4NL5A

Mycobacterium tuberculosis heme-degrading protein mhud in complex with heme and cyanide
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
101
structure length
101
Chain Sequence
PVVKINAIEVPAGAGPELEKRFAHRAHAVENSPGFLGFQLLRPVKGEERYFVVTHWESDEAFQAWANGPAIAAHAGHRANPVATGASLLEFEVVLDVGGTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and Spectroscopic Insights into Heme Degradation by Mycobacterium tuberculosis MhuD.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
molecule keywords Heme-degrading monooxygenase HmoB
total genus 17
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature ec 1.14.99.57: Heme oxygenase (mycobilin-producing).
pdb deposition date 2013-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03992 ABM Antibiotic biosynthesis monooxygenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.100 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nl5A00
2N4DA 2ZDOA 1TUVA 1X0PA 1AFJA 1KVIA 4A48A 4FNIA 3BM7A 1ULRA 4Q2MA 4A47A 1CC7A 4HH1A 2W4PA 1N5VA 1SB6A 1SQEA 1VQSA 2QYCA 3IWLA 1VQYA 5B0AA 3BR8A 1YJTA 2XMTA 5IXUA 2W4DA 2XMJA 1JWWA 1LQ9A 1FVQA 3FRYA 1IUJA 2PGCA 2IYGA 4OJGA 1MWZA 2N7YA 1TZ0A 3LGMA 2BJDA 4DN9A 2OKQA 4DL0C 3BGUA 2AJ1A 2N4CA 3KG1A 5B08A 1YJRA 2K2PA 3CJKA 2G9OA 1JK9B 1URRA 1CPZA 2HLTA 3UDCA 3KKFA 5B0EA 2AW0A 1APSA 1K0VA 1YJVA 2JDJA 2HQIA 1OQ3A 3MZIA 1FVSA 1X7VA 2W4CA 2FHMA 2FTRA 5B0FA 5T7LB 2K1RA 4OJ1A 1R6YA 4ZOSA 3HF5A 2LQBA 3MCSA 4U9RA 2OFHX 5F0WA 5B0CA 4HI1A 3FMBA 4OJ3A 4QOTA 4NPOA 3WDOA 4F67A 1Q4RA 2GCFA 2Q3PA 4YEAA 2KT2A 3VTIA 1AFIA 4NL5A 3QGPA 3LO3A 2KT3A 2BUNA 3DXSX 1MWYA 3K7RA 2GA7A 1P8GA 2RSQA 1QUPA 1S6UA 2ROEA 2AJ0A 3GZ7A 2XMVA 2ASYA 1FESA 1Y3KA 2XMWA 2HFOA 1Y9OA 1OPZA 3IWXA 2ZDPA 4YDXA 1FE0A 3F44A 4HH0A 2FIUA 2KYZA 2L3MA 1YJUA 1AW0A 4Y2KA 3FGVA 2EW9A 1FD8A 3I9ZA 2RMLA 4FNHA 2HFNA 1CC8A 1GXUA 2GV1A 2ACYA 2QLWA 4EFAC 5T7LA 2QLXA 2GO8A 2HIQA 3TOQA 2FB0A 2IYIA 5B0BA 1N5SA 1Y3JA 2OMOA 1Q8LA 1TL5A 3HFKA 2LDIA 4OJHA 2XMKA 1OQ6A 1Q8BA 1SI9A 4OIXA 2AP6A 2GGPA 3T9NA 1TR0A 3HX9A 4DPOA 3BN7A 1FE4A 2ROPA 4Y2IA 3TRGA 2VV5A 2BJEA 2CRLA 3HHLA 3LGNA 1YG0A 3HHLC 2VH7A 2K7JA 4A46A 1WD6A 2OAUA 4HL9A 3BDEA 3HHLB 3HHLD 1Q53A 3KNGA 4A4JA 1S6OA 3TNVA 3BF4A 5A6PA 1OSDA 1GXTA 2LXFA 5B0DA 2XMUA 1V3ZA 2BBEA 3DCAA 1P6TA 1N5TA 2KKHA 2QIFA 3E8OA 2K1RB 5A6WA 1U7LA 2ROGA 1N5QA 2HLUA 2IFXA 1KVJA 2RILA 1YRXA 5K9FA 2OFGX 2PD1A 3HDSA 2K7KA 1Y0HA 1KQKA 5F0UA 4HI2A 2XMMA 4Q2LA 1XBWA 1TL4A 2BYCA 2GGPB 3QMQA 3BB5A 4ZA1A 3KG0A 5B09A 1FEEA 2OD6A 5KAKA 2LQ9A 2OP5A 2OD4A 4Y2MA 1X8DA 1RJJA 3CJKB 1W2IA 2GFFA 5B0GA 2RU9A
chains in the Genus database with same CATH superfamily
3OD2A 4MIWA 3CJ0A 2DEJA 3EWGA 2ZNYA 4CM0A 4K4UA 2RD5C 2CJXB 2XZWA 4X62F 1DHMA 2ERRA 3HVRA 3K17A 3KLFA 2G1DA 3DRSB 4ZPWR 3NOCA 4M1KA 5B0AA 2Y1JA 2XMTA 2RQMA 1KQFB 2N82B 1SL0A 2F40A 3FCVA 1V6HA 1ROFA 3LP1B 3PYFA 4HTIA 3QT6A 4HVZA 4L3KA 5HBMB 2NXCA 5KFKA 4I6YA 4N8OA 2N7YA 1KC8T 2HZVA 1YTYA 3DM2B 1W25A 4KGXB 3VHQA 3QJLA 4B3MF 5HK4A 2GAHC 4LRBA 3GQCA 3KG4A 1RT4A 4RNMA 3A3OB 3AH6A 4KGZB 4O0IA 2ZBQA 4EI2A 3BYPA 4J91A 2N7CA 4ID5B 3PRVA 2NXJA 3QIPA 4OYAA 2D9OA 2JDJA 2QL5B 2ILZA 2AX0A 3W62A 1ZETA 1UFKA 4TLQA 2W4CA 1EAYC 5KFXA 5B0FA 4K4TA 1L3SA 1RTHB 4MAKA 3NGUA 4MYTA 1FWLA 4WE1B 4X4OA 4DR6J 1IKWB 2KG1A 4LSZB 4WU3A 1N56A 3O6QA 2XCAA 2M8HA 4J9VA 1S9FA 1D1UA 4ZP7A 3BO3A 3KHGA 4NPOA 3TARA 2XI3A 1F5AA 1WKKA 2LP4A 2RVJA 3C6TB 1WC6A 3OTEA 3NMAA 2HHXA 3DGVA 1QVGR 4F4WA 1NDLA 4PYDA 4BWJA 4F26A 2RSQA 4F0MA 3QZ7A 2HZCA 5THWA 3OJSA 2W24A 1E6VA 2FUG9 4X4NA 3I56S 2KFNA 3ETMA 4EGLA 3IBCB 2WVEA 5ETQA 2IM0A 3H40A 3EJMA 2HHPA 1YRUA 4NLXA 2MQNA 3FGVA 2EW9A 5CYMA 1UEUA 1TKDA 1WDDA 5BJRA 4K4WA 1YZ7A 4PWDA 2DNPA 3MD1A 4YFUA 2XYHB 1VC6A 3LALA 3QT5A 3CJRA 4PPDA 4L75A 3GFHA 3UD3P 1N4LA 1AUSL 2AKWB 2E29A 1EQ0A 1V5VA 2DR9A 2LU2A 1WOPA 3IS9B 1KEKA 1TL5A 2CVEA 3K8VA 1RAAB 3SI8A 1L3VA 3W5YA 5A8WA 4JI0F 3SXLA 2OPQB 1TR0A 3NGSA 4V19J 2KFZA 1DQ9A 1PC4A 2FZCB 3TJAA 3WX8A 2WSCC 3CWJA 2G0CA 3AD7C 3OR2B 1AUDA 1HR0J 4U7CA 2DIUA 1LXNA 3R1HA 2KVQE 3AA8A 2VH7A 1VCTA 3GYXB 2HGLA 3IO1A 4C0OC 5ETKA 5J2MB 4CNZA 1WD6A 3AA9A 3W61A 1VBYA 4LF4F 1L5UA 2RT3A 1CJTB 2ZBIA 4OZ3A 3K5LA 3WIUA 2J5AA 1PGZA 1YWXA 4O4GB 4DQRA 1OYEA 1DARA 3DRPB 4RWXA 3MPYA 3T6JA 1I3OB 1TKXA 4RW4B 4PWWA 2XY5A 4F2SA 4ICLB 2YWGA 3MPVA 2JLFA 3VAHA 1HBUB 2KHCA 2LVWA 3FEXB 3M1VA 3N28A 5K9FA 4DQIA 2BJ9A 2GS8A 5F0UA 4RWWA 1IQTA 4Q2LA 1IJEB 2DTJA 5HI7A 3DOKB 5D6GA 5EWEA 4CNYA 4MJKA 4NI2B 4UUXA 1U8SA 2HQCA 3R5CA 2A18A 1VIOA 1B64A 1WF1A 2CPYA 3FDSA 5B0GA 4B3TF 3N6MA 2V4QA 1SC4B 3TUIC 3VAIA 1Q5YA 1KVIA 4QCLA 2K8GA 1M0SA 2HRYA 2DNYA 2IJRA 4DX8H 1L3KA 4NLWA 1YDLA 1RAOA 3HLUA 3KLEB 1R0AA 2W4PA 2XY7A 3NGRA 2G1HA 1QAXA 3BR8A 4DV1F 1V9OA 5KFEA 3ILJA 1GAOA 2IHR1 4OX8A 3DLJA 2OPQA 1IUJA 3HHDA 1ZTWA 4OLOA 1YRTA 4RW9B 4OHZA 4X4PA 4IQMA 5DJBA 4A8KA 3R9LA 3US5A 2VPXB 4M5JA 1CS4B 1OO0B 3LP2A 1JLFA 4XDCA 3CCVS 3CJKA 4IOBA 3M6VA 4K4XA 2AJFE 2MZQA 2Q6CA 4IFYA 4NE9C 2GC8A 4C0BA 4CDIA 5F9NA 5K8MA 1QE1A 2DR8A 2PI5A 5CD4A 1Z2LA 1IR1A 2DHGA 3GG1A 1X7VA 2YKPA 2FTRA 5KFMA 3Q8YA 2ALZA 1R6YA 3IAM9 4P7TA 3V5RA 3CSKA 1EJ7L 3R7NB 4CH7A 4QWDA 1U1PA 4QYZJ 3UD4P 4QR0A 3M8RA 2HVHA 5HJYA 1HHQA 1SCJB 2FC9A 2PEHA 3BEGB 4CT8A 2M3DA 4RUBA 2NR0A 2JLGA 3NNAA 4ILLA 4I2PA 4X64F 3SFGA 3D6MB 2FGOA 1SUQB 3M32A 2E7WA 4B17A 3CF5Q 3KK1A 4DV3J 2G4BA 4ZCIA 1RHKB 4QWCA 4NXNF 3KOAA 2C3MA 2ROEA 4ZCLA 2AJ0A 2V8DA 1HWUA 3LAKA 2Z56B 2YX7A 4ZHRB 4TQRA 5H9EK 4NZ6A 2VJVA 2HHHJ 1UZDA 3DHXA 1QJHA 5LT5A 4QJVA 5HP1B 5A8RB 5BYSA 3OQ2A 4R25A 3TAMB 1SJRA 1RTDA 1IXKA 1HWLA 2KYZA 2HBZB 3D1OA 3QO9B 3W60A 4FKXA 3PYGA 2BABA 4DR4F 2PFFB 1U47A 2RB7A 5JVGQ 4NX9A 5L46A 4P74A 2HFNA 3MECB 4NA1A 1OPIA 2E5GA 2L08A 1VQLS 1IKVB 1WG5A 2JLEA 3J7YU 4KQZA 1FK9A 1JXVA 2NXEA 2RHQB 1MMNA 2EG2A 2GVZA 3FQLA 5HMXA 4DEZA 3ULHA 4OHWA 4DV6J 1QAYA 3D67A 1KD1T 2FJXA 2HRUA 2V2QA 4B3OA 2JVOA 3A8KA 5RUBA 4N76A 1NLKL 1SI9A 2QSFA 1FHTA 1SC3B 2CPIA 3DC2A 1JLFB 1FJGJ 2E5IA 4ZMMA 3C6UB 4DPOA 3TUJC 3RJMB 1S5ZA 2CJBA 2HWTA 2HWIA 5KG1A 3TP2A 1ZOTA 1NK8A 3HVAA 4GVBB 1RAFB 2FLLA 2PDAA 1FDBA 2KRRA 1J5OB 2Q66A 1IWAA 2DGOA 2VA2A 1U24A 3RB4A 4A8OA 1YLXA 3KFWX 3G8SA 3V4IA 1VGYA 1YJ9S 4OZJA 2DISA 4DI6A 3R7BB 1CQMA 1SJ1A 5B0DA 9ATCB 1S97A 2BRLA 1UL3A 2D9PA 1WKLA 3DKDA 4ED6A 3TX8A 2CZ9A 3EUNA 4LSLB 1TKZA 4N47A 1X5SA 2IDEA 2YX4A 1N5QA 2F9DA 3FZBA 2AEFA 3R27A 4IO1A 4ZHRA 4DG1A 2MJNA 2V0NA 5KFCA 3HDSA 3Q2SC 3OLAA 2W8LA 1ZM2A 4O3NA 2VHGA 2DH8A 4OLPA 2DGWA 3UDVA 3H20A 1TL4A 5A8RA 2LEAA 4J9NA 3WC2A 2BKNA 1TL3B 4TYBA 4PR6A 2RS8A 4L6V3 2NYIA 1U8WA 3CULA 1WOOA 1JLQA 2Z4PA 2OTJS 3IG1B 2NZ4A 3R2DJ 1F5CA 1HARA 3CTRA 2Z58B 1HLWA 3M9NB 2KN4A 2GW8A 2WRMA 2WVDA 2O01C 5IV4A 1WOSA 4FXVA 3AQOA 3DDNA 4GC6A 3Q83A 4WXOA 1I94J 1ZH5A 1JWWA 2ZITA 5LJ5Y 1ITPA 4KFBA 5KT4A 1R89A 2AIRB 3DRRA 1YK9A 2PEBA 3BGFA 4QIGA 4NOHA 4OJGA 2HIYA 4ILMA 4CM2A 2ZZMA 2Q43A 2DGSA 3I96A 4ZLLA 2R7QA 1VLOA 5IM0A 3ZZOA 4RNNA 4RLEA 2OPPA 4IRDA 4PQUA 3M8PA 4IRCA 4LQ9A 5ETTA 3M2VA 2DGTA 2ZKUA 4WIQA 3VAKA 1VQKS 1N32F 2JOQA 2LDYA 3PACA 3CDBA 2JFDA 2QN6B 1LW0B 2OPRB 3R6LB 3WX4A 2B4VA 4C8LA 5KFHA 1S0VA 3SSQA 2VOOA 2P5VA 3IFEA 1FXLA 4OJ1A 5E0OA 5KFDA 2Y1IA 5EGYA 3GILA 4WYLA 2R7TA 3CW2C 3DU6A 5KFZA 2X3GA 2ZBPA 3EE3A 1Q4RA 4JV5F 1HNVB 3EGVA 3MCNA 2QGFB 4WPAA 5U47A 1G1XA 2CPJA 3MTKA 4WK1A 1RBOB 1C0UA 1UZHA 3JS9A 4IKAA 4U7UD 2OUGA 1P8GA 2QA2A 3FRZA 1U0HA 3K7RA 3PR5B 1UVNA 4C97A 2HZAA 2XMWA 2HFOA 4HT5A 2DXFA 4OMFG 2GX8A 4HH0A 2QLFB 4D3GA 1BE4A 2JWNA 1JKHB 1SH3A 2A2CA 3D54A 4Y2KA 4DCPB 1ZM4A 1RBLA 4BCAA 1RKJA 4XO0A 1Y5IB 2QYGA 4RUHA 2A10A 2RRNA 4MIBA 4OYBA 1VQ8S 1U48A 1HA1A 2YNFA 3N9UC 2FLOA 2HQ3A 3MECA 2XG8A 3NBPA 5SUHA 3SSSA 2OLWA 2VFUA 1U1MA 3KXDA 2IBKA 4KHPJ 3UVJA 2XB2D 1KLNA 4S0MA 5HROA 4OI1A 2HS3A 3RR8A 4ZN3A 2ZUAA 2H5EA 1TTHB 1B99A 4OIXA 2FZGB 5CH7B 4ZCMA 1M5PC 1IVZA 1CJKB 2CA9A 3ONQA 1RT1A 1Y5NB 1T9VA 2R2SA 3VVUA 4C8KA 1LK5A 1DLOA 3M8WA 2BQUA 4MH8A 3IAS9 3AXMA 4DQSA 2CRLA 2J6UA 2EXUA 1N6QA 1K44A 3NS7B 1U1KA 2OH2A 2LFVA 4O0NA 2HQFA 1NB7A 2VA3A 2QJ3A 4CLYA 2GQCA 3W3SA 2E66A 4O4GA 2MB0B 2DCUB 3CCSS 2VBZA 5JXSA 4NLTA 3DRPA 1UFLA 1S1TB 2DNOA 2JL9A 2LCWA 4TQSA 4C4WA 4BLGA 5EWFA 1R0AB 2QO3A 4NYOA 3KJVA 2B8QA 5CYJA 2VIHA 2B8PA 1RTHA 1BQMB 4DQQA 1C2PA 4CLPA 2AD9A 3N79A 3PJXA 4ID8A 2O67A 4DX6A 3PVXA 5D77A 4G1IA 1N0VC 2IFXA 1WEXA 2VQFJ 3CCRS 1SV5A 3GR0A 1J5EJ 3R6GB 5HQLA 7AT1B 5JMNA 4X2BA 1S9GB 1XBWA 1T9YA 5L8RC 4I2QA 4CCHA 4Q0BA 1NNDA 4F7VA 4MFBA 4DCOB 3EPGA 1NPRA 2YKMA 3I0RB 4TY9A 1U49A 1FDDA 4WK3A 1TL3A 2RU9A 3JQMA 5A0YA 1VQ7S 2C2KB 1F1BB 2CDQA 1S1UA 3KWMA 1Q7LB 3QWPA 2ZJQQ 3X1LB 1FJCA 5LXYA 2YQ1A 2WONB 1NU4A 1ULRA 3CMES 4B9NA 4F4XA 1S76D 2BKPA 1N5VA 1UEVA 2DY9A 2JHEA 3RBZA 5IXUA 4F50A 1R3NA 3GSDA 3PKMA 4BC7A 2AF6A 4TN2A 2AMCB 3BREA 1S6QA 5CQGA 2D3UA 4KFBB 5DM6Q 1MROB 5HO4A 3BR9A 3GV7B 2GMLA 1ZPWX 4RNOA 5DM7Q 4QWEA 4OX6A 4UOGA 2M9KA 4DN9A 3BQ0A 1QTNB 2QG9B 4PXBA 5AE2A 1O8BA 1VK3A 5KFWA 2FPHX 2MGZB 3BBCA 1H38A 1RYSA 4NA3A 4KGMA 3BQ1A 1XJWB 4PWUA 3X3UA 1SBRA 1X5PA 3UDCA 2MTLA 3OR2A 5A8KA 3ZZPA 3Q8SB 3I31A 3SZ2A 4DS4A 2CJQA 4C0HA 1XR5A 1VQ4S 2EBEA 4G1QA 3AD8C 1FRXA 2MKJA 2XWYA 2FJAB 3AJ1A 1W7WA 1LW0A 2OPRA 3R7SB 4ALZA 4JB8B 3CCMS 4IOCQ 2GHPA 4U9RA 4AL7A 2D3O1 2WOMA 1VRQC 3HHNB 2UUAF 2WW4A 2RU3A 3NKYA 4P6QA 1NK4A 5CCMA 4DPXA 3I5BA 5IQQA 4CO2A 4K2JA 4LJMA 4FZVA 3VAFA 5KFIA 5KOWA 1EB0A 1GMUA 1QUPA 3QLHA 3OHBA 2ABYA 2ASYA 3FC9A 5F41A 2YNGB 3NXZA 5K5MA 3K57A 3CC2S 4DUYJ 4EBCA 1U0HB 1TELA 2XHCA 2MZ1A 3D1QA 2MKIA 3DMJA 1N0UA 2DNRA 3KMSA 3UCZP 2JEGA 4I7FA 3L7UA 4PAAA 3QSYB 4QQBA 3F73A 3NEKA 3CVKA 3Q22A 4OL8A 2GO9A 3CT9A 1GXUA 1HBNB 1FK9B 1T02A 1QAIA 1QAJA 1HYSB 4EO6A 5F8MA 2Y1LB 1HYSA 3W66A 2PIIA 3SCJE 2GO8A 3ET6A 4ED0A 1WF0A 1S6QB 2ATLA 1YITS 1X60A 3L4BC 2BW7A 4XDDA 4QZVB 1RHUB 1FRKA 1N5SA 4ZPCA 4ZIWA 1WHVA 1S1VB 3QNWB 4OJHA 5AXKA 5AXNA 3BH7B 3BSCA 3G86A 1NKBA 4B3RF 3IR5B 3O5TB 1R8PA 5AE3A 5ETPA 3TRGA 2KI2A 3O1LA 1EZZB 2R8KA 4CLLA 1M5HA 1YZ6A 1EX8A 4UOCA 1O51A 2C3PA 3OBIA 4EBEA 1PBUA 5KT2A 4WXWA 4IH6A 1BGXT 3MF5A 5AXLA 4IH7A 4DX7A 4J9SA 2Q6BA 2EC2A 3CJTA 4KE5A 4B3SJ 1HPZB 2KG0A 3QAUA 3N6NA 5ETOA 1IBMJ 3FEZA 1H7XA 2Z2LA 1NCLA 1JLEB 1FXDA 1S49A 5A6WA 3V6DB 4A8YA 3MR6A 1QDUB 2DIVA 1RT2A 3C16B 1NMEB 4U7UK 2VG7B 2LU1A 2W7AA 2MZJA 3D5MA 3S01A 1S4EA 4EUVA 1TAQA 5C2GA 4IDKA 5L1JA 3UCGA 4NEYA 4LF8J 1SUQA 1R8CA 3BV8A 3M32B 5HJXA 5J1EA 4ZP8A 4ZJLA 5KAKA 5IT9U 2OD6A 4KBIA 1T03A 1TK0A 3NGKA 1T05A 2J76E 2RDIA 4MFBB 4QW8A 4ECVA 3D6TB 1FEHA 2YX1A 1JLAB 3BKTA 1AFJA 3TAMA 1VI7A 1VIXA 1VJWA 1I5OB 2W25A 5FDLA 3UWTA 2HHQA 3DLKA 5F3ZA 3CGIA 1HBOA 4DV4J 4HHHA 5HSPA 4DL2A 2DD8S 2V2ZA 3H59A 2Z2MA 2QYCA 3CCTA 2J8AA 2W8KA 1S0MA 4NLPA 2DR5A 1S77D 2VFSA 5T41A 4ED2A 1HI0P 1F9FA 1R6VA 2MKYA 1CJUB 3FMWA 2QMUB 3KLIB 3P8BB 4FYYB 4NCGA 4PXDA 5C5JA 3GYNA 3CD6S 3OR1A 4LF5F 5I3UB 3OSPA 1A6LA 5KFLA 4ES1A 1T94A 4QR2A 2ZZNA 1F9HA 3RBDA 1NSAA 3THVA 1YJRA 1HQEB 2G9OA 1Y4ZB 3K59A 4DR1J 1LWFB 1VQMS 1RT5B 2BJ8A 2ZEJA 3CMAS 4OI0A 5E7OB 5ETLA 3TA0A 3P3DA 5J1NA 5I4MA 5GAEU 2QMXA 3MR5A 4ELVA 2O3DA 4LF6F 3FNNA 2DNLA 4YN3B 2WB1D 3R5BA 1LEOA 4K59A 4OV6A 4DF4A 2R42A 1SKWA 2XO6A 4ATNA 4DR2J 5K8OA 3JYTA 2ZWPA 2BJ3A 1HKAA 1NPKA 1WKJA 3CD0A 3UO0A 1UJ5A 2MY7A 2UU9J 1YGYA 2GHWA 4PEOA 3NWRA 2UXBJ 4ES3A 4GKJF 3A8JA 3F56A 5HATA 1NHUA 2KT3A 4PG8A 6AT1B 3FSXA 4RZRA 3SYZA 4NLYA 3EDRB 1RHMB 2W9CA 3LP0A 4ZP9A 3FK4A 3DXBA 4QIEA 1JKHA 3Q86A 4EO8A 1Y11A 3G82B 4QW9A 4LFBF 4ID5A 1PSDA 4YDDB 3CCWA 1YKWA 2CQ4A 1RWNB 1PIEA 2LYVA 1S48A 4ECWA 1AW0A 2MSTA 3D0GE 3I4HX 1HBOB 3TZXA 3CXCR 1HHTP 3I9ZA 2MQMA 1AZSB 1B0VA 3GJTB 4I7FB 2YKAA 1B0TA 3EICA 3PHTA 1BXNA 2JC0A 1T95A 2L9DA 4IRKA 2P2CB 4USWA 1CJUA 2HKEA 1X4DA 1TUWA 2C42A 2QX0A 4A8XA 3OVAA 4DV0F 3PV8A 3HK2A 2MQQA 3ET6B 2L9NA 3M8SA 2LMIA 1XK8A 5GAHU 2ZWOA 2VJUA 2HHHF 1KKHA 1UAWA 3IC1A 1SC6A 2AP6A 1P1LA 2FVCA 2HWHA 2IVYA 2NLWA 3PDNA 3FZ2A 4LF2A 3VZIA 4TY8A 2CPEA 3LPYA 5KFSA 4DV3F 4RL1A 4M8LA 2GMHA 2X1FA 1FKAF 3TUPA 2VU5A 2VV5A 3CCUS 4C98A 4CO1A 2ATCB 2HYIB 2MDAA 5KFNA 4LF7J 2MEWA 2HVZA 3HHLD 1GTHA 3I5AA 3JXOA 2CQHA 4O3QA 3KK2B 1NK5A 3BF4A 2O66A 1RWKB 1MMLA 1RHJB 4P9SA 4ETZA 3JYTB 2GMJA 2YTCA 1X9SA 1QSSA 2V50A 4LF6J 2E9RX 2WSEC 2UUWA 2D3OR 5EX3A 1N5TA 4NLSA 2PMWA 4KYZA 2V8GA 1SV5B 2H48B 2OEMA 2ROGA 4I68A 4PG5A 5D0GA 4CLUA 3QZ8A 3DLBA 1JJCB 4AT1B 1H73A 3ZFVA 1YRXA 3IGNA 2BE2A 2W2NP 3HPOA 3SBMA 4NZ7A 2DR7A 4ED4A 4KGVB 3OL7A 4ECZA 2VODA 3EVWA 4Z7YA 4ZITA 1DY3A 2HBRB 2E9TA 3DOLA 1IBMF 1IKYB 2KXNB 3LANA 1F6TA 3BS9A 3MEGA 1H0HB 3HVTA 4RU9A 4QWBA 2QFJA 1Y10A 3GE9A 2B51A 3GONA 2PMHA 3MM8A 4Y2MA 5HVGA 5DQHA 2V4JB 4PPZA 1KFDA 5E3QA 1BC6A 4XTTA 4AD6A 2JX2A 4LRDA 3H4DA 3NS6A 5D78A 3VWSA 5CHCB 5LSLA 3MEKA 3ILLA 3JQKA 4P52A 5FDLB 1IR0A 4TU7A 2ZC3A 2ZH9A 4PUOA 3R5GA 4IG3A 3VVTA 4U6PA 4WFAQ 3OT9A 1MWZA 2HVDA 3RTVA 4MKYA 2DYAA 3CDEA 2DNKA 3NLCA 2EBGA 4FP9A 4MK8A 2VC0A 1CLFA 3A1YG 4K4YA 2WHOA 2YPYA 4PQAA 4WKYA 3JB9k 1HW8A 2AJ1A 2N4CA 3QT8A 4RNFA 4OQJA 1NKCA 1RTIB 3MFIA 2OGUA 3PZPA 1URRA 3V6KA 2JJ4D 3AY0A 4UOFA 4IO9Q 1HNIA 3OJUA 2IBOA 4Y2CA 1K0VA 2I0XA 2IC3B 1HQEA 2ZFHA 4PXEA 3EZOA 2AX1A 1KVKA 2BV3A 2VQEF 2VBXA 4OZ2A 5E33A 1S12A 3GFXA 3ZZZA 3VGTA 1FFSB 3FSIA 4OX9F 1T8EA 2IVMA 1HNZF 2EI5A 5F0WA 1HD0A 1QUVA 4OYIA 1HMVB 1S57A 1RHRB 4X4RA 5DDPC 2M5YA 2P6SA 4O44B 5KFFA 4A8SA 1PO6A 2E5LF 2EG1A 2BVZA 2XULA 4ZPDA 3VTIA 4DCJB 2FJWA 3DOLB 1T11A 3KJNB 4NCAA 3IR6B 3HMJG 1RBAA 3I0SB 3SEOA 1U25A 2GJFA 3GZ7A 5EHHA 3MM8B 2F63A 2XCPA 4DL7A 4IQXA 2W9AA 2BJ1A 1RE1B 2I1RA 3HHEA 2OO4A 3TZZA 4CIOA 1RK8A 2LQJA 2XGQA 2F65A 2HFVA 2B9WA 3OTDA 4I2QB 2MKKA 4OV1A 1QD1A 3HM9A 4CYUA 3CPWR 2YWFA 1FA0A 3I0RA 2VDHA 1NAQA 3UN5A 5GAEI 2AZ3A 2YQ3A 2R2RA 3TR5A 4FN5A 1VQOS 4LFCJ 2F3JA 1S1UB 4EFAC 1RWPB 4IG3B 3LGHA 3F0NA 4ECRA 1MN7A 3OV7A 1XWLA 4K8RA 2V68A 1LXJA 3M30A 3PW2A 2FVQA 4A8MP 4OZ1A 1DQAA 3JSRA 4NWBA 3OXGA 3OXLA 3PEJA 4DV6F 2DB1A 4OYMA 1BQNA 4OYXA 3PYEA 5HP1A 1YBAA 3QIDA 1HNIB 4N8NA 5D15A 1VC5A 1B70B 4JP8A 4ZPAA 3HHLC 4DFJA 3WZ0A 1LFWA 1JJHA 5LSOA 4YR3A 4JBCA 3T3FA 2CNOB 3TWZA 4Z7CA 3T1YJ 1WNEA 4GMKA 5A8KB 3CJ2A 3R1LA 3L9ZA 3NWGA 2XMUA 3W65A 3RG6A 3BSNA 2LQ5A 3DCAA 3E8OA 2UUAJ 2FVSA 4YR0A 3JSYA 2BMBA 5KFBA 1W2BR 4B9UA 2J9DE 3QATA 2E7XA 3ENQA 3EDQB 1BWVA 3MOZA 1GX6A 4H4OB 2RILA 3D0IE 4NRTA 4W98A 1G7CB 2VDIA 4DPYA 1VFJA 1JLCA 1BQXA 1HFEL 4OYWA 4J9OA 1CJVB 2VFTA 1T03B 2EPIA 2GGPB 7FD1A 2BA9A 3I32A 3QJPA 1BY9A 4JI6F 1N36J 1RA6A 4DR3J 5KFYA 4J5OA 5F8HA 5C42B 1RGVA 1RQ0A 1KN6A 2C3OA 3QIPB 4HEA9 5D4PA 1BWEA 1WSRA 4CLTA 1YIJS 3FKBA 4NYZA 1REVB 3V4IB 2ZDOA 3H0PA 1EIYB 2OIHA 4CLSA 3DMJB 2HNDA 3CNQP 4MMOA 4TNOA 5AT1B 1NJWA 4W4MA 3C3LA 4Q2MA 2B7BB 3UR0A 4QWAA 3SCKE 3ITHA 4ED8A 4DS5A 4PABA 1SB6A 2YKQA 3MFHA 4Y00A 1ZM3A 3ISZA 3EXCX 1TKZB 2W01A 4K4ZA 2V6AA 1WC5A 3MGJA 4PCQA 1R0CB 2VOPA 4ECTA 4UY8T 1FVQA 2RQ4A 3PW5A 1IM6A 1ZA2B 2R2UA 2HVEA 4F3QA 5B7WA 1SJ4P 3N01A 4FPIA 1T3NA 1U1QA 1F60B 4ZVTB 5F8LA 4E8UA 4CH1A 5DRKA 3PR4A 1IN0A 3KDNA 5AE1A 5B08A 3PW0A 3M6WA 1FX2A 2QRRA 2ZVSA 3CDAA 3GJSB 4WFXA 3MUTP 3G9CA 2HHSA 1CPZA 1RADB 1S1WB 3GYGA 4WTYA 3MD3A 3MUMP 2XHWA 3RW7A 4CO5A 3J81j 2XLJA 4URSA 4DSKA 4BDPA 4LQ3A 3BGOP 1IQZA 4YB1P 4X66J 2BJ7A 3DLHA 3MR7A 1PG5B 3CMQA 5G0RB 2UXBF 2DBBA 2H54B 4LRFA 3TVKA 1JX4A 4TYAA 1X4HA 3POTA 4OHVA 3A8EA 4FXWA 5B0CA 3DNCA 4QOTA 3PY8A 1A9NB 4TVAB 4AL5A 4GO7X 5DDRC 2R8HA 1FNOA 4KPYA 5BR8F 2HBYB 3GMGA 4YR2A 1U6FA 1HMVA 1RLCL 4NASA 1JLEA 3CC4S 2YKNB 2HFUA 3VAJA 3T9ZA 1VOMA 2GA7A 1SH0A 5HAOA 4L76A 2VONA 3OFGA 4E2FB 2F4FA 3GFYA 2EK6A 4DXLA 3F44A 1P27B 2ZH1A 1YVFA 2GIFA 1TMMA 4RX6A 1S0NA 3PFOA 5F8GA 4CI0B 4BS2A 2KTQA 1JIHA 1UA1A 4CYUB 4K0KF 4WZQA 5IV3A 1JLAA 4TXSA 4QYZK 1AFIA 2DT9A 1TQLA 4C3KA 2IYIA 1WTBA 3MMBA 2CFXA 4OI6A 3W7BA 1S1XA 2FJDB 5DDQC 3DN9A 1Y3JA 2H5IB 4I6AA 1GH8A 3QFWA 5BYRA 4LFCF 2DNHA 1NJXA 1RU1A 1U2FA 1Q8BA 2CYYA 3IP0A 1X0FA 2IA6A 2H3EB 2XTJP 4C3LA 4Q5VA 2XZDB 2X7IA 1DAXA 3MM5B 2R8GA 2VICA 4DWIA 3MHYA 4DUZJ 2HNYA 2NCKL 3LGNA 3BZQA 3IN5A 4O23A 2Z2YB 3R5DA 5GMDA 4F0HA 4PKDB 1EQMA 5DQIA 3KLVA 3AJDA 3DLEA 3K8WA 3KK2A 1VQ6S 1TP7A 1HHSA 3HFVA 4HL9A 1SQFA 4NZ0A 3NNCA 2MQPA 1RT5A 1WC0A 1TL1B 3KLEA 2CQ2A 1VISA 2C3YA 1FD2A 1RZMA 3POTB 4IG0B 4KAIA 1VDHA 5M2RA 5C2CA 3NBPB 5DQGA 3QPIA 1FNXH 4UF4A 1VK8A 3BDPA 3QRPA 2HAFA 1U2RA 2DCLA 3QQCD 4H4MA 3PX6A 3W63A 3C14B 1XR6A 5CD4H 2EFPA 1PJ6A 2HLUA 2DGQA 4RW9A 3RYLA 5IFMA 3MAAB 1K73T 1BD6A 1X4AA 2CUYA 1KQKA 3HD2A 3PW4A 2AJQA 4H4OA 4ZVOB 4NLQA 1DLOB 3FBFA 2BW2A 1SKRA 2BQ3A 5L1KA 4YY3J 3HHKA 4RW6B 1N32J 1JLCB 4DV5J 1K9MT 1HR0F 1QE1B 1X8DA 2YNHB 3E01B 4LFAJ 3TEHB 4KIAA 2DO0A 4JV0A 1TL7B 2DNZA 1ZPVA 4UW2A 4AE5A 2RS2A 2PN6A 4D3HA 4NLRA 4FNIA 1NH8A 2AJ4A 3KJVB 3KUGA 2CQBA 4K5RA 2V2KA 1UVMA 1IM4A 3CDWA 3SFUA 2W4DA 3IWNC 1U1LA 4I2PB 2DNGA 1X4GA 4AL6A 2BACA 1OMSA 3KHLA 4ZVPB 1S10A 1VLYA 2KVIA 5HL7Q 1M1HA 2A6MA 2HMIB 2PMZD 1JLBB 1C0TA 1H98A 3V81B 4QR1A 1Q81T 3KG1A 1N5YA 3RB0A 2R7VA 3IBFB 2UVUA 2VBYA 5A0YB 4I0WA 1IR2A 2HLTA 1H72C 1TL1A 4K5SA 2B6AB 3MEDA 1HQ2A 1HNZJ 4OX9J 1OYDA 2N3LA 2WW8A 2FZKB 1FRLA 1SXLA 2VFVA 3PRBA 2GJIA 4BC9A 5IWAJ 2FHMA 1T9WA 2MYFA 1DQ8A 3NAIA 2R9LA 4MKBA 1ZM9A 5LXRA 3J7A1 2W2PP 2ZE2A 1TVRB 1XEZA 1U02A 2ZD1B 1TAUA 2W9BA 1X4CA 3JSMB 2AGOA 3M4XA 4ZDNA 4B3OB 4H54A 1F5BA 3H8YA 3HKZD 3T5HA 2C2RA 4YMEA 4F67A 2GCFA 1B0PA 3I0SA 1LNQA 4DU7A 3BGRB 2AEJA 5HBMA 4EWTA 3PKYA 2A1BA 2AZ1A 4X66F 4HYKA 1T7PA 4DX5A 2ZBRA 3M8QA 3K2YA 2MQLA 3D0HE 3EM1A 3FEYB 2EFGA 2BE2B 2MGZA 1D3WA 2R2TA 2YKNA 2E5JA 3MM9B 1X5TA 4WFZA 1SJFA 3J7AN 1JQGA 1XMQJ 2J7KA 4TKTA 3W9JA 3BQ2A 1FXRA 5J2QB 4JV1A 2XEXA 1RT7A 3ENVA 4K4SA 2UUBF 3DLLQ 1WI8A 1Q0NA 3MMCB 4MKAA 3ILOA 3T6BA 5H9FJ 3UR3C 4N5SA 5DDOC 1B7FA 2ACYA 4ZVSB 4I1TA 4P7VA 2F8EX 3FSYA 5T7LA 2IM1A 4DU8A 5HQMA 1Y00A 4J9KA 3W5XA 2DGUA 2FB0A 2M2BA 5KG5A 4LIWA 4LF9J 5D8HB 2CDRB 4L74A 2QZ8A 3ZNUA 1RAHB 2FHJD 2Q79A 2JFKA 2CJYB 3IRWP 3JAMY 2ZOGA 5L9NA 1KOOA 2XMKA 4RW8B 4DR4J 2NS1B 4Y3CA 4ZLNA 4F4KA 3ZTQA 1HBMB 3NP5A 2V34A 1LV5A 1JNRB 4DPTA 3H5SA 4JV2A 5ETNA 1NJZA 3MM5A 4PG4A 1XNQF 2MZSA 2H65B 5CYMB 1N54B 2NSCA 1UP1A 1Q53A 4DSIA 3HSJA 1X9MA 4B08A 2J0XA 4ANEA 4DBQA 2G13A 2OEJA 4RNHA 2FC8A 1OSDA 5F8IA 3JSMA 4JI3J 3AAWB 3HFZB 3G4SS 3DLGB 2QLJB 8AT1B 3OFFA 3T5KA 1K1QA 1NSQA 3CJ4A 2UU9F 2D3ZA 2KL8A 3G96A 5AXMA 4FXDA 4KHMA 4RW7A 4I67A 2XC9A 4B9TA 2PD1A 3P6YC 1N8RT 3R2CJ 3VCDA 2MZTA 3C14A 5A8WB 3G6XA 2OPPB 2WBMA 4GRSA 1KBRA 2EFQA 1FEEA 4Y28C 4B9VA 2OP5A 4PG7A 1IBKJ 4KY3A 4OX7A 2PFDA 2MLXA 1QSLA 2GIQA 1LWEB 3I9V9 1X0PA 3GIJA 3CD7A 1RAEB 4JI2F 5J2NA 3HVWA 4BHQA 4JI7J 1LW2A 3M6XA 4N7TA 4A47A 4CO4A 5MLCV 3KLGA 1I1GA 5ETRA 4LR7A 3GV8B 4MIAA 3H5UA 1WDTA 4DL5A 3ZZRA 4OZ0A 5K20B 3Q24A 2V8HA 3B4MA 4LF5J 3M1VB 1XR7A 3R97A 5J2PB 1HNWF 4QPXA 3PX0A 2J6TA 1X31C 4P2MA 1SIWB 3D6FB 4YQWA 3NS5A 4AQYJ 3UNGC 1DTTB 3P96A 4DL0C 3S6EA 3TANA 4B3TJ 2PT0A 5D3GB 4JUZA 4ANDA 5KT6A 5A2QU 3PIOQ 3LWLA 1KSPA 4O3SA 2UZAA 1JLBA 3OL6A 3V81A 2CADA 1NBEB 1R8HA 3QGIA 2GIRA 5H9EJ 4YB6A 2AW0A 3RAQA 2A6OA 2BOPA 3I55S 5G0RA 3RR7A 4E0DA 3KHRA 3MMAB 5K14B 3EPIA 1S7HA 3TAQA 2UUCF 4NLOA 4WJBA 2YNFB 4JV5J 1UETA 3PYDA 3TZWA 3OUYB 1MN9A 2J9CA 1S6PA 3A8IA 4P73A 3ZZUA 4GC7A 4ELUA 2OFHX 2ALYB 2HPUA 3MM6B 3J80Y 4RR5A 4UY85 2BRKA 3SIPB 3KLIA 4NCGB 4P2SA 3CEDA 2ADCA 1RTJA 2B4OA 2VG6A 3AOAA 5C7PA 3KYLA 3MEEB 3NNHA 3QGPA 4I6WA 3QJJA 3UW1A 5I3UA 1KR4A 2BR0A 1MWYA 4DHVA 4DR7F 1S6UA 4LF1A 3C8YA 3BO2A 1YBTA 3CCES 1Y3KA 1VHFA 2ZH3A 5JVHQ 3M8QB 2ASJA 1OPZA 3IWXA 4K2XA 3H5XA 4YDXA 2QT7A 2IVFB 1X5OA 3GIIA 4URQU 5EN1A 3GTYX 1G4CA 3PX4A 1MU2B 3JTOA 1AYEA 1PBAA 4LR8A 4PRFA 3LA0A 3WIVA 2CWXA 4ETXA 1R7IA 2RMLA 2L41A 1PYSB 3V6JA 1WEYA 2E1PA 4JI0J 2B0GA 4XPEA 4WYWA 1HWJA 1Z4UA 4JI8F 4DFMA 1OIAA 4NXMF 2EK1A 1HIYA 2BM0A 3UDEA 2Y8WA 2DHAA 2DXDA 2WAQD 4NXMJ 4WKRA 3HSDA 1ZZFA 2AEMA 2OMOA 2RAQA 5M2UA 4Y2AA 2LDIA 3MTJA 4YY3F 5JUMA 1U6BA 3CD5A 2J6SA 3PHEA 1MLAA 3TVZA 4DR7J 2RKIB 3IGVA 2NREA 2CG8A 2A2DA 2FHJA 3MUVP 2ROPA 1X9WA 1RI7A 4U95A 2IA0A 3JSBA 1U26A 3LPEA 5CZXA 1RTDB 1SL1A 1WWHA 3TX0A 4DUYF 2BKOA 3IM9A 1IBLJ 3E2EA 2R7OA 3GFZA 3MI7X 1G2EA 2DITA 1CVJA 2FGCA 3HHLB 3QO9A 5DS7A 4B02A 1AB8A 2RRBA 4C11A 3KNGA 4USTA 3AQPA 1S1WA 1S6OA 4QYRA 5A6PA 4R5PA 2XM3A 1RB0A 1RISA 2CPFA 3DRSA 1KP6A 2MHNA 4M5KA 2LA6A 3SQGA 4M63A 4ED3A 4K50A 1SVDA 1E6YB 1RWXB 1FKOB 2FY8A 3D6HB 4WP8A 2X1AA 4DDFA 2C22A 3MAAA 4DFKA 2UVVA 4J9RA 4JYAJ 5SZTA 3EZUA 1VYAA 2CJ9A 2ACMA 2FD2A 3IXQA 2UV8G 3NCRA 4IR1A 1JXLA 3HZGA 5BR8J 4AQYF 1Y0HA 4TY8B 1SKSA 3KMQA 2C2EA 2QL7B 1FT8A 2QE5A 2ZOMA 2ZNZA 5B09A 4ZA1A 1EKRA 1NRKA 2QV6A 2V9KA 3W5ZA 2A3JA 3KK3B 4FF2A 4WCEQ 3D3CJ 1VQNS 2XLKA 2HSEB 2DRDA 4J37A 3A3PB 1KFSA 4KR0B 1L3UA 5K8NA 5E41A 5KFPA 1HNWJ 5GVQA 2H5JB 1XNRF 4A8FA 1UVJA 3VV2B 3HXMA 5L1IA 1ZAVA 1VQYA 5FJ4A 4LSLA 2W7OA 2JEFA 3KLGB 2ZHBA 2RUSA 3C46A 4LR9A 1WTFA 3TO8A 1Q7YT 4KO0B 3FVYA 3GV5B 4DPUA 2IYGA 2FJVA 2HQDA 1KONA 1WC1A 1ZAXA 5C25B 4F02A 2ZH7A 2OKQA 1VQ9S 1ICEB 3KUEA 4RKUC 3BGUA 3NGDA 2ZH8A 3NMRA 1D9DA 1KQSR 2ZHAA 3AFGA 3ZTRA 1PYOB 2Z57B 5GADU 1DTTA 2MQ8A 2BOAA 2Z0GA 1RT6A 1LK7A 5L38A 3KNAA 1WG4A 2MSSA 3DGPB 3I5CA 3IG1A 2B9XA 3KKFA 3P45B 1TFWA 1TVRA 2ZBCA 3AOBA 5EDWA 2NXUA 2OEKA 3FFIA 3HZEA 2MKHA 3ILIA 1E6YA 3LF0A 5LMNJ 1AA1B 2YY3A 2M0GB 4B9MA 2K1RA 4DV7F 4YB5A 3HJFA 2V5HG 2B9YA 2RE1A 4KHRA 4DR3F 1HD1A 1N33F 2CNLB 3FMBA 4X65F 4DSFA 4DV7J 1OSCA 5KFVA 3W1YC 4LVNP 4YEAA 5GAHI 1FFWB 3IM8A 3PEHA 3DRRB 1RWVB 3EGWB 1F3FA 4HTJA 2U2FA 4MK7A 4C6AA 1KDNA 2RQCA 3MM9A 2DHSA 1RYRA 3T1HJ 3BPSP 4PQUB 2NSBA 4RPFA 1D0EA 5D4OA 1GQEA 1VQ5S 1Y9OA 1OS5A 3Q8UA 4UQTA 4U8YA 3T19A 1D8YA 4J9MA 2OHDA 2RHSB 2VBWA 4IH5A 3MMCA 5KOXA 4FYDA 2CVIA 4KGKA 2BZ2A 4G1PA 5GAGI 1RT3A 1J27A 2N3OA 3I4PA 3SCLE 3OL8A 3K5PA 3NRBA 4WP9A 3F41A 5DZ6A 4ED5A 1F9EB 3N4WA 4RJVA 3IA0A 2R7RA 2HBQB 1HPZA 1ZA1B 2X3DA 3B8HA 1NDCA 3D7SB 3IRXB 4OYZA 3G87A 4KO0A 1CULA 2IAJB 2CQPA 3MR2A 1NK7A 5B0BA 4LRAA 5M2PA 2HURA 2X51A 2YVSA 4ICLA 2DPJA 2HW3A 2VG7A 2GAGC 2AHOB 3HKWA 5C25A 2MHEA 3HFKA 5EWGA 1HBMA 1N36F 1UTAA 2UV8A 2J7WA 1WUUA 2CZ4A 2Y0BB 1UCNA 2M8DB 3LAMA 2XYPB 3MPDA 5KFTA 4F25A 2HNZA 2F4VJ 4PXCA 5LSRA 1PJ5A 2NYHA 5IC4B 2ZM6J 3DOKA 1S0OA 1KNZA 5CAAA 1UWBB 3DI6B 4DV4F 3QSIA 4DOZA 1R27B 2D7SA 1T0TV 5KG4A 4USVA 1NHKL 1Q16B 4OZ5A 4DJBA 2LXFA 3WQPA 3M2RB 4UTGA 4DSLA 4AUKA 2FVRA 2FDNA 2J0SD 2ZD1A 4LF8F 4ZPTR 4HDHA 1K8AT 4P10A 5J1PA 4URGA 2BE7D 4WFBQ 3OVBA 1TUGB 3QBCA 3V4MA 2ADBA 3N0VA 3U27A 2EFVA 4X4TA 1EP4A 1BMQB 3H42A 4LF4J 2NZCA 4YS2A 4ZLJA 4QU6A 2KJWA 3OPKA 3QRQA 1CS4A 1RT3B 1Q78A 3LP2B 3HO1A 2CPHA 2OD4A 3P5TL 1RHQB 2GFFA 3KK3A 1LOUA 5J2NB 5HQ8A 4K7QA 3RUBL 1N34F 1UWAA 2MKSA 3RAMA 4Z37A 1S9EA 3EX7B 2YH1A 2C2MB 2EEYA 3FJ2A 1CG2A 1LWCB 1O0PA 3BM7A 4IYQA 3TA1A 1CC7A 1RT7B 4P72A 3NY0A 4DUZF 3K5OA 1DTQA 4P71A 3G71S 5J2PA 1NJIT 4GKKJ 3TJ9A 1BQMA 5KT5A 1MMDA 4OI3A 4F4AA 4QU7A 2UUTA 5F8NA 4M95A 5LM7E 2W9CB 4YUDA 2UVRA 2IJFA 2ZC4A 3DOMA 3N6LA 5DG9A 4Y0FA 3HD1A 4LFAF 3G82A 1OY9A 5E3RA 1Q82T 4YHHJ 4DLGA 2H4WB 4B3SF 4JOUA 1TV6B 4HR2A 1T9XA 3CJQA 3P4UB 5ADZA 2YWWA 3OUYA 1CBKA 1FKPB 1N34J 2KH9A 1RT6B 2MY8A 2PI4A 4U8VA 1AXQA 5ETSA 2KZMA 4KPCA 1LWXA 1QM9A 1KWMA 3H5YA 2OSQA 1RTJB 5KFRA 2B3TB 2PA8D 1WHWA 2PSZA 3WDOA 4YHHF 4UQGA 1VC0A 1UVIA 3B54A 2V63A 5A76A 3CC7S 3MOJB 4DR6F 3PM9A 1KS2A 4ZPBA 2BUNA 2EVZA 2CWKA 4JI1F 1SKUB 1P1TA 1M5SA 2IJNA 2B56A 2RQKA 4Y34A 3C6UA 4ZK7M 4UT4A 3J7Z5 4USKA 4IUFA 1DJ0A 3H98A 3G6ES 1UVLA 1GT8A 4M5LA 3U7JA 2FIUA 3HI9A 4F04B 2HGNA 3GSIA 2MLZA 3I87A 2RDJA 4EEYA 1ZYQA 2RJZA 2GNKA 1XMBA 3I6PA 3LTOA 1FD8A 3U02A 4JI5J 4FNHA 4WP3A 2HS4A 2FJEB 2KB2A 4IOAQ 4R0JA 2QLWA 1LWEA 4FS1A 4NRUA 4WE1A 2QLXA 2HIQA 4JI4J 2OPSB 3ISNC 2HRTA 4DQPA 3VZHA 1WELA 3J7YI 3UDLA 1REGX 4K4VA 1YSJA 1C4CA 4O3PA 4ZVGA 3H2LA 3Q8VA 3HP6A 4RO0A 4WIIA 2VD3A 4C8YA 5DGBA 5HVHA 3IR7B 1M5KC 4KJIA 1Z2ZA 4DV2J 1LFPA 4KH0B 3DFEA 3HHLA 2C28A 2HNZB 2K3KA 4C11B 4R5PB 4DL3A 2XNQA 2K7JA 1HNXJ 3GR1A 2OAUA 3OVSA 1H74A 1RWUA 3KTQA 3GCXP 4NMLA 4F36A 4RBUA 1FX4A 2SXLA 2CG4A 3Q23A 2DVIA 3M6UA 3ZZ0A 3UNYA 3L7OA 1P6TA 1NK6A 3H2VE 4LSNB 4PUOB 1N33J 1WACA 4C8MA 4X4QA 4ZPVR 1F2HA 3QWUA 1UW4A 4ELTA 2CJKA 3HULA 1C1CB 3C66A 3IS9A 3MM6A 4LBHA 4ECYA 4JI3F 1KHVA 4M5DA 4QPTA 3SV4A 1OJ4A 2IRUA 1FWPA 2CQGA 4EK2A 5IM0B 5EUHA 3BO4A 2BYCA 1FWKA 3M8PB 3MEEA 4Y65A 3ZNJ1 3TUZC 3RB6A 2CIMA 1XN9A 3ENAA 1SJQA 5DZ7A 3C2PA 2GQQA 2P9GA 2H4YB 4USHA 1FRIA 5KFJA 1RA7A 2BX6A 2K06A 2QTWA 4FKYA 5GMEA 3Q8PB 1YX2A 4X4UA 3G8TA 4ZVEA 4U96A 5T14A 2OPSA 2U1AA 2HFZA 2DR6A 2G0IA 2A0FB 4DR1F 1JLGB 5DLGA 1U1RA 1V3RA 1S72S 1KTVA 5E2QA 5F3TA 1VQSA 3EVMA 4TU8A 3AD9C 1KOHA 3FCWA 3L7PA 1W26A 3WC0A 2BQRA 1XNRJ 1B3TA 1TKXB 2DHHA 1S99A 1MNEA 4YP3A 5E3AA 3TI0A 3DHWC 2C2ZB 3GIRA 5LMUF 5KG6A 1RT2B 3M05A 1MWQA 2IDLA 2XNRA 1PKUA 1UW9A 3LGMA 4ZJOA 1J2VA 5J1EB 4KHPF 2VFRA 4OHXA 2M70A 3EVOA 3KJFB 1KLMA 2H9ZA 2JC1A 2RKIA 1FRJA 3W2VA 5H1SV 4JI4F 1NPPA 3AB2B 3K5MA 1K0TA 3O44A 4TLRA 1K47A 4ANCA 1XQIA 5D0RA 2H51B 4KT0C 3OLBA 1S4FA 3R8YA 1NDKA 5MAOA 1T05B 4JI5F 1YI2S 1TV6A 1RP5A 2GHVC 3SDEA 3ISND 2MLYA 4HKQA 2HK2A 2YBVA 4MKVA 1GEHA 3JQJA 4RBTA 2KFYA 1SH2A 1TMJA 3EMTA 4HACA 1G3OA 2HAIA 1C1CA 4M5IA 2D1CA 2YWHA 2Q3PA 4O4RA 4F4ZA 5LJ3Y 2DNNA 3D3BJ 3N5FA 5G4DA 3VGSA 5AJ3F 3T5JA 3DXSX 4FVCA 5HROB 2HMIA 3WHIA 2QL9B 4LUBA 1BQNB 5E5NA 3D28A 2QEXS 1EHWA 1SQGA 2CJAA 5BXIA 1RT1B 1U0SA 2CQ3A 4Q44A 2RRAA 3B78A 5JJBA 3GIKA 1SL2A 2IM3A 5HMYA 3L3CA 1N6QB 3K89A 4HT7A 2LEPA 1RWMB 2KRBA 1DFDA 4MYUA 1RACB 4ER8A 2W9BB 2NPFA 4QIFA 2HK3A 4RUCA 3UE2A 3RAXA 3DRXA 3OTOJ 5HMZA 1HQUB 3OXFA 4KSEB 2JNJA 1M90T 3PO4A 1FJ7A 5A2QY 5CXTA 2IRYA 3T5LA 2OI2A 3NCPA 2UXDJ 1L3TA 1X4EA 1Q8LA 2J8SA 2DNQA 3IBWA 1NSPA 2GGPA 1KLMB 2XYGB 3GU0A 2UXDF 1NO8A 1UEKA 2G2ZA 2QSWA 1UWBA 3DI6A 3KDOA 2ZOFA 5D0HA 4FDFA 4LREA 4FVMA 4Y6IA 4Y2IA 1TKTA 1H6KX 1HI8A 2CQCA 2KXHA 2C2NA 3BH6B 3C15A 4GVLA 2E5LJ 5F9LA 4Q0BB 1YG0A 3O2IA 4JI8J 1FTRA 1IBCB 2YKMB 3H2UB 2XS5A 2GQ2A 2CPDA 4C3MA 4LT6A 4HACB 4CO3A 3S7RA 1PAUB 1AZSA 2E7VA 4B9SA 1HL6A 3P49B 1QSYA 2WONA 4FYWB 4L72B 3FFIB 2HEKA 5E3CA 4XK8C 3QGHA 3PTWA 2QIFA 1KQGB 4DR5F 2K1RB 1P9YA 4ZCKA 5KG7A 2C2DA 4YB7A 4DFPA 2R8JA 1MROA 2X1GA 3SCIE 2VQEJ 2E9ZA 2AWZA 1URNA 2GJ2A 2ASDA 2V9WA 3BB5A 1C4AA 3CO0P 2HGMA 1U2CA 2ZHOA 1RJJA 3R5AA 1W2IA 2XBPA 1SIZA 3JTNA 1S9EB 2F4VF 2I8EA 3B6BA 4RU2A 2N4DA 2PO4A 3BSOA 1TUVA 3NOGA 3K58A 5HLFB 1I94F 4W90B 2I5JB 3RRHA 1DTQB 3DLGA 4G1QB 2LEBA 1UFWA 1R31A 3H90A 3ETOA 2WOMB 4UZBA 2WZ1A 3D68A 1SQEA 2WBRA 2YH0A 2VG5B 3CO9A 4V1Ak 2AYGA 4PYAA 5KG2A 1R43A 3PIPQ 2Y8YA 4CLZA 4B3MJ 1NSKL 4RBVA 4OI4A 3FRYA 2NXNA 3NG8A 3C6TA 2IMWP 2VUGA 3GLJA 2PGCA 1GMWD 1UMJA 3PCOB 4DZDA 2XS2A 1TKTB 4X62J 2Z2ZA 4A8QA 2BJDA 2OMLA 2YNGA 1YJWS 4W92B 3DRYA 2ZKTA 2QA4G 5E3PA 2DGVA 4X4SA 1IKYA 1JK9B 1FKPA 3M8YA 2H1YA 5GAGU 1JLQB 2NUHA 3B4DA 3MZIA 1AT1B 3GIMA 1LW2B 4ZS6A 1HWKA 4ZN1A 2LECA 4MTPA 2KZZA 2Z8QA 2IY5B 3OHAA 1HBNA 2DNMA 4PWDB 2FQQB 4ZOSA 4H4KA 4DPWA 5I3QA 5DLFA 4FS2A 1XTZA 3BN4A 5HVFA 1FTCA 4FYVB 3RGIA 4CH0S 1FI4A 3M2RA 1ZZNA 1J5EF 3T1AA 3VQSA 4J9LA 2BANB 2BXJA 2P9CA 2XZTB 1TK8A 1S1VA 1A0OB 1K1SA 2MQOA 2XSJB 1GMVA 1HI1A 2V67A 3UN3A 4CP5A 1S79A 2RUGA 3VAGA 2Y9HA 2NQPA 1FDAA 4DR2F 2MMYA 4KRWA 1XNQJ 2F5GA 2EKNA 3PFEA 2RIJA 4KB7A 4C7QA 5HLFA 3SMZA 2J0QD 5ETVA 2M7SA 1YJUA 2R3VA 1I51B 2V69A 2RNEA 2V4RA 4J9QA 4IG0A 4DMZA 2KU7A 3OW2R 1GFWB 3AHPA 2F9JA 4J90A 1CJTA 3VAMA 1WSVA 2X1BA 2PA3A 3AJ2A 1RTZA 3D1HA 3TOQA 2DJWA 4R8UB 1NK9A 1LWCA 1XC9A 3W2WA 5GMKa 2MJUA 2AYBA 2MZRA 2JSXA 3C16A 2J7UA 3CB4A 1HQUA 3HSGA 4QBUA 4FBTA 2GZOA 3G2XA 3V6DA 2V8PA 1GNKA 4USIA 2OTLS 3T9NA 2V8VA 4AFFA 1S59A 3HX9A 2ZZTA 2WVBA 2VZ9A 3BN7A 4LF9F 5F8JA 1FE4A 2XWXA 3V2UC 3DOMB 3KHHA 2DY1A 3HSZA 1GTEA 5KFQA 4X65J 4LRCA 1MU2A 3Q8RB 2B9EA 4USMA 2XSFA 5D4NA 3ZZYA 1PJ7A 1T9TA 2KXFA 4FF4A 4MK9A 3TNVA 2POKA 3QYYA 1I6JA 4QIVA 4Q8FA 2CKWA 2MKCA 2EC0A 3DLKB 3NL0A 1YJ7A 4AXIA 1NZAA 1WHYA 2KKHA 5KFUA 3W8GA 2E1AA 1VMBA 4M5HA 4C2MA 3M30B 2ZH4A 3OR1B 2C1EB 1H3DA 5FIIA 2B5JB 1MG7A 3UVJB 5LOQA 3UCUP 1VRUA 2OFGX 1VJQA 1D9FA 2B7CB 4F2RA 2QMWA 2XMMA 3JAMU 2WB4A 1IJFB 4EU0A 2COLA 3DDKA 4R0EA 3W8PA 4JYAF 1XIQA 3T1YF 3LQVA 3GJRB 2E1MC 1FCAA 3KG0A 4OYOA 2HG4A 4RUAA 3Q8QB 1CSJA 2ZH6A 2LQ9A 2RH3A 3FUYA 1IBLF 2R8IA 2ZH2A 3G8QA 3CJKB 1TK5A 2FLNA 3S1TA 1F3VA 2DKOB 2IRXA 4G6VB 4IFYB 1LWFA 3TW0A 4PZVA 3FQKA 4ZKAA 1S7IA 3BKUA 2I6WA 1FO1A 3DYAB 3SQGB 1R0BG 3A4TA 1V5IB 5KFOA 4F4YA 3RZAA 3BBBA 2CQIA 1WC4A 2I5JA 1S1TA 4DF8A 4G65A 3L09A 2P9EA 3PNIA 1OY6A 3EGNA 2WVFA 2XMJA 3BSAA 1RDRA 3R5JB 3TQEA 2ZJPQ 1NXIA 2E5HA 3PXGa 3MCMA 4DL4A 4N77A 2AJ2A 5FLXY 1RWOB 5KT3A 3MURP 3LP0B 3OFEA 5LL6d 4F3MA 4V19X 2Y0SD 2W7PA 2KJVA 4DZ6A 2UXCJ 1DBDA 1S9GA 4DN0A 5C42A 2Y3YA 3ZXWA 3UI3A 4L73A 4DV5F 2K2PA 3ZC4A 2BDPA 4U67Q 3CIZA 2CQDA 1Q86T 1REVA 2O1PA 3D66A 1U45A 4JI1J 3T41A 1SPBP 2IMOA 2I9SA 3R3TA 1APSA 1U1NA 1OQ3A 3EYZA 3RRGA 3CCJS 3MPUB 1BUXA 2RDDA 2ZH5A 2VC1A 1DZ5A 2HNDB 5T7LB 2APOA 3CE8A 2XS7A 2VPYB 5IWAF 3I82A 4LBIA 3RB3A 3AOCA 4OHYA 3MCSA 2J9EA 2VPWB 4P75A 2B5JA 4HI1A 4IFVB 4UOHA 4DR5J 5CABA 4N56A 4GO5X 1JJ2R 5KFAA 3ICLA 2VL1A 1VR6A 3LH2S 4MT1A 4Q45A 1YJNS 4RW8A 2LXIA 3NAHA 2R4FA 4LSNA 3OTCA 3TQ1A 3LO3A 1TFYA 4NLVA 2K3IA 3MXHP 4B3RJ 2M4MA 4KKOB 1F0XA 4FYXB 1ACMB 3QAEA 3PO5A 3FBBA 3UD5A 1NK0A 4EZ6A 4BBYA 4OFZA 1QTMA 4Z2XA 3N5BA 3RBEA 3BYRA 3THPA 2R7WA 2R7XA 3NCQA 1YQHA 5FD1A 4TU9A 3IMQJ 3OTOF 4CTAB 2LKZA 5EX0A 3KLFB 2UVWA 2XQCA 5DGAA 1O5JA 2OJ3A 2YXLA 1RCOB 2P8IA 4ED1A 2GV1A 2F8HA 4P2XA 1WJ9A 4FF3A 2FY1A 2CPZA 4WBFA 2RF2A 2HVIA 4ED7A 4GKKF 2AT1B 2ZM6F 4F3OA 2W2MP 1JLGA 5ETMA 3TYTA 2WTFA 3A13A 4RW7B 2DPIA 4ZVUB 2E44A 2FVPA 1B7YB 5LMUJ 3GB0A 1C1BB 2XO7A 1OQ6A 2W2QP 4CWBA 1RT4B 2VPZB 1M5VC 2G2YA 2KDOA 3MEGB 5CZVA 2PE8A 5I42B 3QLHB 2LQ8A 4DSJA 4M94A 3NGTA 2WSFC 4F8RA 3K5NA 2E1RA 1XMOJ 2D69A 2W2OP 3LOUA 4CLFA 2KM8B 2XY6A 3BDEA 1RSCA 3KUHA 3AT1B 1ELOA 3SV3A 3W9IA 1RAJA 3ZZTA 4CRJA 6FD1A 1GXTA 1O6XA 1M1GA 2DRBA 4O3OA 4EBDA 1CULB 2IAJA 1V3ZA 3PG9A 1UA0A 4KV8B 3M8ZA 3WBZA 1BLUA 3TVYA 3CUNA 3E3XA 3H25A 4ECXA 1M1KT 2F1FA 3ENWA 3GPAA 2FJBB 4ZVHA 1S1XB 1KVJA 2LXUA 2MPUA 2B4PA 3MM7B 1RAIB 2VASA 4X64J 4ZP6A 1UPPA 1N5YB 1IWGA 4LF7F 2HHTA 4PG6A 1FDNA 5IC6B 4AYBD 2HNYB 4ZVFA 1NEEA 1RTIA 5KTQA 5GADI 1RABB 3J7ZT 2AU0A 5KG0A 5IT4A 4CTAA 2UXCF 2M52A 1Q1KA 3RW6A 3M2VB 3MPWA 2O5DA 3MMJA 3VQTA 2YNIB 1CQNA 3M7VA 5ITHA 2RF2B 3AXKA 3D2WA 2HHUA 2QC3A 3A12A 1MSWD 3TA2A 4A48A 4K0KJ 4ZVRB 1Q8IA 3E51A 4CQ1A 4OZLA 4Q8EA 4HH1A 1WEZA 4IR9A 1Q8KA 1U09A 4DV0J 3DYAA 1JB0C 3H7HB 1IBKF 4L3NA 2VG6B 2P6TA 4NYPA 1JJ4A 1YHQS 4KC5A 3UN2A 2XGPA 4O44A 2DHXA 3CCQS 2AGPA 2AQ4A 3LP1A 1FFGB 1RLDA 2QA1A 3T1HF 3FCHA 5I42A 1TZ0A 3KLHB 1ZS6A 3W9HA 1QY7A 4M5NA 4RW6A 4ECSA 3THTA 4DV1J 4M5GA 1FNMA 2F8MA 2JVRA 5J2MA 3CJ8A 4DUTA 1XMQF 4G3IA 1RKIA 4LFBJ 4USJC 3ZTOA 2Q1LA 2ZUGA 3C15B 2VB6A 2NPIA 1N88A 2UUBJ 3VF0B 4JI6J 4C8NA 3GG0A 2HQIA 1WI6A 5H9FK 2IPOB 1T9UA 3QT7A 4CLWA 4KTQA 3HJVA 1NZ8A 2EKYA 1D9AA 1DURA 3U1MA 3H4BA 3Q0AA 3VALA 4YOEA 4J9UE 3P5BP 5KG3A 2LQBA 3O8WA 4ES2A 1RXOB 2YPZA 2KM8C 1PAEX 6FDRA 1HBUA 4OJ3A 3MM7A 2DO4A 3FBCA 2XSJA 2KT2A 2HHWA 2G0JA 2BM1A 4LMZA 4NLDA 2KYXA 5HANA 2AYMA 2Y1RI 4J7CA 1DRZA 4WF9Q 5CYQA 1HNXF 4USUA 1CJKA 1FESA 2CZVC 4WFYA 4NLGA 3Q2TC 1WORA 3PJ9A 2D74B 2EFNA 4KKOA 4M5MA 3J80U 2L48A 2ZDPA 3MCOA 3CIMA 4C8OA 2L3MA 2J9DA 4HHUA 1E6VB 1Z1ZA 3Q89A 4WWSA 1VBKA 4CZCA 3TAPA 2B6AA 3MEDB 2XI2A 1SJ3P 4R8UA 4FF1A 1H2UX 3W2WB 3RBXA 3PRDA 1FKOA 3RRKA 1T3OA 2ZE2B 4E98A 1H2VZ 4N41A 2KT5A 3EZ5A 1VRTA 1Q79A 2VKRA 3TZYA 4CT9A 1CEZA 1KTQA 4I56A 1UJ4A 1NH7A 5IQ6A 3KLHA 2VG5A 2L9WA 4BWMA 4I69A 1JNZB 2FHKA 3HCXA 1IKXB 2VKZG 2HQGA 1CJVA 1H2TZ 3BGRA 1GX5A 3L95X 3O3LA 3J81Y 5FLXU 4HHJA 4ZIVA 3V6HA 2QFIA 2CXEA 4ERDA 2ZJRQ 3MWBA 1C1BA 1Y5LB 3CCZA 1JXEA 2WK4A 3B82A 4XIUA 1RCXB 2BJEA 3ADAC 4HLBA 4WFNQ 5CCLA 2PC6A 2Z30B 1X4FA 2GVDA 5L39A 1PC5A 3OTBA 3DDIA 1M5OC 5J2QA 4A46A 4OYPA 4ECQA 8ATCB 3DU5A 3D9BA 3K0JA 2V94A 2HS0A 5IZHA 3ITHB 3U1LA 1U6ZA 3GP9A 1XERA 5DETA 1VHIA 4J9PA 1RUSA 2BBEA 2D41A 2FHOB 2J0WA 2HFSA 4O3RA 1XMOF 1NB2A 4ENOA 1U1OA 5IOLA 1HWIA 3KK1B 1U7LA 3AB4B 4I4BA 3FBEA 3EXYA 5KT7A 4B9LA 1OWXA 2WCXA 4Q7AA 5DO2A 2K7KA 1VBZA 4FPRA 5KFGA 2C2OB 1KRPA 2MXYA 2I2YA 2BEFA 2BANA 4X84A 4AXJA 2CQ0A 2CNNB 2M88A 4I64A 4NA2A 4GKJJ 2CNKB 3DGPA 3TEGA 4EMDA 2F7VA 8RUCA 2UUCJ 5L1LA 4LIRA 4XPCA 3W64A 1IKVA 1RAGB 2XMAA 3SQOP 4UUWA 5I3PA 1WF2A 3QGGA 3CCLS 4ZVQB 3UPFA 1GXLA 1LKZA 5L9XA 1RU2A 3CJSA 4LVOP 4WTOB 2CQ1A 5AJ3J 3IWLA 2C3UA 2YQ0A 3A3NB 1FRHA 1G6BA 3HT0A 5HN0A 1YJTA 4CO0A 1GMWA 1IKXA 3MAHA 2V2VA 2YKOA 4FBUA 1WG1A 1QLNA 4ECUA 1LQ9A 1EETB 2VF3A 3GJQB 4OZNA 4M5DB 3SSRA 2W1BA 3AODA 3ZO7A 4DL6A 2BE9B 3BJYA 1NHVA 4GVBA 3KJQB 4ILRA 4F0KA 1Q95G 2FYXA 1GK8A 3UFCX 1H7WA 2WVCA 3PJWA 3QRRA 1MW7A 1D09B 3RU0A 3HVTB 2FLPA 1ZAWA 4JI7F 4X4VA 5B0EA 1PCAA 2JZ5A 1YJVA 2V4JA 1IKWA 3OFHA 1FVSA 2DRAA 1KHWA 4Q43A 1P9QC 2YWEA 2EWHA 1R8BA 3IRXA 5C24A 1NUEA 4IFVA 2ILYA 4ZLPA 4NCBA 2OELA 2XLIA 1UKUA 3BGLA 3HF5A 1NM2A 3HT3A 1TU0B 2DGXA 2EFOA 4DG1B 3MMBB 4NLUA 1Y7PA 4NXNJ 1AROP 2AYEA 4NL5A 2QLBB 4DSEA 1V3SA 4CLKA 1BHNA 2KHDA 3UQSA 2CPXA 2DH7A 2JH3A 3BBFA 4QIWD 2IIHA 2NUUG 2JRSA 1ZTTA 5D3GA 4EYIB 2XMVA 2AGQA 1UJ6A 3U1NA 1VRUB 3W2VB 4EYHB 2YWKA 1FRMA 2DEIA 3MDFA 5CYQB 3D4JA 1EARA 3G6VA 1YBUA 1FE0A 2IM2A 2ZVIA 3BPDA 4ZJQA 4H4KC 3MMAA 5K14A 3SDEB 3M2UB 3DLEB 4KH1B 3CJ3A 2IC3A 3VR1A 4LBPA 3EGZA 1CC8A 5IT0A 4JI2J 1FJGF 1ZBTA 3QFHA 1S6PB 1RWWB 7FDRA 2E1CA 3TJ8A 3PW7A 1SC1B 5K8PA 1EETA 1WC3A 3OSNA 1VBXA 1N48A 2AV5A 4NEZA 3LWMA 3VGUA 3M9MB 3M9OB 2ASLA 5DG7A 4WZMA 2QA4S 5DG8A 4H4MB 2G2OA 1VRTB 1D8ZA 1OY8A 2GVZB 3JTPA 5C24B 2B4UA 1EKSA 1EP4B 1N52B 4WU2A 4IDKB 1FF2A 2LA4A 1HW9A 3DM2A 1NJYA 2JEJA 1NKEA 5CA5A 3VGVA 1VQPS 3ELHA 2YNHA 2I38A 3E01A 3OL9A 2JEIA 3GCWP 2KO1A 2OSRA 1JMTA 3BKFA 4C8ZA 3GWCA 2GVDB 2DK2A 2HHVA 1J5OA 1TL7A 4A4JA 1UVKA 3CDUA 4KV8A 1PYTA 3S8SA 2VQFF 4C48A 1NDPA 1A7GE 4OI2A 5LMNF 4RW4A 3ZTPA 1FJEB 1WHXA 4XAKA 4C9DA 1HNVA 3C19A 1Q5VA 3LW5C 5D0EA 1QVFR 3LUYA 9RUBA 1C0UB 3G6YA 1FERA 2R7SA 5BYQA 3ZTSA 5IT9Y 2DH9A 4DLEA 2B43A 5HMWA 3MR3A 3J81U 1R8AA 4A8WA 4HI2A 4NI2A 2DXEA 1VS3A 2LLZA 1UPMB 2CAJA 5D4LA 1U4BA 2R7UA 3QMQA 4HDGA 1F2GA 4P2FA 4EZ9A 1C0TB 1B4SA 4NMXA 2YNIA 4ITSA 3MAQA 3M2UA 1PILA 1X4BA 5IS2A 4UZCA 4DV2F 3CJ5A 2UP1A
chains in the Genus database with same CATH topology
4MIWA 3CJ0A 4K4UA 2ZNYA 2RD5C 2XZWA 4X62F 1DHMA 2ERRA 3HVRA 3KLFA 2G1DA 3DRSB 4ZPWR 4M1KA 2Y1JA 5B0AA 2XMTA 2RQMA 1KQFB 2N82B 1SL0A 2F40A 3LP1B 1V6HA 1ROFA 4HTIA 5HBMB 4HVZA 5KFKA 4I6YA 4N8OA 2N7YA 1KC8T 1YTYA 3DM2B 1W25A 3QJLA 4B3MF 3GQCA 3KG4A 1RT4A 4RNMA 3AH6A 4O0IA 2N7CA 4ID5B 3QIPA 2D9OA 2JDJA 2ILZA 2AX0A 1ZETA 1W2BR 1L3SA 4TLQA 2W4CA 5KFXA 4K4TA 5B0FA 3NNAA 1RTHB 4MAKA 4MYTA 4WE1B 4X4OA 1IKWB 2KG1A 4WU3A 1N56A 3O6QA 2XCAA 2M8HA 1S9FA 4B3SF 1D1UA 4ZP7A 3BO3A 3KHGA 4NPOA 3TARA 2XI3A 1F5AA 3C6TB 3OTEA 2RVJA 3NMAA 2HHXA 1QVGR 4F4WA 4F26A 4BWJA 2RSQA 3QZ7A 2HZCA 5THWA 3OJSA 2W24A 1E6VA 2FUG9 4X4NA 3I56S 2KFNA 4EGLA 2IM0A 3H40A 2HHPA 1YRUA 4NLXA 2MQNA 3FGVA 2EW9A 5CYMA 1UEUA 1TKDA 5BJRA 4K4WA 4PWDA 2DNPA 3MD1A 4YFUA 1VC6A 3LALA 4PPDA 3UD3P 3GFHA 2E29A 2DR9A 2LU2A 3IS9B 1KEKA 1TL5A 2CVEA 3K8VA 3SI8A 1L3VA 5A8WA 4JI0F 3SXLA 2OPQB 1TR0A 4V19J 2KFZA 1DQ9A 1PC4A 2WSCC 3CWJA 2G0CA 3OR2B 1AUDA 4U7CA 2DIUA 1LXNA 3R1HA 3AA8A 2VH7A 3GYXB 2HGLA 3IO1A 4C0OC 5J2MB 4CNZA 1WD6A 3AA9A 1VBYA 4LF4F 1L5UA 2RT3A 2ZBIA 3K5LA 2J5AA 1PGZA 1YWXA 4O4GB 4DQRA 1DARA 3DRPB 4RWXA 3MPYA 3T6JA 1TKXA 4RW4B 2XY5A 4F2SA 4ICLB 2YWGA 3MPVA 2JLFA 3VAHA 1HBUB 2KHCA 2LVWA 3FEXB 3M1VA 3N28A 5K9FA 4DQIA 5F0UA 4RWWA 1IQTA 4Q2LA 1IJEB 2DTJA 5HI7A 3DOKB 5D6GA 5EWEA 4CNYA 4MJKA 4UUXA 1U8SA 3R5CA 2A18A 1VIOA 1B64A 1WF1A 2CPYA 3FDSA 5B0GA 4B3TF 3N6MA 2V4QA 3TUIC 3VAIA 1KVIA 4QCLA 2K8GA 1M0SA 2HRYA 2DNYA 4DX8H 1L3KA 4NLWA 3HLUA 3KLEB 2W4PA 2XY7A 1QAXA 3BR8A 4DV1F 1V9OA 5KFEA 1GAOA 2IHR1 4OX8A 3DLJA 2OPQA 1IUJA 3HHDA 1ZTWA 4OLOA 1YRTA 4RW9B 4OHZA 4X4PA 4IQMA 5DJBA 4A8KA 3US5A 2VPXB 1OO0B 3LP2A 1JLFA 4XDCA 3CCVS 3CJKA 4IOBA 3M6VA 4K4XA 2AJFE 2MZQA 2Q6CA 4IFYA 1VQ9S 2GC8A 4C0BA 5F9NA 2PI5A 5K8MA 1QE1A 2DR8A 1Z2LA 2DHGA 3GG1A 1X7VA 2YKPA 2FTRA 5KFMA 2ALZA 1R6YA 3IAM9 4P7TA 3V5RA 3CSKA 4CH7A 4QWDA 1U1PA 2HVHA 4QYZJ 3UD4P 4QR0A 3M8RA 2PEHA 2FC9A 3BEGB 4CT8A 2M3DA 2NR0A 2JLGA 4ILLA 4I2PA 4X64F 3SFGA 3CF5Q 2FGOA 1SUQB 3M32A 2E7WA 4B17A 2G4BA 3KK1A 4ZCIA 4QWCA 4NXNF 3KOAA 2C3MA 2ROEA 4ZCLA 2AJ0A 2V8DA 1HWUA 3LAKA 4ZHRB 2YX7A 4TQRA 4NZ6A 3DHXA 1QJHA 5LT5A 4QJVA 5HP1B 5A8RB 5BYSA 3OQ2A 4R25A 3TAMB 1SJRA 1RTDA 1IXKA 1HWLA 2KYZA 3D1OA 3QO9B 2BABA 4DR4F 2PFFB 1U47A 2RB7A 5JVGQ 4NX9A 2HFNA 3MECB 4NA1A 1OPIA 2E5GA 2L08A 1VQLS 1IKVB 1WG5A 2JLEA 4KQZA 1FK9A 5HMXA 1MMNA 2EG2A 3FQLA 1FJCA 1HYSB 4DEZA 3ULHA 4OHWA 1KD1T 1QAYA 4B3OA 2FJXA 2HRUA 2JVOA 4N76A 1SI9A 2QSFA 1FHTA 2CPIA 3DC2A 1JLFB 2E5IA 4ZMMA 3C6UB 4DPOA 3TUJC 5KG1A 2CJBA 2HWIA 2HWTA 1QTMA 3TP2A 1ZOTA 1NK8A 3HVAA 2FLLA 2PDAA 1FDBA 2KRRA 1J5OB 2Q66A 2DGOA 2VA2A 1U24A 3RB4A 4A8OA 3KFWX 3G8SA 3V4IA 1VGYA 1YJ9S 4OZJA 2DISA 1CQMA 1SJ1A 5B0DA 1S97A 2BRLA 1UL3A 2D9PA 4ED6A 3TX8A 3EUNA 4LSLB 1TKZA 4N47A 2YX4A 1X5SA 3FZBA 1N5QA 2F9DA 2UVUA 3R27A 4IO1A 2XGQA 4ZHRA 4DG1A 2MJNA 2V0NA 5KFCA 3HDSA 3Q2SC 3OLAA 2W8LA 1ZM2A 4O3NA 2DH8A 4OLPA 2DGWA 3H20A 1TL4A 5A8RA 2LEAA 4J9NA 3WC2A 1TL3B 4TYBA 4PR6A 2RS8A 4L6V3 2NYIA 3CULA 1JLQA 2Z4PA 2OTJS 3IG1B 2NZ4A 1F5CA 1HARA 3CTRA 3M9NB 2KN4A 2GW8A 2WRMA 2O01C 4FXVA 3AQOA 3DDNA 4GC6A 1ZH5A 4WXOA 2ZITA 5LJ5Y 4KFBA 5KT4A 1R89A 3DRRA 3BGFA 4QIGA 4NOHA 4OJGA 2ZZMA 2Q43A 2DGSA 3I96A 2R7QA 4IRDA 5IM0A 3ZZOA 4RNNA 4RLEA 2OPPA 4PQUA 3M8PA 4IRCA 4LQ9A 3M2VA 2DGTA 2ZKUA 3VAKA 1VQKS 1N32F 2JOQA 2LDYA 3PACA 3CDBA 2JFDA 1LW0B 2OPRB 3WX4A 2B4VA 4C8LA 5KFHA 1S0VA 3SSQA 2VOOA 2P5VA 3IFEA 1FXLA 4OJ1A 5E0OA 5KFDA 2Y1IA 5EGYA 3GILA 4WYLA 3DU6A 5KFZA 2X3GA 1Q4RA 4JV5F 1HNVB 5U47A 1G1XA 2CPJA 3MTKA 4WK1A 1C0UA 4IKAA 3FRZA 1P8GA 2QA2A 3K7RA 3PR5B 1UVNA 4C97A 2XMWA 2HFOA 4HT5A 4OMFG 2GX8A 4HH0A 4D3GA 1JKHB 1SH3A 2A2CA 2JWNA 3D54A 1RKJA 4Y2KA 1N4LA 1ZM4A 4BCAA 4XO0A 1Y5IB 4RUHA 2A10A 2RRNA 4MIBA 1VQ8S 1U48A 1HA1A 2YNFA 3N9UC 2FLOA 2HQ3A 3MECA 2XG8A 3NBPA 5SUHA 3SSSA 2OLWA 2VFUA 1U1MA 2IBKA 2XB2D 1KLNA 5HROA 3RR8A 4OI1A 2HS3A 4OIXA 2H5EA 1M5PC 5CH7B 4ZCMA 3ONQA 1RT1A 1Y5NB 2R2SA 4C8KA 1LK5A 1DLOA 2BQUA 4MH8A 3IAS9 4DQSA 2J6UA 2CRLA 1N6QA 1U1KA 2OH2A 1NB7A 2VA3A 2GQCA 3W3SA 2E66A 4O4GA 2MB0B 2DCUB 3CCSS 2VBZA 5JXSA 4NLTA 3DRPA 1UFLA 1S1TB 2DNOA 2JL9A 2LCWA 4TQSA 4C4WA 5EWFA 1R0AB 2QO3A 4NYOA 3KJVA 1RYSA 5CYJA 4DQQA 2AD9A 1RTHA 1BQMB 1C2PA 3N79A 3PJXA 4ID8A 2O67A 3PVXA 5D77A 4G1IA 1N0VC 2IFXA 1WEXA 3CCRS 1SV5A 3GR0A 4X2BA 1S9GB 1XBWA 5L8RC 4I2QA 4CCHA 4Q0BA 1NNDA 4MFBA 3EPGA 2YKMA 3I0RB 4TY9A 1U49A 1FDDA 4WK3A 1TL3A 2RU9A 5A0YA 1VQ7S 2CDQA 3KWMA 3QWPA 1S1UA 2ZJQQ 1Q7LB 3X1LB 5LXYA 2WONB 1NU4A 1ULRA 3CMES 4B9NA 4F4XA 1S76D 4IQXA 1N5VA 1UEVA 2JHEA 5IXUA 4F50A 3PKMA 1R3NA 3GSDA 4BC7A 2AF6A 4TN2A 3BREA 5CQGA 1S6QA 2D3UA 4KFBB 5DM6Q 1MROB 5HO4A 3BR9A 3GV7B 2GMLA 1ZPWX 4RNOA 5DM7Q 4QWEA 4OX6A 3BQ0A 2M9KA 4DN9A 4PXBA 5AE2A 1O8BA 1VK3A 5KFWA 2FPHX 2MGZB 1H38A 4NA3A 4KGMA 3BQ1A 4PWUA 3X3UA 1SBRA 1X5PA 3UDCA 5A8KA 3OR2A 3Q8SB 3ZZPA 3I31A 3SZ2A 4DS4A 2CJQA 4C0HA 1XR5A 1VQ4S 2EBEA 4G1QA 3AJ1A 1FRXA 2MKJA 2FJAB 2XWYA 3CCMS 1LW0A 2OPRA 4ALZA 4AL7A 4IOCQ 2GHPA 4U9RA 2WOMA 3HHNB 2UUAF 2RU3A 3NKYA 4P6QA 1NK4A 5CCMA 3I5BA 5IQQA 4CO2A 4LJMA 3VAFA 4FZVA 5KFIA 5KOWA 1QUPA 3QLHA 3OHBA 2ABYA 2ASYA 5F41A 3CMAS 2YNGB 3CC2S 5K5MA 3K57A 4EBCA 2MZ1A 3D1QA 2MKIA 3DMJA 1N0UA 2DNRA 3KMSA 3UCZP 2JEGA 4I7FA 4QQBA 3F73A 3CVKA 4OL8A 2GO9A 3CT9A 1GXUA 1HBNB 1FK9B 1T02A 1QAIA 1QAJA 4EO6A 5F8MA 1HYSA 2PIIA 3SCJE 2GO8A 4ED0A 2ATLA 1WF0A 1S6QB 1YITS 4XDDA 4QZVB 1FRKA 1N5SA 4ZPCA 1WHVA 1S1VB 4OJHA 5AXKA 5AXNA 3BSCA 3G86A 1NKBA 4B3RF 3IR5B 3O5TB 1R8PA 5AE3A 3TRGA 2KI2A 3O1LA 2R8KA 1M5HA 4UOCA 1O51A 2C3PA 3OBIA 4EBEA 5KT2A 4WXWA 4IH6A 1BGXT 3MF5A 5AXLA 4IH7A 4J9SA 2Q6BA 4KE5A 1HPZB 2KG0A 3QAUA 3N6NA 3FEZA 1H7XA 2Z2LA 5A6WA 1JLEB 1FXDA 1S49A 3V6DB 4A8YA 3MR6A 2DIVA 1RT2A 4U7UK 2VG7B 2LU1A 2W7AA 2MZJA 3D5MA 3S01A 4EUVA 1TAQA 5L1JA 4IDKA 3UCGA 1SUQA 1R8CA 3M32B 5J1EA 4ZP8A 5KAKA 2OD6A 4KBIA 1T03A 1TK0A 3NGKA 1T05A 2J76E 2RDIA 4MFBB 4QW8A 4ECVA 1FEHA 2YX1A 1JLAB 1AFJA 3TAMA 1VI7A 1VIXA 1VJWA 2W25A 5FDLA 3UWTA 2HHQA 3DLKA 5F3ZA 3CGIA 1HBOA 4DL2A 2DD8S 3H59A 2Z2MA 2QYCA 3CCTA 2J8AA 2W8KA 1S0MA 4NLPA 2DR5A 1S77D 2VFSA 5T41A 4ED2A 1HI0P 1F9FA 5DQIA 4PXDA 3FMWA 5C5JA 3KLIB 4NCGA 3CD6S 3GYNA 3OR1A 4LF5F 5I3UB 3OSPA 1A6LA 5KFLA 4ES1A 1T94A 4QR2A 2ZZNA 3RBDA 3THVA 1YJRA 1HQEB 2G9OA 1Y4ZB 3K59A 1LWFB 1VQMS 1RT5B 4OI0A 5E7OB 5I4MA 3TA0A 3P3DA 5J1NA 5GAEU 2QMXA 3MR5A 4ELVA 2O3DA 4LF6F 3FNNA 2DNLA 2WB1D 3R5BA 4K59A 4DF4A 1SKWA 4ATNA 5K8OA 3JYTA 3CD0A 1UJ5A 2MY7A 1YGYA 2GHWA 4ES3A 4GKJF 3F56A 4PG8A 1NHUA 2KT3A 3FSXA 4RZRA 3SYZA 4NLYA 2W9CA 3LP0A 4ZP9A 3DXBA 4QIEA 1JKHA 4EO8A 4QW9A 4LFBF 4ID5A 1PSDA 4YDDB 3CCWA 2CQ4A 2LYVA 1S48A 4ECWA 1AW0A 2MSTA 3D0GE 3I4HX 1HBOB 3CXCR 1HHTP 3I9ZA 2MQMA 1B0VA 4I7FB 2YKAA 1B0TA 2JC0A 1T95A 2L9DA 4IRKA 1X4DA 2C42A 3HK2A 4A8XA 3OVAA 4DV0F 2MQQA 2L9NA 3M8SA 2LMIA 1XK8A 5GAHU 2HHHF 1UAWA 3IC1A 1SC6A 2AP6A 1P1LA 2FVCA 2HWHA 2IVYA 2NLWA 3PDNA 3FZ2A 3VZIA 4TY8A 2CPEA 3LPYA 5KFSA 4DV3F 4M8LA 2GMHA 2X1FA 1FKAF 2VV5A 3CCUS 4C98A 4CO1A 2HYIB 2MDAA 5KFNA 2HVZA 3HHLD 1GTHA 3I5AA