A B;  3ITP A;  4F7X A;  5IT9 L;  2WKD A;  2HDM A;  2K33 A;  4I65 A;  5E4X A;  5KIX A;  5C5M A;  4Y7N B;  5CV5 A;  4DN4 M;  2FIN B;  4IUQ A;  4C1N I;  2LY7 A;  1A15 A;  3CRK C;  2BDN A;  2SNS A;  2Z4I A;  3SK4 A;  1RF2 D;  2DY8 A;  5DEH A;  3F2U A;  3U9O A;  2G9D A;  3A7L A;  1PFB A;  2NZ1 D;  5KND A;  3AMU A;  4OIJ A;  3OIP A;  1NAP A;  1SMY D;  2ID0 A;  1FR3 A;  2EOT A;  1NSN S;  2X6G A;  5COY A;  1IKM A;  1EU3 A;  1GXD C;  3BYY B;  3GTG B;  3NP8 A;  4CHT B;  5KNC A;  5C3W A;  5A35 A;  2RDF A;  3T16 A;  1BBX C;  1STN A;  2A68 C;  2JA8 B;  1CZW A;  1D1K A;  1KDA A;  5CC4 A;  3NXW A;  3GTQ B;  2EYO A;  2FJ2 A;  3BS1 A;  4C3I G;  3A55 A;  5I9P A;  3MEH A;  4QF4 A;  1VF7 A;  3BG3 A;  3WOF A;  2R3Z A;  2I46 A;  1EY6 A;  1HRJ A;  3MC0 B;  2RQX A;  2Z4H A;  1QIL A;  3ERQ A;  3S2D B;  1PLF A;  1SBB B;  2EPB A;  1ZYR D;  1K8M A;  1FNW A;  4G4K A;  1AN8 A;  3K59 A;  3GP7 A;  5E1F A;  1TS2 A;  4FF3 A;  1ET6 A;  3A8J E;  3O13 A;  3PO3 B;  3SR1 A;  2B2T A;  5DAU A;  3K6O A;  2R7Z B;  3BVZ A;  1LLR D;  2BCO A;  4N9T A;  4XQJ A;  1EY0 A;  3FRP B;  3MFG A;  5EGT A;  2PZT A;  1D6E C;  1FD7 D;  1F77 A;  5CV4 A;  4FXK C;  3MXP A;  4KN4 C;  2RVL A;  2ICE C;  3HS0 C;  4PMB A;  1EWH A;  3S1N B;  3Q24 A;  4QCL A;  3EJI A;  1A2U A;  3SHL A;  2KJX A;  2QIL A;  1B4O A;  1PDQ A;  1QWY A;  3TP7 A;  1IHZ A;  1JWS D;  1LTG D;  2K04 A;  3NTH A;  3PO2 B;  1GHJ A;  3UI2 A;  3S1Q B;  1JC7 A;  5EBC A;  4N9P A;  2EYF A;  2K03 A;  1SYD A;  2J4X A;  2PCF B;  5CV9 A;  4KY5 A;  1KAB A;  1FGB D;  2L5T A;  1ESR A;  3V2T A;  1STA A;  4XXE A;  3LX0 A;  4RGN A;  3P75 A;  5KRU A;  1CHQ D;  5E3F A;  1SYC A;  1HPC A;  3Q22 A;  3FVQ A;  5IGD A;  4RA8 A;  1EY9 A;  1SNP A;  4ODG A;  1DOM A;  1LT4 D;  4CGY B;  3CHB D;  1SDF A;  2JYO A;  2MPM A;  5BN5 A;  3I4N B;  3KLS A;  2M9V A;  3OSO A;  5LHY 1;  5HUR A;  3TP8 A;  1HQM C;  1XXG A;  1AZQ A;  4C56 C;  1YNJ C;  4HSV A;  5C0X I;  1UNS A;  2QDB A;  4LAA A;  5DM6 3;  3NE5 B;  4IUR A;  1HTL D;  3SK6 A;  2JP1 A;  3K0Y A;  1WTQ A;  3GTO B;  4KJN A;  5ELB A;  4TKO B;  2F0E A;  1SND A;  1GJX A;  4OHJ A;  1LTT D;  1HA6 A;  1TY0 A;  1B9M A;  3D4W A;  4K2K A;  4DXF A;  1PZJ D;  2FHT A;  1RHP A;  1M8A A;  1TT2 A;  3T13 A;  1PTO H;  4XQN A;  3I73 A;  1K83 B;  4DAP A;  2EXZ A;  3EA6 A;  3HZX A;  4LMQ D;  1ICW A;  1EIG A;  3K58 A;  2JA7 B;  2H4O A;  3H6M A;  3GO5 A;  2DN8 A;  4A3D B;  2CQA A;  5TSS A;  1PFN A;  1SSO A;  1RKN A;  3D4D A;  2KOL A;  1ZKO A;  2F0F A;  2HCI A;  1G29 1;  2L11 A;  3J7A V;  4NKL A;  2PNR C;  1XWE A;  2BDO A;  3BDO A;  2A73 B;  3R2I A;  2R6G A;  4ULL A;  1I3Q B;  4CKB A;  1IYV A;  5JVH 3;  3GV3 A;  1Z7T A;  1DZ1 A;  1U9R A;  1PMR A;  4KHZ A;  1SJH D;  4A3B B;  3EVQ A;  1G8Z D;  1RJT A;  3PIP 3;  1TWH B;  1Z47 A;  5C0X G;  1QG7 A;  5KEE A;  3M4Y A;  4RH6 A;  2ICI A;  2K5W A;  3DEO A;  4KKU A;  5A2Q L;  1B1Z A;  2FMC A;  3NSW A;  1TS5 A;  5IGF A;  2AQ2 B;  2BA1 A;  2VUM B;  5CGK A;  1WD0 A;  3MWY W;  1LV9 A;  1Y1W B;  4FP5 D;  3D6C A;  4U68 A;  2B2Y C;  1HFG A;  4HMJ A;  2A74 C;  5DNF A;  1LT3 D;  2F0W A;  3K57 A;  3NWT A;  1VDZ A;  5C3E B;  2PO4 A;  1Q8I A;  3Q0A A;  3MXU A;  4R9W A;  1RCV D;  2OT2 A;  4B08 A;  1B50 A;  1YNJ D;  3H3V C;  2PPB C;  5C0X H;  2O2L D;  3QOL A;  2E2H B;  1RDP D;  5BN3 A;  2HDL A;  3TME A;  1BF4 A;  5C4J B;  1DJR D;  2AUK A;  1R4P B;  2KHS A;  3W3A A;  1JWU D;  4BA1 I;  2RA4 A;  2LS0 1;  1O80 A;  1JOQ A;  1SYF A;  5FO9 B;  4H13 C;  1GUN A;  1HFN A;  2F0I A;  1MD2 D;  4C3J G;  4K5W A;  5C4H A;  3M7G A;  2EY1 A;  1ENC A;  2WII B;  4F8M A;  4FXD A;  1KAA A;  1M4V A;  4YIJ A;  2A6H D;  1STY A;  4RAU C;  2NVT B;  2A6E C;  3TP6 A;  1WTW A;  1ILQ A;  2YYZ A;  5M5W B;  2YU9 B;  5ELE A;  2K5Q A;  4IFD H;  3K5O A;  2NTT A;  1GUT A;  2NUC A;  3NBH A;  3C1E A;  3EQL C;  4IUV A;  1BUV T;  5EJW A;  3MHB A;  1SYG A;  2NVX B;  4IZ8 A;  2K28 A;  1GUS A;  1EY7 A;  4DK0 A;  3HOX B;  2HQE A;  4KKS A;  1CQF A;  3PUZ A;  4BY1 B;  4NDX A;  4B9X A;  2K5D A;  2EVB A;  3OW7 A;  1PTO C;  1G6Z A;  1LTR D;  2E76 C;  4A3G B;  4KK7 A;  2PZU A;  2IT1 A;  3IL8 A;  3Q6S A;  1QOH A;  4HAE A;  1DYQ A;  1FNV A;  3CKI B;  2F0P A;  4FO2 A;  1OXS C;  1FNU A;  3T51 B;  5C6A A;  1NUC A;  2KQ3 A;  3NHH A;  5T1G A;  1VMP A;  4RWS C;  3D6W A;  1KNA A;  4H7B A;  2Q8I B;  3R3O A;  5CBE E;  5C0X J;  2ZT9 C;  4K6D A;  2CW0 C;  4L8J A;  2NWG A;  4C1N K;  4UAI A;  1ENF A;  3QJY A;  2WKC A;  4DGZ A;  1R4Q B;  2IL8 A;  2AWO A;  4FF1 A;  1E2W A;  2NYZ D;  1Q3L A;  2B8F A;  3K7A B;  5IIF A;  3C3L A;  2KVM A;  5JVG 3;  3OMG A;  4BY7 B;  2VXW A;  3D4R A;  2ZXP A;  4X3S A;  4ZKB B;  2XN9 C;  2EYL A;  1DOL A;  1SNC A;  4KN7 C;  4Q5V A;  3P1H A;  1X3P A;  1S5D D;  3I8Z A;  4L63 B;  3H91 A;  4XYO A;  1AZP A;  4IFD J;  3J80 E;  1SYE A;  2VB3 X;  3MVV A;  1OXV A;  4K14 A;  3BDC A;  1CK1 A;  3T53 B;  1UUP A;  1LTA D;  2XRQ D;  1RD9 D;  1H9S B;  3Q23 A;  1S5E D;  2FMM A;  2IJ0 A;  2AUJ D;  3J81 E;  1TY2 A;  5I6W A;  1JOR A;  1GHK A;  4Z9C B;  3K5L A;  4PMW A;  5IGB A;  5EKI A;  2E74 C;  2F4I A;  2F0O A;  2K05 A;  1F2M A;  4PV1 C;  5DM7 3;  1X3Q A;  4IUT A;  4OO1 I;  2F0L A;  1JR0 D;  4UDU C;  5I4D A;  5C44 B;  1A3V A;  2TMP A;  2MJ8 A;  4HSP A;  4K8I A;  1WTX A;  1QE6 A;  3VYS A;  2BE5 C;  3PUX A;  5K36 G;  1V1P B;  1C48 A;  3DWP A;  1JCK B;  3QO2 A;  3KLR A;  1EIH A;  3S9W A;  3J80 L;  1GOZ A;  3J7Y W;  5J1Z A;  1XX8 A;  3QWN A;  2JA6 B;  4XTC S;  2OF1 A;  1U4R A;  1TS3 A;  2KUM A;  2ZXO A;  3RZO B;  3TZD A;  1C8C A;  5C4Z A;  2MGS A;  3J81 L;  1SE3 A;  3AU7 A;  4XT1 B;  4CKE A;  3HOU B;  4EGV A;  1ONL A;  1EZ8 A;  2E2D C;  1V8Q A;  1S5C D;  2K01 A;  3FMC A;  3SK8 A;  2WP8 J;  2CW0 D;  2N55 A;  2R92 B;  3RLF A;  5CV6 A;  3MZ5 A;  3PUW A;  1CM9 A;  2V4D A;  4PNY A;  2MP1 A;  5M3F B;  1JQY D;  4JK1 C;  1S4Z A;  1EYA A;  2B2T C;  5K36 H;  2JE6 I;  4C3H B;  2EY5 A;  3KF8 A;  4OO1 G;  4BBR B;  1EU4 A;  1F2Z A;  4DU9 A;  4ZK9 B;  1D5Z C;  1TWG B;  1SNO A;  4RGM A;  2MUY A;  3E0J A;  1TWF B;  3H0G B;  3DHQ A;  3TP5 A;  2EY6 A;  1EFI D;  2A68 D;  1A3U A;  4F88 A;  1WTV A;  4CBV A;  4RHS A;  2EYJ A;  2VNU D;  4PQX A;  1EOT A;  2DNC A;  3C46 A;  4H44 C;  4V0B A;  3G6J B;  3NK9 A;  3SK5 A;  1D2B A;  1HTP A;  1EL0 A;  3HKZ B;  4K6L A;  4L6T B;  3A8K E;  1O7Z A;  3S17 B;  4ZUI A;  5ELC A;  4J6H A;  1CT1 D;  2IX3 A;  2LFN A;  1I6V C;  5EBD A;  5JPM C;  1R9T B;  5KYL A;  2JEA I;  3GTP B;  4OGQ C;  1OXT A;  4O1N A;  1EYD A;  4OO1 H;  1B44 D;  2CHB D;  1F9S A;  5A2Q E;  4HR7 B;  3K5M A;  4HTH A;  1GUO A;  3VYT A;  1JE4 A;  1Y8O B;  5M5X B;  2EDG A;  3DWQ A;  2TSS A;  5EKK A;  3GQB A;  3S16 B;  3BVG A;  2F1M A;  3LWU A;  1TII D;  4TRD A;  3VR5 A;  2F0M A;  3R8B A;  1EY8 A;  1STG A;  4QMG A;  3BZD B;  4X3T A;  5T1I A;  3I4M B;  1TS4 A;  1SAP A;  1LT6 D;  4RCN A;  4FF4 A;  2WAC A;  5JEA G;  1BQQ T;  1G2T A;  1CFM A;  1S5F D;  1VF5 C;  1BNZ A;  4LJZ C;  2PZW A;  4WRD A;  2EYM A;  4ZKC B;  2IWH A;  4KD3 A;  1EWC A;  1WCM B;  2D5D A;  5JJZ A;  1H9J A;  3HOZ B;  4G7H C;  1VMC A;  4KHV A;  4ME5 A;  4WJW A;  4K5V A;  4K2L A;  4EVO A;  1SNM A;  3ND9 A;  4ZQ3 A;  5EQ0 A;  4WFN 3;  5FLX E;  1QJO A;  2X6L A;  3OOC A;  4RGO S;  2A69 C;  2R61 A;  1EYC A;  2B2W A;  1SEB D;  3I72 A;  3OWF A;  1NCV A;  2PYK A;  4MIU A;  3NWS A;  5IOC A;  2Z1C A;  2QCP X;  3WOE A;  3PUY A;  1RTN A;  4ZUJ A;  2EZV A;  1MSH A;  3IKJ A;  2N88 A;  1IL8 A;  3DWA A;  4QUC A;  2H1E A;  2J0T D;  4MN3 A;  3OPO A;  5JEA H;  2L4N A;  4QUF A;  2RKS A;  4EQO A;  5J22 A;  1T5X D;  3MAQ A;  1TWC B;  5K5P A;  3NTI A;  4EQN A;  1TVX A;  3GD7 A;  4F87 A;  4FXG C;  3CQZ B;  3KK7 A;  2I07 B;  2D9U A;  2IPK D;  4TQU S;  4RHR A;  1PRT C;  1W6K A;  4X3K A;  2F0U A;  4ZAI A;  2L55 A;  1STB A;  4KTA A;  2K7V A;  5COR A;  2L1B A;  1CA5 A;  3SE0 A;  2AQ3 B;  5FLX L;  4RKB A;  3R2T A;  1XTC D;  1JWM D;  4M8A A;  2F0J A;  2B2W C;  3I4L A;  4TSS A;  3M3Y B;  1KTK A;  4B9W A;  1VCI A;  4CKC A;  4IUN A;  2F0T A;  5LL6 S;  3P20 A;  1Z6H A;  1QB5 D;  1EQT A;  3TSS A;  2XIW A;  3NTK A;  1CZG A;  4HCS A;  2B2U A;  1V43 A;  4NP5 A;  2O5I C;  1J8I A;  2XSC A;  4ILW A;  3OHX C;  3NPP A;  5C3X A;  1SFO B;  3X3M A;  1B9N A;  1AW7 A;  2QF7 A;  2KCN A;  4IAL A;  2NTS A;  3HEJ A;  3VA7 A;  1F2Y A;  5CYU A;  5FK9 C;  2K1B A;  3OWE B;  3JAM E;  1I4Q A;  4M1U B;  4ABN A;  1O7L A;  1QNU A;  4CJ1 B;  3OIQ A;  4KMU C;  4DXG A;  5IGC A;  1ROD A;  1CTM A;  2PQE A;  5C4X B;  3BVM A;  5IOD A;  1SE4 A;  3H09 A;  5JEA J;  1L0Y B;  2MHV A;  2AQ1 B;  3HG9 A;  2Y0S B;  2NBF A;  3L7Z C;  1PFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...