4NL5A

Mycobacterium tuberculosis heme-degrading protein mhud in complex with heme and cyanide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
b'PVVKINAIEVPAGAGPELEKRFAHRAHAVENSPGFLGFQLLRPVKGEERYFVVTHWESDEAFQAWANGPAIAAHAGHRANPVATGASLLEFEVVLDVGGTG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heme-degrading monooxygenase HmoB
publication title Crystallographic and Spectroscopic Insights into Heme Degradation by Mycobacterium tuberculosis MhuD.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 17
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature ec 1.14.99.57: Heme oxygenase (mycobilin-producing).
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nl5A00
1W2IA 4Y2KA 4HH0A 2ACYA 2BYCA 3KG0A 1XBWA 5A6PA 1OQ3A 4Q2LA 5B0AA 1TL5A 1Y0HA 3MZIA 1Q4RA 1SQEA 4QOTA 2HFOA 1TR0A 4U9RA 1CC8A 2XMMA 3HHLD 1Y3KA 2GCFA 1KVJA 2OD4A 2FIUA 1GXUA 2VV5A 3HF5A 3UDCA 1S6UA 2AW0A 3BN7A 2XMWA 2W4DA 2G9OA 2RILA 1SI9A 1YG0A 2L3MA 4OJ1A 2Q3PA 3LGNA 4NPOA 3VTIA 3QMQA 2BBEA 1OPZA 1Q53A 2PD1A 1R6YA 1N5QA 3BF4A 1IUJA 1MWYA 3IWXA 2W4CA 4OJ3A 2PGCA 3CJKB 2XMKA 2XMUA 2RSQA 2XMVA 1URRA 1AW0A 4HI2A 1P8GA 5B08A 3LGMA 2VH7A 3E8OA 3KKFA 1N5VA 1S6OA 2N4DA 3HHLA 3LO3A 4FNIA 5T7LB 5B09A 2XMTA 3QGPA 2BJEA 4Y2MA 1X8DA 3BM7A 4A4JA 4HI1A 3F44A 5B0DA 1JWWA 5IXUA 1YJVA 2N7YA 1Q8LA 2IYGA 3I9ZA 2AJ0A 2HQIA 2K7JA 3HHLB 4OJGA 2FTRA 4DN9A 2KT3A 2RMLA 4Y2IA 5B0CA 3KNGA 2KT2A 1APSA 2KYZA 2LDIA 2LQ9A 3BR8A 2ZDOA 3CJKA 2GGPA 4EFAC 2AP6A 3TNVA 2ASYA 2LQBA 2OD6A 1VQSA 2K7KA 2BJDA 4OJHA 3HFKA 4A48A 5B0GA 1K0VA 1P6TA 1ULRA 3FRYA 1AFIA 2CRLA 1FD8A 2GGPB 5T7LA 2K1RB 4OIXA 1FEEA 1N5SA 1YJTA 2ZDPA 1U7LA 1QUPA 2GFFA 1TZ0A 1MWZA 2OMOA 2OP5A 3DXSX 2OKQA 2QLWA 3FGVA 1Y9OA 1KVIA 2HLUA 4FNHA 2FHMA 4ZOSA 1GXTA 1YJUA 1SB6A 2ROGA 2XMJA 1OSDA 4DL0C 5B0BA 4A47A 1FE0A 2ROPA 5K9FA 4NL5A 5KAKA 1X7VA 2OFGX 2OAUA 4HL9A 5B0FA 2K2PA 3K7RA 5F0WA 5A6WA 1AFJA 1FVQA 2GA7A 2K1RA 2KKHA 3HDSA 3MCSA 1LQ9A 2EW9A 3TOQA 4ZA1A 2W4PA 3BB5A 1FESA 5B0EA 2N4CA 1FVSA 2GO8A 3HX9A 3GZ7A 4F67A 1N5TA 1TUVA 1Y3JA 2IYIA 1FE4A 2BUNA 4YDXA 2QIFA 5F0UA 2FB0A 2QYCA 3KG1A 2ROEA 2HIQA 1X0PA 2QLXA 2IFXA 1VQYA 4YEAA 3TRGA 4A46A 4DPOA 1CPZA 1YJRA 1TL4A 3T9NA 1YRXA 1JK9B 3BGUA 2AJ1A 3FMBA 3WDOA 2HFNA 2HLTA 2LXFA 2JDJA 1V3ZA 3IWLA 4HH1A 1RJJA 1CC7A 2OFHX 3DCAA 1WD6A 1KQKA 3HHLC 2GV1A 3BDEA 4Q2MA 1Q8BA 1OQ6A 2RU9A
chains in the Genus database with same CATH superfamily
3M9NB 3GPAA 2VQFJ 4DSLA 1ZTWA 1UVKA 3OVSA 2JNJA 1A7GE 4LVOP 4NLVA 2QA4S 3VQTA 3KOAA 1N32F 1NHUA 1UL3A 2Y1RI 4LUBA 5FDLA 3FRZA 3C16A 3HKZD 2MHEA 3MFHA 1UJ4A 4RWWA 5B09A 4W90B 1F3FA 5KG0A 3HHLB 1RKIA 4PUOB 1RK8A 2GNKA 4XPEA 1WDTA 3MMAA 2WZ1A 1IR0A 1OO0B 5L1LA 4TY9A 2HAFA 1SIWB 1N4LA 4RW9B 2J0SD 4QWCA 2XMJA 3QATA 2ZITA 2OAUA 1H2UX 5CA5A 1F5BA 1NLKL 3T1HJ 4I2QA 1HR0J 1FKOB 1YSJA 1VIOA 1GQEA 1WF1A 3UN2A 3FQKA 2DGTA 1S1WA 4NCGA 2VJVA 3RTVA 4ZVRB 3W5ZA 1VQ4S 3U02A 1L3SA 3O2IA 1K47A 3SI8A 2XY5A 2W2OP 4ELTA 2RDJA 1RTJB 1GXUA 3CMAS 4ZDNA 4C8NA 2UUAJ 2MB0B 3D4JA 4MAKA 3KK1B 4CLKA 1RHRB 1MWYA 2IVMA 3QIPB 2HNDA 1EETB 1U09A 3M8QB 3PO5A 3BM7A 2B4VA 2YNHA 5B0CA 1NK9A 4ZHRB 1UAWA 2GAHC 3CCUS 2DJWA 4KKOB 4X62F 3KJNB 4LIRA 2RKIB 4DV2J 3X3UA 4LF6F 3W63A 4CO3A 3V4MA 2HQFA 3Q8UA 4PQUB 1S1UA 1PO6A 1VQ5S 1S1TB 2ZH3A 3QRRA 1RWVB 2EFOA 5J2NB 1X0PA 1VQYA 2FDNA 4TU8A 2XLIA 1Q5YA 4NLRA 2E44A 2LXFA 5E3RA 1TK5A 1KHVA 1VBKA 3KXDA 3THPA 1BC6A 3PXGa 3HHNB 4ZN1A 5FJ4A 2BYCA 1I3OB 1FO1A 3MZIA 1FXDA 1SKRA 1NHVA 5T14A 3JTOA 2MLYA 3AXMA 2JLFA 4ES3A 1SJFA 2L3MA 1N33F 4PAAA 3D6MB 3PTWA 3ILJA 2VBWA 3OV7A 4EK2A 1RT4B 2H54B 3BBCA 2YWKA 1QD1A 1VRTA 4NLPA 4IOBA 5HO4A 4DLGA 1BLUA 4NE9C 2GGPB 4KHMA 3RBXA 4ECSA 5FIIA 1B3TA 2YKAA 1D0EA 4TN2A 5CABA 1OY8A 2DY9A 1HQUB 3EGWB 2R7TA 1Z4UA 3RZAA 2W2QP 2M9KA 3K5PA 2AYEA 4TU9A 3VAMA 3SV3A 1UMJA 4QR1A 5C24A 4RX6A 2V2VA 2WSEC 3WX4A 1FTCA 4ES1A 4QJVA 5K14B 2EG1A 3DLBA 3TVKA 2Q3PA 4K4SA 1BQMA 1R89A 2VFVA 4IH6A 1JLAA 2NZCA 3ILIA 4OV1A 1DFDA 3DHWC 2C3UA 4IFYA 4YMEA 1FEHA 3T1AA 3ZZPA 3PW7A 4XDDA 2V2KA 2LA4A 4QIEA 2YQ0A 4ID5B 5G0RA 3DRPB 1TKXA 3D1OA 5LSLA 2GJ2A 1M1KT 1WF0A 3JXOA 4JI6F 1QE1A 2IDEA 3R7BB 2Z2LA 3MTKA 2LEPA 3H4BA 4A47A 3N4WA 3RJMB 2QEXS 2E7WA 1P9YA 4CH7A 1HW8A 2G4BA 2UU9F 5EGYA 2PE8A 2G0CA 2HHVA 2ASJA 4QU6A 2QJ3A 3C6UB 4QWDA 1FRMA 1ZH5A 2HSEB 2FPHX 3CD5A 3U27A 5IT0A 1LOUA 4F26A 4F3MA 4PPZA 2XGPA 3DDIA 1FCAA 1N52B 3W9IA 2APOA 1T9WA 2BW2A 1Y3KA 4WYWA 3RU0A 4I7FA 1FA0A 4AE5A 5DLFA 3PX6A 4CCHA 4AXJA 1FRHA 1DQ9A 2B6AB 1B0VA 2HMIB 2W9CB 1YVFA 4DV5F 2RH3A 3AD9C 5T7LB 3DLGB 1ZBTA 4BS2A 3FEZA 5C7PA 2WVBA 1VRQC 1KR4A 2P6TA 4NLTA 4B9SA 1FX4A 1S6QA 2C1EB 2I2YA 5K8PA 1MWZA 2LCWA 1EJ7L 1YJUA 4W98A 4QU7A 2W9BB 2ROPA 2DGSA 1FF2A 2JEFA 2F40A 1KLMB 1T05A 3HZEA 4JI1F 2XM3A 4DQSA 4DL4A 1JLQA 5B7WA 3A3NB 1UFLA 4DXLA 4X4QA 3DYAB 2VZ9A 4WFYA 1T9TA 1QLNA 2GVDB 5LT5A 3S8SA 3NKYA 2IJNA 4ZVFA 3CJSA 3KHRA 5KFAA 4MH8A 2YWHA 3D28A 2EBEA 1NRKA 3UDCA 1NJZA 2JEJA 3V6JA 1HQEB 4GKKF 3QO9B 4H4MB 4UT4A 4WP8A 2UUCF 1RLDA 1JJCB 2DGOA 4DZ6A 2FY8A 1IR2A 3J80Y 2OPRB 2CJKA 4B3RJ 2CDQA 3I56S 1AUDA 4A48A 3KJVB 1DZ5A 2X51A 1VQ9S 1JKHB 3DLJA 3X1LB 2NXUA 2BZ2A 3MM5B 3K5MA 2W2MP 3NWGA 5A0YA 4DPYA 4NXNF 4DV7J 2XO6A 1FDDA 2K2PA 3UWTA 1O0PA 1P27B 2P9GA 4HT7A 4QIWD 1UWBB 3GCXP 5HQMA 2D41A 5AXMA 4DR1J 1S9GB 4KB7A 3HHKA 5A8KA 2VICA 5CYQB 2Q43A 3RR7A 1NJXA 2Y8YA 4PG6A 3UN3A 2E9RX 2YQ1A 1M1HA 3QGIA 1CS4A 1SXLA 1KTVA 4JI7J 3I31A 2HIYA 2IBKA 4WYLA 2AYMA 4CO5A 4E8UA 5D6GA 2IC3A 1RT3B 1YJVA 3QSIA 5IFMA 3QJPA 4JI5F 4C8ZA 3HFKA 3GG1A 4ZCLA 1DTTA 3J7Z5 3J7AN 2DHHA 2QLJB 2X1GA 5L9NA 5AE3A 4P74A 5DO2A 3OHBA 3LWLA 1CJKB 3O5TB 2UV8A 3KDNA 4OHYA 2DEJA 1GX5A 4QWEA 5BXIA 3EZOA 3P45B 4YB1P 1NSQA 3GIJA 2P9EA 1IR1A 3HO1A 1M5VC 1OQ3A 1U1OA 2VG6A 2YNFA 1N34J 1JLBA 5AXNA 1NUEA 4Q8FA 4XPCA 1JJHA 3MDFA 3KLFA 4WFZA 3VGUA 4QIGA 3QAUA 3ZZZA 2ZOGA 4J9QA 3EMTA 1T02A 1N5VA 5F9NA 4A4JA 1VIXA 2A18A 1FTRA 4CT9A 4Y2AA 3KNGA 5LMNF 4FDFA 2JJ4D 5H1SV 4X4UA 2FHJA 4P2MA 1D8YA 1CJTA 2RQKA 9RUBA 4LFCF 1NJYA 3BN4A 2VONA 4DFPA 1Y10A 3FBEA 2QLWA 2P8IA 3W66A 2R4FA 2MQMA 3AJ1A 1NEEA 3DLEA 4G65A 4JI2F 1TL3A 3SQGA 5LSRA 1XK8A 2MZSA 2IM0A 4O4GA 3G82B 3R2CJ 1E6VB 3G6YA 4OI1A 4DJBA 4L72B 2HVZA 4KYZA 1CPZA 4F0MA 3W64A 2QLBB 1X5OA 3OTDA 2PO4A 3FVYA 1C0UB 3OL6A 1WHVA 5ADZA 1V3SA 2EG2A 3KMSA 1N36J 2HAIA 1HHTP 3DGVA 2ZNZA 4WFBQ 1LK7A 1A0OB 4DV6J 4NA1A 5MLCV 2BANA 2NPIA 3K58A 1HA1A 1C0TA 5JUMA 3DU5A 1KNZA 5F8IA 1U1KA 2W2PP 1PC4A 4DR4F 3R1LA 1LWCB 4CLZA 2RS2A 4RU2A 5HJYA 4K2JA 4ES2A 1HNWF 2CNLB 3D67A 3RAXA 3DOMA 3B4DA 2V34A 2ZM6F 4K5SA 3O8WA 4F8RA 5B0EA 4ECUA 2HHSA 4LFBJ 2B8PA 5E3AA 4LF5J 1SUQA 3CC4S 1OJ4A 2HRTA 4L74A 3ENQA 1YITS 4Q2LA 4K59A 1QUVA 1WC6A 1OWXA 3UDLA 4LR9A 1ACMB 1LW2B 4RW6A 4C4WA 4URGA 1VBYA 4V19X 3LWMA 2BKOA 3HPOA 1WORA 2A6MA 5AJ3F 2KYZA 4KFBB 2YKQA 2O67A 2ZVIA 3OUYA 4XIUA 3Q24A 3RAMA 1MNEA 5E3PA 1IKVA 2AQ4A 4M5JA 4TY8B 3SSQA 3M2UB 1KWMA 2U2FA 3T1YF 4J9UE 2QSFA 3WIUA 3JQKA 5GMDA 4JI0J 1TL1A 3MR5A 1RT7A 2R9LA 1XMQF 1W25A 2C2KB 3PRBA 4CM0A 1OYDA 4CLYA 1YJRA 3GSIA 1PSDA 1EX8A 5KFOA 4EUVA 2VIHA 3R5DA 3Q83A 4EYIB 1WI6A 3J7A1 3ILOA 3CMQA 2V68A 1OMSA 3C16B 2F8EX 5K20B 3IMQJ 4K4UA 3NS5A 2QA2A 4NLOA 4NPOA 2RIJA 3VCDA 3MM8A 3G4SS 1LK5A 2AZ1A 2FJEB 1R0AA 4C0HA 3ZZUA 2XHCA 3CE8A 3UNYA 2ZH7A 5GAHU 3KHLA 3B78A 3TAMA 1VC6A 5CCMA 2ZUAA 2HGNA 4EWTA 1RHUB 4N8OA 5CZXA 4KY3A 2F4VF 3IGNA 1I1GA 5DG8A 3K7RA 1S1WB 4NCGB 5HK4A 4CLSA 3GZ7A 1N5TA 1FFGB 3U1NA 2HVHA 2CQ0A 2B9XA 1SJRA 2WVFA 2VF3A 1KDNA 1M1GA 4KBIA 4RNHA 5F9LA 4LF4J 1RCOB 1XNQJ 2Z4PA 2VFRA 2VUGA 4UTGA 1J2VA 4K0KJ 3BS9A 2HNDB 4PCQA 3DMJB 5HL7Q 5KFGA 1KKHA 3AXKA 1SI9A 1L3TA 4RW7B 3BQ2A 1T9YA 3N79A 4FPIA 2GMHA 1WJ9A 4B3OA 1IUJA 3NS7B 4O3SA 4USUA 4IG0A 2BACA 3H0PA 2HNYA 2KM8C 4UW2A 4AL7A 1DTQA 4H4KC 1EKRA 1RP5A 2R7XA 2CPIA 3AOBA 2O5DA 4M5MA 3A3PB 4J37A 4R0JA 1S1UB 1H72C 2NLWA 4J9OA 2C3PA 2B9YA 5HAOA 4ECTA 2ACMA 4P7TA 2AEMA 2C28A 3HDSA 5E5NA 2G13A 4B3MF 2RQCA 2XLJA 4NCBA 3MM6A 4WU2A 1R31A 2R8KA 3SDEA 1R27B 5KOWA 3OR1B 1IM4A 4DBQA 4UOFA 2E5LJ 1C4CA 1BXNA 2EC2A 1WACA 2FLLA 3NGRA 3IN5A 2CWXA 2BV3A 5KFYA 1M90T 2JVRA 3VWSA 4OI3A 2XMWA 4OZ2A 1AA1B 2J9CA 3JAMY 3GV5B 1VRTB 2MKJA 4EBCA 4U96A 1XQIA 3W2WB 1HBNA 3A4TA 2EEYA 2IYGA 2E7VA 3ISND 3H2VE 4X4SA 1RAOA 1NDLA 2OD6A 1J5EJ 3GMGA 4B9UA 2C3OA 4FBTA 2CPEA 2W7PA 3PW4A 4FF4A 2RF2A 3KNAA 4KH0B 2ADCA 1U0SA 2V5HG 3RGIA 1GMWA 5ETVA 5C24B 2FJXA 2DGWA 1S12A 1KD1T 2JHEA 2UUWA 2XZWA 2Z8QA 1SCJB 4LF9F 3BSAA 2WRMA 4DCJB 3MWBA 3GIRA 2OTJS 2DR9A 4OX8A 2FZGB 3C46A 2XLKA 3MOJB 2YXLA 2LU2A 3I32A 3LANA 3SEOA 5IZHA 3HXMA 4OI0A 3WC0A 1FJGJ 2ZH2A 4HACA 2VASA 4DF4A 4ZVSB 3TZWA 3TA2A 3Q0AA 3NG8A 5G0RB 3KYLA 2D69A 1HNVA 4ZLPA 2F5GA 3CEDA 2ZJRQ 1QE1B 2LQ9A 1KRPA 2HFSA 3ONQA 1CSJA 1X60A 1HNZJ 1Y5IB 5D8HB 3CVKA 4YR2A 2W8LA 2BJ3A 2ATLA 1BQNA 2QMWA 4LQ3A 5KAKA 2YX4A 2MKYA 1M0SA 3MUTP 2MQ8A 3E01A 1IVZA 1HI8A 2YWGA 5DRKA 2QA4G 1VQKS 2YKNA 4RO0A 4JV1A 1GAOA 4IKAA 4JOUA 4DEZA 1G1XA 4OI6A 3SYZA 5HANA 5HMZA 5IT4A 2Q6CA 1SJQA 4QR2A 5T41A 1TL5A 4RJVA 3SXLA 4D3GA 3TP2A 5KFJA 4U9RA 3EXYA 1KBRA 3A3OB 3HZGA 4TU7A 4DZDA 5GADI 3M6UA 5KFLA 1QY7A 3GYXB 1IJEB 5I3PA 4M8LA 3PZPA 4QYZJ 3SMZA 1PJ5A 4R8UA 4TLRA 5KT6A 4KSEB 4PXDA 4PXEA 2HRYA 4QPXA 1REVA 4FYVB 3GLJA 4LRAA 1AROP 4RL1A 2VPWB 2XNQA 1TKTB 4TQRA 1K8AT 1LWFA 1X9MA 4RPFA 3K59A 2H51B 4JBCA 1UPPA 3V5RA 5HI7A 1JQGA 3WBZA 2YWFA 1NZ8A 3O44A 4OHZA 4JV2A 1OSDA 1JLQB 2K8GA 2G2OA 3LOUA 4ZPWR 5CAAA 4F3QA 3KJQB 4ZVQB 3W2VA 1CQNA 5AT1B 1DQ8A 1YX2A 5D4NA 4D3HA 5HBMA 5IOLA 3NBPA 3CNQP 3PACA 1T3OA 1RXOB 1WOPA 4KV8A 4KRWA 4XDCA 3BSOA 1N0UA 4P2XA 2AD9A 2NR0A 1CULB 4O44A 4CWBA 1CJUB 2RUGA 2NQPA 2GC8A 4CQ1A 2DRDA 1YJ7A 3G6ES 5D4PA 3BYPA 2OPPA 2ZOMA 5GVQA 1T0TV 3CO0P 3QT8A 4O4RA 3BR8A 2E29A 4X65J 1M5KC 5E0OA 2VFSA 4MYUA 1IKXA 4UY85 3BGFA 3M2RA 4K50A 4AYBD 3QT5A 5IQQA 4DX6A 1U45A 3ENAA 1NZAA 3I87A 2K1RA 4CI0B 2LDYA 3CPWR 1FESA 5A8KB 4FYXB 1X4HA 1FE4A 3EZUA 3BO2A 2HFVA 4HEA9 3J7YI 1SVDA 2VQFF 3FZ2A 3D0IE 2PA8D 4A46A 1NSAA 4F25A 2X1AA 1U1MA 1JLGB 1ELOA 4ILMA 4ZLNA 4DG1A 2DB1A 2YNGA 1NJWA 2HHTA 2L9WA 3JSRA 3JSMB 4Q8EA 2VBXA 1OSCA 3VAHA 4I69A 2IC3B 5K8NA 2Q66A 5JXSA 1BE4A 3F0NA 4DR5J 4Q43A 1S9FA 3EGVA 4TNOA 2N82B 3SSSA 3CCMS 1XNRJ 2BJEA 3CGIA 3M9OB 2N7YA 3I9ZA 3ZTPA 4DN9A 3AH6A 1D9FA 1QVFR 2QMUB 3CJ8A 2B4UA 2BMBA 3QNWB 1H98A 4IDKB 3TNVA 1JIHA 4RUHA 2UXCJ 2FJBB 2GIRA 5J1EA 3CJRA 1U1NA 3PHEA 1QUPA 4BWMA 2BX6A 1S9EA 4ZP8A 2V0NA 3BH7B 3T1HF 3J7ZT 2KJWA 3WZ0A 4ILRA 1HR0F 2XGQA 4MMOA 4URQU 3MXHP 3HJFA 1VC5A 3MURP 3H5SA 1TAQA 4JYAJ 3FCVA 5EX3A 3RB0A 2VG6B 2YNFB 5FLXY 1F0XA 4YEAA 3IA0A 4MYTA 2PSZA 2Z2YB 5E33A 1NSKL 1SL2A 5KFPA 4A8WA 4Y2KA 4HH0A 1RZMA 3PEHA 3RUBL 2ABYA 1NKEA 2UUAF 3BJYA 4X4PA 2OD4A 4N5SA 2BM0A 4I64A 1PG5B 3VZIA 1RT5A 4CT8A 3F73A 3BH6B 3QMQA 2MQOA 3IWXA 4LF1A 5HMWA 4ZMMA 2AWZA 2VC0A 1U49A 3HHLA 3AD7C 4OYOA 3EVWA 1D09B 3UR0A 3GV8B 2H5IB 2XYPB 1TUWA 2V67A 4DL3A 3DC2A 3ENWA 1YWXA 1S99A 4QW8A 4DV2F 3LP1B 5DDRC 2Z0GA 4RW9A 2DR6A 4O4GB 1U24A 1OY9A 2KH9A 5BYQA 1D3WA 1WWHA 3O3LA 1LQ9A 1FKOA 4UOHA 3WC2A 4F36A 2N4CA 5JVHQ 2B4OA 2ILZA 3OTEA 4AL6A 2JVOA 3BV8A 2J9DA 4RUAA 4PWUA 3GR0A 3DRXA 2IJFA 2ILYA 2HFUA 3PJWA 3PYEA 4F50A 2L08A 4CO1A 3EUNA 2J0WA 4WWSA 2M5YA 3KK1A 4PWDA 2ZZMA 3QIPA 3UCZP 3D0HE 1OPZA 4EI2A 3BBBA 2LMIA 3MM7B 1S6OA 2V4QA 2EVZA 3BREA 1Q7YT 4ZHRA 3QGGA 1XN9A 2EBGA 2AJ0A 4TYBA 5KFIA 4KKOA 2LDIA 2DNQA 1R8HA 1WC5A 3EGNA 4B02A 4DN0A 4ECVA 1ICEB 3MD3A 2EFGA 1X9WA 2QRRA 1S57A 3SCLE 1ZPVA 1TL7B 3DOKB 1VQLS 3AY0A 2GA7A 2PI5A 3GJTB 4FZVA 5J2NA 4GC7A 3BB5A 3T5KA 2UVVA 4UQGA 2CZ4A 3RAQA 4IQXA 1LW0B 4I68A 1R8PA 2KXNB 2JDJA 1VR6A 1NDPA 2XCPA 2U1AA 2RU9A 1HKAA 4RW8B 4KHPF 1HIYA 3OL8A 5G4DA 4YB7A 1PIEA 1Q78A 4AXIA 3T19A 1NU4A 3KLGB 3BR9A 1D1UA 5J2PB 4ZVGA 2V8DA 1ZM9A 3QQCD 2BRLA 1F9HA 1IKVB 4HI1A 5IXUA 2RUSA 4FYWB 4AT1B 1SPBP 2EFQA 2FTRA 3MF5A 5IQ6A 1FKAF 2PMZD 2GGPA 1TL1B 4X4VA 1RT7B 3D3BJ 4YY3J 2LYVA 2VG7B 3IWNC 4OYMA 4Z7CA 3CT9A 4MFBA 2B8QA 2Z56B 1NK0A 2CPYA 3H5YA 3KJFB 3NOCA 1LXNA 3N6LA 2PEHA 4WFXA 1S4FA 3ZO7A 4M5NA 3EICA 4WZMA 2QLXA 5IC4B 1W7WA 3S1TA 3DLKB 2GV1A 4Q2MA 4RR5A 4F4XA 3MTJA 2F1FA 3PHTA 1WKJA 4WXOA 5EN1A 3E3XA 2PMWA 3THTA 1EHWA 1ZM4A 4JI3J 4JV5J 2JSXA 5F8MA 2CADA 3TYTA 2MJUA 4CO0A 1TMMA 4BHQA 2K3KA 2PD1A 3R1HA 3PEJA 3TAMB 2DXFA 4IO1A 1IBMJ 2VH7A 5DZ6A 4G1QA 4JV0A 2UV8G 3HVRA 1SL0A 2HVEA 4YUDA 2V69A 1RAJA 3I5BA 2L48A 3MPVA 2W9AA 4P71A 1SB6A 1KFDA 5DS7A 2RE1A 4F7VA 1S0MA 2DIUA 3H5UA 3D68A 4LBPA 2QIFA 3VGVA 2QGFB 1VQMS 3M9MB 5KFKA 4V19J 2XYGB 3GFHA 5ETSA 5IM0B 2J8SA 3Q23A 4L76A 3ET6A 4B3OB 5ETOA 3G8TA 1KSPA 2HBRB 1NH8A 2HNYB 2FGCA 3M8RA 2DPJA 4NXMJ 1UJ5A 1HI0P 3Q22A 3JTPA 2B6AA 2HMIA 2BBEA 2B56A 5J2MB 3BDPA 3IS9A 1RTZA 5DZ7A 4XAKA 2N4DA 3TO8A 1HI1A 3Q2SC 4B3RF 3UO0A 4FXVA 4FF2A 4OZ1A 4TLQA 1AXQA 5CYMB 1SJ3P 3V6DB 1N5SA 4DV7F 3MI7X 1J5OA 1OS5A 5KFDA 2CG8A 1SV5A 4C3KA 2CJQA 1GXTA 3ZTRA 1CG2A 3PY8A 1KLMA 2GJIA 2F3JA 4DR1F 1PJ6A 4MIAA 3NNAA 2KHCA 1NM2A 3CXCR 3WX8A 3DYAA 3IG1B 4RBVA 5KG7A 3OXFA 3UD4P 2Y1IA 2QO3A 5A8WB 4J9RA 2DHAA 3N01A 2DPIA 2PEBA 5HN0A 4CNZA 4JI7F 1WG4A 2C2MB 1HQEA 2X3GA 2VQEJ 4AQYJ 1H7XA 3QO9A 1HBNB 2HK3A 4H4MA 3DRYA 2BKNA 2W8KA 1LWXA 2JWNA 2DBBA 1URRA 2XYHB 3PJ9A 5AE1A 1TAUA 2B3TB 2DHSA 3UE2A 4ZPCA 2X3DA 1NKBA 2OPRA 2VA2A 2DTJA 5EHHA 4M5HA 5I3UA 2CQIA 3QFHA 3KJVA 2HWHA 1V3RA 2XS2A 1BUXA 4OJHA 4BLGA 5L46A 4UUWA 2H5JB 3MM5A 1S72S 3DOLA 5ETKA 2I6WA 3KLEB 2H4WB 4WE1A 3PG9A 3NGSA 4PRFA 2BOAA 4IH7A 2QYGA 2PFDA 4B9VA 4TYAA 1UWBA 3QJJA 1RYRA 1UVLA 2I5JB 1S9GA 2BRKA 1H2TZ 5LM7E 2XO7A 5HLFA 4HACB 4DX7A 5L39A 3J81Y 5EUHA 5CYQA 1EQ0A 2X7IA 2IJRA 1N34F 1PYSB 4CRJA 1GK8A 3UCUP 2Q79A 2YPYA 1CLFA 5U47A 1HNVB 2ZHOA 4Y34A 1B70B 3IP0A 2FC9A 1F6TA 2VG5B 1PGZA 3P5TL 4Y3CA 2LQ8A 2DNGA 3CJ2A 4OJ3A 2CZ9A 4J9KA 1QVGR 3SIPB 4E0DA 4FKYA 2F9DA 1XEZA 1B7YB 1K73T 1HQ2A 2DH8A 1BQNB 4Q7AA 1RT2B 3NGTA 1ZS6A 3H8YA 3PX4A 2AX0A 2ZDPA 3B4MA 4DS4A 2GO9A 3ILLA 2CNNB 2YKNB 3PIOQ 1RA7A 3CO9A 1S48A 2AKWB 3RB3A 2YBVA 2SXLA 2MQLA 3M8PA 3TOQA 2ZWPA 1SJ1A 5D77A 2BVZA 1YBTA 2XSJB 3POTA 1GMUA 1FWPA 4CYUA 1FXLA 3BKTA 2C2EA 3Q8QB 3PYGA 3HHLC 3I0RB 1Q8BA 4N41A 3W65A 3ISNC 1SKUB 4ILLA 3LP2A 1N36F 2RQMA 4LBHA 5HROB 2FVQA 1F9FA 4NYZA 1NPKA 4DV6F 3FBFA 4R8UB 3SFUA 7FD1A 3D7SB 4B9NA 4I1TA 1HW9A 4DCPB 1R6YA 4DQPA 2Q1LA 5KFZA 3PO4A 2BABA 4QYZK 2XQCA 3R6LB 8RUCA 3Q2TC 3F44A 1LWFB 2FJVA 1KQGB 1DBDA 2A10A 2FJDB 1WOOA 2C2ZB 3M1VA 2E1PA 1S5ZA 3VQSA 1IJFB 3W2VB 2EKYA 2D3UA 3FCWA 1WC0A 3OL7A 4LFBF 3CDWA 4S0MA 3VALA 3NBPB 1S97A 3G82A 2XC9A 1N5YB 4BDPA 3M30A 1VK8A 1VMBA 3DNCA 4FF3A 2ZZTA 2MJNA 4CLFA 8AT1B 3WHIA 1VQOS 1C0UA 4R0EA 4R25A 4WZQA 3E2EA 3FZBA 4M5DB 3MEGB 2BKPA 3KTQA 2C2OB 3I4HX 1XWLA 4LJMA 3THVA 2AIRB 2CPDA 2QT7A 1X4FA 4OZNA 2OPPB 2XCAA 2XMKA 4OYAA 4YB6A 2RU3A 3NGDA 3EPIA 2CFXA 2XMTA 5RUBA 1IKXB 2ZBPA 2FVPA 4IUFA 2KT3A 2MZRA 1UTAA 3IO1A 1FXRA 2EC0A 3CJ3A 4I4BA 4RUBA 3HT3A 4JI0F 4FVMA 2K1RB 5KFTA 5L8RC 4CLTA 1RAIB 2GFFA 4FXDA 3B6BA 1YHQS 4RW4B 4FNHA 4UY8T 1T9UA 2E1AA 4K4XA 2D9PA 2H5EA 4B9LA 1U1PA 4LRDA 2CDRB 4X66J 4ITSA 1H6KX 2QYCA 2ZOFA 4K4ZA 3PKYA 3IFEA 4NRTA 4NA2A 3KK2B 1Y5LB 4HHJA 2W4PA 2AEFA 2AJFE 2MGZB 4EBEA 4ZPVR 1XMBA 3OSPA 2I9SA 1TVRA 2DH9A 1LW2A 1PBUA 3CWJA 3LGNA 3BPSP 4PR6A 2PC6A 7AT1B 4NX9A 2K3IA 4DUTA 3OTCA 5HQLA 4KFBA 4IR9A 4MTPA 4OJGA 2CJXB 4LF2A 2FLOA 2V2QA 1WKLA 4DR7F 3BQ0A 2AJ2A 3FRYA 1WC3A 1DLOB 2EK6A 3BO3A 1VHIA 2NSBA 4CLWA 5HQ8A 3TUZC 2GZOA 2KZZA 2HQDA 2OFGX 3L4BC 1SQGA 1Y7PA 3LPEA 4LF4F 1TV6B 1V5VA 4ANCA 1NPPA 2WSCC 1TUVA 4KC5A 1P9QC 2F4FA 1XNQF 4J91A 4A8XA 2ROEA 3R9LA 2GS8A 2QL7B 1PYOB 4K0KF 2HFNA 4FYDA 4F2SA 2DIVA 2H9ZA 1RT5B 4OZ0A 1X5SA 2OPQA 4JI8J 3FCHA 4B9TA 2YTCA 3H4DA 1FNMA 3HFZB 1FJEB 2FVCA 1OPIA 1RACB 2Y9HA 2KXHA 1TK8A 1JNZB 1YG0A 1VYAA 3MUMP 3QZ7A 2IHR1 3BF4A 1YZ7A 3BGOP 1X4CA 2CWKA 4X4NA 3CCSS 2KZMA 4HI2A 1P8GA 2FC8A 3GG0A 1QAJA 2HVIA 1S0OA 4Y2MA 3TVYA 3QPIA 2D3OR 4A8KA 5KT2A 2EXUA 3P49B 3D1QA 2LQBA 1NO8A 3TARA 3QAEA 1Q16B 2RJZA 4UZCA 3MEEB 3OFGA 3B8HA 1NB2A 2VD3A 1DARA 4C2MA 3TAPA 2NXNA 3S7RA 3EVOA 2LVWA 3TJAA 3L7UA 2DNNA 3KG4A 1FERA 1MMDA 2HZVA 2KDOA 2E5LF 3A1YG 4PWDB 1KP6A 2OJ3A 3KG0A 3DMJA 1GX6A 1I94J 3NMRA 3QYYA 3FMWA 4RW7A 3L7OA 3D6FB 2NZ4A 4L6V3 5D15A 3A8JA 1U2CA 3CJQA 1TELA 2J6UA 2CQ4A 4IR1A 1YBUA 2E7XA 4O3OA 2HS0A 2YY3A 4Y2CA 3QFWA 2MQQA 1J5EF 5B0DA 1TMJA 3EE3A 1Q8LA 3ZZYA 2KVIA 5GAHI 2FUG9 2ZKTA 5C42A 1RTHA 3EGZA 1P6TA 1KOOA 1X4AA 5KOXA 3VVTA 1WSVA 2P6SA 1F1BB 1TZ0A 2YWWA 1Y9OA 2M4MA 1H0HB 1NXIA 1N6QB 5E3QA 3JQMA 4OX6A 3MOZA 1L5UA 4NI2B 1Q7LB 3CD0A 5C5JA 4HKQA 5EX0A 3OR1A 1SKSA 2AJ1A 3QZ8A 1FJGF 3PR5B 1YTYA 4WP9A 5D0GA 4J5OA 4IFVB 2DITA 1KHWA 2BA9A 2J9DE 5IV4A 5GAEU 3VTIA 1TQLA 5GMKa 1ZA2B 4M1KA 3RRGA 3W2WA 2FHJD 4C11A 5HMXA 4GVBA 4ETZA 3G86A 4ER8A 4FNIA 2GQCA 3D54A 1HNZF 4MFBB 3BQ1A 3PV8A 3SFGA 1FD8A 2PI4A 3HP6A 1S49A 2AHOB 4C9DA 3TQEA 3GE9A 3HHEA 2AF6A 2OP5A 1S77D 4OHVA 3OT9A 4ED4A 1TKZA 3UDEA 3GWCA 1U26A 4KE5A 1X7VA 5LMUJ 2CPZA 4HVZA 1RBAA 1RWMB 2BM1A 1RTIA 3OR2A 4YDXA 2MKIA 4DU8A 2B43A 5KFSA 4F3OA 4KHPJ 2WK4A 3DM2A 2IPOB 3QRQA 3PRVA 2ZBCA 5CH7B 4DSJA 3NNHA 5ETLA 3CC7S 2GCFA 5L9XA 5HATA 2G1HA 3C2PA 4YR3A 4G1QB 2VPZB 3HSJA 1JJ4A 1LEOA 2WB1D 4XTTA 2XI2A 2UUBJ 2Y1LB 2CYYA 2DGVA 3Q8PB 3ZTQA 2AYBA 4NZ6A 2AP6A 1T9VA 2BJDA 1YQHA 3SSRA 2Y0BB 2A6OA 4K5RA 2W7OA 1QTMA 2VFUA 3NRBA 1RE1B 1KS2A 3ZNJ1 1JLCA 2IVYA 3LH2S 3PW5A 4WKRA 1ZM3A 3TAQA 2F8MA 2DD8S 2V94A 3GU0A 2NCKL 4YP3A 3J81j 4EYHB 3ET6B 3K89A 3IXQA 3TUJC 4KT0C 1Z1ZA 1LFWA 4P9SA 3MAQA 9ATCB 1JXVA 2QE5A 1KQKA 3V4IA 4ZP7A 2GQQA 3OTOJ 1GTEA 3AFGA 3LW5C 2ZC4A 1RA6A 3I4PA 3KK3A 3A8EA 3IS9B 4B3SJ 4RNOA 3GR1A 2CNOB 1X4BA 1ZZFA 3MPUB 5KG3A 5KG4A 3DFEA 2RSQA 3ITHB 5DETA 4X65F 3KHHA 3LO3A 2LFVA 1X8DA 2M88A 5DDQC 5IS2A 1W26A 3N28A 5CXTA 1J5OB 2CQ3A 3RBZA 1ZPWX 2DNHA 2QFIA 1SV5B 1F60B 1TKTA 3AQPA 2NXJA 3R27A 1S59A 1JJ2R 2DO0A 1B0PA 1SC1B 1REGX 3HFVA 4OZ3A 4DL0C 1FE0A 5A6WA 4DF8A 4OLOA 4OI2A 2F9JA 3GJSB 5F8HA 4LSLB 2FB0A 3H42A 2XNRA 4DPTA 3CJ4A 2A2CA 4NASA 3NP5A 3TRGA 1ZAWA 1PKUA 3B82A 4R5PA 5KFUA 4USVA 4WIIA 3C6TA 3AOAA 2KRRA 2BJ7A 2GIFA 2VPYB 2Y0SD 1CULA 2AGOA 3KUEA 4DR5F 4I56A 1CJUA 3D0GE 2J5AA 1E6YB 1HWLA 1XNRF 4YDDB 1RGVA 5I3UB 3CF5Q 3OPKA 3SCKE 2PFFB 2JOQA 3OJSA 4YN3B 4P7VA 4G3IA 2MSSA 3DOLB 2UXCF 1RTDB 1MU2B 3CCQS 4P10A 4WE1B 4KQZA 3EX7B 1X5TA 1FEEA 3I55S 2CVIA 3GFXA 4PQAA 5L38A 2EFVA 4JYAF 3D2WA 3ADAC 2CPXA 2D3ZA 5HLFB 1YK9A 3MCOA 2OEKA 4DPWA 5D0HA 2IMOA 4CTAB 2DNPA 3TA1A 3N9UC 2V9KA 1V9OA 4C48A 1JLGA 1BWEA 2XEXA 1UFWA 1WSRA 1RT1B 3C15A 3KLIA 1OQ6A 3OVBA 2G2YA 2IM1A 5K8OA 3JSMA 4ALZA 1C1BA 3AB2B 4ZKAA 4OJ1A 4JI4J 3VZHA 1F2GA 3W8PA 2GVZA 2OI2A 1FI4A 4BBYA 1HYSA 3LGMA 2PDAA 1XR6A 2E66A 5LXRA 2CJYB 2R8JA 1DJ0A 5HJXA 4ERDA 4IDKA 1WI8A 1WEZA 2X1FA 1L3KA 3AA9A 2GAGC 4E2FB 4C3LA 5L1IA 1QSYA 2JX2A 3M8PB 3CCLS 3HSDA 2NXCA 3POTB 2P2CB 2HVDA 3CDUA 4CYUB 3T6BA 2CPHA 1RISA 3P8BB 5JVGQ 3IM9A 1MMLA 1HMVA 4PG8A 4NLXA 2JH3A 2G0IA 1UA1A 4P73A 2AJQA 3LP2B 2XS7A 3M8SA 5CYJA 2RDDA 1H74A 2MXYA 3BGRA 4K4WA 2MTLA 2E1MC 4FBUA 1IBKJ 2BJ8A 3CTRA 3I0SB 4DL6A 2BEFA 1R8AA 2DGQA 2HZAA 4FPRA 1L3UA 2G0JA 3SBMA 1VK3A 3UI3A 2E9TA 3TVZA 1AW0A 3M1VB 2FLPA 1FHTA 4Y0FA 2NYIA 3GQCA 3UPFA 1Q95G 1AZSB 1R6VA 1GMWD 4NLWA 4B9MA 3LP1A 2K7KA 2CPJA 1IN0A 5M2RA 4PWWA 2CKWA 3M30B 1YJTA 4RZRA 3H7HB 4LQ9A 2OKQA 5HSPA 1XMOJ 2MQPA 2I38A 4FKXA 1T9XA 3M05A 2WTFA 1WUUA 3FUYA 5F0WA 2BJ1A 2GHWA 4C6AA 2ATCB 3LUYA 5SUHA 3TX0A 1J27A 2MZJA 2FZCB 4OI4A 2ZBIA 5E3CA 2DNKA 2QG9B 4LIWA 4I6WA 1YRXA 2DO4A 1HWUA 1C4AA 1UP1A 1O6XA 2J7UA 4WTYA 1NK6A 2HZCA 2AX1A 3NS6A 3M4XA 1W2BR 4DR3J 2CQCA 4LF8J 1M5OC 3ETOA 2A0FB 4ZLLA 1FT8A 1TUGB 3MM7A 1BHNA 3H2UB 5DG7A 4ZPTR 4FS2A 3CMES 4F02A 4DV1J 1RAGB 2KJVA 4ZJOA 2JC1A 4YY3F 4C3MA 3N6NA 3JTNA 4YB5A 2KG1A 1U2FA 5ITHA 3W8GA 3KUHA 2JZ5A 2AGQA 1TL7A 3OHAA 1X31C 3DOKA 1JNRB 4AUKA 1R0BG 2E1CA 3DI6A 4HL9A 2AGPA 3FK4A 1HHSA 3K57A 2GO8A 2XI3A 1LW0A 2RVJA 4F4WA 1GNKA 1K1SA 4J7CA 3OJUA 2FVSA 3RG6A 1ZYQA 4RW8A 4LR7A 1VI7A 3DRSA 1TVRB 2BDPA 4JI3F 4JV5F 3FDSA 3RW6A 3H2LA 3EZ5A 4NZ7A 2OELA 2ZFHA 2LQ5A 2C3YA 3BKFA 3LP0A 1UEVA 3GFYA 3KLGA 3DDKA 4A8YA 1IBMF 5J2PA 5DGAA 2WSFC 2POKA 4WU3A 1EQMA 2XSFA 2JRSA 2BJ9A 2UXDJ 2HQ3A 1MROA 1VJQA 2RAQA 8ATCB 4LSNB 1RABB 1VFJA 2F63A 1MW7A 2VG7A 2VU5A 4ID8A 4WTOB 1RCXB 2FQQB 2RB7A 2V4RA 2R2SA 1YJNS 2LKZA 3GILA 4NLYA 3RRHA 2R7VA 2RRBA 3MPYA 1FDNA 5FD1A 1FK9A 1VQ8S 4DCOB 1VQ6S 3DLHA 4HLBA 3G6XA 1NKCA 3ZZRA 2Z2MA 2IYIA 3MAAA 2OPQB 2XWXA 1UZHA 1Y11A 4YHHJ 3DLKA 3TZXA 4FN5A 2QTWA 5L1KA 1MLAA 4M95A 2DR5A 5KFFA 4NXMF 3ZXWA 1RWUA 4PG4A 3UD3P 2NXEA 1HD1A 1MN7A 1G6BA 2GX8A 4OZJA 1Q0NA 4HTJA 3EJMA 3MMJA 4PXCA 2OTLS 5DLGA 4K4VA 1FRJA 4DR7J 1GT8A 2AYGA 1PC5A 4Q0BB 1IXKA 4LR8A 1ROFA 5HP1A 1NH7A 4ECXA 1APSA 1R8CA 4V1Ak 2ZDOA 5D0EA 4QIFA 4RWXA 2BE2B 3QRPA 4MK9A 3UR3C 3IRWP 2M8DB 5ETQA 2QSWA 3CCWA 2FHMA 3UVJA 4LT6A 4IYQA 2NPFA 1FWKA 4JP8A 4GMKA 5B0FA 2I1RA 4PYDA 3A12A 3R5BA 3UQSA 3G96A 2HHXA 1R43A 4XO0A 1XR7A 3E51A 3P96A 3VAFA 1VRUB 5IM0A 2DCLA 2FHKA 1NPRA 3HF5A 4LRCA 2VQEF 4AQYF 2CQPA 4EMDA 4WJBA 4X4RA 1Q4RA 3NCRA 2WVCA 1KC8T 2H3EB 4O0NA 1KOHA 2M2BA 1PCAA 5J2MA 1N5QA 1EKSA 3AOCA 1VDHA 2VKZG 2HBZB 4ELVA 1Q8IA 1V6HA 1BQXA 5C42B 1RTHB 4KGMA 2B9WA 3CCZA 4WFAQ 5K5MA 1NCLA 2MPUA 3MCNA 5CYMA 2UP1A 1MWQA 4FS1A 3V6DA 1SH0A 1HD0A 3SQOP 2R7WA 2B0GA 1NNDA 1R3NA 5E7OB 3CDEA 5B0BA 1S7IA 4USTA 5F8NA 3VGTA 4ZVHA 2CUYA 4ZJLA 3IG1A 2GMJA 1UCNA 5C25A 2Y3YA 3CC2S 4X84A 2HBYB 2KTQA 5A8WA 3KG1A 1BWVA 2JLGA 4DLEA 1P1TA 3BO4A 2WBMA 3NLCA 2XY7A 2FD2A 2ZUGA 4ZCIA 2NSCA 1KTQA 3D6TB 1GEHA 2H1YA 2HNZB 1NK7A 4C11B 2HQGA 3HHLD 2GMLA 4GVBB 5KFWA 2VV5A 4UOGA 2DXEA 2W4DA 2QC3A 3AJDA 5DDPC 2DK2A 1YGYA 3DGPA 3D9BA 2DR8A 2IY5B 4U6PA 5ETTA 5GAGU 4L3KA 3LALA 5J2QA 4NLUA 1FKPB 2OIHA 3QT6A 4U7UK 2UXBJ 1S76D 1TKZB 3CJKA 1VQPS 3AT1B 2WONB 2QZ8A 4U67Q 3T5HA 3KLEA 5M2PA 2OMOA 1RTIB 1UKUA 2DNOA 2ZD1B 3OR2B 4C8YA 3S6EA 2DY1A 3FEXB 3DM2B 3C14A 4O3RA 3M8YA 2I5JA 2CVEA 5J1PA 2DNYA 1WTBA 4DV3J 4EZ9A 1ZA1B 1N8RT 1KQSR 5F0UA 1RLCL 2YX1A 3ULHA 1VLYA 1T94A 3ELHA 5LJ5Y 3FQLA 4URSA 3ZTSA 3I5AA 2RQ4A 2J8AA 2M52A 3PYDA 2EKNA 1VISA 1FFSB 2VG5A 2M8HA 2CPFA 3W5XA 3GP9A 5B08A 5KT5A 4O3NA 1L3VA 1BGXT 6AT1B 3O6QA 3GTYX 4A8MP 2K7JA 2XS5A 1RT2A 3KUGA 3D66A 2AMCB 1JLCB 3P3DA 3TA0A 2BW7A 2HQCA 1YRUA 3W7BA 4B3TJ 3NOGA 2XY6A 4IOCQ 2WOMA 1U7LA 3JYTA 3ISZA 2HLUA 3FJ2A 2HHHJ 1IWAA 2C42A 2ALYB 3J80U 2XSJA 1YDLA 1P1LA 2IAJA 4KH1B 3V4IB 1VGYA 4J9LA 3DDNA 1HBOA 2FYXA 2HIQA 4OV6A 3LPYA 1U6FA 3KK3B 3I0RA 1X0FA 1DURA 1M5SA 3BDEA 1WG1A 5HROA 2E5IA 2R7RA 3PM9A 1RWPB 2UZAA 3DLLQ 2YPZA 1CJVB 3H20A 2YQ3A 2FLNA 4NOHA 3EYZA 4DWIA 2QL5B 4HTIA 4GVLA 3N6MA 1GXLA 2XULA 3HJVA 4ED6A 2ZKUA 2QL9B 3HLUA 3E8OA 4EO6A 2OEMA 3RW7A 2R8IA 4EEYA 2X1BA 4ZCMA 3Q8YA 2ZWOA 3EXCX 1FRKA 2HHPA 1WOSA 4LF7J 2MKSA 5IWAJ 3FKBA 5LJ3Y 3R7SB 1KVIA 3B54A 1XTZA 1FRXA 3MMBB 1NBEB 1N5YA 1IBLJ 1LWEB 4X66F 4ATNA 1SQFA 3C19A 1SKWA 4ICLB 3VVUA 4R5PB 3CDAA 4DUZJ 3T5JA 1KLNA 1B0TA 1HWIA 4CZCA 3C6TB 4WFNQ 3GIIA 3BGLA 3NAIA 4FXWA 4KAIA 3M8ZA 4M5DA 3MEGA 3L9ZA 5DG9A 1UETA 4CH1A 3TUPA 4H4KA 2JEGA 3HMJG 2JFKA 2FIUA 2DKOB 5KFQA 1U8SA 4U8YA 1HNIA 2IRXA 3A8KA 2PIIA 2IIHA 3ZZ0A 3QWPA 1WEXA 3KWMA 1MMNA 4U7CA 3K5LA 4DL7A 3ZZOA 3R5AA 2R7SA 2RRNA 3TW0A 4DUYF 2BQUA 3SCIE 2YNIB 4IRDA 4NCAA 3CD6S 4YOEA 3IBCB 2KT2A 4IO9Q 5D3GB 3MHYA 3NCQA 3TQ1A 1HBUB 2DT9A 4RW4A 4J9NA 3KLHA 4F2RA 2H48B 4ELUA 4I2PA 2OUGA 4LRFA 4WK3A 1OY6A 2C2RA 3EDRB 1JXLA 4EO8A 4Z2XA 3C15B 3KLIB 3TZYA 4RU9A 3IGVA 1C2PA 3QJLA 2DNLA 2DNZA 1T3NA 1C1BB 3KK2A 1ITPA 2IFXA 1RHQB 5F41A 4RBUA 4JI8F 1U4BA 3VAIA 1CC7A 1U0HA 3EM1A 1RB0A 2MGZA 3WIVA 1I6JA 2F7VA 4X64J 2HEKA 2MDAA 2GVZB 4DSEA 4DSFA 3D3CJ 2ASLA 2OSQA 2UVRA 1HYSB 3HKWA 3BN7A 5F8LA 1HPZB 1N48A 4KGZB 1WC1A 2ZEJA 3L3CA 2R2TA 5DJBA 3KHGA 2E5HA 4GC6A 3OVAA 1RADB 3KFWX 3RBDA 4DQQA 2R2UA 1RWOB 3SV4A 2MY8A 4B08A 1VCTA 2WVEA 5EWFA 1NSPA 1DLOA 2XTJP 3V81B 2V8HA 5B0GA 3W62A 1YJWS 5DQGA 1HMVB 2D9OA 2ZH5A 4USJC 2LU1A 1K1QA 2OHDA 2M3DA 3GYGA 4PZVA 1H7WA 5E2QA 1GMVA 1XIQA 1TV6A 4BCAA 3BGRB 3EDQB 3RR8A 2EFNA 2CNKB 1K44A 2WHOA 2HLTA 2HBQB 4Q45A 1I94F 3CCTA 2LA6A 3D5MA 4NLGA 1EP4B 2G1DA 2HFOA 2XMMA 1SJ4P 2JLEA 1KVJA 2V63A 3PVXA 2HURA 3CCVS 3M6XA 4OHWA 1Q81T 4K4TA 4Y65A 5C2CA 3RBEA 3DKDA 4OYZA 2M7SA 1KFSA 4DV0J 4KJIA 2VOPA 1UWAA 1FX2A 1I5OB 4NA3A 4ENOA 4RNNA 3MEEA 1FDAA 4HYKA 1S6PA 4TKTA 1YBAA 2D74B 4DPXA 2A1BA 3DXSX 4OMFG 3P6YC 3GJRB 3BBFA 2RT3A 2KKHA 4YS2A 1FNOA 1JX4A 1RDRA 1SH2A 2BXJA 5KT4A 4MJKA 2DH7A 1SL1A 4DR6J 2I0XA 4P2FA 2CJAA 1CEZA 1IKWA 1NDKA 1FRIA 4CO4A 1JLFA 1H73A 3A8IA 3K0JA 2KL8A 2MMYA 4USHA 5KFBA 3I82A 3LGHA 4LBIA 3EWGA 2RHSB 3R8YA 1WDDA 1S1VB 5BR8J 3CJ0A 3R97A 2DVIA 1A6LA 1R8BA 1RKJA 2VODA 5I4MA 3PNIA 2KHDA 3W5YA 3AB4B 3NY0A 2R7OA 3NL0A 3DI6B 4N77A 1IWGA 4DSIA 5KT7A 5LMUF 3MM9B 3FGVA 4XK8C 4DS5A 2HFZA 1RBOB 1N6QA 1EIYB 3QBCA 4GKJJ 4P6QA 4NI2A 2EWHA 4C0BA 4EZ6A 4O23A 1RT6A 3DRSB 1RAFB 2QFJA 1QJHA 1ZETA 3M6VA 4RNFA 3UN5A 4CH0S 2R3VA 3FFIB 4IH5A 4J9VA 2OEJA 4WCEQ 1TL4A 1AUSL 5I3QA 3CCRS 1V3ZA 3LP0B 4IFVA 3MGJA 3H40A 4ZVOB 5D4LA 3CJ5A 2E5JA 4DL2A 4OX9J 2GHPA 1HNXJ 1C1CA 1ZOTA 2VKRA 2AW0A 2G9OA 2RILA 1MROB 1T8EA 1FJ7A 2UUBF 2KXFA 2JFDA 3TX8A 4AD6A 2LXIA 2XMUA 4QR0A 3US5A 1LKZA 1WKKA 4MK7A 1Y5NB 3QGPA 1VQNS 2A3JA 1F9EB 2YKPA 3MCMA 2XZTB 3PW2A 1XJWB 2DGUA 2VDHA 4N8NA 1RHJB 4ZS6A 2ZE2B 2WW8A 1SC4B 1FK9B 1TTHB 2OPSB 4F04B 4KGXB 2H4YB 5LXYA 4DPUA 5HVGA 4RNMA 4LFAJ 2HKEA 3MAAB 1AYEA 3IBFB 3R5JB 3AJ2A 2RDIA 5CQGA 4F0KA 3KMQA 2XB2D 3CCES 1TFYA 1Z2ZA 2NYHA 1S7HA 3GJQB 3PFEA 1QM9A 3UCGA 3OTOF 3DHXA 1YLXA 3VF0B 1WELA 5F8GA 2J0XA 4HH1A 1G3OA 3T3FA 4B3SF 5IT9U 1JLEB 4DV4J 1D9DA 5A6PA 3RYLA 5KFVA 1U2RA 5CD4H 1X5PA 2LP4A 2QA1A 2WB4A 4W92B 4CP5A 5KG5A 2BOPA 2KRBA 4MKVA 2XG8A 4AFFA 1JXEA 3IRXA 3NEKA 3OD2A 5HP1B 5GAEI 5KFXA 1VS3A 2O01C 5I42A 2IRUA 4QZVB 2OGUA 1HBMA 4DI6A 2ZH8A 2H65B 5FDLB 1X4EA 1K0TA 3VGSA 3BKUA 2HQIA 1WC4A 3JAMU 3UVJB 5ETPA 2MZ1A 1NK4A 1NB7A 3CDBA 3MMAB 4NLDA 1T03A 1QSSA 1D9AA 4K8RA 1S1XA 4J9PA 1VLOA 4HHUA 1FVQA 2IBOA 4ZLJA 5F3ZA 3FSYA 4WPAA 1LV5A 3QLHA 2WVDA 4WBFA 4I2QB 4CLLA 2MSTA 2V4JA 3G8QA 3VR1A 3FSIA 5HMYA 3HD1A 3RB4A 4LMZA 3W9HA 1CVJA 4NYOA 3ETMA 3K17A 1RAHB 3W1YC 1S79A 4DR2J 4L75A 1VHFA 2B4PA 2CQDA 2MLXA 3UNGC 4L73A 3ITHA 4O3QA 5IV3A 4X4OA 4M5LA 4NLSA 3TEHB 2XMVA 4JB8B 1S0NA 2KO1A 1N32J 1T11A 2DISA 2ZBQA 3MR3A 4DX5A 2L9NA 4YFUA 1B64A 2YNHB 2CRLA 4LREA 2KFYA 4B17A 1IKYA 5C25B 2XMAA 1RI7A 3NXZA 3G8SA 5JMNA 1N54B 4DFJA 7FDRA 3RRKA 4UF4A 4LSLA 2KU7A 1A9NB 2GJFA 4I6AA 3O1LA 4GO7X 2VBZA 1RJJA 4ZVUB 1HHQA 2FJAB 3DGPB 5IT9Y 1O8BA 1VJWA 4ZVPB 1XBWA 4ED3A 2B7CB 3H90A 4JI4F 1E6YA 3F41A 3P4UB 2GIQA 1OYEA 4WK1A 1KN6A 3JQJA 4NMLA 5J2QB 4A8SA 3OBIA 5A8RA 4HDGA 2EK1A 3CJKB 2PA3A 5KFEA 1RTDA 1MU2A 5AXKA 2YKMA 4WXWA 2ZZNA 5BYSA 1O5JA 5KG1A 3G9CA 4PYAA 3U7JA 2J76E 2O66A 3TUIC 4DU7A 3MAHA 3AA8A 4H54A 3CD7A 5DQIA 3C14B 5ETNA 2AJ4A 3NWRA 3D6HB 4UOCA 3LAKA 4DHVA 2NUUG 2CJBA 2HRUA 3IR6B 5LL6d 3DN9A 4X62J 5K9FA 4GRSA 3CJTA 4CTAA 5A76A 4HR2A 4C97A 4ZA1A 4YQWA 4LF6J 2LXUA 1Y3JA 5IC6B 4M5KA 5ETMA 3ZTOA 3AD8C 4IG3A 1IBKF 1RT1A 4G6VB 5J1NA 1UVIA 2DR7A 3F56A 4TQSA 1ZAXA 5D0RA 3PKMA 2DEIA 2VA3A 4H4OA 3NAHA 4W4MA 4M5GA 3M8WA 4ZP9A 3OQ2A 3OW2R 1U02A 1BQMB 1JLAB 1TP7A 3M7VA 1URNA 2LECA 2GW8A 4DFMA 1N33J 3HK2A 2WOMB 3OXLA 3TWZA 1MSWD 4ZIWA 4IFYB 3JYTB 4F0HA 3VHQA 3W60A 1UVJA 4OHXA 4UQTA 1XMOF 2LQJA 2IAJB 4ECYA 1TKXB 1T7PA 2FVRA 4NEYA 3MR6A 1PILA 3DRRA 1HBOB 2ROGA 1QDUB 4WP3A 1WTFA 4IRCA 1XR5A 4K2XA 3CB4A 4QWAA 1BD6A 4ZP6A 1KVKA 2N7CA 4MKYA 3TR5A 1WF2A 3T9NA 1HWKA 1FDBA 4ECWA 3I0SA 4DR3F 3T9ZA 3MEDA 4LF8F 1LFPA 3IAS9 1KONA 2D3O1 2DNRA 3AAWB 1CQMA 2DHGA 3PCOB 4OYIA 5HVFA 2MY7A 4ZK7M 3H59A 2VDIA 1WNEA 4YR0A 1HFEL 4I7FB 1UA0A 1UJ6A 4DV1F 2W4CA 3C66A 4KPYA 2ZH6A 1UEKA 1O51A 1AZSA 2RNEA 4NMXA 1RBLA 5CHCB 5KG6A 1U1RA 3NMAA 2E9ZA 1RYSA 5H9FJ 3HVWA 2IA6A 3A13A 3OL9A 3PDNA 1S6QB 1SC6A 3HVTA 2NUHA 3V6KA 2RRAA 5LSOA 3OLAA 3HVAA 3V2UC 2EW9A 3FBBA 4JI6J 2KM8B 2ZHAA 1T05B 1WHXA 1YZ6A 4ED5A 2WW4A 1M5HA 2AZ3A 3Q89A 2C2NA 2UU9J 2ZH1A 2N3OA 1XC9A 1HNIB 4MKAA 4F4ZA 5H9EJ 4BC9A 3W61A 1RHKB 5FLXU 3HI9A 3MR7A 1VOMA 3SZ2A 2HPUA 2UXDF 2B5JA 3NCPA 4QBUA 2MKHA 4CO2A 4G1PA 4F4KA 2J0QD 2CXEA 4KO0A 5MAOA 1VQ7S 1JWWA 2BE7D 1AB8A 3LQVA 1B4SA 3KLHB 4DV5J 4I2PB 4ZITA 3PX0A 2AV5A 2Z57B 1FD2A 1VQSA 5THWA 2PMHA 4P52A 1GFWB 1B99A 2HGLA 3N0VA 4C98A 3QT7A 2VFTA 3N5BA 4USWA 1UW4A 2IMWP 2BE9B 1MG7A 2MLZA 2ZH4A 5A0YB 1U0HB 4YHHF 2WCXA 3V6HA 3GONA 1FVSA 4PKDB 1D8ZA 2OMLA 2P5VA 3U1MA 2R42A 3BGUA 2Y1JA 1R0CB 4JI1J 4ZN3A 5HVHA 2B51A 1FRLA 4TVAB 2YKOA 2PN6A 4WKYA 2HS4A 2ZVSA 2UVUA 3VV2B 3G71S 1S6UA 3K8WA 1B7FA 1H3DA 1CS4B 4KGVB 3KDOA 3NGKA 5EWGA 4DUYJ 1Q53A 3ZC4A 1N0VC 3K2YA 3GB0A 2IM2A 3GFZA 2KT5A 5ETRA 3KKFA 3PW0A 4LSNA 4GKKJ 5DM6Q 4OQJA 2VC1A 3DXBA 2C22A 4EBDA 2UUCJ 3HM9A 3M2VA 2CA9A 2RD5C 1AFIA 3OFFA 4ZPAA 4ZCKA 3OFEA 2V50A 1OIAA 1DTTB 2MKCA 4M63A 1F3VA 3OFHA 4TXSA 2KFZA 2E1RA 4DOZA 3M32A 1HWJA 4NXNJ 2HG4A 1IBCB 2ZH9A 3MMCA 1UVNA 1TU0B 3FMBA 2AU0A 5KFCA 3IBWA 4NRUA 3MECA 2HK2A 1JLBB 4C8OA 4PEOA 4USIA 2W7AA 1NHKL 3KLFB 2WBRA 3HHDA 4Q0BA 3R5GA 1YKWA 4J90A 2R7UA 1S6PB 4LRBA 2ERRA 3T41A 3GSDA 4ZPBA 1RAEB 3IR5B 2BE2A 4OL8A 2CIMA 2G2ZA 4OLPA 4JI5J 4HT5A 1CJTB 2RS8A 4PUOA 3EVMA 1DHMA 2JEIA 1IKWB 1U6BA 4ED0A 3DLEB 3JSBA 4P2SA 1TL3B 1G4CA 3SQGB 2R2RA 4RBTA 1VRUA 1R7IA 5K8MA 1JLFB 2IRYA 4C8MA 4RKUC 4ZIVA 4OYXA 3H98A 4K4YA 4Z37A 5EDWA 4PXBA 2HYIB 4NYPA 4C8KA 4QOTA 2COLA 1TFWA 3GYNA 4DX8H 1RHMB 3CULA 3OTBA 3D1HA 3TI0A 4OZLA 3K5OA 2BQ3A 2LEBA 4QIVA 1RTJA 2W25A 5E41A 4J9MA 2UXBF 2HWIA 5A2QU 1ZTTA 1S0VA 2BANB 2L9DA 2UVWA 1N88A 2XHWA 1C0TB 2ZNYA 2ASYA 1RU1A 1EETA 1ULRA 4NLQA 2VPXB 3M8QA 3UDVA 4NZ0A 5LMNJ 1NDCA 4P72A 1RT6B 4KIAA 1KQFB 4CLPA 4N56A 4ZPDA 4CLUA 3HCXA 2DRBA 4DV3F 4MKBA 4LFCJ 1H2VZ 1Y00A 4OZ5A 1QTNB 2QX0A 1IM6A 4ZJQA 4ED1A 4IOAQ 3DOMB 2JC0A 2RKIA 3TJ9A 4JUZA 1Q86T 1RQ0A 4JI2J 4C8LA 2FJWA 4PQUA 1YJ9S 4QQBA 1C1CB 4I67A 4Z7YA 1SUQB 3DU6A 1S1TA 2HNZA 4CDIA 3Q8VA 4F4YA 5D78A 2R8HA 1Q79A 3C8YA 3N5FA 2A2DA 2R7QA 2DGXA 1SBRA 4MT1A 3QWUA 2EI5A 2ASDA 2XZDB 1UPMB 4MK8A 3PR4A 2I8EA 1G7CB 4NWBA 4OFZA 1FKPA 4LVNP 4RW6B 5LOQA 1U25A 4B3TF 5DDOC 4PPDA 1PJ7A 4ECRA 2HHQA 2WONA 1VBZA 4I0WA 4UZBA 3FC9A 4N47A 3JB9k 1RT4A 2HHHF 2ZD1A 2KYXA 2EFPA 3OUYB 2MZTA 2VL1A 1V5IB 5BJRA 4DR4J 5JJBA 4ZOSA 1VBXA 3MPWA 3W9JA 1HNWJ 3T5LA 2ZJQQ 1NK8A 3R6GB 4WIQA 3K5NA 3VAGA 2BUNA 2KG0A 4DQRA 2ZM6J 2HGMA 4O3PA 1HQUA 3ICLA 2DNMA 3FBCA 3G2XA 3IWLA 3DCAA 2OO4A 3IRXB 3MFIA 3IM8A 5KG2A 5I42B 3I9V9 3HSZA 1Q5VA 1HBMB 1RUSA 5F3TA 4UUXA 1FNXH 2V8VA 1BY9A 1X4DA 2FHOB 2BQRA 5K14A 1NMEB 3QSYB 4G1IA 3MM8B 2O1PA 5GAGI 2CQ2A 1EAYC 2IVFB 3UW1A 5A2QY 3WQPA 1R0AB 4OYWA 2JL9A 4LF7F 5IWAF 4Y28C 1T03B 2F8HA 4GO5X 1S1XB 3BSNA 4Q5VA 3GIKA 3HSGA 4OYBA 5AJ3J 3CIZA 1IBLF 2R8GA 4ANDA 4Q44A 3R2DJ 4ED8A 3FEYB 3QLHB 4DUZF 2MQNA 2KVQE 1PYTA 4ID5A 1JB0C 2DXDA 2V4JB 4USMA 3DRPA 3T1YJ 2GHVC 3ZFVA 2V8GA 2C2DA 4U8VA 1UEUA 1AT1B 2DRAA 1XMQJ 4X2BA 2B7BB 2ZJPQ 4FF1A 4MIWA 1X4GA 2ZBRA 2PT0A 4DMZA 4HHHA 2KFNA 1WD6A 3LF0A 1RWKB 1FFWB 5KT3A 3AODA 1UW9A 2VHGA 4Y00A 1BMQB 1CJVA 2J7WA 3R3TA 1RWXB 2CG4A 5KTQA 1SQEA 3C6UA 4P75A 2OH2A 2LLZA 2GQ2A 3SCJE 1DY3A 1ZAVA 3J81U 2F65A 1QAIA 4IRKA 2QV6A 1FJCA 3EPGA 3ZZTA 2VJUA 1H38A 1U47A 3MEKA 1U48A 1JMTA 5DM7Q 2PGCA 1WHWA 1F5AA 1U1QA 2J6SA 4U95A 1Y4ZB 4WF9Q 2IM3A 1U1LA 1YRTA 2QN6B 4IG0B 2D1CA 1IKYB 1UZDA 2W9CA 1DTQB 3AHPA 4MIBA 5T7LA 4X4TA 4FVCA 2OSRA 3DLGA 3OSNA 3MMBA 1LWEA 1IQZA 4ICLA 2F4VJ 3IR7B 4FYYB 3Q8RB 1WHYA 1X9SA 2HHWA 4I6YA 1T95A 2N3LA 2W9BA 2E5GA 1PBAA 4X64F 1QSLA 3MM6B 4AL5A 1I51B 3SDEB 4NEZA 4L3NA 2WAQD 3LTOA 2W1BA 4CNYA 3CUNA 5A8RB 3LAMA 1KEKA 1EARA 3RB6A 2CQGA 3W3SA 2W2NP 3ZNUA 4KHRA 5SZTA 3PJXA 4ECQA 2GVDA 2YKMB 4QWBA 2OLWA 4O0IA 3UFCX 1VC0A 2YNIA 3VAJA 2YVSA 4ZVEA 1IQTA 3PRDA 3TANA 4PABA 5D3GA 2KI2A 2RMLA 1HBUA 1FWLA 3GIMA 1CBKA 2CQBA 3QIDA 3K8VA 4OIXA 3T6JA 4IQMA 3HT0A 4ZVTB 1HARA 2RF2B 4IG3B 1EZZB 1JKHA 1GTHA 1YI2S 2KN4A 1GH8A 4PG5A 3CSKA 5AXLA 2CZVC 4LSZB 1Q1KA 2DHXA 2Y8WA 4B3MJ 3G87A 4ECZA 4H4OB 4A8QA 3PIPQ 5KFNA 2NS1B 4N7TA 2ACYA 3JS9A 2BR0A 2D7SA 1N56A 1WEYA 1RWWB 1CC8A 5DQHA 1HPZA 1M5PC 2RHQB 4EGLA 3BPDA 2ALZA 1NJIT 1Q8KA 5GADU 1RWNB 3I5CA 3UD5A 4CM2A 4DV0F 4DSKA 4BWJA 2M0GB 2Z2ZA 3PFOA 2EPIA 2HHUA 5L1JA 3V81A 2Z58B 3G6VA 3DRRB 4M5IA 3FNNA 4RUCA 2Z30B 2QLFB 4A8FA 1RT3A 3CIMA 4QCLA 3Q8SB 5C2GA 3U1LA 3CCJS 3L7PA 4KGKA 4DR6F 4QW9A 6FD1A 3MEDB 3E01B 3BSCA 3GV7B 1WG5A 2FY1A 2J6TA 1CJKA 3MUVP 4LF9J 3TJ8A 1QAXA 4BC7A 4N76A 1EP4A 1W2IA 1RAAB 2V8PA 4DFKA 5B0AA 1PAEX 1Y0HA 3TEGA 5BR8F 3KLVA 3C3LA 1YIJS 4Y6IA 2L41A 2P9CA 2C3MA 3R7NB 4KTQA 2DCUB 2XBPA 4RLEA 4EU0A 2V2ZA 1LNQA 4KPCA 2CQ1A 2DYAA 4DQIA 5AE2A 2IDLA 3HVTB 1HL6A 1REVB 2J7KA 1K0VA 3L09A 3LA0A 1F2HA 5GMEA 1UVMA 4GKJF 5H9FK 2MEWA 1Q82T 5KFHA 2VB6A 2ADBA 4ED2A 5DGBA 1ZM2A 3I96A 3HX9A 3IAM9 3J7YU 2LEAA 2O3DA 4QPTA 1EB0A 3WDOA 2V6AA 5HBMB 4OX9F 1HNXF 1U6ZA 1QAYA 1E6VA 4LF5F 2AEJA 3VAKA 5H9EK 3BEGB 2B5JB 2FGOA 4C0OC 1TR0A 1NAQA 3HD2A 2J9EA 3NNCA 4KV8B 5CD4A 4FP9A 3L95X 1S1VA 1TK0A 1HLWA 3R5CA 4KO0B 4KR0B 5F8JA 2M70A 6FDRA 2MKKA 4C7QA 2HS3A 2FZKB 3CW2C 4O44B 3IC1A 5EWEA 4J9SA 1SH3A 3MPDA 5KFRA 1XERA 5M2UA 1ZZNA 4Y2IA 1TKDA 2YX7A 2NREA 1DRZA 1Z2LA 3OLBA 2CQHA 1SC3B 2HW3A 2KB2A 4LFAF 1SIZA 4HDHA 5D4OA 3MM9A 3BZQA 4QYRA 4OYPA 5KFMA 3M6WA 1RU2A 2MYFA 3M2RB 2YH1A 2VBYA 2AT1B 5BYRA 1LWCA 2Q6BA 2HWTA 3Q86A 5CZVA 2W01A 3OXGA 3FFIA 1NK5A 4K7QA 2YH0A 4F67A 2K06A 4E98A 2CAJA 4DV4F 1JK9B 2OFHX 1MN9A 2CJ9A 2MHNA 3AQOA 3NGUA 1UFKA 3BYRA 1F5CA 1S4EA 4DG1B 3FSXA 2ZHBA 2YNGB 4ETXA 1U8WA 3JSYA 3TZZA 2QMXA 2UUTA 3M2VB 1LXJA 3PYFA 4A8OA 3QGHA 3HULA 3MD1A 4OX7A 2ZE2A 3S01A 4EFAC 2OPSA 1PAUB 2IA0A 3GCWP 1DAXA 4DDFA 3P5BP 2V9WA 4DL5A 3ENVA 3M32B 5CCLA 5J1EB 4ED7A 3MR2A 2XWYA 1S10A 1S9EB 1DQAA 3H5XA 3MMCB 4NL5A 1AFJA 3MCSA 4CIOA 4USKA 4TY8A 1G2EA 4ANEA 4PG7A 1K9MT 3M2UA 2YWEA 2ZC3A 2VOOA 2MZQA 2B9EA 2W24A 3H25A 1RSCA 3I6PA 4DPOA 3MECB 4U7UD 1JLEA 4F4AA 4M94A 4DR2F
chains in the Genus database with same CATH topology
4ILMA 3C6TA 3M9NB 3RB4A 4DSLA 4LMZA 4DG1A 2KRRA 1ZTWA 2DB1A 1CVJA 4NYOA 1UVKA 3OVSA 2YNGA 2VPYB 2Y0SD 1NJWA 2AGOA 2HHTA 2L9WA 3JSRA 1A7GE 1S79A 4I56A 4DR5F 3D0GE 3JSMB 4LVOP 4NLVA 2J5AA 4Q8EA 2VBXA 2QA4S 1OSCA 1VHFA 1E6YB 2B4PA 1HWLA 3VAHA 4I69A 2CQDA 2IC3B 3VQTA 5K8NA 1XNRF 3KOAA 1N32F 3UNGC 2Q66A 5JXSA 4YDDB 1NHUA 1UL3A 2Y1RI 1RGVA 3ITHA 1S9FA 4O3QA 5I3UB 4Q43A 3CF5Q 3OPKA 4X4OA 4LUBA 5FDLA 4TNOA 4NLSA 3SCKE 2N82B 2PFFB 2XMVA 3SSSA 2JOQA 3FRZA 3CCMS 3HKZD 2MHEA 3OJSA 1S0NA 2KO1A 3MFHA 1UJ4A 4P7VA 4RWWA 5B09A 4G3IA 2BJEA 3CGIA 2DISA 4W90B 3M9OB 3MR3A 2N7YA 2MSSA 3DOLB 3I9ZA 2UXCF 5KG0A 3HHLB 4DN9A 3AH6A 1D9FA 1RKIA 1RTDB 1MU2B 1QVFR 2L9NA 4YFUA 3CCQS 1B64A 2B4UA 4PUOB 2YNHB 4IDKB 1H98A 3TNVA 1RK8A 4WE1B 1JIHA 2GNKA 2CRLA 4KQZA 4RUHA 4XPEA 2FJBB 3EX7B 1X5TA 3MMAA 2GIRA 1IR0A 1FEEA 1OO0B 5J1EA 5L1LA 4TY9A 3I55S 2KFYA 4B17A 1U1NA 3PHEA 1QUPA 2CVIA 1IKYA 4BWMA 1S9EA 3GFXA 4ZP8A 5C25B 4PQAA 1SIWB 1RI7A 1N4LA 2V0NA 5L38A 3T1HF 3J7ZT 3G8SA 4RW9B 2J0SD 2EFVA 2KJWA 2XMJA 3WZ0A 4QWCA 4JYAF 3D2WA 2ZITA 4ILRA 1HR0F 2XGQA 2CPXA 1N54B 4MMOA 4DFJA 2D3ZA 7FDRA 5HLFB 2OAUA 1H2UX 5CA5A 1F5BA 3RRKA 4URQU 3MXHP 3HJFA 1VC5A 3MURP 3H5SA 1TAQA 2IMOA 4LSLA 4CTAB 2DNPA 2KU7A 4I2QA 3TA1A 1A9NB 3N9UC 1FKOB 5EX3A 3RB0A 1YSJA 2VG6B 2YNFB 1VIOA 1GQEA 1WF1A 2V9KA 3FQKA 5FLXY 1V9OA 1F0XA 4YEAA 1JLGA 3IA0A 2DGTA 2XEXA 4I6AA 1UFWA 3O1LA 1BWEA 4GO7X 2VBZA 4MYTA 1S1WA 4NCGA 3RTVA 1RJJA 2PSZA 1RT1B 5E33A 3KLIA 1VQ4S 1OQ6A 1SL2A 3OVBA 2FJAB 5KFPA 4A8WA 5IT9Y 4Y2KA 1O8BA 1VJWA 4HH0A 3U02A 2IM1A 1XBWA 1L3SA 3O2IA 5K8OA 4ED3A 2B7CB 3PEHA 3JSMA 3SI8A 2XY5A 4JI4F 4ALZA 2ABYA 1C1BA 1NKEA 2UUAF 1E6YA 4ELTA 3BJYA 4X4PA 3F41A 1RTJB 2RDJA 2GIQA 3AB2B 2OD4A 4N5SA 1GXUA 2BM0A 4ZKAA 4WK1A 1KN6A 4I64A 3VZIA 1RT5A 4NMLA 4OJ1A 4CT8A 5J2QB 3F73A 3CMAS 4ZDNA 4C8NA 3VZHA 4A8SA 3QMQA 1F2GA 3OBIA 2MB0B 5A8RA 4MAKA 3KK1B 1MWYA 2IVMA 4HDGA 2MQOA 3IWXA 2EK1A 3QIPB 3CJKB 2HNDA 5HMWA 4ZMMA 1EETB 4BBYA 2AWZA 1HYSA 1U09A 3LGMA 2VC0A 3M8QB 1U49A 2PDAA 1XR6A 2E66A 2PA3A 3HHLA 5LXRA 3PO5A 5KFEA 1RTDA 1MU2A 3BM7A 2R8JA 5AXKA 2YKMA 1DJ0A 4ERDA 4WXWA 2B4VA 2YNHA 4IDKA 1O5JA 5BYSA 2ZZNA 1WI8A 1WEZA 2X1FA 1L3KA 3AA9A 5KG1A 3UR0A 3GV8B 5B0CA 4DL3A 1NK9A 3DC2A 3G9CA 4ZHRB 4C3LA 3ENWA 1UAWA 3U7JA 5L1IA 1QSYA 3CCUS 2J76E 2O66A 1YWXA 2DJWA 3TUIC 1S99A 4KKOB 3MAHA 3AA8A 4H54A 2JX2A 3CD7A 4QW8A 4DV2F 3M8PB 5DQIA 2AJ4A 3LP1B 4X62F 5DDRC 3CCLS 4UOCA 3LAKA 2Z0GA 4DHVA 4LIRA 4RW9A 3POTB 2NUUG 4O4GB 3CDUA 1U24A 2RKIB 2CJBA 2HRUA 3IR6B 5LL6d 3X3UA 3T6BA 2KH9A 2CPHA 1RISA 5JVGQ 5BYQA 4LF6F 3DN9A 5K9FA 1D3WA 4CO3A 3V4MA 1MMLA 4CTAA 1HMVA 1WWHA 4PQUB 4PG8A 4NLXA 2JH3A 3O3LA 1LQ9A 4C97A 1UA1A 4ZA1A 1S1UA 1PO6A 1FKOA 3WC2A 1VQ5S 1S1TB 2N4CA 2ZH3A 4YQWA 2AJQA 2EFOA 3LP2B 2LXUA 1Y3JA 5J2NB 2XS7A 5JVHQ 2B4OA 2ILZA 3OTEA 4AL6A 3M8SA 4IG3A 5CYJA 1IBKF 1RT1A 1X0PA 4G6VB 5J1NA 1UVIA 1VQYA 2FDNA 4TU8A 2XLIA 2JVOA 2DR7A 2MXYA 4NLRA 2E44A 3BGRA 2LXFA 5E3RA 1TK5A 2J9DA 4K4WA 4RUAA 1KHVA 1BC6A 4PWUA 2E1MC 3F56A 3THPA 3PXGa 4FBUA 4TQSA 3HHNB 3GR0A 5FJ4A 3DRXA 3CTRA 2BYCA 3I0SB 4DL6A 1FO1A 1ZAXA 2IJFA 2ILYA 3PJWA 3MZIA 1FXDA 1SKRA 3PKMA 1NHVA 4F50A 2L08A 4CO1A 3EUNA 2J0WA 2VA3A 1R8AA 5T14A 2DGQA 3JTOA 4FPRA 2M5YA 1L3UA 4H4OA 2JLFA 3NAHA 3KK1A 4PWDA 2ZZMA 4ES3A 1SJFA 2L3MA 3QIPA 3UCZP 4ZP9A 1VK3A 3OQ2A 3D0HE 3UI3A 1OPZA 3OW2R 1N33F 2E9TA 3TVZA 1BQMB 1AW0A 2VBWA 2LMIA 3M1VB 3MM7B 2FLPA 1JLAB 3OV7A 1FHTA 1S6OA 1RT4B 1TP7A 1URNA 2V4QA 2LECA 2GW8A 4DFMA 2EVZA 3BREA 4Y0FA 4ZHRA 1Q7YT 3HK2A 2WOMB 2NYIA 3QGGA 3OXLA 1XN9A 3GQCA 2EBGA 2AJ0A 4TYBA 3UPFA 1MSWD 4IFYB 2YWKA 5KFIA 3JYTB 1VRTA 4KKOA 2LDIA 4NLWA 1UVJA 4OHXA 4B9MA 3LP1A 2DNQA 2K7KA 4NLPA 4UQTA 2CPJA 1IN0A 1R8HA 4IOBA 5HO4A 4DLGA 1BLUA 5M2RA 2LQJA 1XMOF 2IAJB 3EGNA 2GGPB 4KHMA 2CKWA 4B02A 3M30B 4DN0A 1YJTA 4RZRA 4ECVA 3MD3A 4ECYA 1TKXB 1T7PA 2FVRA 4ECSA 5FIIA 2YKAA 2EFGA 4LQ9A 1X9WA 3MR6A 2QRRA 2OKQA 1PILA 3DRRA 1D0EA 2MQPA 2I38A 1HBOB 3M05A 4TN2A 3SCLE 2ROGA 1ZPVA 2WTFA 3DOKB 1VQLS 1HQUB 3EGWB 5F0WA 3AY0A 2GA7A 2R7TA 1Z4UA 2PI5A 5J2NA 4FZVA 2GHWA 4GC7A 3BB5A 3RZAA 1WTFA 3T5KA 1XR5A 4IRCA 2UVVA 2M9KA 3K5PA 3LUYA 3CB4A 2AYEA 4K2XA 5SUHA 4UQGA 4QWAA 2MZJA 1BD6A 4ZP6A 4TU9A 3VAMA 3SV3A 4OI4A 1UMJA 2CZ4A 4QR1A 2N7CA 3RAQA 2ZBIA 4MKYA 4IQXA 1LW0B 4I68A 5E3CA 2DNKA 4LIWA 5C24A 4I6WA 3TR5A 1R8PA 1WF2A 2KXNB 3T9NA 1YRXA 1HWKA 2DO4A 4RX6A 2JDJA 1FDBA 4ECWA 3I0SA 1HWUA 2XCPA 4DR3F 1C4AA 2U1AA 3T9ZA 3MEDA 2RU9A 4LF8F 2WSEC 1LFPA 3IAS9 4RW8B 1UP1A 1KONA 4KHPF 2DNRA 3WX4A 3AAWB 1CQMA 2J7UA 2DHGA 4WTYA 1NK6A 2HZCA 3OL8A 5G4DA 2AX1A 1FTCA 4ES1A 4QJVA 2MY7A 5K14B 3NS6A 3M4XA 1W2BR 2CQCA 4ZK7M 3H59A 4YB7A 2EG1A 1M5OC 1Q78A 4AXIA 3ETOA 1WNEA 3DLBA 3T19A 4YR0A 3TVKA 2Q3PA 4K4SA 1HFEL 4I7FB 1FT8A 1BQMA 1NU4A 1R89A 2VFVA 4IH6A 3MM7A 3KLGB 1UA0A 1UJ6A 3BR9A 1JLAA 4DV1F 3H2UB 1D1UA 2W4CA 3C66A 4KPYA 5DG7A 4OV1A 1DFDA 2ZH6A 4ZPTR 5J2PB 4ZVGA 2V8DA 1O51A 1ZM9A 3DHWC 2C3UA 4IFYA 4YMEA 2RNEA 1FEHA 2BRLA 4FS2A 1IKVB 4HI1A 3CMES 5IXUA 4F02A 3T1AA 2KJVA 3ZZPA 3PW7A 2JC1A 4YY3F 2EFQA 2FTRA 4XDDA 2V2KA 3MF5A 5CHCB 5KG6A 5IQ6A 1FKAF 4C3MA 3N6NA 1U1RA 2PMZD 2LA4A 1TL1B 2GGPA 3JTNA 4YB5A 1RT7B 4X4VA 4QIEA 4ID5B 2KG1A 1U2FA 5ITHA 5G0RA 3DRPB 1TKXA 3NMAA 2E9ZA 2LYVA 2VG7B 2JZ5A 2AGQA 3D1OA 5LSLA 1RYSA 5H9FJ 2GJ2A 1M1KT 3HVWA 1WF0A 3IWNC 2IA6A 3OL9A 3CT9A 4MFBA 4JI6F 3OHAA 1QE1A 3DOKA 3PDNA 1S6QB 1JNRB 4AUKA 1SC6A 3HVTA 2Z2LA 3MTKA 2LEPA 2NUHA 3H4BA 3V6KA 4A47A 2RRAA 5LSOA 3OLAA 2E1CA 3HVAA 3N4WA 3DI6A 4HL9A 2E7WA 2CPYA 3V2UC 2AGPA 1NK0A 2QEXS 2EW9A 3H5YA 4CH7A 1HHSA 1HW8A 2G4BA 2KM8B 1LXNA 3N6LA 2PEHA 3K57A 2GO8A 2XI3A 2UU9F 1LW0A 2RVJA 4WFXA 1S4FA 5EGYA 2PE8A 4F4WA 2ZHAA 1T05B 1WHXA 2G0CA 4ED5A 1GNKA 1K1SA 3OJUA 2HHVA 4WZMA 2ASJA 4QU6A 2QLXA 2FVSA 3C6UB 1M5HA 1ZYQA 4QWDA 4RW8A 1FRMA 1ZH5A 3S1TA 1VI7A 2FPHX 3CD5A 3DLKB 2GV1A 3DRSA 4Q2MA 3U27A 2ZH1A 1TVRB 2N3OA 5IT0A 2BDPA 1XC9A 4F4XA 1LOUA 4JI3F 1HNIB 3FDSA 2F1FA 3MTJA 4MKAA 4F26A 4F4ZA 4F3MA 3RW6A 4JV5F 4PPZA 2XGPA 3H2LA 3EZ5A 4WXOA 5H9EJ 1FCAA 4NZ7A 1N52B 4BC9A 5EN1A 3E3XA 2ZFHA 2APOA 2LQ5A 3THTA 2BW2A 1Y3KA 2C3YA 4WYWA 1ZM4A 3RU0A 3LP0A 1UEVA 4I7FA 2JSXA 3GFYA 5F8MA 1FA0A 3HI9A 3KLGA 3DDKA 4AE5A 5DLFA 3TYTA 3PX6A 2MJUA 4CO0A 4AXJA 4CCHA 4A8YA 1IBMF 1VOMA 4BHQA 3SZ2A 2K3KA 5J2PA 2PD1A 3R1HA 1FRHA 2HPUA 3PEJA 2UXDF 2B5JA 3NCPA 1DQ9A 4QBUA 3TAMB 2B6AB 2MKHA 1B0VA 4CO2A 2WSFC 5DGAA 2POKA 4WU3A 2HMIB 2W9CB 1YVFA 4DV5F 2RH3A 2XSFA 4G1PA 4IO1A 2J0QD 4F4KA 2JRSA 2VH7A 5T7LB 4KO0A 5MAOA 1VQ7S 1JWWA 2HQ3A 4G1QA 3DLGB 4JV0A 2UV8G 1MROA 3HVRA 3LQVA 3KLHB 1ZBTA 4LSNB 4BS2A 4I2PB 3FEZA 3PX0A 1SL0A 2AV5A 1VFJA 1KR4A 1MW7A 1FD2A 2VG7A 1VQSA 4ID8A 5THWA 2P6TA 4NLTA 4YUDA 2PMHA 1RAJA 4B9SA 2RB7A 2V4RA 1S6QA 2R2SA 2I2YA 3I5BA 1YJNS 5K8PA 2L48A 2LKZA 3GILA 3MPVA 2HGLA 4NLYA 3RRHA 3N0VA 1MWZA 4C98A 2R7VA 2RRBA 2LCWA 2W9AA 2VFTA 3MPYA 1YJUA 4QU7A 1SB6A 3N5BA 2W9BB 1UW4A 1FDNA 1KFDA 5DS7A 1FK9A 2ROPA 5FD1A 1VQ8S 2IMWP 1VQ6S 3DLHA 2RE1A 2DGSA 4HLBA 1S0MA 1FF2A 3G6XA 1NKCA 2JEFA 2F40A 2ZH4A