4NKUA

Structure of cid1 in complex with its short product apu
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
340
structure length
320
Chain Sequence
DMSHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCAIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTSRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title A critical switch in the enzymatic properties of the Cid1 protein deciphered from its product-bound crystal structure.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase/rna
total genus 112
structure length 320
sequence length 340
chains with identical sequence B
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4nkuA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4nkuA02
4LZDA 3MDCA 5J2CA 1TV9A 7ICRA 8ICUA 3AQMA 5HHHA 2Q66A 5J2IA 4KLGA 4O9MA 8ICLA 8ICEA 5IIOA 7ICSA 4GXKA 4X0AA 1FA0A 4ATBB 3V7LA 4WC7A 2B4VA 9ICNA 4YMMA 5DB6A 4DO9A 3WFSC 3OVAA 4WCWA 4KLIA 4P4OA 4QZDA 4EP7A 4F5QA 2BE3A 9ICXA 4Z6FA 4WC5A 4X5VA 4WC1A 1F5AA 1OU5A 5CP2A 4P4MA 8ICAA 8ICRA 7ICFA 4UBBA 2BCUA 5D4BA 5HRGA 4QZHA 4DOCA 1HUOA 4QZBA 2DR7A 2ISPA 4XRHA 4X4OA 5IINA 2BCQA 7ICGA 5J0PA 3V72A 3RH6A 4UB5A 4FHXA 4JWMA 1NOMA 5EOZA 2DRAA 1XSPA 9ICOA 4I2FA 1RZTA 1XSNA 9ICWA 7ICPA 5HRFA 4UB2A 4TUQA 1ZQEA 3OGUA 5D49A 1ZQJA 5DECA 4TURA 9ICRA 4QZEA 3JZ0A 3C2MA 5D46A 9ICFA 3UQ0A 4RQ3A 4UB3A 9ICMA 8ICJA 4AT9B 3C66A 1BPBA 4LT6A 3JYYA 3TFRA 4WC2A 4O5KA 2BCSA 1R8BA 8ICHA 4R64A 3AQKA 9ICCA 8ICPA 3B0YA 4Z6CA 8ICCA 4MF2A 4KLFA 4UBCA 2BCVA 4PH5A 1JQRA 4M9JA 3GDXA 8ICKA 5HRIA 1ZQBA 4WC6A 4X0BA 2FMSA 3LK9A 4WBZA 9ICJA 1Q78A 4AT7B 4RPXA 4UD5A 3C2LA 7ICEA 9ICAA 8ICTA 3AQLA 2W9MA 4F5NA 3UPQA 4NXZA 5J0SA 4P2HA 4FHVA 4X4SA 2HHPA 2BPGA 1R89A 5J2EA 5J0QA 1R8AA 5IIKA 4XUSA 4M9HA 4X4TA 4MFCA 1UEUA 3AU2A 3MDAA 2PFPA 4F5PA 4X4RA 1TVAA 4RQ2A 3RJJA 3WFQE 3HW8A 1ZQHA 1ZQGA 5CB1A 1HUZA 8ICSA 4WC3A 3LQCB 4PHEA 3TFSA 4RWPA 2ZH6A 4M47A 4FO6A 5HRDA 4O5CA 4AT9A 9ICUA 5BOMA 4RPZA 1PX5A 4EBJA 4GXJA 8ICFA 5TZVA 5J2DA 1JMSA 3ISCA 2PXIA 4PGXA 3K75D 3JPPA 2ID1A 5CWRA 4DOBA 8ICNA 7ICJA 4I2IA 5J2FA 1TFYA 2ZHBA 1ZQRA 2ZHAA 5J29A 1VFGA 5F2VO 4M04A 1TFWA 9ICIA 3RJFA 1BPDA 4UAYA 3H37A 5DKWA 3JPOA 8ICOA 1UEVA 2DR5A 5IIIA 2ZH9A 2DRBA 7ICOA 9ICLA 3RH4A 2DVIA 3RJIA 4AT8B 5IIMA 4KLJA 5J0WA 4X4QA 4PGYA 4UD4A 2PFQA 4IQWA 3MBYA 1ZQLA 9ICHA 5HREA 4XA5A 3JPNA 5J0XA 4WBYA 4KLDA 2PFNA 4NKTA 4GXIA 3HIYA 1MIVA 8ICQA 4I29A 3ISDA 3MGIA 1WOTA 3PMNA 7ICNA 7ICTA 4M0AA 2M2VA 4KLUA 9ICKA 2PFOA 3NYBA 4E8FA 2NRKA 2M2WA 4QZFA 5HHIA 4RQ0A 4KLTA 4FH5A 1KDHA 3C18A 3JPQA 3PMLA 4KLLA 3C5GA 2O1PA 4IQVA 5DBBA 7ICUA 4UAZA 3HWTA 4RQ7A 8ICMA 4IQUA 4ATBA 4KLHA 4RT3A 3UXPA 4RWNA 4I28A 5CHGA 4F5RA 4K4GA 1R8CA 4RQ8A 3UQ2A 4IQTA 3MGHA 4PHDA 5IILA 4X4VA 4UB4A 4NKUA 4YD1A 8ICXA 4RWOA 4NLNA 1ZQQA 4JWNA 4O5EA 4IG8A 4MF8A 4Z6EA 5CR0A 4X4PA 4TUSA 4I27A 3H38A 2ZH5A 4RWQA 5J2KA 9ICTA 2O5AA 3WFRE 3RJGA 8ICGA 4UB1A 8ICIA 1ZQTA 4R65A 4R63A 3HX0A 4I2GA 1ZJNA 3H39A 4RPYA 1ZQCA 1JN3A 5J2GA 2ZH3A 5HRHA 2ZH4A 4RQ6A 1XSLA 5CJ7A 4X4NA 4I2EA 5HR9A 3AQNA 1MIYA 1V4AA 4MFFA 2DR8A 4I2CA 4PHAA 5J0YA 1VJ7A 3OVBA 3RJEA 8ICBA 7ICQA 3PNCA 3OUYB 7ICLA 2DR9A 1ZQUA 1ZQYA 5J2AA 4KLMA 4NM2A 4M2YA 5DB7A 1ZQOA 4QZ8A 1ZQKA 4XQ8A 5CA7A 7ICKA 5DDMA 4KLOA 4I2AA 3OV7A 2M2TA 5DB9A 4QZ9A 2FMQA 2BPCA 5J0RA 4E7XA 1NO5A 3C2KA 4K4HA 5J2JA 1UETA 4S3NA 4P4PA 1MIWA 1BPEA 2IHMA 3RJHA 4FHWA 4YN4A 3HJ4A 9ICBA 4NLKA 7ICMA 3JPSA 4M9NA 4PGQA 2ZH7A 1KEJA 3WFOA 3ISBA 9ICEA 4PHPA 2B51A 4FH3A 2RFFA 3H3AA 1ZJMA 5J0TA 4AT7A 3UPSA 1MQ2A 7ICIA 8ICWA 2ZH1A 3RJKA 4TUPA 3JPRA 2FMPA 4X4UA 5DDYA 4WC4A 1ZQDA 5HRKA 2PBEA 5DB8A 2I9GA 3AUOA 7ICVA 4KLSA 1BPYA 1BPXA 1Q79A 4MFAA 5HRLA 5DBAA 4RQ4A 3WFPA 2B56A 3OVSA 1ZQZA 4I2HA 9ICQA 4RQ1A 5J2HA 4M9GA 1ZQPA 1ZQAA 4YMOA 4I2JA 2BCRA 1ZQMA 4LVSA 8ICYA 1MQ3A 4EBKA 9ICPA 3UXOA 5J0OA 3V7JA 2P66A 1ZQXA 4NY8A 4YMNA 1ZQIA 3B0XA 1ZQWA 4K4IA 3OUYA 4KLQA 4M5DA 4FHPA 5J2BA 5HC9A 5BOLA 3L9DA 3RH5A 1YLQA 4QZCA 4NM1A 1RPLA 3HJ1A 4KLEA 7ICHA 9ICGA 1BPZA 9ICSA 4QZIA 4QZGA 4QZAA 3C5FA 4YD2A 5HRBA 1ZQFA 4I2BA 5BPCA 4NLZA 4Z6DA 1ZQNA 2ISOA 1ZQSA 3AU6A 4PPXA 5IIJA 4FHYA 3V7KA 2ZH8A 3UXNA 4R66A 4XQ7A 4RQ5A 4LZGA 8ICVA 3JPTA 4AT8A 2M2UA 4UAWA 1ZQVA 4DOAA 5DEDA 4YCXA 9ICVA 4E80A 4M9LA 5J0UA 4WC0A 4RT2A 1JAJA 5DBCA 2ZH2A 1KNYA 2VANA 4F5OA 2BPFA 2GWSA 8ICZA 4I2DA
chains in the Genus database with same CATH superfamily
4LZDA 3MDCA 5J2CA 1TV9A 7ICRA 8ICUA 3AQMA 5HHHA 2Q66A 5J2IA 4KLGA 4O9MA 8ICLA 8ICEA 5IIOA 7ICSA 2BBHA 3ER8C 4GXKA 4OAFA 4X0AA 1FA0A 4ATBB 3V7LA 4WC7A 2B4VA 9ICNA 4O6AA 4YMMA 5DB6A 4DO9A 3WFSC 3OVAA 4WCWA 4KLIA 4P4OA 4QZDA 4EP7A 4F5QA 4O68A 2BE3A 9ICXA 5CFTA 4Z6FA 4WC5A 4X5VA 4WC1A 1F5AA 1OU5A 5CP2A 4P4MA 8ICAA 8ICRA 7ICFA 4UBBA 2BCUA 5D4BA 5HRGA 4QZHA 4DOCA 1HUOA 4QZBA 2DR7A 2ISPA 4XRHA 4X4OA 5IINA 2BCQA 7ICGA 5J0PA 3V72A 3RH6A 4UB5A 4FHXA 4JWMA 1NOMA 5EOZA 2GA9D 2DRAA 1XSPA 9ICOA 4I2FA 1RZTA 1XSNA 9ICWA 7ICPA 5HRFA 4UB2A 4TUQA 1ZQEA 3OGUA 5D49A 1ZQJA 5DECA 4TURA 9ICRA 4QZEA 3JZ0A 3C2MA 5D46A 9ICFA 3UQ0A 4RQ3A 3JCFA 4WQLA 4UB3A 9ICMA 8ICJA 2EWRA 4AT9B 3C66A 1BPBA 4LT6A 3JYYA 3TFRA 4WC2A 4O5KA 2BCSA 1R8BA 8ICHA 4R64A 3AQKA 9ICCA 8ICPA 3B0YA 4Z6CA 8ICCA 4MF2A 3K7DA 4KLFA 4UBCA 2GAFD 2BCVA 4PH5A 1JQRA 4M9JA 3GDXA 8ICKA 2HN2A 4K98A 5HRIA 1ZQBA 4HX0A 4WC6A 4X0BA 2FMSA 3LK9A 4WBZA 9ICJA 1Q78A 4AT7B 4RPXA 4UD5A 3C2LA 7ICEA 4EEBA 9ICAA 8ICTA 3AQLA 2W9MA 4F5NA 3UPQA 4NXZA 5J0SA 4P2HA 4FHVA 4X4SA 2HHPA 2HN1A 4O69A 2BPGA 1R89A 4LEWA 5J2EA 5J0QA 1R8AA 5IIKA 4FO1A 4XUSA 4M9HA 4X4TA 4MFCA 1UEUA 3AU2A 3MDAA 2PFPA 4F5PA 4X4RA 1TVAA 4RQ2A 3RJJA 3WFQE 3HW8A 1ZQHA 3CK6A 1ZQGA 5CB1A 1HUZA 8ICSA 4WC3A 3LQCB 4PHEA 3TFSA 4RWPA 2ZH6A 4M47A 4FO6A 5HRDA 4O5CA 4AT9A 9ICUA 4EEDA 3EF2A 4K8VA 5BOMA 4RPZA 1PX5A 4EBJA 4GXJA 8ICFA 5TZVA 5J2DA 1JMSA 3ISCA 2PXIA 4PGXA 3K75D 3NWIA 3JPPA 2ID1A 5CWRA 4DOBA 8ICNA 7ICJA 4I2IA 5J2FA 1TFYA 2ZHBA 1ZQRA 2ZHAA 5J29A 1VFGA 5F2VO 1TFWA 4M04A 9ICIA 3RJFA 1BPDA 4UAYA 3H37A 5DKWA 3JPOA 4O67A 8ICOA 1UEVA 2DR5A 4JLXA 5IIIA 4MKPA 2ZH9A 2DRBA 4NXXA 7ICOA 9ICLA 4NXWA 3RH4A 2DVIA 3RJIA 4AT8B 5IIMA 4KLJA 5J0WA 4X4QA 3NKUA 4PGYA 4UD4A 2PFQA 4IQWA 3MBYA 1ZQLA 9ICHA 5HREA 4XA5A 3JPNA 5J0XA 4WBYA 4KLDA 2PFNA 4NKTA 4GXIA 3HIYA 1MIVA 8ICQA 4I29A 3ISDA 3MGIA 1WOTA 3PMNA 7ICNA 7ICTA 4M0AA 2M2VA 4KLUA 9ICKA 2PFOA 4WQKA 3NYBA 4E8FA 2NRKA 2M2WA 4QZFA 5HHIA 4RQ0A 4KLTA 4FH5A 1KDHA 3C18A 3JPQA 4OAIZ 3PMLA 4KLLA 3C5GA 2O1PA 4IQVA 5DBBA 4KB6A 3ERCC 3PHZA 7ICUA 4UAZA 3HWTA 4RQ7A 8ICMA 4NXTA 3OWGA 4ATBA 4IQUA 5D63A 4KLHA 4LEVA 4RT3A 3UXPA 4RWNA 4I28A 5CHGA 4F5RA 4K4GA 1R8CA 4RQ8A 3UQ2A 4IQTA 3MGHA 4PHDA 4X4VA 5D61A 5IILA 4UB4A 4NKUA 4YD1A 4OAGA 8ICXA 4RWOA 4NLNA 4EV6A 1ZQQA 2IHOA 4IG8A 4JWNA 4O5EA 4MF8A 4Z6EA 5CR0A 4X4PA 4TUSA 4I27A 2ZH5A 3H38A 4RWQA 5J2KA 9ICTA 2O5AA 3WFRE 3RJGA 8ICGA 4UB1A 8ICIA 1ZQTA 4R65A 4R63A 3HX0A 4I2GA 1ZJNA 3H39A 4RPYA 1ZQCA 1JN3A 5J2GA 5CHEA 2ZH3A 5HRHA 2ZH4A 4RQ6A 1XSLA 5CJ7A 4X4NA 4I2EA 5HR9A 3AQNA 1MIYA 1V4AA 4MFFA 2DR8A 4I2CA 4PHAA 5J0YA 3OVBA 1VJ7A 3RJEA 8ICBA 7ICQA 3PNCA 3OUYB 7ICLA 2DR9A 1ZQUA 1ZQYA 5J2AA 4KLMA 4NM2A 4M2YA 5DB7A 1ZQOA 4QZ8A 1ZQKA 4XQ8A 4N7RA 5CA7A 7ICKA 5DDMA 4KLOA 5JTGA 4I2AA 3OV7A 2M2TA 5DB9A 4QZ9A 2FMQA 2BPCA 5J0RA 4E7XA 1NO5A 3C2KA 4K4HA 3MCRA 5J2JA 1UETA 4S3NA 4P4PA 1MIWA 1BPEA 2BBJA 2IHMA 3RJHA 4FHWA 4YN4A 3HJ4A 9ICBA 4NLKA 5B3PA 7ICMA 3JPSA 4M9NA 4PGQA 2ZH7A 1KEJA 3WFOA 3ISBA 9ICEA 4PHPA 2B51A 4FH3A 2RFFA 3H3AA 4XJEA 1ZJMA 5J0TA 4AT7A 3UPSA 1MQ2A 4WH5A 7ICIA 8ICWA 2ZH1A 3RJKA 4TUPA 4I0UA 3JPRA 2FMPA 4X4UA 5DDYA 4WC4A 1ZQDA 5HRKA 2PBEA 5DB8A 2I9GA 3AUOA 7ICVA 4KLSA 1BPYA 4LEYA 4NXUA 1BPXA 1Q79A 4MFAA 4K9BA 5HRLA 5DBAA 4RQ4A 3WFPA 2B56A 3OVSA 1ZQZA 4I2HA 9ICQA 5CFSA 4RQ1A 5J2HA 4M9GA 1ZQPA 1ZQAA 4YMOA 4I2JA 2BCRA 1ZQMA 4LVSA 4K96A 8ICYA 1MQ3A 4EBKA 9ICPA 3UXOA 4K9AA 5J0OA 3V7JA 2P66A 1ZQXA 4K99A 3NVOA 4YMNA 4NY8A 4WOYA 1ZQIA 3B0XA 1ZQWA 2FCLA 4K4IA 3OUYA 4KLQA 4M5DA 4KM5A 4FHPA 5D62A 5J2BA 5HC9A 5BOLA 3L9DA 5CFUA 3RH5A 1YLQA 4QZCA 4NM1A 1RPLA 3HJ1A 4KLEA 4K97A 7ICHA 9ICGA 1BPZA 9ICSA 4QZIA 4QZGA 4QZAA 3C5FA 4YD2A 5HRBA 1ZQFA 4I2BA 5BPCA 4NLZA 4Z6DA 1ZQNA 2ISOA 1ZQSA 3AU6A 4PPXA 5IIJA 4FHYA 3V7KA 2ZH8A 3UXNA 4JLZA 4R66A 4XQ7A 4RQ5A 4LZGA 8ICVA 3JPTA 4AT8A 2M2UA 4UAWA 1ZQVA 4DOAA 5DEDA 4YCXA 9ICVA 4E80A 4M9LA 5J0UA 4WC0A 4RT2A 1JAJA 5DBCA 2ZH2A 1KNYA 2IUBA 3ER9B 5B3QA 2VANA 4F5OA 4LEZA 1GPJA 2BPFA 4EGWA 2GWSA 4NXVA 8ICZA 4OAHA 4I2DA
chains in the Genus database with same CATH topology
4LZDA 3MDCA 5J2CA 1TV9A 7ICRA 8ICUA 3AQMA 5HHHA 2Q66A 5J2IA 4KLGA 4O9MA 8ICLA 8ICEA 5IIOA 7ICSA 4GXKA 4OAFA 4X0AA 1FA0A 4ATBB 3V7LA 4WC7A 2B4VA 9ICNA 4O6AA 4YMMA 5DB6A 4DO9A 3WFSC 3OVAA 4WCWA 4KLIA 4P4OA 4QZDA 4EP7A 4F5QA 4O68A 2BE3A 9ICXA 4Z6FA 4WC5A 4X5VA 4WC1A 1F5AA 1OU5A 5CP2A 4P4MA 8ICAA 8ICRA 7ICFA 4UBBA 2BCUA 5D4BA 5HRGA 4QZHA 4DOCA 1HUOA 4QZBA 2DR7A 2ISPA 4XRHA 4X4OA 5IINA 2BCQA 7ICGA 5J0PA 3V72A 3RH6A 4UB5A 4FHXA 4JWMA 1NOMA 5EOZA 2DRAA 1XSPA 9ICOA 4I2FA 1RZTA 1XSNA 9ICWA 7ICPA 5HRFA 4UB2A 4TUQA 1ZQEA 3OGUA 5D49A 1ZQJA 5DECA 4TURA 9ICRA 4QZEA 3JZ0A 3C2MA 5D46A 9ICFA 3UQ0A 4RQ3A 4UB3A 9ICMA 8ICJA 4AT9B 3C66A 1BPBA 4LT6A 3JYYA 3TFRA 4WC2A 4O5KA 2BCSA 1R8BA 8ICHA 4R64A 3AQKA 9ICCA 8ICPA 3B0YA 4Z6CA 8ICCA 4MF2A 4KLFA 4UBCA 2BCVA 4PH5A 1JQRA 4M9JA 3GDXA 8ICKA 4K98A 5HRIA 1ZQBA 4WC6A 4X0BA 2FMSA 3LK9A 4WBZA 9ICJA 1Q78A 4AT7B 4RPXA 4UD5A 3C2LA 7ICEA 9ICAA 8ICTA 3AQLA 2W9MA 4F5NA 3UPQA 4NXZA 5J0SA 4P2HA 4FHVA 4X4SA 2HHPA 4O69A 2BPGA 1R89A 4LEWA 5J2EA 5J0QA 1R8AA 5IIKA 4XUSA 4M9HA 4X4TA 4MFCA 1UEUA 3AU2A 3MDAA 2PFPA 4F5PA 4X4RA 1TVAA 4RQ2A 3RJJA 3WFQE 3HW8A 1ZQHA 1ZQGA 5CB1A 1HUZA 8ICSA 4WC3A 3LQCB 4PHEA 3TFSA 2ZH6A 4RWPA 4M47A 4FO6A 5HRDA 4O5CA 4AT9A 9ICUA 4K8VA 5BOMA 4RPZA 1PX5A 4EBJA 4GXJA 8ICFA 5TZVA 5J2DA 1JMSA 3ISCA 2PXIA 4PGXA 3K75D 3JPPA 2ID1A 5CWRA 4DOBA 8ICNA 7ICJA 4I2IA 5J2FA 1TFYA 2ZHBA 1ZQRA 2ZHAA 5J29A 1VFGA 5F2VO 1TFWA 4M04A 9ICIA 3RJFA 1BPDA 4UAYA 3H37A 5DKWA 3JPOA 4O67A 8ICOA 1UEVA 2DR5A 4JLXA 5IIIA 4MKPA 2ZH9A 2DRBA 4NXXA 7ICOA 9ICLA 4NXWA 3RH4A 2DVIA 3RJIA 4AT8B 5IIMA 4KLJA 5J0WA 4X4QA 4PGYA 4UD4A 2PFQA 4IQWA 3MBYA 1ZQLA 9ICHA 5HREA 4XA5A 3JPNA 5J0XA 4WBYA 4KLDA 2PFNA 4NKTA 4GXIA 3HIYA 1MIVA 8ICQA 4I29A 3ISDA 3MGIA 1WOTA 3PMNA 7ICNA 7ICTA 4M0AA 2M2VA 4KLUA 9ICKA 2PFOA 3NYBA 4E8FA 2NRKA 2M2WA 4QZFA 5HHIA 4RQ0A 4KLTA 4FH5A 1KDHA 3C18A 3JPQA 4OAIZ 3PMLA 4KLLA 3C5GA 2O1PA 4IQVA 5DBBA 4KB6A 7ICUA 4UAZA 3HWTA 4RQ7A 8ICMA 4NXTA 4IQUA 4ATBA 4KLHA 4LEVA 4RT3A 3UXPA 4RWNA 4I28A 5CHGA 4F5RA 4K4GA 1R8CA 4RQ8A 3UQ2A 4IQTA 3MGHA 4PHDA 4X4VA 5IILA 4UB4A 4NKUA 4YD1A 4OAGA 8ICXA 4RWOA 4NLNA 1ZQQA 4JWNA 4O5EA 4IG8A 4MF8A 4Z6EA 5CR0A 4X4PA 4TUSA 4I27A 2ZH5A 3H38A 4RWQA 5J2KA 9ICTA 2O5AA 3WFRE 3RJGA 8ICGA 4UB1A 8ICIA 1ZQTA 4R65A 4R63A 3HX0A 4I2GA 1ZJNA 3H39A 4RPYA 1ZQCA 1JN3A 5J2GA 2ZH3A 5HRHA 2ZH4A 4RQ6A 1XSLA 5CJ7A 4X4NA 4I2EA 5HR9A 3AQNA 1MIYA 1V4AA 4MFFA 2DR8A 4I2CA 4PHAA 5J0YA 3OVBA 1VJ7A 3RJEA 8ICBA 7ICQA 3PNCA 3OUYB 7ICLA 2DR9A 1ZQUA 1ZQYA 5J2AA 4KLMA 4NM2A 4M2YA 5DB7A 1ZQOA 4QZ8A 1ZQKA 4XQ8A 5CA7A 7ICKA 5DDMA 4KLOA 4I2AA 3OV7A 2M2TA 5DB9A 4QZ9A 2FMQA 2BPCA 5J0RA 4E7XA 1NO5A 3C2KA 4K4HA 5J2JA 1UETA 4S3NA 4P4PA 1MIWA 1BPEA 2IHMA 3RJHA 4FHWA 4YN4A 3HJ4A 9ICBA 4NLKA 7ICMA 3JPSA 4M9NA 4PGQA 2ZH7A 1KEJA 3WFOA 3ISBA 9ICEA 4PHPA 2B51A 4FH3A 2RFFA 3H3AA 1ZJMA 5J0TA 4AT7A 3UPSA 1MQ2A 7ICIA 8ICWA 2ZH1A 3RJKA 4TUPA 3JPRA 2FMPA 4X4UA 5DDYA 4WC4A 1ZQDA 5HRKA 2PBEA 5DB8A 2I9GA 3AUOA 7ICVA 4KLSA 1BPYA 4LEYA 4NXUA 1BPXA 1Q79A 4MFAA 4K9BA 5HRLA 4RQ4A 5DBAA 3WFPA 2B56A 3OVSA 1ZQZA 4I2HA 9ICQA 4RQ1A 5J2HA 4M9GA 1ZQPA 1ZQAA 4YMOA 4I2JA 2BCRA 1ZQMA 4LVSA 4K96A 8ICYA 1MQ3A 4EBKA 9ICPA 3UXOA 4K9AA 5J0OA 3V7JA 2P66A 1ZQXA 4K99A 4NY8A 4YMNA 4WOYA 1ZQIA 3B0XA 1ZQWA 4K4IA 3OUYA 4KLQA 4M5DA 4KM5A 4FHPA 5J2BA 5HC9A 5BOLA 3L9DA 3RH5A 1YLQA 4QZCA 4NM1A 1RPLA 3HJ1A 4KLEA 4K97A 7ICHA 9ICGA 1BPZA 9ICSA 4QZIA 4QZGA 4QZAA 3C5FA 4YD2A 5HRBA 1ZQFA 4I2BA 5BPCA 4NLZA 4Z6DA 1ZQNA 2ISOA 1ZQSA 3AU6A 4PPXA 5IIJA 4FHYA 3V7KA 2ZH8A 3UXNA 4JLZA 4R66A 4XQ7A 4RQ5A 4LZGA 8ICVA 3JPTA 4AT8A 2M2UA 4UAWA 1ZQVA 4DOAA 5DEDA 4YCXA 9ICVA 4E80A 4M9LA 5J0UA 4WC0A 4RT2A 1JAJA 5DBCA 2ZH2A 1KNYA 2VANA 4F5OA 4LEZA 2BPFA 2GWSA 4NXVA 8ICZA 4OAHA 4I2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LZD A;  3MDC A;  5J2C A;  1TV9 A;  7ICR A;  8ICU A;  3AQM A;  5HHH A;  2Q66 A;  5J2I A;  4KLG A;  4O9M A;  8ICL A;  8ICE A;  5IIO A;  7ICS A;  4GXK A;  4X0A A;  1FA0 A;  4ATB B;  3V7L A;  4WC7 A;  2B4V A;  9ICN A;  4YMM A;  5DB6 A;  4DO9 A;  3WFS C;  3OVA A;  4WCW A;  4KLI A;  4P4O A;  4QZD A;  4EP7 A;  4F5Q A;  2BE3 A;  9ICX A;  4Z6F A;  4WC5 A;  4X5V A;  4WC1 A;  1F5A A;  1OU5 A;  5CP2 A;  4P4M A;  8ICA A;  8ICR A;  7ICF A;  4UBB A;  2BCU A;  5D4B A;  5HRG A;  4QZH A;  4DOC A;  1HUO A;  4QZB A;  2DR7 A;  2ISP A;  4XRH A;  4X4O A;  5IIN A;  2BCQ A;  7ICG A;  5J0P A;  3V72 A;  3RH6 A;  4UB5 A;  4FHX A;  4JWM A;  1NOM A;  5EOZ A;  2DRA A;  1XSP A;  9ICO A;  4I2F A;  1RZT A;  1XSN A;  9ICW A;  7ICP A;  5HRF A;  4UB2 A;  4TUQ A;  1ZQE A;  3OGU A;  5D49 A;  1ZQJ A;  5DEC A;  4TUR A;  9ICR A;  4QZE A;  3JZ0 A;  3C2M A;  5D46 A;  9ICF A;  3UQ0 A;  4RQ3 A;  4UB3 A;  9ICM A;  8ICJ A;  4AT9 B;  3C66 A;  1BPB A;  4LT6 A;  3JYY A;  3TFR A;  4WC2 A;  4O5K A;  2BCS A;  1R8B A;  8ICH A;  4R64 A;  3AQK A;  9ICC A;  8ICP A;  3B0Y A;  4Z6C A;  8ICC A;  4MF2 A;  4KLF A;  4UBC A;  2BCV A;  4PH5 A;  1JQR A;  4M9J A;  3GDX A;  8ICK A;  5HRI A;  1ZQB A;  4WC6 A;  4X0B A;  2FMS A;  3LK9 A;  4WBZ A;  9ICJ A;  1Q78 A;  4AT7 B;  4RPX A;  4UD5 A;  3C2L A;  7ICE A;  9ICA A;  8ICT A;  3AQL A;  2W9M A;  4F5N A;  3UPQ A;  4NXZ A;  5J0S A;  4P2H A;  4FHV A;  4X4S A;  2HHP A;  2BPG A;  1R89 A;  5J2E A;  5J0Q A;  1R8A A;  5IIK A;  4XUS A;  4M9H A;  4X4T A;  4MFC A;  1UEU A;  3AU2 A;  3MDA A;  2PFP A;  4F5P A;  4X4R A;  1TVA A;  4RQ2 A;  3RJJ A;  3WFQ E;  3HW8 A;  1ZQH A;  1ZQG A;  5CB1 A;  1HUZ A;  8ICS A;  4WC3 A;  3LQC B;  4PHE A;  3TFS A;  4RWP A;  2ZH6 A;  4M47 A;  4FO6 A;  5HRD A;  4O5C A;  4AT9 A;  9ICU A;  5BOM A;  4RPZ A;  1PX5 A;  4EBJ A;  4GXJ A;  8ICF A;  5TZV A;  5J2D A;  1JMS A;  3ISC A;  2PXI A;  4PGX A;  3K75 D;  3JPP A;  2ID1 A;  5CWR A;  4DOB A;  8ICN A;  7ICJ A;  4I2I A;  5J2F A;  1TFY A;  2ZHB A;  1ZQR A;  2ZHA A;  5J29 A;  1VFG A;  5F2V O;  4M04 A;  1TFW A;  9ICI A;  3RJF A;  1BPD A;  4UAY A;  3H37 A;  5DKW A;  3JPO A;  8ICO A;  1UEV A;  2DR5 A;  5III A;  2ZH9 A;  2DRB A;  7ICO A;  9ICL A;  3RH4 A;  2DVI A;  3RJI A;  4AT8 B;  5IIM A;  4KLJ A;  5J0W A;  4X4Q A;  4PGY A;  4UD4 A;  2PFQ A;  4IQW A;  3MBY A;  1ZQL A;  9ICH A;  5HRE A;  4XA5 A;  3JPN A;  5J0X A;  4WBY A;  4KLD A;  2PFN A;  4NKT A;  4GXI A;  3HIY A;  1MIV A;  8ICQ A;  4I29 A;  3ISD A;  3MGI A;  1WOT A;  3PMN A;  7ICN A;  7ICT A;  4M0A A;  2M2V A;  4KLU A;  9ICK A;  2PFO A;  3NYB A;  4E8F A;  2NRK A;  2M2W A;  4QZF A;  5HHI A;  4RQ0 A;  4KLT A;  4FH5 A;  1KDH A;  3C18 A;  3JPQ A;  3PML A;  4KLL A;  3C5G A;  2O1P A;  4IQV A;  5DBB A;  7ICU A;  4UAZ A;  3HWT A;  4RQ7 A;  8ICM A;  4IQU A;  4ATB A;  4KLH A;  4RT3 A;  3UXP A;  4RWN A;  4I28 A;  5CHG A;  4F5R A;  4K4G A;  1R8C A;  4RQ8 A;  3UQ2 A;  4IQT A;  3MGH A;  4PHD A;  5IIL A;  4X4V A;  4UB4 A;  4NKU A;  4YD1 A;  8ICX A;  4RWO A;  4NLN A;  1ZQQ A;  4JWN A;  4O5E A;  4IG8 A;  4MF8 A;  4Z6E A;  5CR0 A;  4X4P A;  4TUS A;  4I27 A;  3H38 A;  2ZH5 A;  4RWQ A;  5J2K A;  9ICT A;  2O5A A;  3WFR E;  3RJG A;  8ICG A;  4UB1 A;  8ICI A;  1ZQT A;  4R65 A;  4R63 A;  3HX0 A;  4I2G A;  1ZJN A;  3H39 A;  4RPY A;  1ZQC A;  1JN3 A;  5J2G A;  2ZH3 A;  5HRH A;  2ZH4 A;  4RQ6 A;  1XSL A;  5CJ7 A;  4X4N A;  4I2E A;  5HR9 A;  3AQN A;  1MIY A;  1V4A A;  4MFF A;  2DR8 A;  4I2C A;  4PHA A;  5J0Y A;  1VJ7 A;  3OVB A;  3RJE A;  8ICB A;  7ICQ A;  3PNC A;  3OUY B;  7ICL A;  2DR9 A;  1ZQU A;  1ZQY A;  5J2A A;  4KLM A;  4NM2 A;  4M2Y A;  5DB7 A;  1ZQO A;  4QZ8 A;  1ZQK A;  4XQ8 A;  5CA7 A;  7ICK A;  5DDM A;  4KLO A;  4I2A A;  3OV7 A;  2M2T A;  5DB9 A;  4QZ9 A;  2FMQ A;  2BPC A;  5J0R A;  4E7X A;  1NO5 A;  3C2K A;  4K4H A;  5J2J A;  1UET A;  4S3N A;  4P4P A;  1MIW A;  1BPE A;  2IHM A;  3RJH A;  4FHW A;  4YN4 A;  3HJ4 A;  9ICB A;  4NLK A;  7ICM A;  3JPS A;  4M9N A;  4PGQ A;  2ZH7 A;  1KEJ A;  3WFO A;  3ISB A;  9ICE A;  4PHP A;  2B51 A;  4FH3 A;  2RFF A;  3H3A A;  1ZJM A;  5J0T A;  4AT7 A;  3UPS A;  1MQ2 A;  7ICI A;  8ICW A;  2ZH1 A;  3RJK A;  4TUP A;  3JPR A;  2FMP A;  4X4U A;  5DDY A;  4WC4 A;  1ZQD A;  5HRK A;  2PBE A;  5DB8 A;  2I9G A;  3AUO A;  7ICV A;  4KLS A;  1BPY A;  1BPX A;  1Q79 A;  4MFA A;  5HRL A;  5DBA A;  4RQ4 A;  3WFP A;  2B56 A;  3OVS A;  1ZQZ A;  4I2H A;  9ICQ A;  4RQ1 A;  5J2H A;  4M9G A;  1ZQP A;  1ZQA A;  4YMO A;  4I2J A;  2BCR A;  1ZQM A;  4LVS A;  8ICY A;  1MQ3 A;  4EBK A;  9ICP A;  3UXO A;  5J0O A;  3V7J A;  2P66 A;  1ZQX A;  4NY8 A;  4YMN A;  1ZQI A;  3B0X A;  1ZQW A;  4K4I A;  3OUY A;  4KLQ A;  4M5D A;  4FHP A;  5J2B A;  5HC9 A;  5BOL A;  3L9D A;  3RH5 A;  1YLQ A;  4QZC A;  4NM1 A;  1RPL A;  3HJ1 A;  4KLE A;  7ICH A;  9ICG A;  1BPZ A;  9ICS A;  4QZI A;  4QZG A;  4QZA A;  3C5F A;  4YD2 A;  5HRB A;  1ZQF A;  4I2B A;  5BPC A;  4NLZ A;  4Z6D A;  1ZQN A;  2ISO A;  1ZQS A;  3AU6 A;  4PPX A;  5IIJ A;  4FHY A;  3V7K A;  2ZH8 A;  3UXN A;  4R66 A;  4XQ7 A;  4RQ5 A;  4LZG A;  8ICV A;  3JPT A;  4AT8 A;  2M2U A;  4UAW A;  1ZQV A;  4DOA A;  5DED A;  4YCX A;  9ICV A;  4E80 A;  4M9L A;  5J0U A;  4WC0 A;  4RT2 A;  1JAJ A;  5DBC A;  2ZH2 A;  1KNY A;  2VAN A;  4F5O A;  2BPF A;  2GWS A;  8ICZ A;  4I2D A; 
#chains in the Genus database with same CATH topology
 4LZD A;  3MDC A;  5J2C A;  1TV9 A;  7ICR A;  8ICU A;  3AQM A;  5HHH A;  2Q66 A;  5J2I A;  4KLG A;  4O9M A;  8ICL A;  8ICE A;  5IIO A;  7ICS A;  2BBH A;  3ER8 C;  4GXK A;  4OAF A;  4X0A A;  1FA0 A;  4ATB B;  3V7L A;  4WC7 A;  2B4V A;  9ICN A;  4O6A A;  4YMM A;  5DB6 A;  4DO9 A;  3WFS C;  3OVA A;  4WCW A;  4KLI A;  4P4O A;  4QZD A;  4EP7 A;  4F5Q A;  4O68 A;  2BE3 A;  9ICX A;  5CFT A;  4Z6F A;  4WC5 A;  4X5V A;  4WC1 A;  1F5A A;  1OU5 A;  5CP2 A;  4P4M A;  8ICA A;  8ICR A;  7ICF A;  4UBB A;  2BCU A;  5D4B A;  5HRG A;  4QZH A;  4DOC A;  1HUO A;  4QZB A;  2DR7 A;  2ISP A;  4XRH A;  4X4O A;  5IIN A;  2BCQ A;  7ICG A;  5J0P A;  3V72 A;  3RH6 A;  4UB5 A;  4FHX A;  4JWM A;  1NOM A;  5EOZ A;  2GA9 D;  2DRA A;  1XSP A;  9ICO A;  4I2F A;  1RZT A;  1XSN A;  9ICW A;  7ICP A;  5HRF A;  4UB2 A;  4TUQ A;  1ZQE A;  3OGU A;  5D49 A;  1ZQJ A;  5DEC A;  4TUR A;  9ICR A;  4QZE A;  3JZ0 A;  3C2M A;  5D46 A;  9ICF A;  3UQ0 A;  4RQ3 A;  3JCF A;  4WQL A;  4UB3 A;  9ICM A;  8ICJ A;  2EWR A;  4AT9 B;  3C66 A;  1BPB A;  4LT6 A;  3JYY A;  3TFR A;  4WC2 A;  4O5K A;  2BCS A;  1R8B A;  8ICH A;  4R64 A;  3AQK A;  9ICC A;  8ICP A;  3B0Y A;  4Z6C A;  8ICC A;  4MF2 A;  3K7D A;  4KLF A;  4UBC A;  2GAF D;  2BCV A;  4PH5 A;  1JQR A;  4M9J A;  3GDX A;  8ICK A;  2HN2 A;  4K98 A;  5HRI A;  1ZQB A;  4HX0 A;  4WC6 A;  4X0B A;  2FMS A;  3LK9 A;  4WBZ A;  9ICJ A;  1Q78 A;  4AT7 B;  4RPX A;  4UD5 A;  3C2L A;  7ICE A;  4EEB A;  9ICA A;  8ICT A;  3AQL A;  2W9M A;  4F5N A;  3UPQ A;  4NXZ A;  5J0S A;  4P2H A;  4FHV A;  4X4S A;  2HHP A;  2HN1 A;  4O69 A;  2BPG A;  1R89 A;  4LEW A;  5J2E A;  5J0Q A;  1R8A A;  5IIK A;  4FO1 A;  4XUS A;  4M9H A;  4X4T A;  4MFC A;  1UEU A;  3AU2 A;  3MDA A;  2PFP A;  4F5P A;  4X4R A;  1TVA A;  4RQ2 A;  3RJJ A;  3WFQ E;  3HW8 A;  1ZQH A;  3CK6 A;  1ZQG A;  5CB1 A;  1HUZ A;  8ICS A;  4WC3 A;  3LQC B;  4PHE A;  3TFS A;  4RWP A;  2ZH6 A;  4M47 A;  4FO6 A;  5HRD A;  4O5C A;  4AT9 A;  9ICU A;  4EED A;  3EF2 A;  4K8V A;  5BOM A;  4RPZ A;  1PX5 A;  4EBJ A;  4GXJ A;  8ICF A;  5TZV A;  5J2D A;  1JMS A;  3ISC A;  2PXI A;  4PGX A;  3K75 D;  3NWI A;  3JPP A;  2ID1 A;  5CWR A;  4DOB A;  8ICN A;  7ICJ A;  4I2I A;  5J2F A;  1TFY A;  2ZHB A;  1ZQR A;  2ZHA A;  5J29 A;  1VFG A;  5F2V O;  1TFW A;  4M04 A;  9ICI A;  3RJF A;  1BPD A;  4UAY A;  3H37 A;  5DKW A;  3JPO A;  4O67 A;  8ICO A;  1UEV A;  2DR5 A;  4JLX A;  5III A;  4MKP A;  2ZH9 A;  2DRB A;  4NXX A;  7ICO A;  9ICL A;  4NXW A;  3RH4 A;  2DVI A;  3RJI A;  4AT8 B;  5IIM A;  4KLJ A;  5J0W A;  4X4Q A;  3NKU A;  4PGY A;  4UD4 A;  2PFQ A;  4IQW A;  3MBY A;  1ZQL A;  9ICH A;  5HRE A;  4XA5 A;  3JPN A;  5J0X A;  4WBY A;  4KLD A;  2PFN A;  4NKT A;  4GXI A;  3HIY A;  1MIV A;  8ICQ A;  4I29 A;  3ISD A;  3MGI A;  1WOT A;  3PMN A;  7ICN A;  7ICT A;  4M0A A;  2M2V A;  4KLU A;  9ICK A;  2PFO A;  4WQK A;  3NYB A;  4E8F A;  2NRK A;  2M2W A;  4QZF A;  5HHI A;  4RQ0 A;  4KLT A;  4FH5 A;  1KDH A;  3C18 A;  3JPQ A;  4OAI Z;  3PML A;  4KLL A;  3C5G A;  2O1P A;  4IQV A;  5DBB A;  4KB6 A;  3ERC C;  3PHZ A;  7ICU A;  4UAZ A;  3HWT A;  4RQ7 A;  8ICM A;  4NXT A;  3OWG A;  4ATB A;  4IQU A;  5D63 A;  4KLH A;  4LEV A;  4RT3 A;  3UXP A;  4RWN A;  4I28 A;  5CHG A;  4F5R A;  4K4G A;  1R8C A;  4RQ8 A;  3UQ2 A;  4IQT A;  3MGH A;  4PHD A;  4X4V A;  5D61 A;  5IIL A;  4UB4 A;  4NKU A;  4YD1 A;  4OAG A;  8ICX A;  4RWO A;  4NLN A;  4EV6 A;  1ZQQ A;  2IHO A;  4IG8 A;  4JWN A;  4O5E A;  4MF8 A;  4Z6E A;  5CR0 A;  4X4P A;  4TUS A;  4I27 A;  2ZH5 A;  3H38 A;  4RWQ A;  5J2K A;  9ICT A;  2O5A A;  3WFR E;  3RJG A;  8ICG A;  4UB1 A;  8ICI A;  1ZQT A;  4R65 A;  4R63 A;  3HX0 A;  4I2G A;  1ZJN A;  3H39 A;  4RPY A;  1ZQC A;  1JN3 A;  5J2G A;  5CHE A;  2ZH3 A;  5HRH A;  2ZH4 A;  4RQ6 A;  1XSL A;  5CJ7 A;  4X4N A;  4I2E A;  5HR9 A;  3AQN A;  1MIY A;  1V4A A;  4MFF A;  2DR8 A;  4I2C A;  4PHA A;  5J0Y A;  3OVB A;  1VJ7 A;  3RJE A;  8ICB A;  7ICQ A;  3PNC A;  3OUY B;  7ICL A;  2DR9 A;  1ZQU A;  1ZQY A;  5J2A A;  4KLM A;  4NM2 A;  4M2Y A;  5DB7 A;  1ZQO A;  4QZ8 A;  1ZQK A;  4XQ8 A;  4N7R A;  5CA7 A;  7ICK A;  5DDM A;  4KLO A;  5JTG A;  4I2A A;  3OV7 A;  2M2T A;  5DB9 A;  4QZ9 A;  2FMQ A;  2BPC A;  5J0R A;  4E7X A;  1NO5 A;  3C2K A;  4K4H A;  3MCR A;  5J2J A;  1UET A;  4S3N A;  4P4P A;  1MIW A;  1BPE A;  2BBJ A;  2IHM A;  3RJH A;  4FHW A;  4YN4 A;  3HJ4 A;  9ICB A;  4NLK A;  5B3P A;  7ICM A;  3JPS A;  4M9N A;  4PGQ A;  2ZH7 A;  1KEJ A;  3WFO A;  3ISB A;  9ICE A;  4PHP A;  2B51 A;  4FH3 A;  2RFF A;  3H3A A;  4XJE A;  1ZJM A;  5J0T A;  4AT7 A;  3UPS A;  1MQ2 A;  4WH5 A;  7ICI A;  8ICW A;  2ZH1 A;  3RJK A;  4TUP A;  4I0U A;  3JPR A;  2FMP A;  4X4U A;  5DDY A;  4WC4 A;  1ZQD A;  5HRK A;  2PBE A;  5DB8 A;  2I9G A;  3AUO A;  7ICV A;  4KLS A;  1BPY A;  4LEY A;  4NXU A;  1BPX A;  1Q79 A;  4MFA A;  4K9B A;  5HRL A;  5DBA A;  4RQ4 A;  3WFP A;  2B56 A;  3OVS A;  1ZQZ A;  4I2H A;  9ICQ A;  5CFS A;  4RQ1 A;  5J2H A;  4M9G A;  1ZQP A;  1ZQA A;  4YMO A;  4I2J A;  2BCR A;  1ZQM A;  4LVS A;  4K96 A;  8ICY A;  1MQ3 A;  4EBK A;  9ICP A;  3UXO A;  4K9A A;  5J0O A;  3V7J A;  2P66 A;  1ZQX A;  4K99 A;  3NVO A;  4YMN A;  4NY8 A;  4WOY A;  1ZQI A;  3B0X A;  1ZQW A;  2FCL A;  4K4I A;  3OUY A;  4KLQ A;  4M5D A;  4KM5 A;  4FHP A;  5D62 A;  5J2B A;  5HC9 A;  5BOL A;  3L9D A;  5CFU A;  3RH5 A;  1YLQ A;  4QZC A;  4NM1 A;  1RPL A;  3HJ1 A;  4KLE A;  4K97 A;  7ICH A;  9ICG A;  1BPZ A;  9ICS A;  4QZI A;  4QZG A;  4QZA A;  3C5F A;  4YD2 A;  5HRB A;  1ZQF A;  4I2B A;  5BPC A;  4NLZ A;  4Z6D A;  1ZQN A;  2ISO A;  1ZQS A;  3AU6 A;  4PPX A;  5IIJ A;  4FHY A;  3V7K A;  2ZH8 A;  3UXN A;  4JLZ A;  4R66 A;  4XQ7 A;  4RQ5 A;  4LZG A;  8ICV A;  3JPT A;  4AT8 A;  2M2U A;  4UAW A;  1ZQV A;  4DOA A;  5DED A;  4YCX A;  9ICV A;  4E80 A;  4M9L A;  5J0U A;  4WC0 A;  4RT2 A;  1JAJ A;  5DBC A;  2ZH2 A;  1KNY A;  2IUB A;  3ER9 B;  5B3Q A;  2VAN A;  4F5O A;  4LEZ A;  1GPJ A;  2BPF A;  4EGW A;  2GWS A;  4NXV A;  8ICZ A;  4OAH A;  4I2D A; 
#chains in the Genus database with same CATH homology
 4LZD A;  3MDC A;  5J2C A;  1TV9 A;  7ICR A;  8ICU A;  3AQM A;  5HHH A;  2Q66 A;  5J2I A;  4KLG A;  4O9M A;  8ICL A;  8ICE A;  5IIO A;  7ICS A;  4GXK A;  4OAF A;  4X0A A;  1FA0 A;  4ATB B;  3V7L A;  4WC7 A;  2B4V A;  9ICN A;  4O6A A;  4YMM A;  5DB6 A;  4DO9 A;  3WFS C;  3OVA A;  4WCW A;  4KLI A;  4P4O A;  4QZD A;  4EP7 A;  4F5Q A;  4O68 A;  2BE3 A;  9ICX A;  4Z6F A;  4WC5 A;  4X5V A;  4WC1 A;  1F5A A;  1OU5 A;  5CP2 A;  4P4M A;  8ICA A;  8ICR A;  7ICF A;  4UBB A;  2BCU A;  5D4B A;  5HRG A;  4QZH A;  4DOC A;  1HUO A;  4QZB A;  2DR7 A;  2ISP A;  4XRH A;  4X4O A;  5IIN A;  2BCQ A;  7ICG A;  5J0P A;  3V72 A;  3RH6 A;  4UB5 A;  4FHX A;  4JWM A;  1NOM A;  5EOZ A;  2DRA A;  1XSP A;  9ICO A;  4I2F A;  1RZT A;  1XSN A;  9ICW A;  7ICP A;  5HRF A;  4UB2 A;  4TUQ A;  1ZQE A;  3OGU A;  5D49 A;  1ZQJ A;  5DEC A;  4TUR A;  9ICR A;  4QZE A;  3JZ0 A;  3C2M A;  5D46 A;  9ICF A;  3UQ0 A;  4RQ3 A;  4UB3 A;  9ICM A;  8ICJ A;  4AT9 B;  3C66 A;  1BPB A;  4LT6 A;  3JYY A;  3TFR A;  4WC2 A;  4O5K A;  2BCS A;  1R8B A;  8ICH A;  4R64 A;  3AQK A;  9ICC A;  8ICP A;  3B0Y A;  4Z6C A;  8ICC A;  4MF2 A;  4KLF A;  4UBC A;  2BCV A;  4PH5 A;  1JQR A;  4M9J A;  3GDX A;  8ICK A;  4K98 A;  5HRI A;  1ZQB A;  4WC6 A;  4X0B A;  2FMS A;  3LK9 A;  4WBZ A;  9ICJ A;  1Q78 A;  4AT7 B;  4RPX A;  4UD5 A;  3C2L A;  7ICE A;  9ICA A;  8ICT A;  3AQL A;  2W9M A;  4F5N A;  3UPQ A;  4NXZ A;  5J0S A;  4P2H A;  4FHV A;  4X4S A;  2HHP A;  4O69 A;  2BPG A;  1R89 A;  4LEW A;  5J2E A;  5J0Q A;  1R8A A;  5IIK A;  4XUS A;  4M9H A;  4X4T A;  4MFC A;  1UEU A;  3AU2 A;  3MDA A;  2PFP A;  4F5P A;  4X4R A;  1TVA A;  4RQ2 A;  3RJJ A;  3WFQ E;  3HW8 A;  1ZQH A;  1ZQG A;  5CB1 A;  1HUZ A;  8ICS A;  4WC3 A;  3LQC B;  4PHE A;  3TFS A;  2ZH6 A;  4RWP A;  4M47 A;  4FO6 A;  5HRD A;  4O5C A;  4AT9 A;  9ICU A;  4K8V A;  5BOM A;  4RPZ A;  1PX5 A;  4EBJ A;  4GXJ A;  8ICF A;  5TZV A;  5J2D A;  1JMS A;  3ISC A;  2PXI A;  4PGX A;  3K75 D;  3JPP A;  2ID1 A;  5CWR A;  4DOB A;  8ICN A;  7ICJ A;  4I2I A;  5J2F A;  1TFY A;  2ZHB A;  1ZQR A;  2ZHA A;  5J29 A;  1VFG A;  5F2V O;  1TFW A;  4M04 A;  9ICI A;  3RJF A;  1BPD A;  4UAY A;  3H37 A;  5DKW A;  3JPO A;  4O67 A;  8ICO A;  1UEV A;  2DR5 A;  4JLX A;  5III A;  4MKP A;  2ZH9 A;  2DRB A;  4NXX A;  7ICO A;  9ICL A;  4NXW A;  3RH4 A;  2DVI A;  3RJI A;  4AT8 B;  5IIM A;  4KLJ A;  5J0W A;  4X4Q A;  4PGY A;  4UD4 A;  2PFQ A;  4IQW A;  3MBY A;  1ZQL A;  9ICH A;  5HRE A;  4XA5 A;  3JPN A;  5J0X A;  4WBY A;  4KLD A;  2PFN A;  4NKT A;  4GXI A;  3HIY A;  1MIV A;  8ICQ A;  4I29 A;  3ISD A;  3MGI A;  1WOT A;  3PMN A;  7ICN A;  7ICT A;  4M0A A;  2M2V A;  4KLU A;  9ICK A;  2PFO A;  3NYB A;  4E8F A;  2NRK A;  2M2W A;  4QZF A;  5HHI A;  4RQ0 A;  4KLT A;  4FH5 A;  1KDH A;  3C18 A;  3JPQ A;  4OAI Z;  3PML A;  4KLL A;  3C5G A;  2O1P A;  4IQV A;  5DBB A;  4KB6 A;  7ICU A;  4UAZ A;  3HWT A;  4RQ7 A;  8ICM A;  4NXT A;  4IQU A;  4ATB A;  4KLH A;  4LEV A;  4RT3 A;  3UXP A;  4RWN A;  4I28 A;  5CHG A;  4F5R A;  4K4G A;  1R8C A;  4RQ8 A;  3UQ2 A;  4IQT A;  3MGH A;  4PHD A;  4X4V A;  5IIL A;  4UB4 A;  4NKU A;  4YD1 A;  4OAG A;  8ICX A;  4RWO A;  4NLN A;  1ZQQ A;  4JWN A;  4O5E A;  4IG8 A;  4MF8 A;  4Z6E A;  5CR0 A;  4X4P A;  4TUS A;  4I27 A;  2ZH5 A;  3H38 A;  4RWQ A;  5J2K A;  9ICT A;  2O5A A;  3WFR E;  3RJG A;  8ICG A;  4UB1 A;  8ICI A;  1ZQT A;  4R65 A;  4R63 A;  3HX0 A;  4I2G A;  1ZJN A;  3H39 A;  4RPY A;  1ZQC A;  1JN3 A;  5J2G A;  2ZH3 A;  5HRH A;  2ZH4 A;  4RQ6 A;  1XSL A;  5CJ7 A;  4X4N A;  4I2E A;  5HR9 A;  3AQN A;  1MIY A;  1V4A A;  4MFF A;  2DR8 A;  4I2C A;  4PHA A;  5J0Y A;  3OVB A;  1VJ7 A;  3RJE A;  8ICB A;  7ICQ A;  3PNC A;  3OUY B;  7ICL A;  2DR9 A;  1ZQU A;  1ZQY A;  5J2A A;  4KLM A;  4NM2 A;  4M2Y A;  5DB7 A;  1ZQO A;  4QZ8 A;  1ZQK A;  4XQ8 A;  5CA7 A;  7ICK A;  5DDM A;  4KLO A;  4I2A A;  3OV7 A;  2M2T A;  5DB9 A;  4QZ9 A;  2FMQ A;  2BPC A;  5J0R A;  4E7X A;  1NO5 A;  3C2K A;  4K4H A;  5J2J A;  1UET A;  4S3N A;  4P4P A;  1MIW A;  1BPE A;  2IHM A;  3RJH A;  4FHW A;  4YN4 A;  3HJ4 A;  9ICB A;  4NLK A;  7ICM A;  3JPS A;  4M9N A;  4PGQ A;  2ZH7 A;  1KEJ A;  3WFO A;  3ISB A;  9ICE A;  4PHP A;  2B51 A;  4FH3 A;  2RFF A;  3H3A A;  1ZJM A;  5J0T A;  4AT7 A;  3UPS A;  1MQ2 A;  7ICI A;  8ICW A;  2ZH1 A;  3RJK A;  4TUP A;  3JPR A;  2FMP A;  4X4U A;  5DDY A;  4WC4 A;  1ZQD A;  5HRK A;  2PBE A;  5DB8 A;  2I9G A;  3AUO A;  7ICV A;  4KLS A;  1BPY A;  4LEY A;  4NXU A;  1BPX A;  1Q79 A;  4MFA A;  4K9B A;  5HRL A;  4RQ4 A;  5DBA A;  3WFP A;  2B56 A;  3OVS A;  1ZQZ A;  4I2H A;  9ICQ A;  4RQ1 A;  5J2H A;  4M9G A;  1ZQP A;  1ZQA A;  4YMO A;  4I2J A;  2BCR A;  1ZQM A;  4LVS A;  4K96 A;  8ICY A;  1MQ3 A;  4EBK A;  9ICP A;  3UXO A;  4K9A A;  5J0O A;  3V7J A;  2P66 A;  1ZQX A;  4K99 A;  4NY8 A;  4YMN A;  4WOY A;  1ZQI A;  3B0X A;  1ZQW A;  4K4I A;  3OUY A;  4KLQ A;  4M5D A;  4KM5 A;  4FHP A;  5J2B A;  5HC9 A;  5BOL A;  3L9D A;  3RH5 A;  1YLQ A;  4QZC A;  4NM1 A;  1RPL A;  3HJ1 A;  4KLE A;  4K97 A;  7ICH A;  9ICG A;  1BPZ A;  9ICS A;  4QZI A;  4QZG A;  4QZA A;  3C5F A;  4YD2 A;  5HRB A;  1ZQF A;  4I2B A;  5BPC A;  4NLZ A;  4Z6D A;  1ZQN A;  2ISO A;  1ZQS A;  3AU6 A;  4PPX A;  5IIJ A;  4FHY A;  3V7K A;  2ZH8 A;  3UXN A;  4JLZ A;  4R66 A;  4XQ7 A;  4RQ5 A;  4LZG A;  8ICV A;  3JPT A;  4AT8 A;  2M2U A;  4UAW A;  1ZQV A;  4DOA A;  5DED A;  4YCX A;  9ICV A;  4E80 A;  4M9L A;  5J0U A;  4WC0 A;  4RT2 A;  1JAJ A;  5DBC A;  2ZH2 A;  1KNY A;  2VAN A;  4F5O A;  4LEZ A;  2BPF A;  2GWS A;  4NXV A;  8ICZ A;  4OAH A;  4I2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...