4NKLA

Crystal structure of staphylococcal nuclease variant delta+phs v66a/i92q at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMAENAKKIEVEFDKGQRTDKYGRGLAYQYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pressure effects in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4nklA00
4KTAA 1EYDA 4HTHA 5KEEA 5CV8A 3H6MA 4IALA 2F0NA 1SYDA 2EY5A 1KDBA 1SNCA 2SOBA 3SK8A 2F0IA 1EY8A 4K8IA 2OEOA 5IGBA 2EYLA 4TRDA 5CGKA 4EQNA 4KJOA 3C1FA 5EKLA 5IIFA 4ID6A 2SNMA 5IODA 5KIXA 2F0HA 1EY0A 5EGTA 5IGDA 5CV4A 3VA5A 1STYA 3SR1A 1SNQA 4J1MA 4KHVA 2RKSA 4IZ8A 2M00A 4K5XA 4F7XA 5J1ZA 5CC4A 3TP7A 1JOOA 3NP8A 5IGFA 1EY9A 1TQOA 3C1EA 3OMCA 3OSOA 4I65A 1STBA 4J6HA 1A3UA 4PMCA 4K2LA 4H7BA 3DMUA 3QB3A 4EQOA 2EYHA 2SNSA 5CV7A 3TP5A 4N9PA 4QMGA 4RKLA 4ZQ3A 2OXPA 4OL7A 4KJNA 3DHQA 2F0JA 2PZTA 2O4XA 1TR5A 4R8NA 5I6WA 5CV9A 1JORA 2EXZA 2F0QA 2F0TA 3EJIA 3NUCA 1EY7A 4ME5A 4LAAA 3D4DA 4QB4A 5E3FA 3SXHA 4EVOA 5M9OA 1A3TA 2EY1A 3EROA 4MIUA 4IUNA 2F0GA 5DAUA 4B9XA 4K2KA 5I9PA 5E1FA 5CV5A 3P1HA 2LKVA 1SNDA 4KY6A 2EYJA 2F0UA 3SK6A 5KGUA 5KRUA 2F0PA 2F0EA 3R3OA 2RDFA 4KD3A 3U9OA 1RKNA 5JOBA 5C4ZA 3MVVA 3NQTA 4KY5A 1EYAA 2F0KA 4NMZA 4K6DA 4S3SA 5K5PA 2F0SA 3E5SA 2HQEA 1KDCA 3P75A 4K8JA 4N9TA 1A2TA 1SNMA 2EYOA 5C4HA 5NUCA 1NUCA 3S9WA 4WRDA 1SYBA 3RUZA 3MEHA 3NK9A 4DGZA 5HGTA 3MXPA 2EYMA 2F0OA 2NUCA 4K5VA 4NKLA 4G57A 1II3A 2PYKA 2OF1A 4ZUJA 5C5MA 2WACA 5C5LA 1NSNS 2EYFA 2EY6A 2KQ3A 2PQEA 3ERQA 2PW7A 2F0VA 4YIJA 4ZUIA 3SHLA 1SYGA 4WORA 3TP6A 3TMEA 5HURA 4K5WA 1EY5A 2KHSA 5IOCA 3BDLA 4K14A 1SYEA 5F2DA 1KABA 4NDXA 4PMBA 1SYFA 3MZ5A 1SNOA 3HEJA 3D6CA 5IGGA 3T16A 1STAA 2F0LA 1KAAA 2F3VA 2PZWA 1STGA 2F3WA 4HMIA 4DFAA 5KYIA 3NHHA 2PZUA 5I9OA 5CV6A 1F2MA 4EQPA 5JAVA 2F0FA 1JOQA 1TT2A 1A3VA 3T13A 3NXWA 4ODGA 5IGEA 3BDCA 4KD4A 4PNYA 5EKKA 4DF7A 1F2ZA 5IGCA 1AEXA 3QOJA 3LX0A 1EYCA 1U9RA 4F8MA 3ITPA 1ENAA 5C3XA 3TP8A 3D4WA 5CR3A 5C3WA 1SYCA 3D8GA 3HZXA 3OWFA 1KDAA 2EYPA 4NP5A 4DU9A 1EZ6A 5ISRA 1ENCA 4KV6A 2PW5A 2F0WA 1EQVA 1STNA 2F0DA 3QOLA 1EY4A 4RKBA 1F2YA 4B9WA 4E6IA 5C6AA 3PMFA 3OMGA 2EY2A 2RBMA 3V2TA 1A2UA 3MHBA 2ENBA 5DEHA 1IHZA 4HMJA 1JOKA 1SNPA 1EY6A 1STHA 3EVQA 2F0MA 5I6YA 5KYLA 3SK4A 2QDBA 5J22A 5J39A 4QF4A 1EZ8A 3SK5A 4KY7A
chains in the Genus database with same CATH superfamily
1VQ9A 2Q8IB 3I4NH 2N49A 4WJWA 3J81c 1XNQL 2A6ED 1MKHA 4N8X1 5IP7G 2A73B 2F0IA 4YWLA 1RCVD 4POFA 5C4XG 5IYDG 1KLUD 1NMGA 3MXNA 4BWGB 1XNRQ 1T5XD 4A3KB 1XPUA 4F7XA 1OXSC 1EOVA 3C1EA 3OMCA 4PMCA 2MNAA 1Y69U 3J81j 4IFDI 3M9BA 2SNSA 1Q7YC 2WAQE 4FYDA 2UU9L 2K75A 1PVOA 4JI6L 4KHPQ 1E22A 1K8GA 2B63B 2I5LX 4LUOA 4GOPC 2HIXA 2F03A 3EROA 5AJ3Q 1CKNB 2F0GA 3VYTA 3J81E 4DUZQ 4DV5Q 1WTQA 4A3BG 4IFDJ 1ILPA 4BXXG 3PF4A 1BCPD 5IE8A 3R3OA 2Z4HA 1EOTA 1RKNA 4DAPA 3QR8A 4KY5A 1HTPA 1PV4A 2JEAI 2BE5D 2HIVA 4HAEA 1YNND 4O0AA 1H9JA 3OOCA 5IT9E 1T5EA 1FD7D 1TWHB 1NE3A 1XTCD 1N9WA 4XQJA 2CQAA 3GTKB 1XMOL 2DN8A 1F9QA 5KNBA 2RCFA 4NDXA 5JJLA 2FINB 1FR3A 1N34Q 4A3KH 4HJ5A 1X3FA 2IX1A 3DWAA 1EWIA 3M85A 2F52A 2LFNA 5CV6A 2JK8A 1JWSD 3AMUA 1RL2A 1WFQA 3S1RB 2KHIA 1IYVA 1SLJA 4CDCC 3GTPH 2PPBC 4C3HH 2RSOA 3D8GA 4NP5A 3ICEA 2VNUD 1ENCA 1I4XA 4KV6A 3HOUG 1D1KA 2QW7A 3HOWB 1F2YA 3PMFA 2A68D 4A75A 3PO3B 2ENBA 1QVFA 1JJGA 3T4AC 4A3GG 1VCIA 3J81L 1SN8A 3FRPB 2MQHA 4IN3A 3F8TA 3H0GG 1KLGD 4A3MB 5IP9H 5CV8A 2IX3A 2BDNA 3O13A 2CCZA 4JI5Q 1KQSA 3VA7A 2NVTH 2LSSA 2OEOA 1DOKA 1B7YB 2JA6G 3J7YW 1Q86C 1EY0A 2JA7H 2L11A 1SNQA 4KHVA 5C3EG 3DWPA 1RTNA 1TY0A 4HIOA 2A69D 2KBNA 2JA5B 4R8IA 4ULLA 5C0XI 2WB1G 4DK1A 2K01A 3LGJA 4EQOA 1PRTF 4C2MH 1L0YB 1HR0Q 1X6OA 3ER0A 4BY1H 5I6WA 5GQOA 2F0QA 3VR4A 1HA5A 1W3SA 2K5WA 2BH8A 4HSPA 1BBXC 1GD7A 4DR7Q 4A4IA 2L55A 2YV5A 2AUJD 4DV4L 3D0FA 3C46A 1QUQA 4KMUC 1VQBA 2BCOA 2C9OA 4Y52H 4DR2Q 2Z9HA 4JI0L 1X3EA 1MSGA 4Q5VA 2ZJQA 1LT6D 1KDCA 3NPPA 1HUMA 1KNAA 4DR6L 5JPNC 2UXBL 1HUNA 4LK1C 3MXPA 1IKLA 1CHPD 2NUCA 3OIPA 4FP5D 4R1JA 4DV3L 5JVH3 5JEAG 3J80L 1SYGA 4IPDA 3TMEA 4GOPB 4NW2A 1R9TB 5C3EB 1RF2D 1HCZA 5DLQE 1V1PA 2E2DC 1HNZL 1Q82C 4P71A 2AQ3B 4B3MQ 4RGMA 3T13A 3BS1A 2ATWA 1EQRA 5J3BA 1HPCA 3P20A 4X3SA 4G4KA 5IGCA 3FP9A 3HGBA 1HQMC 1GUOA 3S2DB 3CPWA 4BY1B 5C44G 4RMFA 3K59A 4GNXA 3HOVG 4MTNA 4KK7A 1RJTA 1E1TA 3CU7A 1I94L 3I4MG 2E2IH 3M3YH 3MHBA 3HOVH 1FNUA 1LTAD 2N8NA 1QNKA 4Q0FA 5I6YA 4K0KL 5J22A 5J39A 2EJFC 1E0BA 4NXNL 1PYSB 4LFBL 2F0NA 1A63A 4KHZA 1SE2A 1Z6HA 3CMEA 4BY7B 2TSSA 1PH2A 1Z47A 3I4NG 1IBKQ 2NVXH 3SR1A 1Y1WG 4K5XA 4QY7A 1M8AA 3S1MH 1S5CD 5IWAQ 1H9RA 5CORA 4ZQ3A 3AFPA 4OO1I 4UAIA 1TR5A 2E5LL 5EPLA 3S15B 5C0XH 4L5RC 4IURA 4KKTA 2VQFQ 2DY7A 1XJVA 4JI1L 1O78A 4ABNA 4IUNA 2H1EA 1ESRA 2B39A 3HOYH 4CKBA 3DLLA 2JP1A 1JT8A 1BDOA 2QEJC 1CZWA 5FLXL 4V0BA 3C3LA 2LY7A 3GTMH 1VQGA 4S3SA 4C3JH 1VQCA 3HOYG 4NB3A 3SDZA 3M4YA 1T9HA 1SNMA 3PQIA 1EQQA 2R7DA 4L6TB 4A3IG 3CMAA 2EDGA 1SMYD 2D0OA 1XWEA 3KDFB 5C5LA 5T1GA 2EYFA 4Z9CB 2B3GA 1PH8A 1Y8OB 4XT3B 1AN8A 1S72A 4AQYQ 1WTWA 1KAAA 1L0XB 1BQQT 4U673 3KJPA 2EIFA 4BA2I 4NXMQ 2D0PA 1TT2A 3CCLA 3PUWA 4CGYB 4C56C 1O7YA 4NXNQ 5C3XA 2ZM6L 1SYCA 2CH4A 5ELOA 3HOWG 4R4OA 1AP0A 4JBJA 4JBMA 1SMYC 1Q1EA 3KBGA 4MN3A 2RSNA 4IPHA 1EY6A 3HOYB 1PA6A 2ZXPA 4A3JB 2VQFL 2B8GA 3HKZE 3SK4A 2YU9H 2FMCA 1SE8A 3FMCA 1JC7A 4FNFA 5KEEA 1ZYRD 4RH6A 3T53B 1SYDA 4DR1Q 3M4PA 2F3IA 1K0RA 3C1FA 4KJOA 5IIFA 3HOZB 4CKCA 3Q6SA 1B3QA 1U4MA 2V1CC 4FVMA 5K36G 2KHJA 1E2ZA 3I73A 2DJFC 3GDEA 2ID0A 2JA9A 5JVG3 3S2HH 1PRTD 3I90A 4R8NA 4JBWA 1Y8PB 2PQAA 4JI2Q 1MD2D 5FO8B 4RGNA 2DY8A 3K7UC 3D3RA 4L8JA 1A3TA 1AE2A 5DAUA 1S3OA 4DV6L 5FLXc 4OXPA 1HA6A 3CD6A 4OEMB 1MJCA 5E1FA 4ZK9B 1HFNA 2JA8H 2YTVA 4QGUA 1SNDA 3PF5A 2B63G 1C0AA 3H3VC 1D7QA 1K3RA 3BVZA 2E2JB 3NQTA 1B70B 1FGBD 2HQEA 1TWAH 3W3AA 4JOIA 5DM73 3W2DA 1SYBA 1M4VA 1FJGQ 2KA7A 4DXFA 1HFGA 1CI3M 4P74A 4X65L 3A56A 3LNNA 1YBYA 1PYWD 3TP6A 2LXKA 3RZOH 3QG1A 1PTOF 1J6QA 2UUBL 4WFN3 1ZYRC 1SYFA 4IUVA 5BN3A 4DV1L 1QWYA 2JN4A 4PZ7A 1XPRA 4HMIA 3NTIA 1HR0W 4MHEA 4CBVA 3G7LA 1IXRA 4X65Q 4MTKA 4F8MA 2XTIA 3J80c 1N36Q 1X32A 1FJGL 3HZXA 2K14A 4CJ2C 5M3MH 3EIVA 1H9KA 4CDDC 5KNDA 1SJHD 1STNA 2VQEL 3TBIB 2HHHQ 3OMGA 2RDHA 3HS0C 2EY2A 1A2UA 2R3ZA 3PUZA 1D1IA 3E0JA 2JE6I 5DEHA 2CVRA 1JOKA 4KLKA 1I94Q 5LL6X 3VR5A 3MEFA 2HCCA 1TWGB 1WD1A 4DV6Q 4OIJA 1N36L 5M3FG 2KOLA 3CKIB 1G8ZD 4A3MH 3BVMA 3A8JE 5IGBA 1DOLA 3PO2H 4A93B 1OXXK 1NNXA 3DM3A 2IX0A 1R4PB 4DR4Q 3CCRA 1XMQL 5C4JB 5IGFA 1AFPA 4AYBE 4DAYA 1DXMA 1Q12A 1O80A 2XWJB 1OXVA 2WFWA 3BG3A 3GTJB 1BKBA 2N88A 1B9MA 4A3BH 4B3TQ 5DM63 2A69C 3SE0A 1X9NA 3J80E 1AE3A 4Y7NH 4QB4A 2BA1A 3KFUA 1WCMH 3A5ZB 1E7ZA 2K03A 1EFWA 4AYBB 3GD7A 3A7AB 3HFZB 1STEA 3K57A 1S4ZA 2F0EA 1YHQA 1BBWA 1ASYA 2R61A 3I4MH 2IWHA 2B2YC 5C4ZA 5CYUA 2QDLA 4DR2L 1PHJA 2BOSA 4L5QA 1B44D 4DK3C 2L15A 4YY3Q 3I55A 4HJ9A 2NWGA 1GOZA 2A68C 4ZRZA 2B2TC 3U9SA 4JI6Q 1II3A 4X64Q 1TWHH 1KXLA 4JCVE 4IOCA 5CMDA 4WORA 4DUYQ 1NJIC 1VDZA 4N8FA 3D6WA 2R93H 4C2MB 3FHWA 3T1HL 4PMBA 4UDUC 3MZ5A 2PNRC 1VQAA 5IGGA 1STAA 2F3VA 2PZWA 4RA8A 1ML0D 1H9SA 4DA2A 3GTLB 4YCVA 4DAMA 2PZUA 3KBXA 1GO3E 3DEPA 1N32L 4RCOA 5IGEA 4DR1L 1X3QA 1EYCA 3CCEA 4AH6A 3N52A 1DM0B 4X3UA 5C0XG 5FO9B 4YY3L 5FK9C 3WDNA 3D31A 4FF3A 5JJZA 1LLRD 3CCJA 1SEBD 2VL6A 4U68A 5G3LD 3QOLA 4RGOS 3I3CA 5M5WB 2IHEA 2B2WC 4LFAQ 3DWQA 3NWTA 2KCTA 2RF4A 1SNPA 3CQZH 2BE5C 2QDBA 1WOCA 1VMCA 5KNCA 4KTAA 1K8AC 1WTVA 4A3IH 1EY8A 3ZJYC 1LT3D 4C3IB 3FDTA 2E5LQ 2F0HA 3S1RH 4F87A 4IFDH 1X54A 1HXYD 2EXDA 3I72A 3L0OA 2RKSA 4X66L 2OTLA 1ONLA 1JCKB 3W1GA 4DV2L 3PUYA 3K5NA 4EGVA 1EL0A 4QMGA 2H5XA 4YHHL 1XMOQ 3N6RA 3H94A 1TWFH 2K4KA 1PRTC 3G6EA 2GN5A 2PMZE 3KUPA 1HNXL 1VF7A 2UXBQ 3AB9A 3CHBD 5M3MG 1HZCA 4B9XA 2RHQB 4FXDA 4XIGS 4CJ0B 1SAPA 3CCSA 4DV7Q 5IT9L 1BVSA 1WTRA 4IJHA 4XDXA 1TU2B 3PIP3 3HOUH 3K5OA 3MWYW 1LUZA 4GNXC 2JA7B 4JI4L 1JE4A 3BYYB 2JA6B 2ZXOA 3CW2C 4PZ6A 1K0SA 1HR0L 3DUZA 1EIHA 5IP9G 1EEFD 3U4ZA 1S5DD 1NSNS 1MHWC 4GKKL 4GKJL 2KECA 4JYAL 1ICWA 1KIXA 3CF5A 1GVPA 4K14A 2JSOA 5C3EH 4ALPA 3MXUA 2RA4A 3I56A 4B3RL 5COYA 2WV6D 4R4IA 1RODA 3GTOB 3NXWA 4ODGA 1X65A 5EKKA 3CC4A 4OO1H 3NENA 2LS01 1AEXA 1U9RA 4ZKCB 3CRLC 1XNQQ 2QA4A 2CW0D 2K32A 4OO1G 3UDFA 3OWEB 1I3QB 1I6HB 1H95A 1EQVA 1Q81C 2RQXA 4C3JB 1J5EL 4B9WA 5C6AA 4FXKC 5LMUL 4X6AH 2JA8G 3S14B 5EQ0A 4JI7Q 1X56A 5FO7B 4DR5L 5C0XJ 3H91A 1STHA 3M3YB 3JAME 5KYLA 2KVMA 3AU7A 2A1AA 1YI2A 4H0LC 4HTHA 1PH7A 4IALA 1K83H 4PQXA 3K58A 3STBC 1KDBA 1SNCA 4M8AA 2K52A 4DR7L 1BCPF 4K8IA 4TRDA 4A3CH 2XNAC 4DR5Q 5IODA 4XT1B 5KIXA 5D3IB 3NE5B 3E3XA 3A7LA 3QWNA 5LMNW 1SRUA 5IYDH 3BVGA 2K05A 1K28A 1D5ZC 4MZ9A 4CJ1B 4EX5A 3BDOA 2HQLA 2WINB 4OWTB 1HTLD 4LMQD 1IZ6A 4DV3Q 2GVBA 5FKAC 3VR3A 2ZJRA 1QZGA 1FYCA 2XIWA 1V1QA 4TKOB 4XTCS 4LFCQ 1N33Q 1G91A 4DAVA 1ENFA 1H9MA 2XVSA 4JI3Q 1Y14B 4QL5A 1ZXTA 3TS0A 2OQ0A 1ASZA 5JOBA 1I6HH 4GKKQ 4GKJQ 5EKIA 2F0KA 3PSIA 5K5PA 5EAYA 3KF6B 4N9TA 5G3LF 5C4HA 2EYOA 3OHXC 5I2XA 4A3GB 4R4TA 2UU9Q 4UP9A 2E8GA 3VYSA 3R93A 1YNXA 2F0VA 3AYHB 2B8FA 3H15A 4JBKA 1X3PA 4P2CB 1E3PA 2PI2E 2I07B 3SEBA 3Q23A 1ILQA 2LMCB 3GP7A 2ZXRA 4DV7L 2F0LA 4OGQC 3Q0AA 3CCQA 4JVZA 3QJYA 1JMCA 3IAYA 2J0TD 4PNYA 2WB1B 4G7OC 3UE1A 1EUJA 1BBUA 3I70A 2WAQG 4UP8A 1EU3A 2XGTA 2EYPA 1A8VA 2B2VA 1YJ9A 1EZ6A 2EE1A 4FDBA 2D5DA 3MFYA 4DV2Q 3FKIB 4B3SQ 4APVA 5ELEA 4E6IA 2C35B 4C3HG 4X66Q 3ULLA 3KYHC 2YTYA 4HN7A 4HMJA 4A3EB 1TWCB 3MXNB 4IUTA 2KCNA 2F0MA 2OT2A 4LF5Q 5J1ZA 2WKCA 4V190 2NTSA 3SK5A 2B29A 2E75C 3UDIA 3CCMA 1YJWA 3JAMc 2KENA 1TWGH 2L12A 5EKLA 1S5FD 2E2HB 4RGTA 2XRQD 2VUMB 3I2ZA 1FGUA 5IWAL 4LFAL 5CC4A 3S17H 2PNHA 1EU4A 2UUAL 1PH5A 4RHRA 2EYHA 1G6ZA 2FFKB 2D9UA 3TP5A 1YITA 1PH6A 1AW7A 1JR0D 1XX8A 1KRSA 1QCBD 1QVGA 3NUCA 1QG7A 2YU9B 3D4DA 1E1OA 2B63H 4LFBQ 4MIUA 4BY1G 4FF2A 2L4NA 4F88A 4TSSA 2R92B 3PIPA 1U4LA 3RNUA 1IKMA 2A6HD 1L2FA 4WJ3M 2G5DA 2K33A 5GADC 4ZYSA 3PIOA 2QF7A 3TN2A 4FXGC 2CH4W 1F9RA 3PV0A 1P16A 5IP7H 1YNJC 4TVAB 2L9HA 4XQNA 1QILA 2PYKA 1SE3A 4JV5L 2WACA 2K04A 4HJ8A 2PMZB 1YJNA 4ZUIA 2VB2X 2D2CC 1Y8NB 4JI3L 5IOCA 1CUKA 3FPPA 1PTOC 1B8AA 4BBRH 1Y1WB 1KABA 1GUNA 1J5EQ 1IBLL 4P72A 3HEJA 3GQBA 1STGA 3E0EA 1CQFA 1WTXA 1JE5A 3H3VH 2X69A 1F2ZA 3J81i 3QOJA 4DNTB 3PO3G 3GV6A 1ENAA 1SXTA 3F2UA 5L37A 3TSSA 2EOTA 3NWSA 3OWFA 5ELBA 4KN4C 2R92G 4IUQA 2F0WA 1EY4A 1CM9A 3PUXA 3KLSA 2AHOB 5C44H 2MJ8A 2NZOA 2QCPX 2R92H 3Q8DA 1IBMQ 5M3FH 3EFXD 2NVQB 1QUQB 4P73A 2K1BA 3NQIA 4IOAA 1YHAA 2B2UC 2JQOA 4DV4Q 4XYOA 4JI8Q 2HD3A 1BUVT 2XSCA 2MPMA 4DN4M 4EQNA 4IUPA 1STYA 3TQYA 2RVLA 1I4PA 4A3KG 3ONAB 2XWBB 1EEID 4I65A 3OSOA 3ND8A 4H02A 1YVCA 2KJXA 3DMUA 4PZ8A 4DNIA 4B3SL 1BF4A 1U0LA 3OW2A 1Y1WH 4RKLA 5ELNA 2IPKD 2OXPA 1K73C 4OL7A 2ZTCA 2O5JC 3OIQA 3EJIA 4JI5L 3GTJH 2RDGA 4A3BB 1WYDA 1WTPA 2TMPA 2Z0SA 4X62L 1A15A 4DKAC 1I6VC 1GUWA 4JYAQ 1D2BA 2UUBQ 3LWUA 2Q2IA 3K80C 1DCZA 4OONA 1IBLQ 3EA6A 2K6AA 3TDQA 4EQ5A 3VDYA 5EBDA 3Q24A 2JA6H 1NTGA 3CXCA 2R93G 1CT1D 2EJMA 2JA7G 2PQEA 2KQ3A 4R4CA 3G4SA 2R7ZH 4YIJA 5C4XH 5M5XH 5HURA 1M1KC 1B2TA 3GTGH 3BDLA 5F2DA 2LXJA 4ZKBB 3F2BA 1LTGD 3J7A5 1R9TH 1HZ9A 1E2WA 1CK1A 5I9OA 1F2MA 1A3VA 3J7AF 4HCSA 1CKMA 2NBFA 5EPKA 5IYCH 4C1NI 2A74C 3K5LA 4DU9A 3HOUB 4A3FB 1UAPA 2NN6H 2PW5A 3M4OB 1EIGA 1LM0A 2AQ2B 3HOWH 2ES2A 2J7ZA 4H13C 2UUAQ 3GTKH 3MTSA 3I4NB 1CKNA 2JEBI 4GOPA 4RAUC 3NTKA 4QF4A 1KRTA 1I4HA 4KY7A 1W6KA 4X3TA 3H0GB 4LF8Q 2CHBD 2A19A 3GTLH 2DGYA 3K81C 3TREA 5JEAH 1U5KA 1VQ4A 3JC66 4KHPL 3BYTB 3BZDB 3S24A 1E24A 1UNSA 2IT1A 3P7JA 1OXUA 1B1ZA 5LL6S 2MO0A 1QE6A 3QB3A 3GTGB 1SFOH 1V9PA 2F0JA 3BZCA 2F0TA 4M1UB 5BR8L 1EY7A 4O2DA 3RLNA 1JJ2A 1LTSD 1Q1BA 1TS5A 3T1HQ 2AWNA 4RFBA 4B08A 3P1HA 4KY6A 4QIWB 4B3RQ 1XMQQ 4P75A 1SSOA 1O7IA 3U4VA 3G71A 3AFQA 2I0QA 4C3IH 3KLRA 1CA5A 3NBHB 2VS1A 2UUCQ 1UE5A 4G7ZC 4HJAA 4C3IG 5H1SE 1A6XA 4G57A 3SVMA 3I7FA 2OQKA 2EY6A 1D5MC 3E9HA 4JI7L 5JJIA 3E9IA 3SHLA 3OYYA 1YIJA 3MAQA 4KKSA 2HT1A 5FLXE 1B9NA 1YNJD 1VQ7A 4OWXB 4L5TA 3PCOB 2F3WA 1O7LA 4JI1Q 1P8LA 5IY0A 3UDXA 3GTPB 3TS2A 3J80i 2DNCA 3BDCA 3TRZA 1TKWB 2Y0SB 4A3JG 4OHJA 1B3AA 3B6YA 3L2PA 2K5QA 2M2LA 2Z8LA 4JC0A 3HOVB 3A0JA 1KC8C 2KEDA 1QZHA 1LTRD 3F1ZA 4IPGA 1K8MA 4WJ4A 4HSVA 3EVQA 1OTCA 2FHTA 5JJKA 1SR3A 4O1NA 2MUYA 3A8IE 2NVTB 3WWVA 3LWEA 1PFBA 3ULJA 2JJQA 4IQZA 1F9PA 3K5MA 2R7ZG 2CW0C 1EWCA 3R2IA 3ZYYX 1G51A 2KCMA 2QGQA 4IUUA 3S1QH 5IGDA 3VA5A 4A3MG 2ICEC 1MSHA 3TP7A 2GA4B 2FXQA 5GAHC 3ULPA 4R4QA 2E2HH 4J6HA 3PO2G 3A8KE 4XQQA 1STBA 4HCEA 1NCVA 5A2QL 1HHVA 3GTQH 1I3QH 2VW9A 2MO1A 3H3VI 4LFCL 5ELCA 2UXDL 4G7HC 2B2VC 2O4XA 3R2TA 5IYCG 1X3GA 3S2HB 4YHHQ 2DJGC 1A62A 2JA5G 2CWAA 3CC7A 4EVOA 2OCEA 2EY1A 3RMHA 3UI2A 4B3TL 4LF6Q 1VQMA 2AMCB 1GUTA 2NYZD 1L1OA 2E74C 4BS9A 1PZID 4BBSB 1VQHA 2RDFA 1CQVA 1D6EC 2NVYH 1MIUA 3E5SA 3HKZB 1B53A 1U4PA 1VS0A 4DR3L 2RCNA 5A35A 2Z6KC 1LYLA 1Q8IA 3J7ZC 1DYQA 1FL0A 4ZUJA 4CKEA 1GJXA 4RG1A 3KF6A 1VQPA 5K36H 3WOFA 1FNVA 1BXTA 4QJFA 1TIID 1EYGA 3RZOB 2EPBA 4XYQA 1UEAB 3X3NA 5I2YA 3S1QB 5LMUQ 2I5MX 2PCFB 2VXWA 3NELA 4LWCA 1HNWL 4HR7B 4EQPA 2ZM6Q 1PYBA 3J7AV 3HOXB 3T56B 1PFNA 4KD4A 3IL8A 4KN7C 2C5CA 4O42A 5C3WA 1NR2A 2NB0A 3NBHA 2RHSB 1GM5A 2Z1CA 4ZLTF 1HNXQ 3DXJC 3MFGA 3V96A 2F0DA 1YZ6A 4AQYL 1CTMA 2D62A 4YWKA 1F2LA 5M3MB 2A5HA 5EPJA 2MGSA 1TS3A 2OWOA 3NEMA 5DNFA 3A74A 4X64L 3M4QA 5C44B 4DK0A 1UEBA 1CSPA 2ICIA 3A5UA 3KLSX 1I4RA 4JPBW 2HDMA 1NR4A 3MA2B 3K0XA 1NMFA 5AFWA 4QUFA 3Q22A 2ZJPA 2ZTEA 2XN9C 2B2UA 2K5DA 1Y1VH 3S1NH 4J1MA 2EJGC 1C8CA 2P5ZX 4IZ8A 1JOOA 1K3BC 3STBD 2K7VA 1NAPA 5D3DA 3S17B 1VF5C 4BY7G 2IJ0A 1GKHA 3KLWA 1L1OB 3K7AB 3S16B 4KJNA 4AYBG 3T1YQ 3HOXG 2PZTA 1EQTA 1BCPC 1VMPA 3HKSA 1S5ED 3L9AX 4GLAC 3HOXH 1WVLA 4JI2L 5IYBG 3KK7A 3FEWX 1N32Q 3C2PA 4QCLA 4CHTB 2IY5B 3I4LA 4DV1Q 2EYJA 5KRUA 1B50A 2NN6G 2E2JH 2F0PA 1WCMB 2JA8B 3HOZH 2VUMH 2ZT9C 4K6DA 2F0SA 4DUYL 3OTOQ 3M7GA 5HY6A 1NUCA 3UE0A 4IJLA 3MEHA 3NK9A 2F0OA 2F4VQ 1GUSA 1LTTD 2A6EC 3WOEA 3T1YL 1VQOA 5C5MA 1SROA 3K8AA 4R9WA 1VQ8A 5TSSA 2IW3A 2HHHL 4DXGA 1OXTA 1QB5D 5D14A 5M5XB 5C4XB 4HEDA 4QQBX 1Y1VB 3RD4A 2V4DA 1VQKA 2R93B 1V8QA 1VQFA 4DFAA 4HJ7A 2K28A 1PFSA 1EWHA 5JAVA 1IL2A 1LV9A 4A3DH 3M7NA 2BA0A 3IFDA 2Z6KA 1TVXA 2UUCL 1CHQD 3K7AH 3EN2A 4B3ML 1TWAB 3D4WA 4A3DG 1KDAA 5JEAJ 1H9SB 1KHIA 3KOJA 1EIFA 3OTOL 1C48A 3RZDH 4GLXA 4A3FH 3EBEA 3HRZC 2N78A 1IHZA 4LW1A 5M5WH 2PI2A 1XNRL 2QKIC 3T51B 3RR5A 4DR4L 5BR8Q 4A3FG 1EZ8A 4UY8C 1MBYA 4OELB 2KUMA 1EYDA 4UPAA 3MC0B 1HNWQ 1AZPA 3SK8A 5CV4A 1R4QB 5LMNL 2M00A 2PO4A 1HQRD 4IO9A 3KF8A 2O2LD 5C4JH 2WIIB 5CV7A 2VQEQ 3TZDA 4PMWA 3DHQA 3BZKA 2EXZA 2QILA 4DR3Q 2Q2HA 2F4VL 4LAAA 3SGIA 4I7ZC 4A3DB 2WAQB 2OTJA 3PGZA 4NXML 2MHVA 1TS4A 2LKVA 2HUGA 4ME3A 4RHSA 1BOSA 3I4MB 1RD9D 1V43A 4GN5A 1EYAA 2F4IA 1RDPD 3FKIG 1LO5D 2UXCL 1Q46A 5IT9c 4GNXB 5NUCA 4JG2A 4WRDA 4CDFC 2EZVA 2UXDQ 4A3EG 3K6OA 1V1PB 4NKLA 4GS3A 1I4QA 1FNWA 2AWOA 4IFDG 2X6LA 3URYA 3W1BA 2R7FA 1ET6A 5BN4A 3CPFA 3CQZB 1I4GA 4L5SA 1TXYA 2L0CA 2B2YA 2K5HA 1G291 1CFMA 3A55A 3D6CA 4GZYC 2MFIA 1XYIA 1HZBA 4GN3B 4GN4B 2B2TA 1PTOH 2F0FA 3EQLC 5GROA 1JWUD 3KJOA 1IW7D 3CC2A 1XTDA 3DEOA 1IL8A 1W2BA 3ITPA 2MP1A 1SJED 3GTOH 5CR3A 1DD2A 3CAMA 2JA5H 2I5HA 3G6JB 2UXCQ 1YNNC 5FLMH 3VR6A 1LTBD 1HZAA 3V2TA 2RBMA 3KDFA 3BU2A 4CDEC 3S14H 1WI5A 1IYUA 1LACA 5FLMG 5T1IA 1DGSA 4A3IB 2CWPA 3QO2A 4LNQA 2R6GA 1FVIA 3PUVA 3BJUA 3H0GH 1DOMA 4PV1C 4ID6A 2SNMA 2CKZB 4DR6Q 1JICA 4JW0A 1LABA 3K0YA 3NSWA 1LT4D 4LUVA 3E6ZX 2WB1E 1C9OA 3NP8A 1PXUA 1TQOA 4YCWA 5ELDA 1B4OA 3UDGA 3CRKC 5FOBB 1GHKA 3M4OH 4N9PA 4LF4L 4A93G 1GXDC 4I7AA 1U4RA 4JI8L 3I4OA 4Y7NB 1J8IA 4LF8L 2VY3A 1W6JA 3RLFA 1LTLA 1PTOB 3KF8B 5E3FA 3S9WA 3TZUA 4K2KA 3CCVA 4UHVA 1KTKA 5ELFA 1CKOA 2SDFA 2F0UA 3SK6A 1DONA 2HDLA 3F2CA 2A6HC 2PQAB 4MNOA 1IBKL 1VQ6A 4KD3A 3U9OA 2GVAA 2I46A 1ZKOA 3P75A 4ILWA 1JWMD 4LF6L 1VQNA 2F1MA 1A0IA 1E2VA 2IL8A 2CQOA 1UE7A 1LTID 2OF1A 1UE1A 1SFOB 1TWFB 2E76C 2E2IB 1ICFB 1N8RC 5FJ8G 1OO9B 2PW7A 3HKZG 1PH9A 3RN5A 3GTQB 5M5YB 1Y1VG 2AKWB 4LF7L 1L0WA 1SNOA 4DUZL 5CBAE 2YYZA 1QVCA 3CP0A 4BA1I 1F77A 5KYIA 1V1OA 4BBRG 4FO2A 4BY7H 1NBWA 2EVBA 4C3HB 4TQUS 3V05A 4DF7A 3S2DH 1XXGA 2Z6BA 2K50A 3TEHB 2N3SA 3LX0A 4RCNA 3U50C 3VYUA 1ET9A 1BNZA 3H09A 3S1MB 4ZCKA 3PO3H 5IYBH 4RKBA 1QJOA 1C7YA 1JQYD 3NTHA 2JYOA 3U58A 4KI0A 4KKUA 4C3JG 4UP7A 2ZTDA 3FKIH 2FJ2A 1CSQA 3F2DA 3L3OC 1S40A 1DJRD 2H4OA 2VUMG 4H44C 4POGA 1KNEA 1QOHA 5I4DA 2EY5A 2SOBA 2QEXA 2L1BA 2EYLA 5CGKA 4A76A 5D65A 3RLOA 4JI0Q 1GUGA 1TS2A 4K0KQ 1VQ5A 4NPSA 1I5FA 2NZ1D 2KEEA 2K5NA 2NZHA 1A3UA 3S1NB 4K2LA 4H7BA 2WKDA 5M5YH 1MGSA 4YWMA 2Y0SG 1KD1C 5E7NA 1IW7C 1JORA 3VR2A 4LF5L 1K8OA 4ME5A 5GAGC 1EFID 1RHPA 1PLFA 1SBBB 2ALYB 4J15A 3CCUA 5CBEE 1PZJD 5E4WC 4DK6C 4A3LG 5I9PA 2L5TA 1S5BD 5KGUA 1PTOD 2VB3X 1ZEQX 3W5OA 3GTMB 3VYRA 1HNZQ 4X62Q 1N33L 1CA6A 4A3LH 4OX9Q 1F9SA 2K5VA 4BBSH 2HCIA 1PH3A 4DNRB 1Q8KA 3MVVA 4HIDA 1JB7A 1EIYB 4YCUA 2ASBA 1Q3LA 2AUKA 5JPMC 3AQQA 1VQIA 4RWSC 3RUZA 5HGTA 3FVQA 1SDFA 4K5VA 4LJZC 4OWWB 1WTHA 1D5XC 1RTOA 1NY4A 1BR9A 4A3CG 4A3EH 4K5WA 1EY5A 3OW7A 2KHSA 2YTXA 1PDQA 1WTOA 1SYEA 4DV0L 1VQEA 2EQSA 3IKJA 2BH2A 1YHBA 2NVXB 2Y0SE 2KCCA 2IHFA 1Z7TA 4DV5L 1JOQA 1CZGA 1PH1A 4HIKA 2BDOA 1BO0A 2DNEA 2G9DA 2NVYB 5GAEC 4JOIC 3TP8A 2A8VA 1UUPA 2DUDA 4LF4Q 3AEVA 2M9VA 3S15H 4IPCA 1G2TA 5E4XA 1D8LA 3D4RA 3ND9A 5ISRA 4DPGA 1HRJA 1MJEA 1VQDA 4BXXH 5EBCA 4X3KA 3I8ZA 1RIPA 3QIAA 2Q8TA 1K83B 4C1NK 2NN6I 3H6MA 1KL9A 4DAYB 1AH9A 2G9HD 2Q8RE 1XPOA 1C4QA 1WJJA 5EGTA 5A2QE 4OX9L 1I50H 1PZKD 2CFMA 3HP3A 2WP8J 4QUCA 2FMMA 1EY9A 3L7ZC 3RN2A 3MXGA 3GV3A 5AJ3L 4FF4A 1Z9FA 1K9MC 1AZQA 1SE4A 2Z4IA 1ESFA 3R8BA 3I91A 5CV9A 3S16H 3JAMi 3ERSX 2O5IC 1JJCB 3OPOA 3NBIA 3SXHA 5M9OA 5BN5A 1M90C 3A54A 1PH4A 2XRSD 5CV5A 3PIO3 2B2WA 4OIKA 1DZ1A 5LHY1 3DM1A 1WD0A 3G48A 4LUZA 4QIWE 4NMZA 4A3GH 1Q90A 4K8JA 1A2TA 2AQ1B 4GLVB 1MI2A 4DGZA 2EYMA 3HG9A 4J8QA 1VQJA 2N55A 3ERQA 2VZAA 3IRBA 2JXMB 1UE6A 5M3FB 1TY2A 1JB3A 2R7ZB 1PFMA 1SMXA 1KAWA 5FJ8H 4PG3A 4BBRB 3T16A 1G6PA 1GHJA 1HJPA 1LT5D 1I50B 1PRTB 4ZAIA 3NHHA 3X3MA 1VQLA 4LF9L 1G2SA 1O7ZA 4A93H 3PO2B 1IYJB 1YEZA 4L63B 5HGQA 1QNUA 1UWVA 4JV5Q 4LF9Q 4JI4Q 3FPUB 2NTTA 1WCMG 4XXEA 2Q2TA 4FF1A 1X55A 2Q2UA 4K6LA 4AIMA 1BCPB 4LF7Q 2J4XA 4JK1C 1IBML 1TWCH 1N34L 5LMNQ 2X6GA 4BBSG 4A3JH 2SEBD 2NVQH 1L1OC 5EJWA 3RZDB 3JAML 3IFTA 4HIMA 1J9OA 4DV0Q 3GO5A 1HH2P 3HOZG 1PMRA
chains in the Genus database with same CATH topology
2Q8IB 4WJWA 2A6ED 2A73B 2F0IA 1RCVD 1KLUD 3MXNA 4BWGB 1T5XD 4A3KB 4F7XA 1OXSC 3C1EA 3OMCA 4PMCA 1Y69U 4IFDI 2SNSA 4FYDA 2B63B 2F03A 3EROA 2F0GA 3J81E 3VYTA 1WTQA 1ILPA 4IFDJ 1BCPD 3R3OA 2Z4HA 1EOTA 1RKNA 4DAPA 4KY5A 1HTPA 2JEAI 2BE5D 4HAEA 1YNND 1H9JA 3OOCA 5IT9E 1T5EA 1TWHB 1FD7D 1XTCD 4XQJA 2CQAA 3GTKB 2DN8A 1F9QA 5KNBA 4NDXA 2FINB 1FR3A 2IX1A 3DWAA 3M85A 2LFNA 5CV6A 1JWSD 3AMUA 3S1RB 1IYVA 2PPBC 2RSOA 3D8GA 4NP5A 2VNUD 1ENCA 1I4XA 4KV6A 1D1KA 3HOWB 1F2YA 3PMFA 2A68D 3PO3B 2ENBA 3T4AC 1VCIA 3J81L 3FRPB 4IN3A 1KLGD 4A3MB 5CV8A 2IX3A 2BDNA 3O13A 3VA7A 2OEOA 1DOKA 3J7YW 1EY0A 2L11A 1SNQA 4KHVA 3DWPA 1RTNA 1TY0A 2A69D 2JA5B 4R8IA 4ULLA 5C0XI 4DK1A 2K01A 4EQOA 1PRTF 1L0YB 5I6WA 2F0QA 3VR4A 1HA5A 2K5WA 4HSPA 1BBXC 2L55A 2AUJD 3C46A 4KMUC 2BCOA 2C9OA 1MSGA 4Q5VA 1LT6D 1KDCA 3NPPA 1HUMA 1KNAA 5JPNC 1HUNA 4LK1C 3MXPA 1IKLA 1CHPD 2NUCA 3OIPA 4FP5D 5JVH3 5JEAG 3J80L 1SYGA 3TMEA 4NW2A 1R9TB 5C3EB 1RF2D 1HCZA 1V1PA 2E2DC 2AQ3B 4RGMA 3T13A 3BS1A 1HPCA 3P20A 4X3SA 4G4KA 5IGCA 3HGBA 1HQMC 1GUOA 3S2DB 4BY1B 3K59A 4KK7A 1RJTA 3CU7A 3MHBA 1FNUA 1LTAD 1QNKA 4Q0FA 5I6YA 5J22A 5J39A 2EJFC 1E0BA 2F0NA 4KHZA 1SE2A 1Z6HA 4BY7B 2TSSA 1Z47A 3SR1A 4K5XA 1M8AA 1S5CD 1H9RA 5CORA 4ZQ3A 4OO1I 4UAIA 1TR5A 5EPLA 3S15B 5C0XH 4IURA 4KKTA 2DY7A 1O78A 4ABNA 4IUNA 2H1EA 1ESRA 2B39A 4CKBA 2JP1A 1BDOA 2QEJC 1CZWA 5FLXL 4V0BA 3C3LA 2LY7A 4S3SA 3SDZA 3M4YA 1SNMA 4L6TB 2EDGA 1SMYD 1XWEA 5C5LA 5T1GA 2EYFA 4Z9CB 1Y8OB 4XT3B 1AN8A 1WTWA 1KAAA 1L0XB 1BQQT 4U673 4BA2I 1TT2A 3PUWA 4CGYB 4C56C 1O7YA 5C3XA 1SYCA 1AP0A 1SMYC 1Q1EA 3KBGA 4MN3A 2RSNA 1EY6A 3HOYB 2ZXPA 4A3JB 2B8GA 3SK4A 2FMCA 3FMCA 1JC7A 4FNFA 5KEEA 1ZYRD 4RH6A 3T53B 1SYDA 4KJOA 3C1FA 5IIFA 3HOZB 4CKCA 3Q6SA 1U4MA 4FVMA 5K36G 1E2ZA 3I73A 5JVG3 2ID0A 1PRTD 3I90A 4R8NA 4JBWA 1Y8PB 1MD2D 5FO8B 4RGNA 2DY8A 3D3RA 4L8JA 1A3TA 5DAUA 1HA6A 5E1FA 4ZK9B 1HFNA 1SNDA 3H3VC 3BVZA 2E2JB 3NQTA 1FGBD 2HQEA 3W3AA 5DM73 3W2DA 1SYBA 1M4VA 2KA7A 4DXFA 1HFGA 1CI3M 3A56A 3LNNA 1PYWD 3TP6A 3QG1A 1PTOF 4WFN3 1ZYRC 1SYFA 4IUVA 5BN3A 1QWYA 4HMIA 3NTIA 4MHEA 4CBVA 3G7LA 4F8MA 1X32A 3HZXA 4CJ2C 1H9KA 5KNDA 1SJHD 1STNA 3TBIB 3OMGA 2RDHA 3HS0C 2EY2A 1A2UA 2R3ZA 3E0JA 1D1IA 3PUZA 2JE6I 5DEHA 2CVRA 1JOKA 5LL6X 3VR5A 2HCCA 1TWGB 1WD1A 4OIJA 2KOLA 3CKIB 1G8ZD 3BVMA 3A8JE 5IGBA 1DOLA 4A93B 1OXXK 2IX0A 1R4PB 5C4JB 5IGFA 1AFPA 4DAYA 1DXMA 1Q12A 1O80A 2XWJB 1OXVA 3BG3A 3GTJB 2N88A 1B9MA 5DM63 2A69C 3SE0A 3J80E 4QB4A 2BA1A 2K03A 4AYBB 3GD7A 3A7AB 1STEA 3K57A 1S4ZA 2F0EA 2R61A 2IWHA 2B2YC 5C4ZA 5CYUA 2BOSA 1B44D 2NWGA 1GOZA 2A68C 4ZRZA 2B2TC 3U9SA 1II3A 5CMDA 4WORA 1VDZA 3D6WA 4C2MB 4PMBA 4UDUC 3MZ5A 2PNRC 5IGGA 1STAA 2F3VA 2PZWA 4RA8A 1ML0D 1H9SA 4DA2A 3GTLB 2PZUA 3KBXA 3DEPA 4RCOA 5IGEA 1X3QA 1EYCA 3N52A 1DM0B 4X3UA 5C0XG 5FO9B 5FK9C 3WDNA 3D31A 4FF3A 5JJZA 1LLRD 1SEBD 4U68A 5G3LD 3QOLA 4RGOS 3I3CA 5M5WB 2B2WC 3DWQA 3NWTA 1SNPA 2BE5C 2QDBA 1VMCA 5KNCA 4KTAA 1WTVA 1EY8A 1LT3D 4C3IB 3FDTA 2F0HA 4F87A 4IFDH 1HXYD 3I72A 2RKSA 1ONLA 1JCKB 3PUYA 3K5NA 4EGVA 1EL0A 4QMGA 3N6RA 3H94A 1PRTC 3KUPA 1VF7A 3AB9A 3CHBD 4B9XA 4FXDA 4XIGS 4CJ0B 1SAPA 5IT9L 1WTRA 4XDXA 1TU2B 3PIP3 3K5OA 3MWYW 2JA7B 1JE4A 3BYYB 2JA6B 2ZXOA 3DUZA 1EIHA 1EEFD 1S5DD 1NSNS 2KECA 1ICWA 4K14A 2JSOA 3MXUA 2RA4A 5COYA 2WV6D 1RODA 3GTOB 3NXWA 4ODGA 5EKKA 4OO1H 2LS01 1AEXA 1U9RA 4ZKCB 3CRLC 2CW0D 2K32A 4OO1G 3OWEB 1I3QB 1I6HB 1EQVA 2RQXA 4C3JB 4B9WA 5C6AA 4FXKC 3S14B 5EQ0A 5FO7B 5C0XJ 3H91A 1STHA 3M3YB 3JAME 5KYLA 2KVMA 3AU7A 4H0LC 4HTHA 4IALA 4PQXA 3K58A 1KDBA 1SNCA 4M8AA 1BCPF 4K8IA 4TRDA 2XNAC 5IODA 4XT1B 5KIXA 5D3IB 3NE5B 3A7LA 3QWNA 2K05A 3BVGA 1D5ZC 4CJ1B 3BDOA 2WINB 1HTLD 4LMQD 5FKAC 3VR3A 1FYCA 2XIWA 4TKOB 4XTCS 1G91A 4DAVA 1ENFA 1H9MA 2XVSA 1ZXTA 5JOBA 5EKIA 2F0KA 5K5PA 4N9TA 5G3LF 5C4HA 2EYOA 3OHXC 5I2XA 4A3GB 3VYSA 3R93A 2F0VA 2B8FA 1X3PA 4P2CB 2I07B 3SEBA 3Q23A 1ILQA 2LMCB 3GP7A 2ZXRA 2F0LA 4OGQC 3Q0AA 3QJYA 3IAYA 2J0TD 4PNYA 2WB1B 4G7OC 3I70A 1EU3A 2EYPA 2B2VA 1EZ6A 2EE1A 2D5DA 3MFYA 3FKIB 5ELEA 4E6IA 4C3HG 4HN7A 4HMJA 4A3EB 1TWCB 4IUTA 2KCNA 2F0MA 2OT2A 5J1ZA 2WKCA 4V190 2NTSA 3SK5A 2E75C 2L12A 5EKLA 1S5FD 2E2HB 4RGTA 2XRQD 2VUMB 5CC4A 1EU4A 4RHRA 2EYHA 1G6ZA 2FFKB 2D9UA 3TP5A 1AW7A 1JR0D 1XX8A 1QCBD 3NUCA 1QG7A 2YU9B 3D4DA 4MIUA 4FF2A 2L4NA 4F88A 4TSSA 2R92B 1U4LA 1IKMA 2A6HD 2K33A 4ZYSA 2QF7A 3TN2A 4FXGC 1F9RA 3PV0A 1YNJC 2L9HA 4XQNA 1QILA 2PYKA 1SE3A 2WACA 2K04A 2PMZB 4ZUIA 2VB2X 2D2CC 1Y8NB 5IOCA 3FPPA 1PTOC 1Y1WB 1KABA 1GUNA 3HEJA 3GQBA 1STGA 1CQFA 1WTXA 2X69A 1F2ZA 3QOJA 4DNTB 3GV6A 1ENAA 1SXTA 3F2UA 3TSSA 2EOTA 3NWSA 3OWFA 5ELBA 4KN4C 4IUQA 2F0WA 1EY4A 1CM9A 3PUXA 3KLSA 2MJ8A 2QCPX 3EFXD 2NVQB 2K1BA 3NQIA 2B2UC 4XYOA 1BUVT 2XSCA 2MPMA 4DN4M 4EQNA 4IUPA 1STYA 2RVLA 1I4PA 3ONAB 2XWBB 1EEID 4I65A 3OSOA 3ND8A 2KJXA 3DMUA 1BF4A 4RKLA 2IPKD 2OXPA 4OL7A 2O5JC 3OIQA 3EJIA 2RDGA 4A3BB 1WTPA 2TMPA 1A15A 1I6VC 1GUWA 1D2BA 3LWUA 1DCZA 3EA6A 2K6AA 3TDQA 5EBDA 3Q24A 1CT1D 2EJMA 2PQEA 2KQ3A 4YIJA 5HURA 1B2TA 3BDLA 5F2DA 4ZKBB 1LTGD 1E2WA 1CK1A 5I9OA 1F2MA 1A3VA 3J7AF 4HCSA 2NBFA 5EPKA 4C1NI 2A74C 3K5LA 4DU9A 3HOUB 4A3FB 1UAPA 2NN6H 2PW5A 3M4OB 1EIGA 2AQ2B 2J7ZA 4H13C 3I4NB 3MTSA 2JEBI 4RAUC 3NTKA 4QF4A 1I4HA 4KY7A 1W6KA 4X3TA 3H0GB 2CHBD 5JEAH 3BYTB 3BZDB 1UNSA 2IT1A 3P7JA 1OXUA 1B1ZA 5LL6S 1QE6A 3QB3A 3GTGB 2F0JA 2F0TA 4M1UB 1EY7A 1LTSD 1Q1BA 1TS5A 2AWNA 4RFBA 4B08A 3P1HA 4KY6A 4QIWB 1SSOA 3KLRA 1CA5A 4G7ZC 4C3IG 1A6XA 4G57A 3SVMA 2EY6A 1D5MC 3SHLA 3MAQA 4KKSA 5FLXE 1B9NA 1YNJD 2F3WA 1O7LA 3GTPB 2DNCA 3BDCA 1TKWB 2Y0SB 4OHJA 1B3AA 2K5QA 2M2LA 2Z8LA 3HOVB 2KEDA 1LTRD 1K8MA 4HSVA 3EVQA 2FHTA 4O1NA 2MUYA 3A8IE 2NVTB 3LWEA 1PFBA 4IQZA 3K5MA 1F9PA 2CW0C 1EWCA 3R2IA 3ZYYX 4IUUA 5IGDA 3VA5A 2ICEC 1MSHA 3TP7A 2GA4B 4J6HA 3A8KE 4XQQA 1STBA 4HCEA 1NCVA 5A2QL 1HHVA 5ELCA 4G7HC 2B2VC 2O4XA 3R2TA 3S2HB 4EVOA 3RMHA 2EY1A 3UI2A 1GUTA 2NYZD 2E74C 4BS9A 1PZID 4BBSB 2RDFA 1CQVA 1D6EC 3E5SA 3HKZB 1B53A 1U4PA 5A35A 1Q8IA 1DYQA 4ZUJA 4CKEA 1GJXA 5K36H 3WOFA 1FNVA 1BXTA 1TIID 3RZOB 2EPBA 4XYQA 1UEAB 3X3NA 5I2YA 3S1QB 2PCFB 2VXWA 4HR7B 4EQPA 3J7AV 3HOXB 3T56B 1PFNA 4KD4A 3IL8A 4KN7C 2C5CA 4O42A 5C3WA 1NR2A 2NB0A 3NBHA 2Z1CA 4ZLTF 3DXJC 3MFGA 3V96A 2F0DA 1CTMA 2D62A 1F2LA 5M3MB 2A5HA 5EPJA 2MGSA 1TS3A 5DNFA 5C44B 4DK0A 2ICIA 3KLSX 1I4RA 2HDMA 1NR4A 3MA2B 4QUFA 5AFWA 3Q22A 2XN9C 2B2UA 2K5DA 4J1MA 2EJGC 1C8CA 4IZ8A 1JOOA 2K7VA 1NAPA 5D3DA 3S17B 1VF5C 2IJ0A 3K7AB 3S16B 4KJNA 2PZTA 1EQTA 1BCPC 1VMPA 1S5ED 3L9AX 1WVLA 3KK7A 3FEWX 3C2PA 4QCLA 4CHTB 3I4LA 2EYJA 5KRUA 1B50A 2NN6G 2F0PA 1WCMB 2JA8B 2ZT9C 4K6DA 2F0SA 3M7GA 1NUCA 3MEHA 3NK9A 2F0OA 1GUSA 1LTTD 2A6EC 3WOEA 5C5MA 4R9WA 5TSSA 2IW3A 4DXGA 1OXTA 1QB5D 5D14A 5M5XB 5C4XB 4HEDA 1Y1VB 3RD4A 2V4DA 2R93B 1V8QA 4DFAA 2K28A 1EWHA 5JAVA 1LV9A 3M7NA 2BA0A 3IFDA 1TVXA 1CHQD 1TWAB 3D4WA 1KDAA 5JEAJ 1H9SB 1C48A 3HRZC 1IHZA 2QKIC 3T51B 1EZ8A 1MBYA 2KUMA 1EYDA 3MC0B 1AZPA 3SK8A 5CV4A 1R4QB 2M00A 2PO4A 1HQRD 3KF8A 2O2LD 2WIIB 5CV7A 3TZDA 4PMWA 3DHQA 2EXZA 2QILA 4LAAA 4A3DB 4I7ZC 2WAQB 2MHVA 1TS4A 2LKVA 2HUGA 4RHSA 1BOSA 3I4MB 1RD9D 1V43A 1EYAA 2F4IA 1RDPD 1LO5D 5NUCA 4WRDA 2EZVA 3K6OA 1V1PB 4NKLA 1I4QA 1FNWA 2AWOA 4IFDG 2X6LA 3URYA 1ET6A 5BN4A 3CQZB 1I4GA 2L0CA 2B2YA 1G291 1CFMA 3A55A 3D6CA 4GZYC 1XYIA 2B2TA 1PTOH 2F0FA 3EQLC 1JWUD 1IW7D 3DEOA 1IL8A 3ITPA 2MP1A 1SJED 5CR3A 1DD2A 3G6JB 1YNNC 3VR6A 1LTBD 3V2TA 2RBMA 1IYUA 1LACA 5T1IA 4A3IB 3QO2A 2R6GA 3PUVA 1DOMA 4PV1C 4ID6A 2SNMA 1JICA 1LABA 3K0YA 3NSWA 1LT4D 3E6ZX 3NP8A 1PXUA 1TQOA 5ELDA 1B4OA 3CRKC 5FOBB 1GHKA 4N9PA 1GXDC 1U4RA 4Y7NB 1J8IA 1W6JA 3RLFA 1PTOB 5E3FA 3S9WA 3TZUA 4K2KA 1KTKA 5ELFA 2SDFA 2F0UA 3SK6A 1DONA 2HDLA 2A6HC 4KD3A 3U9OA 2I46A 1ZKOA 3P75A 4ILWA 1JWMD 2F1MA 2IL8A 1E2VA 1LTID 2OF1A 1SFOB 1TWFB 2E76C 2E2IB 1OO9B 2PW7A 3GTQB 5M5YB 1SNOA 5CBAE 2YYZA 4BA1I 1F77A 5KYIA 1V1OA 4FO2A 2EVBA 4C3HB 4TQUS 3V05A 4DF7A 1XXGA 3LX0A 4RCNA 3VYUA 1ET9A 1BNZA 3H09A 3S1MB 4RKBA 1QJOA 1JQYD 3NTHA 2JYOA 4KI0A 4KKUA 4C3JG 2FJ2A 3L3OC 1DJRD 2H4OA 4H44C 1KNEA 1QOHA 5I4DA 2EY5A 2SOBA 2L1BA 2EYLA 5CGKA 5D65A 1GUGA 1TS2A 2NZ1D 2KEEA 1A3UA 3S1NB 4K2LA 4H7BA 2WKDA 1MGSA 1IW7C 1JORA 3VR2A 1K8OA 4ME5A 1EFID 1RHPA 1PLFA 1SBBB 5CBEE 1PZJD 5E4WC 5I9PA 2L5TA 1S5BD 5KGUA 1PTOD 2VB3X 1ZEQX 3GTMB 3VYRA 1CA6A 1F9SA 2HCIA 4DNRB 3MVVA 1Q3LA 2AUKA 5JPMC 4RWSC 3RUZA 5HGTA 3FVQA 1SDFA 4K5VA 4LJZC 1D5XC 1RTOA 1BR9A 4K5WA 1EY5A 3OW7A 2KHSA 1PDQA 1WTOA 1SYEA 3IKJA 2NVXB 2KCCA 1Z7TA 1JOQA 1CZGA 2BDOA 1BO0A 2DNEA 2G9DA 2NVYB 3TP8A 1UUPA 2M9VA 1G2TA 5E4XA 3D4RA 3ND9A 5ISRA 1HRJA 5EBCA 4X3KA 3I8ZA 3QIAA 2Q8TA 1K83B 4C1NK 2NN6I 3H6MA 2G9HD 2Q8RE 1C4QA 5EGTA 5A2QE 1PZKD 3HP3A 2WP8J 4QUCA 2FMMA 1EY9A 3L7ZC 3MXGA 3GV3A 4FF4A 1AZQA 1SE4A 2Z4IA 1ESFA 3R8BA 3I91A 5CV9A 2O5IC 3OPOA 3NBIA 3SXHA 5M9OA 5BN5A 3A54A 2XRSD 5CV5A 3PIO3 2B2WA 4OIKA 1DZ1A 5LHY1 3DM1A 1WD0A 4NMZA 1Q90A 4K8JA 1A2TA 2AQ1B 1MI2A 4DGZA 2EYMA 3HG9A 4J8QA 2N55A 3ERQA 2JXMB 5M3FB 1TY2A 1JB3A 2R7ZB 1PFMA 4BBRB 3T16A 1GHJA 1LT5D 1I50B 1PRTB 4ZAIA 3NHHA 3X3MA 1G2SA 1O7ZA 3PO2B 4L63B 1QNUA 3FPUB 2NTTA 4XXEA 4FF1A 4K6LA 1BCPB 2J4XA 4JK1C 2X6GA 2SEBD 5EJWA 3RZDB 3JAML 3IFTA 1J9OA 3GO5A 1PMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KTA A;  1EYD A;  4HTH A;  5KEE A;  5CV8 A;  3H6M A;  4IAL A;  2F0N A;  1SYD A;  2EY5 A;  1KDB A;  1SNC A;  2SOB A;  3SK8 A;  2F0I A;  1EY8 A;  4K8I A;  2OEO A;  5IGB A;  2EYL A;  4TRD A;  5CGK A;  4EQN A;  4KJO A;  3C1F A;  5EKL A;  5IIF A;  4ID6 A;  2SNM A;  5IOD A;  5KIX A;  2F0H A;  1EY0 A;  5EGT A;  5IGD A;  5CV4 A;  3VA5 A;  1STY A;  3SR1 A;  1SNQ A;  4J1M A;  4KHV A;  2RKS A;  4IZ8 A;  2M00 A;  4K5X A;  4F7X A;  5J1Z A;  5CC4 A;  3TP7 A;  1JOO A;  3NP8 A;  5IGF A;  1EY9 A;  1TQO A;  3C1E A;  3OMC A;  3OSO A;  4I65 A;  1STB A;  4J6H A;  1A3U A;  4PMC A;  4K2L A;  4H7B A;  3DMU A;  3QB3 A;  4EQO A;  2EYH A;  2SNS A;  5CV7 A;  3TP5 A;  4N9P A;  4QMG A;  4RKL A;  4ZQ3 A;  2OXP A;  4OL7 A;  4KJN A;  3DHQ A;  2F0J A;  2PZT A;  2O4X A;  1TR5 A;  4R8N A;  5I6W A;  5CV9 A;  1JOR A;  2EXZ A;  2F0Q A;  2F0T A;  3EJI A;  3NUC A;  1EY7 A;  4ME5 A;  4LAA A;  3D4D A;  4QB4 A;  5E3F A;  3SXH A;  4EVO A;  5M9O A;  1A3T A;  2EY1 A;  3ERO A;  4MIU A;  4IUN A;  2F0G A;  5DAU A;  4B9X A;  4K2K A;  5I9P A;  5E1F A;  5CV5 A;  3P1H A;  2LKV A;  1SND A;  4KY6 A;  2EYJ A;  2F0U A;  3SK6 A;  5KGU A;  5KRU A;  2F0P A;  2F0E A;  3R3O A;  2RDF A;  4KD3 A;  3U9O A;  1RKN A;  5JOB A;  5C4Z A;  3MVV A;  3NQT A;  4KY5 A;  1EYA A;  2F0K A;  4NMZ A;  4K6D A;  4S3S A;  5K5P A;  2F0S A;  3E5S A;  2HQE A;  1KDC A;  3P75 A;  4K8J A;  4N9T A;  1A2T A;  1SNM A;  2EYO A;  5C4H A;  5NUC A;  1NUC A;  3S9W A;  4WRD A;  1SYB A;  3RUZ A;  3MEH A;  3NK9 A;  4DGZ A;  5HGT A;  3MXP A;  2EYM A;  2F0O A;  2NUC A;  4K5V A;  4NKL A;  4G57 A;  1II3 A;  2PYK A;  2OF1 A;  4ZUJ A;  5C5M A;  2WAC A;  5C5L A;  1NSN S;  2EYF A;  2EY6 A;  2KQ3 A;  2PQE A;  3ERQ A;  2PW7 A;  2F0V A;  4YIJ A;  4ZUI A;  3SHL A;  1SYG A;  4WOR A;  3TP6 A;  3TME A;  5HUR A;  4K5W A;  1EY5 A;  2KHS A;  5IOC A;  3BDL A;  4K14 A;  1SYE A;  5F2D A;  1KAB A;  4NDX A;  4PMB A;  1SYF A;  3MZ5 A;  1SNO A;  3HEJ A;  3D6C A;  5IGG A;  3T16 A;  1STA A;  2F0L A;  1KAA A;  2F3V A;  2PZW A;  1STG A;  2F3W A;  4HMI A;  4DFA A;  5KYI A;  3NHH A;  2PZU A;  5I9O A;  5CV6 A;  1F2M A;  4EQP A;  5JAV A;  2F0F A;  1JOQ A;  1TT2 A;  1A3V A;  3T13 A;  3NXW A;  4ODG A;  5IGE A;  3BDC A;  4KD4 A;  4PNY A;  5EKK A;  4DF7 A;  1F2Z A;  5IGC A;  1AEX A;  3QOJ A;  3LX0 A;  1EYC A;  1U9R A;  4F8M A;  3ITP A;  1ENA A;  5C3X A;  3TP8 A;  3D4W A;  5CR3 A;  5C3W A;  1SYC A;  3D8G A;  3HZX A;  3OWF A;  1KDA A;  2EYP A;  4NP5 A;  4DU9 A;  1EZ6 A;  5ISR A;  1ENC A;  4KV6 A;  2PW5 A;  2F0W A;  1EQV A;  1STN A;  2F0D A;  3QOL A;  1EY4 A;  4RKB A;  1F2Y A;  4B9W A;  4E6I A;  5C6A A;  3PMF A;  3OMG A;  2EY2 A;  2RBM A;  3V2T A;  1A2U A;  3MHB A;  2ENB A;  5DEH A;  1IHZ A;  4HMJ A;  1JOK A;  1SNP A;  1EY6 A;  1STH A;  3EVQ A;  2F0M A;  5I6Y A;  5KYL A;  3SK4 A;  2QDB A;  5J22 A;  5J39 A;  4QF4 A;  1EZ8 A;  3SK5 A;  4KY7 A; 
#chains in the Genus database with same CATH topology
 1VQ9 A;  2Q8I B;  3I4N H;  2N49 A;  4WJW A;  3J81 c;  1XNQ L;  2A6E D;  1MKH A;  4N8X 1;  5IP7 G;  2A73 B;  2F0I A;  4YWL A;  1RCV D;  4POF A;  5C4X G;  5IYD G;  1KLU D;  1NMG A;  3MXN A;  4BWG B;  1XNR Q;  1T5X D;  4A3K B;  1XPU A;  4F7X A;  1OXS C;  1EOV A;  3C1E A;  3OMC A;  4PMC A;  2MNA A;  1Y69 U;  3J81 j;  4IFD I;  3M9B A;  2SNS A;  1Q7Y C;  2WAQ E;  4FYD A;  2UU9 L;  2K75 A;  1PVO A;  4JI6 L;  4KHP Q;  1E22 A;  1K8G A;  2B63 B;  2I5L X;  4LUO A;  4GOP C;  2HIX A;  2F03 A;  3ERO A;  5AJ3 Q;  1CKN B;  2F0G A;  3VYT A;  3J81 E;  4DUZ Q;  4DV5 Q;  1WTQ A;  4A3B G;  4IFD J;  1ILP A;  4BXX G;  3PF4 A;  1BCP D;  5IE8 A;  3R3O A;  2Z4H A;  1EOT A;  1RKN A;  4DAP A;  3QR8 A;  4KY5 A;  1HTP A;  1PV4 A;  2JEA I;  2BE5 D;  2HIV A;  4HAE A;  1YNN D;  4O0A A;  1H9J A;  3OOC A;  5IT9 E;  1T5E A;  1FD7 D;  1TWH B;  1NE3 A;  1XTC D;  1N9W A;  4XQJ A;  2CQA A;  3GTK B;  1XMO L;  2DN8 A;  1F9Q A;  5KNB A;  2RCF A;  4NDX A;  5JJL A;  2FIN B;  1FR3 A;  1N34 Q;  4A3K H;  4HJ5 A;  1X3F A;  2IX1 A;  3DWA A;  1EWI A;  3M85 A;  2F52 A;  2LFN A;  5CV6 A;  2JK8 A;  1JWS D;  3AMU A;  1RL2 A;  1WFQ A;  3S1R B;  2KHI A;  1IYV A;  1SLJ A;  4CDC C;  3GTP H;  2PPB C;  4C3H H;  2RSO A;  3D8G A;  4NP5 A;  3ICE A;  2VNU D;  1ENC A;  1I4X A;  4KV6 A;  3HOU G;  1D1K A;  2QW7 A;  3HOW B;  1F2Y A;  3PMF A;  2A68 D;  4A75 A;  3PO3 B;  2ENB A;  1QVF A;  1JJG A;  3T4A C;  4A3G G;  1VCI A;  3J81 L;  1SN8 A;  3FRP B;  2MQH A;  4IN3 A;  3F8T A;  3H0G G;  1KLG D;  4A3M B;  5IP9 H;  5CV8 A;  2IX3 A;  2BDN A;  3O13 A;  2CCZ A;  4JI5 Q;  1KQS A;  3VA7 A;  2NVT H;  2LSS A;  2OEO A;  1DOK A;  1B7Y B;  2JA6 G;  3J7Y W;  1Q86 C;  1EY0 A;  2JA7 H;  2L11 A;  1SNQ A;  4KHV A;  5C3E G;  3DWP A;  1RTN A;  1TY0 A;  4HIO A;  2A69 D;  2KBN A;  2JA5 B;  4R8I A;  4ULL A;  5C0X I;  2WB1 G;  4DK1 A;  2K01 A;  3LGJ A;  4EQO A;  1PRT F;  4C2M H;  1L0Y B;  1HR0 Q;  1X6O A;  3ER0 A;  4BY1 H;  5I6W A;  5GQO A;  2F0Q A;  3VR4 A;  1HA5 A;  1W3S A;  2K5W A;  2BH8 A;  4HSP A;  1BBX C;  1GD7 A;  4DR7 Q;  4A4I A;  2L55 A;  2YV5 A;  2AUJ D;  4DV4 L;  3D0F A;  3C46 A;  1QUQ A;  4KMU C;  1VQB A;  2BCO A;  2C9O A;  4Y52 H;  4DR2 Q;  2Z9H A;  4JI0 L;  1X3E A;  1MSG A;  4Q5V A;  2ZJQ A;  1LT6 D;  1KDC A;  3NPP A;  1HUM A;  1KNA A;  4DR6 L;  5JPN C;  2UXB L;  1HUN A;  4LK1 C;  3MXP A;  1IKL A;  1CHP D;  2NUC A;  3OIP A;  4FP5 D;  4R1J A;  4DV3 L;  5JVH 3;  5JEA G;  3J80 L;  1SYG A;  4IPD A;  3TME A;  4GOP B;  4NW2 A;  1R9T B;  5C3E B;  1RF2 D;  1HCZ A;  5DLQ E;  1V1P A;  2E2D C;  1HNZ L;  1Q82 C;  4P71 A;  2AQ3 B;  4B3M Q;  4RGM A;  3T13 A;  3BS1 A;  2ATW A;  1EQR A;  5J3B A;  1HPC A;  3P20 A;  4X3S A;  4G4K A;  5IGC A;  3FP9 A;  3HGB A;  1HQM C;  1GUO A;  3S2D B;  3CPW A;  4BY1 B;  5C44 G;  4RMF A;  3K59 A;  4GNX A;  3HOV G;  4MTN A;  4KK7 A;  1RJT A;  1E1T A;  3CU7 A;  1I94 L;  3I4M G;  2E2I H;  3M3Y H;  3MHB A;  3HOV H;  1FNU A;  1LTA D;  2N8N A;  1QNK A;  4Q0F A;  5I6Y A;  4K0K L;  5J22 A;  5J39 A;  2EJF C;  1E0B A;  4NXN L;  1PYS B;  4LFB L;  2F0N A;  1A63 A;  4KHZ A;  1SE2 A;  1Z6H A;  3CME A;  4BY7 B;  2TSS A;  1PH2 A;  1Z47 A;  3I4N G;  1IBK Q;  2NVX H;  3SR1 A;  1Y1W G;  4K5X A;  4QY7 A;  1M8A A;  3S1M H;  1S5C D;  5IWA Q;  1H9R A;  5COR A;  4ZQ3 A;  3AFP A;  4OO1 I;  4UAI A;  1TR5 A;  2E5L L;  5EPL A;  3S15 B;  5C0X H;  4L5R C;  4IUR A;  4KKT A;  2VQF Q;  2DY7 A;  1XJV A;  4JI1 L;  1O78 A;  4ABN A;  4IUN A;  2H1E A;  1ESR A;  2B39 A;  3HOY H;  4CKB A;  3DLL A;  2JP1 A;  1JT8 A;  1BDO A;  2QEJ C;  1CZW A;  5FLX L;  4V0B A;  3C3L A;  2LY7 A;  3GTM H;  1VQG A;  4S3S A;  4C3J H;  1VQC A;  3HOY G;  4NB3 A;  3SDZ A;  3M4Y A;  1T9H A;  1SNM A;  3PQI A;  1EQQ A;  2R7D A;  4L6T B;  4A3I G;  3CMA A;  2EDG A;  1SMY D;  2D0O A;  1XWE A;  3KDF B;  5C5L A;  5T1G A;  2EYF A;  4Z9C B;  2B3G A;  1PH8 A;  1Y8O B;  4XT3 B;  1AN8 A;  1S72 A;  4AQY Q;  1WTW A;  1KAA A;  1L0X B;  1BQQ T;  4U67 3;  3KJP A;  2EIF A;  4BA2 I;  4NXM Q;  2D0P A;  1TT2 A;  3CCL A;  3PUW A;  4CGY B;  4C56 C;  1O7Y A;  4NXN Q;  5C3X A;  2ZM6 L;  1SYC A;  2CH4 A;  5ELO A;  3HOW G;  4R4O A;  1AP0 A;  4JBJ A;  4JBM A;  1SMY C;  1Q1E A;  3KBG A;  4MN3 A;  2RSN A;  4IPH A;  1EY6 A;  3HOY B;  1PA6 A;  2ZXP A;  4A3J B;  2VQF L;  2B8G A;  3HKZ E;  3SK4 A;  2YU9 H;  2FMC A;  1SE8 A;  3FMC A;  1JC7 A;  4FNF A;  5KEE A;  1ZYR D;  4RH6 A;  3T53 B;  1SYD A;  4DR1 Q;  3M4P A;  2F3I A;  1K0R A;  3C1F A;  4KJO A;  5IIF A;  3HOZ B;  4CKC A;  3Q6S A;  1B3Q A;  1U4M A;  2V1C C;  4FVM A;  5K36 G;  2KHJ A;  1E2Z A;  3I73 A;  2DJF C;  3GDE A;  2ID0 A;  2JA9 A;  5JVG 3;  3S2H H;  1PRT D;  3I90 A;  4R8N A;  4JBW A;  1Y8P B;  2PQA A;  4JI2 Q;  1MD2 D;  5FO8 B;  4RGN A;  2DY8 A;  3K7U C;  3D3R A;  4L8J A;  1A3T A;  1AE2 A;  5DAU A;  1S3O A;  4DV6 L;  5FLX c;  4OXP A;  1HA6 A;  3CD6 A;  4OEM B;  1MJC A;  5E1F A;  4ZK9 B;  1HFN A;  2JA8 H;  2YTV A;  4QGU A;  1SND A;  3PF5 A;  2B63 G;  1C0A A;  3H3V C;  1D7Q A;  1K3R A;  3BVZ A;  2E2J B;  3NQT A;  1B70 B;  1FGB D;  2HQE A;  1TWA H;  3W3A A;  4JOI A;  5DM7 3;  3W2D A;  1SYB A;  1M4V A;  1FJG Q;  2KA7 A;  4DXF A;  1HFG A;  1CI3 M;  4P74 A;  4X65 L;  3A56 A;  3LNN A;  1YBY A;  1PYW D;  3TP6 A;  2LXK A;  3RZO H;  3QG1 A;  1PTO F;  1J6Q A;  2UUB L;  4WFN 3;  1ZYR C;  1SYF A;  4IUV A;  5BN3 A;  4DV1 L;  1QWY A;  2JN4 A;  4PZ7 A;  1XPR A;  4HMI A;  3NTI A;  1HR0 W;  4MHE A;  4CBV A;  3G7L A;  1IXR A;  4X65 Q;  4MTK A;  4F8M A;  2XTI A;  3J80 c;  1N36 Q;  1X32 A;  1FJG L;  3HZX A;  2K14 A;  4CJ2 C;  5M3M H;  3EIV A;  1H9K A;  4CDD C;  5KND A;  1SJH D;  1STN A;  2VQE L;  3TBI B;  2HHH Q;  3OMG A;  2RDH A;  3HS0 C;  2EY2 A;  1A2U A;  2R3Z A;  3PUZ A;  1D1I A;  3E0J A;  2JE6 I;  5DEH A;  2CVR A;  1JOK A;  4KLK A;  1I94 Q;  5LL6 X;  3VR5 A;  3MEF A;  2HCC A;  1TWG B;  1WD1 A;  4DV6 Q;  4OIJ A;  1N36 L;  5M3F G;  2KOL A;  3CKI B;  1G8Z D;  4A3M H;  3BVM A;  3A8J E;  5IGB A;  1DOL A;  3PO2 H;  4A93 B;  1OXX K;  1NNX A;  3DM3 A;  2IX0 A;  1R4P B;  4DR4 Q;  3CCR A;  1XMQ L;  5C4J B;  5IGF A;  1AFP A;  4AYB E;  4DAY A;  1DXM A;  1Q12 A;  1O80 A;  2XWJ B;  1OXV A;  2WFW A;  3BG3 A;  3GTJ B;  1BKB A;  2N88 A;  1B9M A;  4A3B H;  4B3T Q;  5DM6 3;  2A69 C;  3SE0 A;  1X9N A;  3J80 E;  1AE3 A;  4Y7N H;  4QB4 A;  2BA1 A;  3KFU A;  1WCM H;  3A5Z B;  1E7Z A;  2K03 A;  1EFW A;  4AYB B;  3GD7 A;  3A7A B;  3HFZ B;  1STE A;  3K57 A;  1S4Z A;  2F0E A;  1YHQ A;  1BBW A;  1ASY A;  2R61 A;  3I4M H;  2IWH A;  2B2Y C;  5C4Z A;  5CYU A;  2QDL A;  4DR2 L;  1PHJ A;  2BOS A;  4L5Q A;  1B44 D;  4DK3 C;  2L15 A;  4YY3 Q;  3I55 A;  4HJ9 A;  2NWG A;  1GOZ A;  2A68 C;  4ZRZ A;  2B2T C;  3U9S A;  4JI6 Q;  1II3 A;  4X64 Q;  1TWH H;  1KXL A;  4JCV E;  4IOC A;  5CMD A;  4WOR A;  4DUY Q;  1NJI C;  1VDZ A;  4N8F A;  3D6W A;  2R93 H;  4C2M B;  3FHW A;  3T1H L;  4PMB A;  4UDU C;  3MZ5 A;  2PNR C;  1VQA A;  5IGG A;  1STA A;  2F3V A;  2PZW A;  4RA8 A;  1ML0 D;  1H9S A;  4DA2 A;  3GTL B;  4YCV A;  4DAM A;  2PZU A;  3KBX A;  1GO3 E;  3DEP A;  1N32 L;  4RCO A;  5IGE A;  4DR1 L;  1X3Q A;  1EYC A;  3CCE A;  4AH6 A;  3N52 A;  1DM0 B;  4X3U A;  5C0X G;  5FO9 B;  4YY3 L;  5FK9 C;  3WDN A;  3D31 A;  4FF3 A;  5JJZ A;  1LLR D;  3CCJ A;  1SEB D;  2VL6 A;  4U68 A;  5G3L D;  3QOL A;  4RGO S;  3I3C A;  5M5W B;  2IHE A;  2B2W C;  4LFA Q;  3DWQ A;  3NWT A;  2KCT A;  2RF4 A;  1SNP A;  3CQZ H;  2BE5 C;  2QDB A;  1WOC A;  1VMC A;  5KNC A;  4KTA A;  1K8A C;  1WTV A;  4A3I H;  1EY8 A;  3ZJY C;  1LT3 D;  4C3I B;  3FDT A;  2E5L Q;  2F0H A;  3S1R H;  4F87 A;  4IFD H;  1X54 A;  1HXY D;  2EXD A;  3I72 A;  3L0O A;  2RKS A;  4X66 L;  2OTL A;  1ONL A;  1JCK B;  3W1G A;  4DV2 L;  3PUY A;  3K5N A;  4EGV A;  1EL0 A;  4QMG A;  2H5X A;  4YHH L;  1XMO Q;  3N6R A;  3H94 A;  1TWF H;  2K4K A;  1PRT C;  3G6E A;  2GN5 A;  2PMZ E;  3KUP A;  1HNX L;  1VF7 A;  2UXB Q;  3AB9 A;  3CHB D;  5M3M G;  1HZC A;  4B9X A;  2RHQ B;  4FXD A;  4XIG S;  4CJ0 B;  1SAP A;  3CCS A;  4DV7 Q;  5IT9 L;  1BVS A;  1WTR A;  4IJH A;  4XDX A;  1TU2 B;  3PIP 3;  3HOU H;  3K5O A;  3MWY W;  1LUZ A;  4GNX C;  2JA7 B;  4JI4 L;  1JE4 A;  3BYY B;  2JA6 B;  2ZXO A;  3CW2 C;  4PZ6 A;  1K0S A;  1HR0 L;  3DUZ A;  1EIH A;  5IP9 G;  1EEF D;  3U4Z A;  1S5D D;  1NSN S;  1MHW C;  4GKK L;  4GKJ L;  2KEC A;  4JYA L;  1ICW A;  1KIX A;  3CF5 A;  1GVP A;  4K14 A;  2JSO A;  5C3E H;  4ALP A;  3MXU A;  2RA4 A;  3I56 A;  4B3R L;  5COY A;  2WV6 D;  4R4I A;  1ROD A;  3GTO B;  3NXW A;  4ODG A;  1X65 A;  5EKK A;  3CC4 A;  4OO1 H;  3NEN A;  2LS0 1;  1AEX A;  1U9R A;  4ZKC B;  3CRL C;  1XNQ Q;  2QA4 A;  2CW0 D;  2K32 A;  4OO1 G;  3UDF A;  3OWE B;  1I3Q B;  1I6H B;  1H95 A;  1EQV A;  1Q81 C;  2RQX A;  4C3J B;  1J5E L;  4B9W A;  5C6A A;  4FXK C;  5LMU L;  4X6A H;  2JA8 G;  3S14 B;  5EQ0 A;  4JI7 Q;  1X56 A;  5FO7 B;  4DR5 L;  5C0X J;  3H91 A;  1STH A;  3M3Y B;  3JAM E;  5KYL A;  2KVM A;  3AU7 A;  2A1A A;  1YI2 A;  4H0L C;  4HTH A;  1PH7 A;  4IAL A;  1K83 H;  4PQX A;  3K58 A;  3STB C;  1KDB A;  1SNC A;  4M8A A;  2K52 A;  4DR7 L;  1BCP F;  4K8I A;  4TRD A;  4A3C H;  2XNA C;  4DR5 Q;  5IOD A;  4XT1 B;  5KIX A;  5D3I B;  3NE5 B;  3E3X A;  3A7L A;  3QWN A;  5LMN W;  1SRU A;  5IYD H;  3BVG A;  2K05 A;  1K28 A;  1D5Z C;  4MZ9 A;  4CJ1 B;  4EX5 A;  3BDO A;  2HQL A;  2WIN B;  4OWT B;  1HTL D;  4LMQ D;  1IZ6 A;  4DV3 Q;  2GVB A;  5FKA C;  3VR3 A;  2ZJR A;  1QZG A;  1FYC A;  2XIW A;  1V1Q A;  4TKO B;  4XTC S;  4LFC Q;  1N33 Q;  1G91 A;  4DAV A;  1ENF A;  1H9M A;  2XVS A;  4JI3 Q;  1Y14 B;  4QL5 A;  1ZXT A;  3TS0 A;  2OQ0 A;  1ASZ A;  5JOB A;  1I6H H;  4GKK Q;  4GKJ Q;  5EKI A;  2F0K A;  3PSI A;  5K5P A;  5EAY A;  3KF6 B;  4N9T A;  5G3L F;  5C4H A;  2EYO A;  3OHX C;  5I2X A;  4A3G B;  4R4T A;  2UU9 Q;  4UP9 A;  2E8G A;  3VYS A;  3R93 A;  1YNX A;  2F0V A;  3AYH B;  2B8F A;  3H15 A;  4JBK A;  1X3P A;  4P2C B;  1E3P A;  2PI2 E;  2I07 B;  3SEB A;  3Q23 A;  1ILQ A;  2LMC B;  3GP7 A;  2ZXR A;  4DV7 L;  2F0L A;  4OGQ C;  3Q0A A;  3CCQ A;  4JVZ A;  3QJY A;  1JMC A;  3IAY A;  2J0T D;  4PNY A;  2WB1 B;  4G7O C;  3UE1 A;  1EUJ A;  1BBU A;  3I70 A;  2WAQ G;  4UP8 A;  1EU3 A;  2XGT A;  2EYP A;  1A8V A;  2B2V A;  1YJ9 A;  1EZ6 A;  2EE1 A;  4FDB A;  2D5D A;  3MFY A;  4DV2 Q;  3FKI B;  4B3S Q;  4APV A;  5ELE A;  4E6I A;  2C35 B;  4C3H G;  4X66 Q;  3ULL A;  3KYH C;  2YTY A;  4HN7 A;  4HMJ A;  4A3E B;  1TWC B;  3MXN B;  4IUT A;  2KCN A;  2F0M A;  2OT2 A;  4LF5 Q;  5J1Z A;  2WKC A;  4V19 0;  2NTS A;  3SK5 A;  2B29 A;  2E75 C;  3UDI A;  3CCM A;  1YJW A;  3JAM c;  2KEN A;  1TWG H;  2L12 A;  5EKL A;  1S5F D;  2E2H B;  4RGT A;  2XRQ D;  2VUM B;  3I2Z A;  1FGU A;  5IWA L;  4LFA L;  5CC4 A;  3S17 H;  2PNH A;  1EU4 A;  2UUA L;  1PH5 A;  4RHR A;  2EYH A;  1G6Z A;  2FFK B;  2D9U A;  3TP5 A;  1YIT A;  1PH6 A;  1AW7 A;  1JR0 D;  1XX8 A;  1KRS A;  1QCB D;  1QVG A;  3NUC A;  1QG7 A;  2YU9 B;  3D4D A;  1E1O A;  2B63 H;  4LFB Q;  4MIU A;  4BY1 G;  4FF2 A;  2L4N A;  4F88 A;  4TSS A;  2R92 B;  3PIP A;  1U4L A;  3RNU A;  1IKM A;  2A6H D;  1L2F A;  4WJ3 M;  2G5D A;  2K33 A;  5GAD C;  4ZYS A;  3PIO A;  2QF7 A;  3TN2 A;  4FXG C;  2CH4 W;  1F9R A;  3PV0 A;  1P16 A;  5IP7 H;  1YNJ C;  4TVA B;  2L9H A;  4XQN A;  1QIL A;  2PYK A;  1SE3 A;  4JV5 L;  2WAC A;  2K04 A;  4HJ8 A;  2PMZ B;  1YJN A;  4ZUI A;  2VB2 X;  2D2C C;  1Y8N B;  4JI3 L;  5IOC A;  1CUK A;  3FPP A;  1PTO C;  1B8A A;  4BBR H;  1Y1W B;  1KAB A;  1GUN A;  1J5E Q;  1IBL L;  4P72 A;  3HEJ A;  3GQB A;  1STG A;  3E0E A;  1CQF A;  1WTX A;  1JE5 A;  3H3V H;  2X69 A;  1F2Z A;  3J81 i;  3QOJ A;  4DNT B;  3PO3 G;  3GV6 A;  1ENA A;  1SXT A;  3F2U A;  5L37 A;  3TSS A;  2EOT A;  3NWS A;  3OWF A;  5ELB A;  4KN4 C;  2R92 G;  4IUQ A;  2F0W A;  1EY4 A;  1CM9 A;  3PUX A;  3KLS A;  2AHO B;  5C44 H;  2MJ8 A;  2NZO A;  2QCP X;  2R92 H;  3Q8D A;  1IBM Q;  5M3F H;  3EFX D;  2NVQ B;  1QUQ B;  4P73 A;  2K1B A;  3NQI A;  4IOA A;  1YHA A;  2B2U C;  2JQO A;  4DV4 Q;  4XYO A;  4JI8 Q;  2HD3 A;  1BUV T;  2XSC A;  2MPM A;  4DN4 M;  4EQN A;  4IUP A;  1STY A;  3TQY A;  2RVL A;  1I4P A;  4A3K G;  3ONA B;  2XWB B;  1EEI D;  4I65 A;  3OSO A;  3ND8 A;  4H02 A;  1YVC A;  2KJX A;  3DMU A;  4PZ8 A;  4DNI A;  4B3S L;  1BF4 A;  1U0L A;  3OW2 A;  1Y1W H;  4RKL A;  5ELN A;  2IPK D;  2OXP A;  1K73 C;  4OL7 A;  2ZTC A;  2O5J C;  3OIQ A;  3EJI A;  4JI5 L;  3GTJ H;  2RDG A;  4A3B B;  1WYD A;  1WTP A;  2TMP A;  2Z0S A;  4X62 L;  1A15 A;  4DKA C;  1I6V C;  1GUW A;  4JYA Q;  1D2B A;  2UUB Q;  3LWU A;  2Q2I A;  3K80 C;  1DCZ A;  4OON A;  1IBL Q;  3EA6 A;  2K6A A;  3TDQ A;  4EQ5 A;  3VDY A;  5EBD A;  3Q24 A;  2JA6 H;  1NTG A;  3CXC A;  2R93 G;  1CT1 D;  2EJM A;  2JA7 G;  2PQE A;  2KQ3 A;  4R4C A;  3G4S A;  2R7Z H;  4YIJ A;  5C4X H;  5M5X H;  5HUR A;  1M1K C;  1B2T A;  3GTG H;  3BDL A;  5F2D A;  2LXJ A;  4ZKB B;  3F2B A;  1LTG D;  3J7A 5;  1R9T H;  1HZ9 A;  1E2W A;  1CK1 A;  5I9O A;  1F2M A;  1A3V A;  3J7A F;  4HCS A;  1CKM A;  2NBF A;  5EPK A;  5IYC H;  4C1N I;  2A74 C;  3K5L A;  4DU9 A;  3HOU B;  4A3F B;  1UAP A;  2NN6 H;  2PW5 A;  3M4O B;  1EIG A;  1LM0 A;  2AQ2 B;  3HOW H;  2ES2 A;  2J7Z A;  4H13 C;  2UUA Q;  3GTK H;  3MTS A;  3I4N B;  1CKN A;  2JEB I;  4GOP A;  4RAU C;  3NTK A;  4QF4 A;  1KRT A;  1I4H A;  4KY7 A;  1W6K A;  4X3T A;  3H0G B;  4LF8 Q;  2CHB D;  2A19 A;  3GTL H;  2DGY A;  3K81 C;  3TRE A;  5JEA H;  1U5K A;  1VQ4 A;  3JC6 6;  4KHP L;  3BYT B;  3BZD B;  3S24 A;  1E24 A;  1UNS A;  2IT1 A;  3P7J A;  1OXU A;  1B1Z A;  5LL6 S;  2MO0 A;  1QE6 A;  3QB3 A;  3GTG B;  1SFO H;  1V9P A;  2F0J A;  3BZC A;  2F0T A;  4M1U B;  5BR8 L;  1EY7 A;  4O2D A;  3RLN A;  1JJ2 A;  1LTS D;  1Q1B A;  1TS5 A;  3T1H Q;  2AWN A;  4RFB A;  4B08 A;  3P1H A;  4KY6 A;  4QIW B;  4B3R Q;  1XMQ Q;  4P75 A;  1SSO A;  1O7I A;  3U4V A;  3G71 A;  3AFQ A;  2I0Q A;  4C3I H;  3KLR A;  1CA5 A;  3NBH B;  2VS1 A;  2UUC Q;  1UE5 A;  4G7Z C;  4HJA A;  4C3I G;  5H1S E;  1A6X A;  4G57 A;  3SVM A;  3I7F A;  2OQK A;  2EY6 A;  1D5M C;  3E9H A;  4JI7 L;  5JJI A;  3E9I A;  3SHL A;  3OYY A;  1YIJ A;  3MAQ A;  4KKS A;  2HT1 A;  5FLX E;  1B9N A;  1YNJ D;  1VQ7 A;  4OWX B;  4L5T A;  3PCO B;  2F3W A;  1O7L A;  4JI1 Q;  1P8L A;  5IY0 A;  3UDX A;  3GTP B;  3TS2 A;  3J80 i;  2DNC A;  3BDC A;  3TRZ A;  1TKW B;  2Y0S B;  4A3J G;  4OHJ A;  1B3A A;  3B6Y A;  3L2P A;  2K5Q A;  2M2L A;  2Z8L A;  4JC0 A;  3HOV B;  3A0J A;  1KC8 C;  2KED A;  1QZH A;  1LTR D;  3F1Z A;  4IPG A;  1K8M A;  4WJ4 A;  4HSV A;  3EVQ A;  1OTC A;  2FHT A;  5JJK A;  1SR3 A;  4O1N A;  2MUY A;  3A8I E;  2NVT B;  3WWV A;  3LWE A;  1PFB A;  3ULJ A;  2JJQ A;  4IQZ A;  1F9P A;  3K5M A;  2R7Z G;  2CW0 C;  1EWC A;  3R2I A;  3ZYY X;  1G51 A;  2KCM A;  2QGQ A;  4IUU A;  3S1Q H;  5IGD A;  3VA5 A;  4A3M G;  2ICE C;  1MSH A;  3TP7 A;  2GA4 B;  2FXQ A;  5GAH C;  3ULP A;  4R4Q A;  2E2H H;  4J6H A;  3PO2 G;  3A8K E;  4XQQ A;  1STB A;  4HCE A;  1NCV A;  5A2Q L;  1HHV A;  3GTQ H;  1I3Q H;  2VW9 A;  2MO1 A;  3H3V I;  4LFC L;  5ELC A;  2UXD L;  4G7H C;  2B2V C;  2O4X A;  3R2T A;  5IYC G;  1X3G A;  3S2H B;  4YHH Q;  2DJG C;  1A62 A;  2JA5 G;  2CWA A;  3CC7 A;  4EVO A;  2OCE A;  2EY1 A;  3RMH A;  3UI2 A;  4B3T L;  4LF6 Q;  1VQM A;  2AMC B;  1GUT A;  2NYZ D;  1L1O A;  2E74 C;  4BS9 A;  1PZI D;  4BBS B;  1VQH A;  2RDF A;  1CQV A;  1D6E C;  2NVY H;  1MIU A;  3E5S A;  3HKZ B;  1B53 A;  1U4P A;  1VS0 A;  4DR3 L;  2RCN A;  5A35 A;  2Z6K C;  1LYL A;  1Q8I A;  3J7Z C;  1DYQ A;  1FL0 A;  4ZUJ A;  4CKE A;  1GJX A;  4RG1 A;  3KF6 A;  1VQP A;  5K36 H;  3WOF A;  1FNV A;  1BXT A;  4QJF A;  1TII D;  1EYG A;  3RZO B;  2EPB A;  4XYQ A;  1UEA B;  3X3N A;  5I2Y A;  3S1Q B;  5LMU Q;  2I5M X;  2PCF B;  2VXW A;  3NEL A;  4LWC A;  1HNW L;  4HR7 B;  4EQP A;  2ZM6 Q;  1PYB A;  3J7A V;  3HOX B;  3T56 B;  1PFN A;  4KD4 A;  3IL8 A;  4KN7 C;  2C5C A;  4O42 A;  5C3W A;  1NR2 A;  2NB0 A;  3NBH A;  2RHS B;  1GM5 A;  2Z1C A;  4ZLT F;  1HNX Q;  3DXJ C;  3MFG A;  3V96 A;  2F0D A;  1YZ6 A;  4AQY L;  1CTM A;  2D62 A;  4YWK A;  1F2L A;  5M3M B;  2A5H A;  5EPJ A;  2MGS A;  1TS3 A;  2OWO A;  3NEM A;  5DNF A;  3A74 A;  4X64 L;  3M4Q A;  5C44 B;  4DK0 A;  1UEB A;  1CSP A;  2ICI A;  3A5U A;  3KLS X;  1I4R A;  4JPB W;  2HDM A;  1NR4 A;  3MA2 B;  3K0X A;  1NMF A;  5AFW A;  4QUF A;  3Q22 A;  2ZJP A;  2ZTE A;  2XN9 C;  2B2U A;  2K5D A;  1Y1V H;  3S1N H;  4J1M A;  2EJG C;  1C8C A;  2P5Z X;  4IZ8 A;  1JOO A;  1K3B C;  3STB D;  2K7V A;  1NAP A;  5D3D A;  3S17 B;  1VF5 C;  4BY7 G;  2IJ0 A;  1GKH A;  3KLW A;  1L1O B;  3K7A B;  3S16 B;  4KJN A;  4AYB G;  3T1Y Q;  3HOX G;  2PZT A;  1EQT A;  1BCP C;  1VMP A;  3HKS A;  1S5E D;  3L9A X;  4GLA C;  3HOX H;  1WVL A;  4JI2 L;  5IYB G;  3KK7 A;  3FEW X;  1N32 Q;  3C2P A;  4QCL A;  4CHT B;  2IY5 B;  3I4L A;  4DV1 Q;  2EYJ A;  5KRU A;  1B50 A;  2NN6 G;  2E2J H;  2F0P A;  1WCM B;  2JA8 B;  3HOZ H;  2VUM H;  2ZT9 C;  4K6D A;  2F0S A;  4DUY L;  3OTO Q;  3M7G A;  5HY6 A;  1NUC A;  3UE0 A;  4IJL A;  3MEH A;  3NK9 A;  2F0O A;  2F4V Q;  1GUS A;  1LTT D;  2A6E C;  3WOE A;  3T1Y L;  1VQO A;  5C5M A;  1SRO A;  3K8A A;  4R9W A;  1VQ8 A;  5TSS A;  2IW3 A;  2HHH L;  4DXG A;  1OXT A;  1QB5 D;  5D14 A;  5M5X B;  5C4X B;  4HED A;  4QQB X;  1Y1V B;  3RD4 A;  2V4D A;  1VQK A;  2R93 B;  1V8Q A;  1VQF A;  4DFA A;  4HJ7 A;  2K28 A;  1PFS A;  1EWH A;  5JAV A;  1IL2 A;  1LV9 A;  4A3D H;  3M7N A;  2BA0 A;  3IFD A;  2Z6K A;  1TVX A;  2UUC L;  1CHQ D;  3K7A H;  3EN2 A;  4B3M L;  1TWA B;  3D4W A;  4A3D G;  1KDA A;  5JEA J;  1H9S B;  1KHI A;  3KOJ A;  1EIF A;  3OTO L;  1C48 A;  3RZD H;  4GLX A;  4A3F H;  3EBE A;  3HRZ C;  2N78 A;  1IHZ A;  4LW1 A;  5M5W H;  2PI2 A;  1XNR L;  2QKI C;  3T51 B;  3RR5 A;  4DR4 L;  5BR8 Q;  4A3F G;  1EZ8 A;  4UY8 C;  1MBY A;  4OEL B;  2KUM A;  1EYD A;  4UPA A;  3MC0 B;  1HNW Q;  1AZP A;  3SK8 A;  5CV4 A;  1R4Q B;  5LMN L;  2M00 A;  2PO4 A;  1HQR D;  4IO9 A;  3KF8 A;  2O2L D;  5C4J H;  2WII B;  5CV7 A;  2VQE Q;  3TZD A;  4PMW A;  3DHQ A;  3BZK A;  2EXZ A;  2QIL A;  4DR3 Q;  2Q2H A;  2F4V L;  4LAA A;  3SGI A;  4I7Z C;  4A3D B;  2WAQ B;  2OTJ A;  3PGZ A;  4NXM L;  2MHV A;  1TS4 A;  2LKV A;  2HUG A;  4ME3 A;  4RHS A;  1BOS A;  3I4M B;  1RD9 D;  1V43 A;  4GN5 A;  1EYA A;  2F4I A;  1RDP D;  3FKI G;  1LO5 D;  2UXC L;  1Q46 A;  5IT9 c;  4GNX B;  5NUC A;  4JG2 A;  4WRD A;  4CDF C;  2EZV A;  2UXD Q;  4A3E G;  3K6O A;  1V1P B;  4NKL A;  4GS3 A;  1I4Q A;  1FNW A;  2AWO A;  4IFD G;  2X6L A;  3URY A;  3W1B A;  2R7F A;  1ET6 A;  5BN4 A;  3CPF A;  3CQZ B;  1I4G A;  4L5S A;  1TXY A;  2L0C A;  2B2Y A;  2K5H A;  1G29 1;  1CFM A;  3A55 A;  3D6C A;  4GZY C;  2MFI A;  1XYI A;  1HZB A;  4GN3 B;  4GN4 B;  2B2T A;  1PTO H;  2F0F A;  3EQL C;  5GRO A;  1JWU D;  3KJO A;  1IW7 D;  3CC2 A;  1XTD A;  3DEO A;  1IL8 A;  1W2B A;  3ITP A;  2MP1 A;  1SJE D;  3GTO H;  5CR3 A;  1DD2 A;  3CAM A;  2JA5 H;  2I5H A;  3G6J B;  2UXC Q;  1YNN C;  5FLM H;  3VR6 A;  1LTB D;  1HZA A;  3V2T A;  2RBM A;  3KDF A;  3BU2 A;  4CDE C;  3S14 H;  1WI5 A;  1IYU A;  1LAC A;  5FLM G;  5T1I A;  1DGS A;  4A3I B;  2CWP A;  3QO2 A;  4LNQ A;  2R6G A;  1FVI A;  3PUV A;  3BJU A;  3H0G H;  1DOM A;  4PV1 C;  4ID6 A;  2SNM A;  2CKZ B;  4DR6 Q;  1JIC A;  4JW0 A;  1LAB A;  3K0Y A;  3NSW A;  1LT4 D;  4LUV A;  3E6Z X;  2WB1 E;  1C9O A;  3NP8 A;  1PXU A;  1TQO A;  4YCW A;  5ELD A;  1B4O A;  3UDG A;  3CRK C;  5FOB B;  1GHK A;  3M4O H;  4N9P A;  4LF4 L;  4A93 G;  1GXD C;  4I7A A;  1U4R A;  4JI8 L;  3I4O A;  4Y7N B;  1J8I A;  4LF8 L;  2VY3 A;  1W6J A;  3RLF A;  1LTL A;  1PTO B;  3KF8 B;  5E3F A;  3S9W A;  3TZU A;  4K2K A;  3CCV A;  4UHV A;  1KTK A;  5ELF A;  1CKO A;  2SDF A;  2F0U A;  3SK6 A;  1DON A;  2HDL A;  3F2C A;  2A6H C;  2PQA B;  4MNO A;  1IBK L;  1VQ6 A;  4KD3 A;  3U9O A;  2GVA A;  2I46 A;  1ZKO A;  3P75 A;  4ILW A;  1JWM D;  4LF6 L;  1VQN A;  2F1M A;  1A0I A;  1E2V A;  2IL8 A;  2CQO A;  1UE7 A;  1LTI D;  2OF1 A;  1UE1 A;  1SFO B;  1TWF B;  2E76 C;  2E2I B;  1ICF B;  1N8R C;  5FJ8 G;  1OO9 B;  2PW7 A;  3HKZ G;  1PH9 A;  3RN5 A;  3GTQ B;  5M5Y B;  1Y1V G;  2AKW B;  4LF7 L;  1L0W A;  1SNO A;  4DUZ L;  5CBA E;  2YYZ A;  1QVC A;  3CP0 A;  4BA1 I;  1F77 A;  5KYI A;  1V1O A;  4BBR G;  4FO2 A;  4BY7 H;  1NBW A;  2EVB A;  4C3H B;  4TQU S;  3V05 A;  4DF7 A;  3S2D H;  1XXG A;  2Z6B A;  2K50 A;  3TEH B;  2N3S A;  3LX0 A;  4RCN A;  3U50 C;  3VYU A;  1ET9 A;  1BNZ A;  3H09 A;  3S1M B;  4ZCK A;  3PO3 H;  5IYB H;  4RKB A;  1QJO A;  1C7Y A;  1JQY D;  3NTH A;  2JYO A;  3U58 A;  4KI0 A;  4KKU A;  4C3J G;  4UP7 A;  2ZTD A;  3FKI H;  2FJ2 A;  1CSQ A;  3F2D A;  3L3O C;  1S40 A;  1DJR D;  2H4O A;  2VUM G;  4H44 C;  4POG A;  1KNE A;  1QOH A;  5I4D A;  2EY5 A;  2SOB A;  2QEX A;  2L1B A;  2EYL A;  5CGK A;  4A76 A;  5D65 A;  3RLO A;  4JI0 Q;  1GUG A;  1TS2 A;  4K0K Q;  1VQ5 A;  4NPS A;  1I5F A;  2NZ1 D;  2KEE A;  2K5N A;  2NZH A;  1A3U A;  3S1N B;  4K2L A;  4H7B A;  2WKD A;  5M5Y H;  1MGS A;  4YWM A;  2Y0S G;  1KD1 C;  5E7N A;  1IW7 C;  1JOR A;  3VR2 A;  4LF5 L;  1K8O A;  4ME5 A;  5GAG C;  1EFI D;  1RHP A;  1PLF A;  1SBB B;  2ALY B;  4J15 A;  3CCU A;  5CBE E;  1PZJ D;  5E4W C;  4DK6 C;  4A3L G;  5I9P A;  2L5T A;  1S5B D;  5KGU A;  1PTO D;  2VB3 X;  1ZEQ X;  3W5O A;  3GTM B;  3VYR A;  1HNZ Q;  4X62 Q;  1N33 L;  1CA6 A;  4A3L H;  4OX9 Q;  1F9S A;  2K5V A;  4BBS H;  2HCI A;  1PH3 A;  4DNR B;  1Q8K A;  3MVV A;  4HID A;  1JB7 A;  1EIY B;  4YCU A;  2ASB A;  1Q3L A;  2AUK A;  5JPM C;  3AQQ A;  1VQI A;  4RWS C;  3RUZ A;  5HGT A;  3FVQ A;  1SDF A;  4K5V A;  4LJZ C;  4OWW B;  1WTH A;  1D5X C;  1RTO A;  1NY4 A;  1BR9 A;  4A3C G;  4A3E H;  4K5W A;  1EY5 A;  3OW7 A;  2KHS A;  2YTX A;  1PDQ A;  1WTO A;  1SYE A;  4DV0 L;  1VQE A;  2EQS A;  3IKJ A;  2BH2 A;  1YHB A;  2NVX B;  2Y0S E;  2KCC A;  2IHF A;  1Z7T A;  4DV5 L;  1JOQ A;  1CZG A;  1PH1 A;  4HIK A;  2BDO A;  1BO0 A;  2DNE A;  2G9D A;  2NVY B;  5GAE C;  4JOI C;  3TP8 A;  2A8V A;  1UUP A;  2DUD A;  4LF4 Q;  3AEV A;  2M9V A;  3S15 H;  4IPC A;  1G2T A;  5E4X A;  1D8L A;  3D4R A;  3ND9 A;  5ISR A;  4DPG A;  1HRJ A;  1MJE A;  1VQD A;  4BXX H;  5EBC A;  4X3K A;  3I8Z A;  1RIP A;  3QIA A;  2Q8T A;  1K83 B;  4C1N K;  2NN6 I;  3H6M A;  1KL9 A;  4DAY B;  1AH9 A;  2G9H D;  2Q8R E;  1XPO A;  1C4Q A;  1WJJ A;  5EGT A;  5A2Q E;  4OX9 L;  1I50 H;  1PZK D;  2CFM A;  3HP3 A;  2WP8 J;  4QUC A;  2FMM A;  1EY9 A;  3L7Z C;  3RN2 A;  3MXG A;  3GV3 A;  5AJ3 L;  4FF4 A;  1Z9F A;  1K9M C;  1AZQ A;  1SE4 A;  2Z4I A;  1ESF A;  3R8B A;  3I91 A;  5CV9 A;  3S16 H;  3JAM i;  3ERS X;  2O5I C;  1JJC B;  3OPO A;  3NBI A;  3SXH A;  5M9O A;  5BN5 A;  1M90 C;  3A54 A;  1PH4 A;  2XRS D;  5CV5 A;  3PIO 3;  2B2W A;  4OIK A;  1DZ1 A;  5LHY 1;  3DM1 A;  1WD0 A;  3G48 A;  4LUZ A;  4QIW E;  4NMZ A;  4A3G H;  1Q90 A;  4K8J A;  1A2T A;  2AQ1 B;  4GLV B;  1MI2 A;  4DGZ A;  2EYM A;  3HG9 A;  4J8Q A;  1VQJ A;  2N55 A;  3ERQ A;  2VZA A;  3IRB A;  2JXM B;  1UE6 A;  5M3F B;  1TY2 A;  1JB3 A;  2R7Z B;  1PFM A;  1SMX A;  1KAW A;  5FJ8 H;  4PG3 A;  4BBR B;  3T16 A;  1G6P A;  1GHJ A;  1HJP A;  1LT5 D;  1I50 B;  1PRT B;  4ZAI A;  3NHH A;  3X3M A;  1VQL A;  4LF9 L;  1G2S A;  1O7Z A;  4A93 H;  3PO2 B;  1IYJ B;  1YEZ A;  4L63 B;  5HGQ A;  1QNU A;  1UWV A;  4JV5 Q;  4LF9 Q;  4JI4 Q;  3FPU B;  2NTT A;  1WCM G;  4XXE A;  2Q2T A;  4FF1 A;  1X55 A;  2Q2U A;  4K6L A;  4AIM A;  1BCP B;  4LF7 Q;  2J4X A;  4JK1 C;  1IBM L;  1TWC H;  1N34 L;  5LMN Q;  2X6G A;  4BBS G;  4A3J H;  2SEB D;  2NVQ H;  1L1O C;  5EJW A;  3RZD B;  3JAM L;  3IFT A;  4HIM A;  1J9O A;  4DV0 Q;  3GO5 A;  1HH2 P;  3HOZ G;  1PMR A; 
#chains in the Genus database with same CATH homology
 2Q8I B;  4WJW A;  2A6E D;  2A73 B;  2F0I A;  1RCV D;  1KLU D;  3MXN A;  4BWG B;  1T5X D;  4A3K B;  4F7X A;  1OXS C;  3C1E A;  3OMC A;  4PMC A;  1Y69 U;  4IFD I;  2SNS A;  4FYD A;  2B63 B;  2F03 A;  3ERO A;  2F0G A;  3J81 E;  3VYT A;  1WTQ A;  1ILP A;  4IFD J;  1BCP D;  3R3O A;  2Z4H A;  1EOT A;  1RKN A;  4DAP A;  4KY5 A;  1HTP A;  2JEA I;  2BE5 D;  4HAE A;  1YNN D;  1H9J A;  3OOC A;  5IT9 E;  1T5E A;  1TWH B;  1FD7 D;  1XTC D;  4XQJ A;  2CQA A;  3GTK B;  2DN8 A;  1F9Q A;  5KNB A;  4NDX A;  2FIN B;  1FR3 A;  2IX1 A;  3DWA A;  3M85 A;  2LFN A;  5CV6 A;  1JWS D;  3AMU A;  3S1R B;  1IYV A;  2PPB C;  2RSO A;  3D8G A;  4NP5 A;  2VNU D;  1ENC A;  1I4X A;  4KV6 A;  1D1K A;  3HOW B;  1F2Y A;  3PMF A;  2A68 D;  3PO3 B;  2ENB A;  3T4A C;  1VCI A;  3J81 L;  3FRP B;  4IN3 A;  1KLG D;  4A3M B;  5CV8 A;  2IX3 A;  2BDN A;  3O13 A;  3VA7 A;  2OEO A;  1DOK A;  3J7Y W;  1EY0 A;  2L11 A;  1SNQ A;  4KHV A;  3DWP A;  1RTN A;  1TY0 A;  2A69 D;  2JA5 B;  4R8I A;  4ULL A;  5C0X I;  4DK1 A;  2K01 A;  4EQO A;  1PRT F;  1L0Y B;  5I6W A;  2F0Q A;  3VR4 A;  1HA5 A;  2K5W A;  4HSP A;  1BBX C;  2L55 A;  2AUJ D;  3C46 A;  4KMU C;  2BCO A;  2C9O A;  1MSG A;  4Q5V A;  1LT6 D;  1KDC A;  3NPP A;  1HUM A;  1KNA A;  5JPN C;  1HUN A;  4LK1 C;  3MXP A;  1IKL A;  1CHP D;  2NUC A;  3OIP A;  4FP5 D;  5JVH 3;  5JEA G;  3J80 L;  1SYG A;  3TME A;  4NW2 A;  1R9T B;  5C3E B;  1RF2 D;  1HCZ A;  1V1P A;  2E2D C;  2AQ3 B;  4RGM A;  3T13 A;  3BS1 A;  1HPC A;  3P20 A;  4X3S A;  4G4K A;  5IGC A;  3HGB A;  1HQM C;  1GUO A;  3S2D B;  4BY1 B;  3K59 A;  4KK7 A;  1RJT A;  3CU7 A;  3MHB A;  1FNU A;  1LTA D;  1QNK A;  4Q0F A;  5I6Y A;  5J22 A;  5J39 A;  2EJF C;  1E0B A;  2F0N A;  4KHZ A;  1SE2 A;  1Z6H A;  4BY7 B;  2TSS A;  1Z47 A;  3SR1 A;  4K5X A;  1M8A A;  1S5C D;  1H9R A;  5COR A;  4ZQ3 A;  4OO1 I;  4UAI A;  1TR5 A;  5EPL A;  3S15 B;  5C0X H;  4IUR A;  4KKT A;  2DY7 A;  1O78 A;  4ABN A;  4IUN A;  2H1E A;  1ESR A;  2B39 A;  4CKB A;  2JP1 A;  1BDO A;  2QEJ C;  1CZW A;  5FLX L;  4V0B A;  3C3L A;  2LY7 A;  4S3S A;  3SDZ A;  3M4Y A;  1SNM A;  4L6T B;  2EDG A;  1SMY D;  1XWE A;  5C5L A;  5T1G A;  2EYF A;  4Z9C B;  1Y8O B;  4XT3 B;  1AN8 A;  1WTW A;  1KAA A;  1L0X B;  1BQQ T;  4U67 3;  4BA2 I;  1TT2 A;  3PUW A;  4CGY B;  4C56 C;  1O7Y A;  5C3X A;  1SYC A;  1AP0 A;  1SMY C;  1Q1E A;  3KBG A;  4MN3 A;  2RSN A;  1EY6 A;  3HOY B;  2ZXP A;  4A3J B;  2B8G A;  3SK4 A;  2FMC A;  3FMC A;  1JC7 A;  4FNF A;  5KEE A;  1ZYR D;  4RH6 A;  3T53 B;  1SYD A;  4KJO A;  3C1F A;  5IIF A;  3HOZ B;  4CKC A;  3Q6S A;  1U4M A;  4FVM A;  5K36 G;  1E2Z A;  3I73 A;  5JVG 3;  2ID0 A;  1PRT D;  3I90 A;  4R8N A;  4JBW A;  1Y8P B;  1MD2 D;  5FO8 B;  4RGN A;  2DY8 A;  3D3R A;  4L8J A;  1A3T A;  5DAU A;  1HA6 A;  5E1F A;  4ZK9 B;  1HFN A;  1SND A;  3H3V C;  3BVZ A;  2E2J B;  3NQT A;  1FGB D;  2HQE A;  3W3A A;  5DM7 3;  3W2D A;  1SYB A;  1M4V A;  2KA7 A;  4DXF A;  1HFG A;  1CI3 M;  3A56 A;  3LNN A;  1PYW D;  3TP6 A;  3QG1 A;  1PTO F;  4WFN 3;  1ZYR C;  1SYF A;  4IUV A;  5BN3 A;  1QWY A;  4HMI A;  3NTI A;  4MHE A;  4CBV A;  3G7L A;  4F8M A;  1X32 A;  3HZX A;  4CJ2 C;  1H9K A;  5KND A;  1SJH D;  1STN A;  3TBI B;  3OMG A;  2RDH A;  3HS0 C;  2EY2 A;  1A2U A;  2R3Z A;  3E0J A;  1D1I A;  3PUZ A;  2JE6 I;  5DEH A;  2CVR A;  1JOK A;  5LL6 X;  3VR5 A;  2HCC A;  1TWG B;  1WD1 A;  4OIJ A;  2KOL A;  3CKI B;  1G8Z D;  3BVM A;  3A8J E;  5IGB A;  1DOL A;  4A93 B;  1OXX K;  2IX0 A;  1R4P B;  5C4J B;  5IGF A;  1AFP A;  4DAY A;  1DXM A;  1Q12 A;  1O80 A;  2XWJ B;  1OXV A;  3BG3 A;  3GTJ B;  2N88 A;  1B9M A;  5DM6 3;  2A69 C;  3SE0 A;  3J80 E;  4QB4 A;  2BA1 A;  2K03 A;  4AYB B;  3GD7 A;  3A7A B;  1STE A;  3K57 A;  1S4Z A;  2F0E A;  2R61 A;  2IWH A;  2B2Y C;  5C4Z A;  5CYU A;  2BOS A;  1B44 D;  2NWG A;  1GOZ A;  2A68 C;  4ZRZ A;  2B2T C;  3U9S A;  1II3 A;  5CMD A;  4WOR A;  1VDZ A;  3D6W A;  4C2M B;  4PMB A;  4UDU C;  3MZ5 A;  2PNR C;  5IGG A;  1STA A;  2F3V A;  2PZW A;  4RA8 A;  1ML0 D;  1H9S A;  4DA2 A;  3GTL B;  2PZU A;  3KBX A;  3DEP A;  4RCO A;  5IGE A;  1X3Q A;  1EYC A;  3N52 A;  1DM0 B;  4X3U A;  5C0X G;  5FO9 B;  5FK9 C;  3WDN A;  3D31 A;  4FF3 A;  5JJZ A;  1LLR D;  1SEB D;  4U68 A;  5G3L D;  3QOL A;  4RGO S;  3I3C A;  5M5W B;  2B2W C;  3DWQ A;  3NWT A;  1SNP A;  2BE5 C;  2QDB A;  1VMC A;  5KNC A;  4KTA A;  1WTV A;  1EY8 A;  1LT3 D;  4C3I B;  3FDT A;  2F0H A;  4F87 A;  4IFD H;  1HXY D;  3I72 A;  2RKS A;  1ONL A;  1JCK B;  3PUY A;  3K5N A;  4EGV A;  1EL0 A;  4QMG A;  3N6R A;  3H94 A;  1PRT C;  3KUP A;  1VF7 A;  3AB9 A;  3CHB D;  4B9X A;  4FXD A;  4XIG S;  4CJ0 B;  1SAP A;  5IT9 L;  1WTR A;  4XDX A;  1TU2 B;  3PIP 3;  3K5O A;  3MWY W;  2JA7 B;  1JE4 A;  3BYY B;  2JA6 B;  2ZXO A;  3DUZ A;  1EIH A;  1EEF D;  1S5D D;  1NSN S;  2KEC A;  1ICW A;  4K14 A;  2JSO A;  3MXU A;  2RA4 A;  5COY A;  2WV6 D;  1ROD A;  3GTO B;  3NXW A;  4ODG A;  5EKK A;  4OO1 H;  2LS0 1;  1AEX A;  1U9R A;  4ZKC B;  3CRL C;  2CW0 D;  2K32 A;  4OO1 G;  3OWE B;  1I3Q B;  1I6H B;  1EQV A;  2RQX A;  4C3J B;  4B9W A;  5C6A A;  4FXK C;  3S14 B;  5EQ0 A;  5FO7 B;  5C0X J;  3H91 A;  1STH A;  3M3Y B;  3JAM E;  5KYL A;  2KVM A;  3AU7 A;  4H0L C;  4HTH A;  4IAL A;  4PQX A;  3K58 A;  1KDB A;  1SNC A;  4M8A A;  1BCP F;  4K8I A;  4TRD A;  2XNA C;  5IOD A;  4XT1 B;  5KIX A;  5D3I B;  3NE5 B;  3A7L A;  3QWN A;  2K05 A;  3BVG A;  1D5Z C;  4CJ1 B;  3BDO A;  2WIN B;  1HTL D;  4LMQ D;  5FKA C;  3VR3 A;  1FYC A;  2XIW A;  4TKO B;  4XTC S;  1G91 A;  4DAV A;  1ENF A;  1H9M A;  2XVS A;  1ZXT A;  5JOB A;  5EKI A;  2F0K A;  5K5P A;  4N9T A;  5G3L F;  5C4H A;  2EYO A;  3OHX C;  5I2X A;  4A3G B;  3VYS A;  3R93 A;  2F0V A;  2B8F A;  1X3P A;  4P2C B;  2I07 B;  3SEB A;  3Q23 A;  1ILQ A;  2LMC B;  3GP7 A;  2ZXR A;  2F0L A;  4OGQ C;  3Q0A A;  3QJY A;  3IAY A;  2J0T D;  4PNY A;  2WB1 B;  4G7O C;  3I70 A;  1EU3 A;  2EYP A;  2B2V A;  1EZ6 A;  2EE1 A;  2D5D A;  3MFY A;  3FKI B;  5ELE A;  4E6I A;  4C3H G;  4HN7 A;  4HMJ A;  4A3E B;  1TWC B;  4IUT A;  2KCN A;  2F0M A;  2OT2 A;  5J1Z A;  2WKC A;  4V19 0;  2NTS A;  3SK5 A;  2E75 C;  2L12 A;  5EKL A;  1S5F D;  2E2H B;  4RGT A;  2XRQ D;  2VUM B;  5CC4 A;  1EU4 A;  4RHR A;  2EYH A;  1G6Z A;  2FFK B;  2D9U A;  3TP5 A;  1AW7 A;  1JR0 D;  1XX8 A;  1QCB D;  3NUC A;  1QG7 A;  2YU9 B;  3D4D A;  4MIU A;  4FF2 A;  2L4N A;  4F88 A;  4TSS A;  2R92 B;  1U4L A;  1IKM A;  2A6H D;  2K33 A;  4ZYS A;  2QF7 A;  3TN2 A;  4FXG C;  1F9R A;  3PV0 A;  1YNJ C;  2L9H A;  4XQN A;  1QIL A;  2PYK A;  1SE3 A;  2WAC A;  2K04 A;  2PMZ B;  4ZUI A;  2VB2 X;  2D2C C;  1Y8N B;  5IOC A;  3FPP A;  1PTO C;  1Y1W B;  1KAB A;  1GUN A;  3HEJ A;  3GQB A;  1STG A;  1CQF A;  1WTX A;  2X69 A;  1F2Z A;  3QOJ A;  4DNT B;  3GV6 A;  1ENA A;  1SXT A;  3F2U A;  3TSS A;  2EOT A;  3NWS A;  3OWF A;  5ELB A;  4KN4 C;  4IUQ A;  2F0W A;  1EY4 A;  1CM9 A;  3PUX A;  3KLS A;  2MJ8 A;  2QCP X;  3EFX D;  2NVQ B;  2K1B A;  3NQI A;  2B2U C;  4XYO A;  1BUV T;  2XSC A;  2MPM A;  4DN4 M;  4EQN A;  4IUP A;  1STY A;  2RVL A;  1I4P A;  3ONA B;  2XWB B;  1EEI D;  4I65 A;  3OSO A;  3ND8 A;  2KJX A;  3DMU A;  1BF4 A;  4RKL A;  2IPK D;  2OXP A;  4OL7 A;  2O5J C;  3OIQ A;  3EJI A;  2RDG A;  4A3B B;  1WTP A;  2TMP A;  1A15 A;  1I6V C;  1GUW A;  1D2B A;  3LWU A;  1DCZ A;  3EA6 A;  2K6A A;  3TDQ A;  5EBD A;  3Q24 A;  1CT1 D;  2EJM A;  2PQE A;  2KQ3 A;  4YIJ A;  5HUR A;  1B2T A;  3BDL A;  5F2D A;  4ZKB B;  1LTG D;  1E2W A;  1CK1 A;  5I9O A;  1F2M A;  1A3V A;  3J7A F;  4HCS A;  2NBF A;  5EPK A;  4C1N I;  2A74 C;  3K5L A;  4DU9 A;  3HOU B;  4A3F B;  1UAP A;  2NN6 H;  2PW5 A;  3M4O B;  1EIG A;  2AQ2 B;  2J7Z A;  4H13 C;  3I4N B;  3MTS A;  2JEB I;  4RAU C;  3NTK A;  4QF4 A;  1I4H A;  4KY7 A;  1W6K A;  4X3T A;  3H0G B;  2CHB D;  5JEA H;  3BYT B;  3BZD B;  1UNS A;  2IT1 A;  3P7J A;  1OXU A;  1B1Z A;  5LL6 S;  1QE6 A;  3QB3 A;  3GTG B;  2F0J A;  2F0T A;  4M1U B;  1EY7 A;  1LTS D;  1Q1B A;  1TS5 A;  2AWN A;  4RFB A;  4B08 A;  3P1H A;  4KY6 A;  4QIW B;  1SSO A;  3KLR A;  1CA5 A;  4G7Z C;  4C3I G;  1A6X A;  4G57 A;  3SVM A;  2EY6 A;  1D5M C;  3SHL A;  3MAQ A;  4KKS A;  5FLX E;  1B9N A;  1YNJ D;  2F3W A;  1O7L A;  3GTP B;  2DNC A;  3BDC A;  1TKW B;  2Y0S B;  4OHJ A;  1B3A A;  2K5Q A;  2M2L A;  2Z8L A;  3HOV B;  2KED A;  1LTR D;  1K8M A;  4HSV A;  3EVQ A;  2FHT A;  4O1N A;  2MUY A;  3A8I E;  2NVT B;  3LWE A;  1PFB A;  4IQZ A;  3K5M A;  1F9P A;  2CW0 C;  1EWC A;  3R2I A;  3ZYY X;  4IUU A;  5IGD A;  3VA5 A;  2ICE C;  1MSH A;  3TP7 A;  2GA4 B;  4J6H A;  3A8K E;  4XQQ A;  1STB A;  4HCE A;  1NCV A;  5A2Q L;  1HHV A;  5ELC A;  4G7H C;  2B2V C;  2O4X A;  3R2T A;  3S2H B;  4EVO A;  3RMH A;  2EY1 A;  3UI2 A;  1GUT A;  2NYZ D;  2E74 C;  4BS9 A;  1PZI D;  4BBS B;  2RDF A;  1CQV A;  1D6E C;  3E5S A;  3HKZ B;  1B53 A;  1U4P A;  5A35 A;  1Q8I A;  1DYQ A;  4ZUJ A;  4CKE A;  1GJX A;  5K36 H;  3WOF A;  1FNV A;  1BXT A;  1TII D;  3RZO B;  2EPB A;  4XYQ A;  1UEA B;  3X3N A;  5I2Y A;  3S1Q B;  2PCF B;  2VXW A;  4HR7 B;  4EQP A;  3J7A V;  3HOX B;  3T56 B;  1PFN A;  4KD4 A;  3IL8 A;  4KN7 C;  2C5C A;  4O42 A;  5C3W A;  1NR2 A;  2NB0 A;  3NBH A;  2Z1C A;  4ZLT F;  3DXJ C;  3MFG A;  3V96 A;  2F0D A;  1CTM A;  2D62 A;  1F2L A;  5M3M B;  2A5H A;  5EPJ A;  2MGS A;  1TS3 A;  5DNF A;  5C44 B;  4DK0 A;  2ICI A;  3KLS X;  1I4R A;  2HDM A;  1NR4 A;  3MA2 B;  4QUF A;  5AFW A;  3Q22 A;  2XN9 C;  2B2U A;  2K5D A;  4J1M A;  2EJG C;  1C8C A;  4IZ8 A;  1JOO A;  2K7V A;  1NAP A;  5D3D A;  3S17 B;  1VF5 C;  2IJ0 A;  3K7A B;  3S16 B;  4KJN A;  2PZT A;  1EQT A;  1BCP C;  1VMP A;  1S5E D;  3L9A X;  1WVL A;  3KK7 A;  3FEW X;  3C2P A;  4QCL A;  4CHT B;  3I4L A;  2EYJ A;  5KRU A;  1B50 A;  2NN6 G;  2F0P A;  1WCM B;  2JA8 B;  2ZT9 C;  4K6D A;  2F0S A;  3M7G A;  1NUC A;  3MEH A;  3NK9 A;  2F0O A;  1GUS A;  1LTT D;  2A6E C;  3WOE A;  5C5M A;  4R9W A;  5TSS A;  2IW3 A;  4DXG A;  1OXT A;  1QB5 D;  5D14 A;  5M5X B;  5C4X B;  4HED A;  1Y1V B;  3RD4 A;  2V4D A;  2R93 B;  1V8Q A;  4DFA A;  2K28 A;  1EWH A;  5JAV A;  1LV9 A;  3M7N A;  2BA0 A;  3IFD A;  1TVX A;  1CHQ D;  1TWA B;  3D4W A;  1KDA A;  5JEA J;  1H9S B;  1C48 A;  3HRZ C;  1IHZ A;  2QKI C;  3T51 B;  1EZ8 A;  1MBY A;  2KUM A;  1EYD A;  3MC0 B;  1AZP A;  3SK8 A;  5CV4 A;  1R4Q B;  2M00 A;  2PO4 A;  1HQR D;  3KF8 A;  2O2L D;  2WII B;  5CV7 A;  3TZD A;  4PMW A;  3DHQ A;  2EXZ A;  2QIL A;  4LAA A;  4A3D B;  4I7Z C;  2WAQ B;  2MHV A;  1TS4 A;  2LKV A;  2HUG A;  4RHS A;  1BOS A;  3I4M B;  1RD9 D;  1V43 A;  1EYA A;  2F4I A;  1RDP D;  1LO5 D;  5NUC A;  4WRD A;  2EZV A;  3K6O A;  1V1P B;  4NKL A;  1I4Q A;  1FNW A;  2AWO A;  4IFD G;  2X6L A;  3URY A;  1ET6 A;  5BN4 A;  3CQZ B;  1I4G A;  2L0C A;  2B2Y A;  1G29 1;  1CFM A;  3A55 A;  3D6C A;  4GZY C;  1XYI A;  2B2T A;  1PTO H;  2F0F A;  3EQL C;  1JWU D;  1IW7 D;  3DEO A;  1IL8 A;  3ITP A;  2MP1 A;  1SJE D;  5CR3 A;  1DD2 A;  3G6J B;  1YNN C;  3VR6 A;  1LTB D;  3V2T A;  2RBM A;  1IYU A;  1LAC A;  5T1I A;  4A3I B;  3QO2 A;  2R6G A;  3PUV A;  1DOM A;  4PV1 C;  4ID6 A;  2SNM A;  1JIC A;  1LAB A;  3K0Y A;  3NSW A;  1LT4 D;  3E6Z X;  3NP8 A;  1PXU A;  1TQO A;  5ELD A;  1B4O A;  3CRK C;  5FOB B;  1GHK A;  4N9P A;  1GXD C;  1U4R A;  4Y7N B;  1J8I A;  1W6J A;  3RLF A;  1PTO B;  5E3F A;  3S9W A;  3TZU A;  4K2K A;  1KTK A;  5ELF A;  2SDF A;  2F0U A;  3SK6 A;  1DON A;  2HDL A;  2A6H C;  4KD3 A;  3U9O A;  2I46 A;  1ZKO A;  3P75 A;  4ILW A;  1JWM D;  2F1M A;  2IL8 A;  1E2V A;  1LTI D;  2OF1 A;  1SFO B;  1TWF B;  2E76 C;  2E2I B;  1OO9 B;  2PW7 A;  3GTQ B;  5M5Y B;  1SNO A;  5CBA E;  2YYZ A;  4BA1 I;  1F77 A;  5KYI A;  1V1O A;  4FO2 A;  2EVB A;  4C3H B;  4TQU S;  3V05 A;  4DF7 A;  1XXG A;  3LX0 A;  4RCN A;  3VYU A;  1ET9 A;  1BNZ A;  3H09 A;  3S1M B;  4RKB A;  1QJO A;  1JQY D;  3NTH A;  2JYO A;  4KI0 A;  4KKU A;  4C3J G;  2FJ2 A;  3L3O C;  1DJR D;  2H4O A;  4H44 C;  1KNE A;  1QOH A;  5I4D A;  2EY5 A;  2SOB A;  2L1B A;  2EYL A;  5CGK A;  5D65 A;  1GUG A;  1TS2 A;  2NZ1 D;  2KEE A;  1A3U A;  3S1N B;  4K2L A;  4H7B A;  2WKD A;  1MGS A;  1IW7 C;  1JOR A;  3VR2 A;  1K8O A;  4ME5 A;  1EFI D;  1RHP A;  1PLF A;  1SBB B;  5CBE E;  1PZJ D;  5E4W C;  5I9P A;  2L5T A;  1S5B D;  5KGU A;  1PTO D;  2VB3 X;  1ZEQ X;  3GTM B;  3VYR A;  1CA6 A;  1F9S A;  2HCI A;  4DNR B;  3MVV A;  1Q3L A;  2AUK A;  5JPM C;  4RWS C;  3RUZ A;  5HGT A;  3FVQ A;  1SDF A;  4K5V A;  4LJZ C;  1D5X C;  1RTO A;  1BR9 A;  4K5W A;  1EY5 A;  3OW7 A;  2KHS A;  1PDQ A;  1WTO A;  1SYE A;  3IKJ A;  2NVX B;  2KCC A;  1Z7T A;  1JOQ A;  1CZG A;  2BDO A;  1BO0 A;  2DNE A;  2G9D A;  2NVY B;  3TP8 A;  1UUP A;  2M9V A;  1G2T A;  5E4X A;  3D4R A;  3ND9 A;  5ISR A;  1HRJ A;  5EBC A;  4X3K A;  3I8Z A;  3QIA A;  2Q8T A;  1K83 B;  4C1N K;  2NN6 I;  3H6M A;  2G9H D;  2Q8R E;  1C4Q A;  5EGT A;  5A2Q E;  1PZK D;  3HP3 A;  2WP8 J;  4QUC A;  2FMM A;  1EY9 A;  3L7Z C;  3MXG A;  3GV3 A;  4FF4 A;  1AZQ A;  1SE4 A;  2Z4I A;  1ESF A;  3R8B A;  3I91 A;  5CV9 A;  2O5I C;  3OPO A;  3NBI A;  3SXH A;  5M9O A;  5BN5 A;  3A54 A;  2XRS D;  5CV5 A;  3PIO 3;  2B2W A;  4OIK A;  1DZ1 A;  5LHY 1;  3DM1 A;  1WD0 A;  4NMZ A;  1Q90 A;  4K8J A;  1A2T A;  2AQ1 B;  1MI2 A;  4DGZ A;  2EYM A;  3HG9 A;  4J8Q A;  2N55 A;  3ERQ A;  2JXM B;  5M3F B;  1TY2 A;  1JB3 A;  2R7Z B;  1PFM A;  4BBR B;  3T16 A;  1GHJ A;  1LT5 D;  1I50 B;  1PRT B;  4ZAI A;  3NHH A;  3X3M A;  1G2S A;  1O7Z A;  3PO2 B;  4L63 B;  1QNU A;  3FPU B;  2NTT A;  4XXE A;  4FF1 A;  4K6L A;  1BCP B;  2J4X A;  4JK1 C;  2X6G A;  2SEB D;  5EJW A;  3RZD B;  3JAM L;  3IFT A;  1J9O A;  3GO5 A;  1PMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...