4NLHA

Skich domain of human tax1bp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
115
structure length
115
Chain Sequence
GPSSPAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SKICH domain of human TAX1BP1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Tax1-binding protein 1
total genus 15
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17751 SKICH SKICH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4nlhA00
4NLHA 3VVVA 2LFEA 3VVWA
chains in the Genus database with same CATH superfamily
1DANT 3GK8H 3KL3A 3D0LA 3R1GL 5ECJE 3CH8A 4BZ2A 1AYOA 1LEGA 3DSFH 3GSOA 4MWFB 2ZOLB 2QTVA 4IM8A 1LTXA 3QEUB 1XR8B 2BSED 2ZUQC 1ZV5A 2NY5C 1ROWA 3DVGA 2VCOA 1X4YA 1KG0A 3Q6FB 3SN6N 4HG4K 3CCHA 3UMNA 1AXIB 5SX5K 2JTYA 3EO0B 3T3PB 4NO3B 3U0TB 1MFUA 3ZW3A 3EJSA 5DS1A 4P2RE 3CX5K 5J5EA 1A6PA 4YSQA 2CLZA 2JJWA 5C0EB 3ZL1A 3KJ6L 2VZTA 1RH8A 4QJ3B 4NZJA 3G6AB 5A2CA 4M7ZB 3WIIL 4Y4KC 1HL5A 2ICCA 5H35B 2F7PA 3B3IB 4S1DD 4NS0A 4Y4KA 5ISZE 1DJSA 3BCDA 2NY7L 3NCWA 4X6CA 5D1QE 2IGTA 3PYCA 3DO7A 4E9XA 3QJHB 1B4TA 4GFTB 2PYEA 5D7HA 4MCNA 1B2WL 1NA8A 2ZOTA 4LOFA 1PD6A 5E03A 3FQNB 2X6UA 3MRBB 1DBKH 3VTTA 4OGQC 5DD1H 3S34L 4DUXA 4PLOB 1KLFB 5EUOE 1JVKA 2G2RB 3BPNC 4G43B 4ZXBD 5MENE 1RMFL 2JXMB 4P8QA 3R8QA 1CWVA 4R4FL 3QZWG 2BIQA 2R4RH 1MRDH 1OB1B 3ARQA 5EN3A 4Y5YB 5CJQL 1H5BA 4JFEA 4OLVH 2XXCB 4AJ0A 2Y5EA 1BMZA 5KSVB 3HMXL 3GMMA 3QXVA 4HKBB 1CPUA 1ZGLM 5L2JB 3FHEA 4GT7A 3WN5B 1YY8B 4HHAA 1E27B 2B8OT 3E3QE 3TWCL 4H4NA 2ZUQB 4JO2L 4PRHE 2ZAIA 5F6IC 2CCLA 2DLTA 5C09A 3QI9A 4V1DD 1OCWL 1BXUA 1QYGL 3OR7A 2C7FA 4ZMQA 5IVNA 1CL7H 4XPFH 2VL4A 2CZNA 2F0CA 4GUPB 4HOXA 4TQHA 3HHSB 2WYTA 3BQUD 2RQ8A 1MJJB 1QEXA 1T6VN 5E6RB 1EO7A 4X4XA 1UJTA 1XO8A 2RFXB 1FI8C 3D50A 2LW3A 4LVHC 4BKLA 1NFDF 3LEXA 3RQ3A 2QELA 3O3EA 3SDCC 3FQTA 1VEPA 3GEFA 4DKFH 5HDWA 2XN0A 4PW3A 4PWJA 4G82A 3HHSA 3R7RA 5DFVC 1G7IB 2C34A 1T04B 1V3JA 4R7NA 3H0TB 3P0YH 3C5ZA 5DO8A 3RVXD 4WHDA 4EN3D 3FKUS 5DA0B 3VQ2C 4IRZA 3OGCB 4ONFH 3IDIA 3MCG1 5I19L 4X8GA 1ROCA 2JE8A 3PGDA 1ZWIB 3O0LA 2YBRB 4YDJB 4MJIB 5HHVH 1MQKH 2VAAB 2DWEA 1A1MA 3RB5A 4KQ4L 4BUGA 2VC2B 3OX8A 1BFVL 4Y1TA 2ADJA 5IBTL 3X1FA 2B4CL 3VXMB 4XP5L 1RZ7H 5CUSL 1CGUA 5D5MB 5FYKD 4XPTL 3GMOB 2F7RA 3LIZH 4M5YH 4PD4K 4WHYG 1FC2D 1DFBH 3VFTB 4DW2H 2ICWB 4WIQA 1E9OA 1YHPA 1AOZA 1CTOA 1D7BA 4JQVA 1HSBA 3IAQA 1RHHB 5HDRA 3RZCA 4XP9L 1E42A 4X8JB 4M8VA 5I1HL 3TJHC 5E6UB 4ODSL 4XMLL 4HXBH 1B0GA 3VFTA 4FCHA 2Q2LA 4L0PB 5PCYA 3OAYH 3STBA 4X80H 1SQMA 2A74A 4LGSB 4ELDA 4Z0XB 4IGBB 4L1LA 2C4FU 4ZOEA 3T4AC 4HJGA 1A2YA 1ORQB 2NNRA 3DPDA 1ZS8A 5EFIA 4J4PD 1WITA 4MS8C 3TV8A 3CDCA 4KK8D 4IRSA 3TN0D 4JVUA 2WINB 2PW2B 1YEDA 4YLCA 1HS6A 3MO1B 1FSKB 1OTTD 2B59B 3DKHA 4U1KB 3HZYB 4XNBA 4QO1A 5I30L 4JDVA 2P5WE 3LZLA 2H32B 1LWHA 2R1YA 4N87A 1N5AA 2NQDA 2ZAHA 4QXGH 3CDYA 2R8SH 1JRHL 3BH9B 3MLSL 3ARBB 9CGTA 1BLNB 1SDYA 2EDNA 4MD5B 5FGCE 4S2SB 4A68A 4B7LA 3RFZA 1GZHC 3TYFA 1XGRB 1S9XA 4JQIA 4Z3TA 2IDUA 4WTQA 4KKLC 3WAKA 4N2BA 4YHOH 4MMXB 2W0PA 1BM3L 4CMHB 5DC2A 3X12B 2P5WD 1QSVA 4J3OF 5HDBE 3N41F 5EZPA 2AXFA 3UDWC 3FFOA 4GXVL 3IFLH 5I23A 4PJXA 1K6QH 5E99H 4A7TA 3QZWA 2WWNA 1OV8A 3RY6A 2F1BA 2V3FA 3GNMH 5EEXA 1IV8A 5DDHB 4EKXA 3UAJA 3V4PB 4XPTH 3NZUA 5F7YC 4PG2A 4YEFA 4OZFG 1MZYA 2X2IA 3I6GB 3JWOH 2R4SH 1B4JH 3P0VL 1FL3B 2NTFA 4XP4H 3LS4H 3FQUA 4U1IA 4AMKL 1CD9B 1NBVL 4HIJA 5C0IB 4M00A 3QQ3A 5DJ6A 1CICD 5BZDA 1T3FB 4PRDB 2F54E 2NW3B 4PJ9D 2GABA 4ODSH 3GINA 1RI8A 2YZ8A 5KZCB 2EE3A 1IQWH 4L18A 1IO4C 2G0LA 4PJEF 2ZG1A 1BQHA 3MJWA 5A40E 4Q9RL 1F6LL 2G60L 1QG3A 3TPUA 1LQBC 5IZ7A 1J1PL 1YQVH 3WMPA 3IFOA 3CXDL 5E4EB 1NEZA 2PMZA 4LCWD 5E5RB 3QULA 4ZG1A 1PKQE 2X6CA 3VWJA 2WM0A 3IMWA 3N1PC 3OHMB 2ARWA 2FT6A 1NOLA 3CSPA 3G5VA 1JTOA 3QQ4B 1O9WA 5IMOA 5CR1A 4NB7A 3OKLB 4UUJB 4AQOA 2HVJA 2Q86B 3NCBB 4N26A 1BVOA 4BH7A 1L0QA 1AAJA 3CVHL 3T1WA 1JK8B 2CRIA 1SF5A 5F70A 5T3XH 4E42A 3CC1A 4GP4B 5E5LA 4PCKA 4AUJA 3QP3A 3BKJL 3CDFA 5MHSE 1Y0LA 2R27A 5BPPA 5D7KD 1R5IA 1A5FH 1HTYA 1R5VB 3O4LB 1CMOA 4M8QB 1YYLH 4YHPA 3T0EE 3UCRA 3MLTA 1ODAA 1HZKA 5I1CH 2CHWA 5FDWB 2HWZL 3WUZA 3O8XA 4ZUWB 1DVFA 2FSEB 1OCWH 3BMWA 2ATKB 3MUZ1 1HQRA 4ABWA 2OQJB 3VXSB 2X38A 1IM9D 4APQA 5F3BA 4JY4A 4NN5B 2DQHL 4AKPA 5ICYB 3BIKA 2ZYHA 3EHBB 4NP4L 1J87A 3QFJD 1SXCA 4HGKC 4NLAA 4A2HA 3GSUB 4XWOC 1FNFA 5HHNB 2NR6C 1RERA 2BSBA 1Z0NA 2FQDA 4G6JH 1IAII 4EAEA 4F8QA 3ULUE 4D0BB 5KYYA 1KIUA 3QNYA 4JO4H 3VRIA 1DEDA 3AFLA 4HS3B 1MPAH 1E4XH 2G2RA 3EOBA 2L04A 2DBLL 3BAXA 4PS7A 3TZVD 2ADGB 1GZQB 5JW4N 2EEBA 4DP6X 1XL4A 5F9JA 5D1XC 2WBXA 4FD0A 5ITBH 1DVQA 3SPVB 3ISYA 1T66C 1X5IA 2ZOWA 3FYEB 3VSVA 1M6UA 3CXDH 4KVNL 5FPIA 2BH0A 1JGLH 2Z4TA 1WBZA 1YSOA 4PREA 4EZJA 1WEJL 4AGMA 5TE7L 3QJSB 3VGAB 5FA3B 4EQ3A 4FG4A 5HHNA 3MJ8B 1CCZA 1FNGB 4HK0A 4LVOB 4U05A 1MFEH 2VR5A 2LAAA 3MBXH 5B1CA 1M2VA 4M5YL 4P23A 3T5WA 1II4E 3O4OB 3KL5A 4TTGA 1PMYA 3MRPB 4LPXA 1NL0L 2ZOKB 4YDLB 4HKBA 3UPRB 1R3KB 2ED7A 1U8QA 3LKRB 4Q6IB 4ODTL 3BUBA 4MNGE 4TVUA 3RIFF 4ABQA 3APMA 1JNHA 3IXAB 1NIAA 5DEFA 3OB0K 3UTSD 3NFSL 1PAZA 4GS7C 4GQZA 4KRMB 4KO9A 3BE1L 3DBSA 3PV6A 4S1SH 1KJVB 2QGBA 3VWJD 1S7QA 3K2UH 4HIQA 4QXWA 4TVSa 3NJXA 3OKYA 5F7WC 1AQ8A 1KPUA 1F4WH 1TZIB 2Z1KA 3VD5A 2EH8L 4MAYB 5IEKB 1RIUH 3GMNB 3L8QA 3N0PB 4FS0A 4NPYB 4ODHL 5C7ZA 1ZA6A 2OLDA 4AIOA 3MRGB 1IEAA 4PJCA 4XBEL 4BE5A 5E8EB 3P2BA 3U6XA 1F4YH 4IRSB 1W2KT 4ALAH 1DSFH 1ZHKA 3KYAA 4O2EB 1FFOA 2CU9A 4RZCA 3QARA 4ZW5A 1U8MA 3ILPB 1SYSA 1Q1JL 4LSRL 3A6CH 3GLAA 1WFNA 4RISH 1HEJC 2EO1A 4X9FA 1I3GL 2P7TB 1KXTA 1SEBA 4LPYA 4E9VA 4DKEH 4GMTH 5CILH 1U8PA 2VLRE 1OE3A 4Y19A 3V6OC 4PRPB 1DYZA 2WC7A 2YD6A 1TYJA 3SKOA 1IMHC 2FX7H 1HDMB 1RJZB 2Z7ZA 3N1MC 1JCVA 2V2TB 4MRCA 2CPUA 1BM3H 2O30A 3MODL 3MUHL 4AUYA 3RURA 3ULUF 1CFSA 1AD9B 2A9ML 2RR3A 4UDTB 1OP3K 2WWKO 3F12A 4J3SA 1FHNA 3WV0A 3DURA 3JWNH 2NYYC 2EDFA 5E0QA 1MI5B 1O0VA 2KI6A 4Q56A 4PR5B 3QUYD 3W37A 3RWEA 1OKEA 5KVGE 3SE3C 1RZKL 1KN4H 3CUPA 3FTUA 2ENPA 3T08A 1OP5H 2CKBA 2R56L 3KHQA 4P2QD 5IB4B 4LARH 3AT0A 5EORL 1KN2L 5CKAA 4PJBB 4Z3HA 3T0EA 4WU7A 5JHMA 2GT9B 2XSKA 3OKNA 5DK3A 3A24A 4RFNC 4GSQA 3ZKQD 1ITBB 4CADB 3BAJA 4ONGL 5ESVB 3GZPA 4OTXL 3M07A 1MFBL 2CLRA 3QPXL 3MNZA 4XMPH 1U21A 1NIBA 2VO5A 3QEQD 4Z7VE 5HYSB 5J56B 3ZRCC 5DMKB 5EUOA 3NIDF 4N90D 1XEUA 4L9LB 3FT4A 1A3RL 3D2UB 2VR8A 1BZ7A 1GY1A 4ODHH 4LK4A 2AABL 4P23D 4X80L 3FB8B 1MUJA 4FLQA 3HOGA 1SFHA 2YSTA 5I5JA 2Q7YB 5IHHA 4N6RB 1A7OH 2BVQB 1MW0A 3VTMA 2JVUA 5I1DA 3BH8B 1OAUL 4NT6B 1MLBB 1XT5A 3QJFB 4XXWA 1AHMA 3HFMH 5K39A 5K1NA 1HNFA 4D9QD 4XPGH 5TPWH 4AIZB 3GB7B 5BZWB 1BQRA 2DKSA 3AREC 3A4DA 5ISZB 4LSRH 4O2FA 2Z8RA 4IBLT 5DTFB 3TBSA 3D3VD 5KVMC 3GMRA 2Y36L 4JO5A 4UOW1 1YNTA 3FFDB 3IPEA 4S1RH 5ICZA 1I8UA 3CPLB 3LS5H 5IR1A 3SYCA 1F6AA 3QIWA 4N0RA 2CM6A 1UM4L 5DS8A 1L0XA 1XF4B 3NRQA 4BSWB 1SUHA 5FYKH 3T0EC 2YGNA 2FX7L 3I9IA 4P57B 4AW7A 4AQZA 4OD3L 1JZJA 2DLIA 4GXFA 2Z35A 2AJVH 5L9DL 2BO0A 3EDDA 4YZFF 4XVUD 4BCYA 1UT1A 2IG2H 3F62A 5J7CC 5JQIB 2MNUA 5E5UB 2JB6B 4KO7A 1KPRA 3FB5B 2K1MA 4PWEA 5DVKA 4KK6C 2QPEB 4AYID 1RJYA 4HJSA 4QHMB 3HKFA 2DQEH 5IFAH 4BA0A 1U8JA 1SZNA 3T8VA 5GIRB 3DROA 4F7KA 3LKQA 3MRHA 1A7QH 3ARGA 5LB1A 3MPCA 1NUDA 2F1AA 4FC3E 1FO0L 1XF4A 1IQDB 1V55B 5H94B 4Q6YA 3OKLA 3X1BA 1KCUH 3EZ8A 3FH8A 4M43L 1G6RB 2DD8L 5E4IA 2VDPH 1FFQA 4FQ2L 4GKOA 3B1TA 4OZGF 5MEOA 1S78C 1HILB 2YFNA 4PJ5A 2Y0SA 1AXTH 3EO0A 2G30A 4HU2A 3VFMB 5IW1A 1TVDA 1CFTB 1DO6A 3DX6A 4HOZA 2Z3FA 5AB1A 1R75A 4LVEA 1P4UA 5CXPA 3RUGB 1TTRA 1S9YA 1PZ2A 3EYQD 4YBLC 1WO2A 3J07A 3QDHA 3O9WB 1Q9LA 2FZ3B 2JKTM 4HEPA 5EO1A 4CRPA 2Q9OA 1TZGH 4KXCA 3O2DA 4D0DB 4D3CL 4GRLB 2OW7A 4LB8A 1H3GA 2ZIDA 1XGQB 4TSCH 1KIUB 1E50A 2IWGA 2WBJD 3L4XA 3RX9A 4JANB 2ZUXA 3IDNA 3AS2A 2G9HB 4JFQA 4LDOB 3IETA 2BIHA 2AEWA 3BSZL 4A6YA 1VPOH 1MG2C 1L6XA 4KTDL 1UD2A 3W11C 4OLUH 4LF3A 5B39A 4MSWA 5C9JB 4HJ0D 4NWUL 2B16A 3TNMB 2C3HA 1JZ3A 1S7WB 1SXZA 1WGOA 2EH7H 2P44B 4X0KA 3I2CH 25C8H 1TJIH 2ZWKA 4UQBA 1EDYA 4ZMVA 3TBVA 3CVHH 3OR7B 5CLWA 1G7PA 3F7PC 3O6FC 2BZDA 4N8VG 1UHVA 2A83B 2NSMA 4GAYB 2BSTB 2B5IC 4JPSA 1UA7A 1V3MA 32C2B 2XKSA 4K71C 1G5GA 5DJAB 1ZHLB 2Z9TA 1WZMA 3BVTA 3K4DA 3O81A 4UQIM 2VLLB 4JFFA 4K5LA 3S7GA 3S35L 1BVNT 3MRIB 3KPNB 2WTPA 5T1MB 4KJQD 2R2BA 1GYCA 4PIBA 3RA7H 5KJRL 3X1EA 3GXMA 2YEVB 5DYFA 4ZMYA 2XUWA 3QRGL 1GGBH 4TSAH 5J1AA 3V4VA 4WO4C 1BYNA 5ESQA 4ZDHB 3D3VA 3RWDA 3VMPA 1MCDA 1MNUL 5DJZA 3FQ1A 4K55A 2IADB 3LKSA 1R24A 3A5VA 5DMIH 2HRPL 5I74B 3G6AA 4NXKA 4LHUD 4PJ7A 4ODXA 3EGDB 5E8DL 2AW2A 3M6DA 3WIAA 1B0WA 2VQTA 3OKOB 2Z92A 4OFPA 2VMCA 1J8HE 2P7TA 3WKPA 2BCKB 2BM3A 1LWRA 2B20A 4UAHA 1EEZA 1WVZA 4R4ND 4NX0A 2PYEE 2IBBA 4P5TB 1VDGA 3UIYA 3IJSA 4N90E 2BSRA 4H1LA 3L3IA 5LCVA 3T3MB 4UOW0 3U4EB 5GS2D 1KCKA 5E8OB 5EIVA 1Q72H 2IH1A 4FQXB 1EEZB 3G6JE 4XODA 3QDMB 4N8CL 1XGUA 2WTRA 3GIZH 5CWSA 4OV5B 4GKNA 1ZV9A 3HC2A 1IUZA 3SQRA 3PWJA 4PJGF 5DU7A 5D2NA 4I77H 4TTDD 1UA6L 3K7UA 1AO7B 4ZPTA 4NQEA 1F1GA 1BBJB 1ZT1B 2P9RA 3VDBA 4GAJH 1OD9A 5AL0A 4P2OD 2A6IA 3FONB 2PWFA 3HRZC 2AANA 3GEWB 4NO5B 1JRHI 4AGOA 2OJEB 3FO0L 3HZVA 2PYFB 1J1OH 5FYJD 1MRFH 3CZFA 5TE4H 4ZAKB 5D2LE 2CHXA 1H3PH 2C3XA 1UOVA 1KXVA 2D7TH 2BW5A 4KTGA 1AGDA 5DUBA 3MJ8A 4HK0B 3SDCA 4HVBA 3SEPA 1Y18A 2RFXA 3U7YH 1G84A 2UY7B 1W72B 3E2HB 1PG7L 1A7OL 3QRGH 5IVXA 1NJ9A 1OAQH 3N43B 5BZXA 2ZP9A 3CSGA 1BF5A 1I9JH 3I3DA 4UMSA 4PJDF 1HT6A 4UOQA 1CDYA 1D6EA 2R0ZL 3V4VL 2G5RA 4QLRA 4OZHE 4ZSOE 4ZMTA 2WAHA 3WEAA 4OM0L 5DFAA 3DMMC 4LSQL 5GGTA 2ODIA 1SBSL 2EJ1A 5C0BA 3PWUA 1W16A 1QASA 3A3YB 4D0CA 1CLYH 2W9DH 3D4YA 4OLXL 1TOXA 4HGMA 3CFNA 4JG1H 1MLCA 2NMSA 2OI9C 4RBPH 4XZUA 1I8MA 3MUGB 3BMVA 2DYPB 1F4WL 1BX2A 5AKTA 2DAVA 1BFSA 1T21A 3L3OB 1ZE3C 5JYMA 1MCWM 2VSKB 3WLBB 4NCC2 3WFBL 2VLJD 2VSDA 5C6WH 3SJVE 3QR2A 4XBMA 3RHWF 2P5EE 3BSZA 5DT1L 4A6YL 2FEEI 3HNVH 1SUJA 5JXAH 4LHUA 5EIIG 3RVVD 1HQ4A 4B9JA 3LKPA 3G3LA 4OSUH 1R9FA 4D2NA 3NZHL 4OQTA 3OTTA 4XN2A 1MFDL 3I9AA 3QC5X 3DUUB 3K71A 1I3GH 3H4FA 3VCLB 1JFHA 2H3XC 4PJAF 5I2IB 4FXKB 4AWJC 1ZLSH 1WAPA 4WU5A 4K8RD 5ACZA 5KBDA 2AK1H 3MRLB 1ES0B 3ARTA 3B2VH 3TP4A 5LQBL 2YC1B 3HAEB 4RGND 2PPFA 3F04A 1A4KA 1BP3B 3MODH 3AQZA 3P77A 4QXTB 4RMQA 3VCLA 3OB8A 2X4PA 2E74C 2DM3A 3QJFA 2X1XR 2XETA 4PJXF 1JN6A 3U7YL 4FQXD 1VZHA 3MRRA 2X4NA 2CSPA 1DR9A 1I7RB 2BNRB 3QXTA 2ADYA 3L9RA 1QUNB 1MFCL 4FXGA 3KPSA 4L8SB 3TO4B 1U92B 3LPFA 4G1MA 1LGVA 3D0LB 3MV9B 4U0RB 4PGEA 3TFBA 3GBNH 2Y06H 4FE9A 1QPPA 2FBOJ 4P9HH 3EJYD 5AKRA 4H0HB 1GOGA 1GSKA 2YQGA 3QUYC 4PRIB 5IMMB 1MNNA 4OT1H 1N5YH 2CGZA 2GC7C 3V4PA 4F24A 1ANUA 4EZKA 4BH7B 3SD5A 2JKJA 5EG6C 1QX1A 3CN2A 1G7MA 1N3NB 3EO1B 3F7KA 1P7QD 5D1ZD 5TH2B 4WI3A 4OIBA 2BP8B 5KVDL 4UQ9A 2ZXDA 3DETC 4JMXA 4Z95L 2BSDA 5TK2A 5T5NG 1P7HL 2EAEA 2I25N 2WZ5A 2O4EA 4WI2A 1JNLH 3KS0J 5SWSE 1MQ8A 3EBAA 5I1JH 4DZ8A 2BNQB 3HS0A 2V2XA 4KKAC 5ID1A 3Q5YA 1ASPA 1KXHA 2FATL 4MNGB 1ND0B 3TA3D 1IM3A 2VE6A 3VXSE 2OSLA 1XXFC 3D39A 3GS7A 1TF4A 3BLPX 4TNWK 4X5RA 5DD5H 4Z7WF 2DQUH 3UBFA 1AP2B 1E40A 3PWPB 5L2KD 4Y5VB 5EF1A 1DSWA 3RZCD 2C1OB 2VN5A 2O61B 2VR6A 3MGOA 5KAQF 2OMUB 4XHJC 3UL4A 2OAAA 1OF2B 4IJTA 4BKSC 5EOQL 4U6HB 3O3EB 4TNFA 4DSYA 3Q8CA 1CTMA 5GISL 3HPJA 3O0RH 1SJHA 3SYAA 5E1IA 5D72H 3JWOC 3QS3A 5SWSD 3WUWA 2YMXL 5A2LH 2IANE 1YVLA 4IRSD 3L6FB 3PJNA 3C09C 2TSAA 4J1UA 4GBXC 3PWLB 4R5XA 3K81A 4APQB 5EIIA 4R97B 3MREA 2HVKA 3HLAB 2EVJA 1HKLL 3QB7C 5JQ6H 2DTSA 3O11A 5GJSL 2GIYA 1ZLUK 3NZ8B 2XKNA 4YQXH 4OGXL 4XZ4A 5JMRA 4J4PC 1JZEA 3L5IA 5GRWA 1GIGL 1VIWA 1U91A 4NUGL 3WMSA 5INCB 1T2JA 2DDQL 3VJ6A 4WI6A 4WLCA 2DQCH 5DZPA 3KYMA 5B38G 2I9TA 2ITFA 2FNBA 1H5BB 1FV1A 2QV2A 3PGCA 5B21A 1EUTA 3OAZH 5C09E 2FSEA 4PB0H 2DN7A 5LHDA 3D18B 3HNTH 4C4UA 3ELAT 5CN2A 2UZIH 4ZYKB 5ICXB 2V8MA 3I74A 4KX9A 4PRBA 5AZ2L 5C7XH 1KENL 5A2BA 4HC1A 1CFQB 1S5HA 2CHNA 2ZNXA 1GR7A 5I71C 2Q7NA 1Q0EA 4L8BB 4G5ZL 5KVDH 2E59A 2IH1B 4FQXA 2IDQA 4BFKA 3QH3A 3KE0A 3VRLF 4MD4A 4TQPA 4ODWA 1EGJA 3ARWA 2MRYA 3IF1B 2J6EL 1NBZB 1GGUA 4H20L 1IBYA 2D4DA 1MHPL 1IC4H 4ZW3A 3G08A 5CEYA 1NBQA 1O7DC 4XNMB 3SE9H 4HZAA 3KWVA 3O6KH 1BJ8A 5DD5L 3O3DB 5F1IB 1INQA 4YXKH 2Q3AA 1BM7A 4PFEA 3SKMA 5I5MA 2BK8A 3ERXA 4JQIL 2PPDA 3DXAD 3IF1A 1U3HC 2J55A 2J6EA 4YWGH 3OKOA 4L3CB 1OM9A 1TTGA 2EDKA 5HJ3B 1REIA 3ARSA 3CH1A 4NZRL 3IJHB 4KROC 3RWCB 4MXWH 5J3HC 2WKOF 4JGNA 1U93B 2BNUB 1M7DB 1JDDA 4K8RH 2PTTA 2QJDA 3ULVE 5F9JB 3WFZA 2HTLC 1TJIL 4MAYA 4S1QL 5E9DA 1E9OB 4TM9A 5HGDB 3BZFB 2V9TA 3DIDA 4PJGE 1ECZA 3GRBA 3H9HB 4XMKL 2CCVA 1H0DA 3BSGA 4M7JL 5D4QA 2X88A 1KXQA 1N7ML 4L9DA 1N12A 5I6PA 2F2HA 4LSDA 3TIEB 5CU9A 2R2HA 1SY6L 5JOPD 1K5WA 1C16A 4WK4B 3ULSB 4PY8I 5FA3A 3MCLH 3HC3H 4AJWA 3WENA 1ICTA 4JFFE 3SD2A 3TJEH 4PU2A 5CZKA 3RPIA 4NNXA 1ZA3B 1G1YA 3SDYH 5I6LA 5INDA 3ETTA 1PSKL 4RQQB 5ESAB 3ZT5A 3L3OA 3U4KA 4G7VH 5K9OA 3V9EA 1HH9A 2NCMA 2N3JA 1CBVL 1W72L 1FG9C 1HN1A 1WGVA 1C16B 2EEAA 3ULSA 7FABH 4R7DB 4CSPA 3QORC 4F1ZA 3E9TA 3ZZ1A 3L3OC 3CHXA 4PTUB 2DL2A 2NNCA 2WJ7A 4J28A 3MNVA 5E1HB 3BGFC 4KNQA 1MUJB 3BKML 5HDBB 3ECBA 3CD4A 3WXVH 1M1XA 4U3XA 1KJMA 3FFCD 3O8XD 5E70A 3BP5B 1XGYL 2X1QA 4HJ1A 4I77L 2OW6A 1E90A 3LKOA 3SPJA 1D5XA 3CFTA 1H6UA 3DOSB 3RP1A 2CE6A 5BV7H 4OFYA 5CS7A 2E6PA 1W0YT 2FUTA 2AJVL 1DQDL 4LCCB 2NDGA 1M2OA 2GAZA 3FUJA 1A6ZB 2ZX5A 1AR1C 1IEBB 2IG2L 3MJGX 1FFOB 3S2CA 5T33L 2AEQL 1H9DA 4PV9B 2P8MA 3T0XA 1I75A 2FIRT 1WT5A 2VL5B 2X4UB 3CFDA 1N18A 3ESMA 1P5UA 5C6TL 1C7SA 2BIPA 1BJ1J 3L1GA 1JVLA 2EIZB 1YYCA 5ADPL 2DMBA 1BWMA 1I1AC 4U1MA 5J6HA 5LNEA 2AZAA 2WAQA 2F53D 3GI8H 1GOFA 1ZSDA 3PHSA 1YMME 4LQ1A 1MAJA 4NPJA 4QTIH 1FRGL 2PO6A 3P3UA 1A64A 4K23H 2FIKA 2XV0A 3SGJA 4Z7VB 3EF4A 4PRAB 1NEZG 1CN4A 5BZDB 2CRYA 4FFYA 3LIZA 2OFQA 3KPRB 1MRFL 2HP4A 3S48A 1GC1C 5IR1B 2VUKA 1OW0A 1ZLUH 3D87B 2NNFA 2X4UA 3CFDB 5AKSA 1TPXC 5ABZA 1HOCB 1JPFA 5DJYB 4O51A 2ZCKL 5DLML 1ZIBA 2FBJL 2NPLX 4HX1B 4ORZC 1QMUA 5T1LB 1MCPL 3GXPA 3BZEB 1ESOA 4QXTA 1TQSA 3F7VB 4MAYD 5T3XD 5G4MA 4NUGH 3KCPB 4KXDA 3EOTL 4FKEA 5B22A 1T1ZB 1KBGH 2C9VA 2FVNA 2F5BL 2VQ1A 3U6XS 4N6RA 2Z34A 3GS4A 3C5SA 3K6DA 3TWYA 4BQCA 1S9XB 1ECYA 4DP4X 1RULL 3V0EA 2OP4H 5KSBA 5J6GA 4NP4H 3CFBA 4Z8FL 4B9PA 4M6OL 3TL5A 2O6FA 4U6YA 2BP0B 3EYOB 4FJZA 4WHYH 1WAEA 5FFLA 4PG9A 4NC1E 5C2BH 1PAMA 2P45B 3F58H 5EBWB 5TDNA 2FWSA 5IOPB 3U9UB 2HH0L 2AQNA 2FO8A 4PRDA 5E24E 1VFUA 4Y2NA 2CG9X 3S35H 1S7SA 1OAZL 5JHAA 3DTXA 1NFDE 2LLGA 4MA7H 5EN2A 2G3NA 2X87A 1QRNE 3TBTA 2J6EH 4RCAA 1CC3A 4OLYL 2FWOA 4G3YL 4M7LL 5IIEA 2VQ1B 3IVKB 3IMUA 5LWYH 3CN4A 4KK5D 1BGXH 3RTQD 2L7EA 2C9PA 4B9GA 3MV8A 2CK0H 4RFOL 3FFCA 5LGKA 5D1QD 3ZDZB 5DUJA 1H3TA 1X9UA 4FQ1L 3BEVB 5D2NE 3RE0A 4FHBD 1J1XL 3CDZB 3KGRA 2JQMA 2YWYA 3ZK0A 1B0IA 4R2GB 3LN4B 1BEYH 3O9WA 3CZLA 4QF1B 5I75C 1JWSA 4LOUC 1S7SB 5C0RL 1D5MB 4APXB 1OGAA 2JB5L 3K1KC 3C08H 4A2EA 1N59B 1I1YB 4XMKH 4CMMA 1F3JA 2CUHA 4I85A 2ARJA 3GXUB 4EQ2A 2PWEA 5EBLA 3IDJB 1TQBC 1K3ZA 1I31A 2JNZA 1RFDL 4BM7A 4CNIB 2F8XC 4LCIH 1R5WA 2J25A 5HYQB 1FL5A 1YQVL 5E5MA 2CH8A 5BRZD 2OTWB 4P5TA 4X2UA 3NSJA 1AGBA 1QQDA 4MTMA 3NEOA 4PGBB 2WZ6A 3NEEA 1FPTL 1OM3L 2XN9E 4H5SB 4PRHA 2F53A 1MFNA 4CGTA 1O7SA 2UVFA 3ARYA 1IFHL 3VFUB 1EFXD 4UTBL 3ZTNH 4WFGE 3EYSL 3RAJH 2VDRB 3QQ9C 1KBKA 3P2DA 5H35A 1SYSB 1YNLH 1EWHA 3V4LA 4H5SA 4TMPA 4O2CB 5BV7B 3TTYA 5E2WH 2DQFB 2XXFA 4LHQB 5FLVA 2DWXA 3NSYA 4UQ2B 4NCC1 4BFJA 2VDRH 2PR4L 3ZSSA 3UJTH 3RNKB 2DLEA 3K2IA 2DBJA 2OL3H 2Y3NA 1XGUB 3WTUA 2ZKMX 1X5JA 2VDMH 2QQNH 4R7VA 1KWKA 1DE4B 3KYKH 5FUZH 4HUNB 3EDFA 2D3LA 4MA7L 1LE9B 3SQOL 3RIAK 2XI9A 3ZTJG 4D7BA 1M3JA 1SEQL 1YRKA 1FZJB 4GB9A 2YD2A 4LFHD 4N22A 3W3BA 1NBYB 2MKLC 1ETB1 1MDAA 3CBJB 2J21A 2BP5M 3QI9B 3O6FB 1LO3L 3SKJH 4A2DA 1CFNA 2XG4B 4OZHF 2UZXB 3FT2A 1X44A 1YG9A 2L8AA 3MJ6A 3FFCE 3GXTA 3L4VA 2B77A 3VXNB 3K5RA 5BS0A 4AKQA 1OPGH 5I73B 2EDYA 3NTCL 2ITDA 3KVQA 5D96C 5D9SA 4DP8X 1EO8H 3WMQA 2CJUH 5AVXB 2ZUTA 3IMBA 1DDTA 3FQTB 2JI2A 3L95B 3LQAC 1SMAA 2DTMH 2EDTA 4KK9D 1NFDA 3ECBB 4Y4HC 4Q8BA 3HUJB 4L3AA 5CF3A 1PDKA 2JB5H 4QYOB 1MJJA 1WJ3A 3H0TA 2G5UA 4HEME 3W9DB 5LCVH 4LNVA 3H42L 4EI6B 1TITA 1TZHA 1IRAY 1S7RA 3VD4A 1HIML 4H8HA 2BOCB 3EF7A 2XIBA 4U0RC 3LVEA 4EN2A 1T20B 1GGCL 2FO4B 5GGSB 2J5LB 5IT2H 1U33A 2R1XA 1UZ6F 4NQDE 4AXWA 3P9MA 4P5TC 1RL1A 4GW5A 4M4RA 2G9KA 4KMLB 4J39A 1S7RB 1LO2L 3O9WD 1F3DJ 4OQ1A 5F0JB 1UWYA 5F3HA 3OAUH 4AT6A 1IBBA 1A6VH 1SVZA 4HJGB 2YN3A 2BVYA 3MYZA 4WVRA 4ZFGH 3V95A 4N0UE 4MVBC 4OTXH 3TGXA 2G0KA 5GJTL 5BW7A 4PJEB 5IWLA 1Z9NA 1L6ZA 2A99A 2QSQA 1ZTMA 1I7UB 1E7VA 2DQTL 4TVPH 4Z76A 1SLWA 3BYTA 1EFXA 1JV2A 4G42A 5C0FB 3HE7B 4I18A 2DZEA 1OCRB 2GJ6E 2IAMC 3HC0A 4O5LL 2WXHA 5IB1B 2UYLA 1GYVA 5A2FA 1KCSL 2V9QA 3EOTH 4GS7B 4CJ1A 3MRFA 2BC4B 2R51A 1X9LA 3AB0B 3HJEA 1J10A 5ETUA 1I1FB 4EI0A 2CO7B 1RLWA 1GS7A 4R97C 4GRMA 4X6EB 3S0PA 1JGEB 4CBZA 2HMID 1FFRA 4LPCA 3TX4A 4IOFD 2E47A 3W0WA 1XR9B 3IGLA 4OFIA 5D7JB 4M7JH 4NERA 4F33A 1NLBL 2FJUB 1OGTB 5T1LA 1QSEE 3KPLA 4JDTH 3ZU8A 5JHLH 4B50A 1HSAA 3FU8A 3EYQC 5CCHE 3V4PH 5KW9H 1XIWD 2GBUA 1ZANL 1QFWL 1T89A 4JFPB 1NGWB 1PKQB 2Q8BH 2QDVA 2R29A 1ASQA 4L4VA 3VGBA 4LLDA 4UB0L 2EXWC 2PPEA 3LY6A 4OM1H 3UAFA 2OPCA 43CAA 3VACA 1OB0A 4LSPL 4AM0Q 1OZTG 2R1WB 2VN4A 2ESVE 1XSKA 3QCUL 5DFVD 2IANB 4P2AA 1GJIA 3EIFA 5AZEL 4JRXE 5TFSH 1CUOA 4TUJA 1DP0A 3TT3L 3RUGF 2HKHL 3KM1A 5EOQH 3QJVB 3CSFA 2J20A 3ZT7A 4YSOA 3EH2A 1A8JH 3I6GA 5I9QB 3VWKD 3M1BB 4W9KC 3FCSB 4MQXC 1JWUB 4NIYE 3NSCA 2AK4A 4AMXA 4JFEE 3VG9B 1BD2B 2E7MA 5EO0A 4XN5A 1IJNA 3LH8A 5IM7B 3M1OA 3US1A 3ETSA 2R69L 1GKEA 3Q9PA 1JNNL 5EUOF 1G7MB 1SDAB 1YNKH 2ZF9A 4Z7NE 1TVHB 1WV7T 3TJPA 3MRNA 4YHML 3AB0C 4X7SL 2BS71 3UFIA 4FQJH 4TQIA 5IB2A 1H19A 2GSGA 5KS9F 3MOBL 3G5ZB 2ENSA 1I9IL 5KSUA 1L0PA 5GZOC 4RGNC 2H6UA 3GPSA 3LTVA 1ED3A 1X5AA 3SDCB 5EU6D 2E7LA 3QFGA 1QACA 5A2KH 4OI7A 1FGVL 2AJUH 1G9ML 3FT3A 4P5SA 4PRIE 1TMQA 1ZT4B 3VFSA 1I7RA 3QPKA 4IJ3B 4NRYA 3RIKA 4Q9QH 3UTSB 1FLRH 4K7PY 4MZ3A 1FHGA 2A9CA 3MX0B 1DBAH 1TETL 4RIRA 4L9LC 4U1NB 1G43A 5E2TL 4WEBH 1B4LA 1GKOA 1FL6A 5E6ID 3UJTL 3DTUB 5E1AB 4CVWA 4ZUSB 5FOBA 1UD4A 1J18A 2BCMA 3I6KA 4H88H 1T03H 4HC1H 5LJYH 3B9VA 2ZTBA 4YH6A 5HHME 3CU7A 3ZHKA 5G4OA 1LK2A 1R5VA 2XN2A 3O4LA 2WQRA 1E65A 1IAOB 3RA7L 4NJAL 5ITFA 1A65A 2CM5A 3ZX1A 2ZCKH 5DLMH 3DUHA 4YK4B 5C0JA 4JFUA 3MV7E 1RURH 1YEIL 2VLME 2DI9A 43C9B 4MJ5B 1YECL 4UI2A 2GFBA 4JY6A 2WN2A 1B90A 4FN0A 4W68A 2D7OA 5A3ID 5ITFB 3V0HA 3RWIA 4F9PC 4WJ5A 1HESA 4OGYH 2Z8SA 4WUUE 4X6DE 1NC4B 3K3QA 5GS3A 3AS0A 5I9QC 43C9A 4CU7A 4QRPD 2X70B 5F89B 3G9VA 4POUB 4L4VD 3B1UA 3GT6A 1INQB 3AREA 1CDJA 5I6NA 1EJ6A 1MRCH 3UZEA 1ZCRA 3MLXL 2X6VA 4K3GA 2VRAA 1HZHL 3C60D 5D1XA 2X1PA 4PGBA 1JERA 1VADB 3JWDL 3I50L 3RJQB 4F2ME 4GBXA 3WY1A 1T0OA 2R69H 2YKKA 4NFDA 4ZFOA 1NGPH 2E5EA 3O3AB 3H2WA 1DJHA 2YBRA 4YDJA 1EVTC 1ZKAA 1AQHA 2VUYA 2XQBL 3QH3B 1KIRB 2KDYA 1HYRC 1K8DB 2DIBA 2VLKD 2HUHA 3CVIH 1AD0B 4QRUB 4WV1B 4Z7WE 4P05A 5FCSH 3P02A 4R4BB 3U9PL 3VD0A 1ZOXA 2YD9A 2XT1B 4TVPL 5GGVH 4LAQH 3FC8A 5IF0A 4QOKD 4BZYA 5FGSA 5C70A 5BUPA 15C8L 1C5CL 4G8GA 4GNKB 1T0PB 1NMBL 4KX7A 2OZNA 3V0IA 4XE5B 1AI1H 5T1KD 4ODVH 3TO4D 2OK0H 2FLRT 3LEXB 1D5MA 2X4RA 1VF5C 2HJKB 3MC0A 2J4WL 1U2CA 4UTBH 1C08A 4URTB 3S37H 2P5ED 2C9UA 1X7QA 4N0CD 2ZX8A 4PGZA 4M5TA 5DQDL 2C3VA 2P24B 5F96L 1MWAB 3VD2A 1S4IA 5BS0B 4PUBL 5DD1L 4L3EA 3POCA 2K7PA 5AYUH 3GO1L 4XPHH 5TPWL 2YIHA 2W0KA 4FNLH 4MCYB 1K8IB 4KPHH 4HSCX 4KKQA 3TIEA 4JVWA 4NUJB 5D4IA 2A73A 4ZMNA 3BXNA 3F12B 4OVVA 4FAAB 5EEWA 3SDCD 4XXCC 2QVIA 2IQAB 2NY2B 1IGTB 4K3DL 1D7DA 3R4DA 1CICA 1W72A 1XH0A 4OZIA 1FZKB 3NT0A 4YGAB 3UAAA 2AJ3A 5JXEC 2HJKA 4ATTA 2HTLD 2ZPKL 2VM3A 5DFWH 5D1ZA 1RU9H 4PJ5E 1HCZA 2AITA 2BSEA 2VZOA 1U8LB 1MWOA 1RLBA 4FG6C 1HJBC 1QFPA 4Y7MA 4KZEL 2W0LA 3BH9A 5DMGC 1LO0H 1VERA 4BRVA 4CN4A 1CGSH 1NGYA 3GBLA 1AFVH 4AJVA 4F7PA 1B0RA 1LEKB 3AADB 2KPWA 1S9VA 4LCWA 4P9MH 4AYGA 1U8IA 3ARFC 1JYNA 3S5LA 2UWEA 1NDGB 5JDSA 1PY0A 1HZHH 3CWGA 3DX8A 3KNBB 4NM4H 5GRVL 2WXRA 3GBML 4HXAL 4XBPB 4HWEH 2R15A 4Y4KD 5KOVC 4JFZH 4LEEA 1MCIA 2WTRB 3OD3A 2XZZA 1BFOB 3WY2A 3WTSA 1NDGA 1HWGB 5JDSB 3HG1A 4ZZFA 5HHPB 2LHAA 3FJTA 2PYED 1M71B 2EEFA 1AO7A 1EGJH 2OMZA 3HE6B 2HN7A 4JZJA 4JZNB 2MOGA 3HKZA 4DQOH 2XWXA 3RU8L 1EANA 4Z3FA 4MBRA 1HQ4B 1T4WA 4B5ZA 4KMQA 3W57A 3HG1B 3SKUD 4WW2B 3FQUB 4M6AA 3BD4A 4L4VB 1MCFA 4KTEL 1MEXH 5JORB 3VO0A 5F71A 1EUUA 3QCVH 4NQCD 4G9DB 4PAZA 2PXYD 1SVBA 1RZ7L 1H8LA 2VMFA 5CUSH 4Z76B 5C3TA 4PV9A 2RD0A 3VNZA 2WXMA 2HH0H 3MV9E 3ZE2B 1CGXA 5MERB 1JFQL 2Z4QB 2AI0H 3W0WB 3VXTB 4DN3H 4KPHL 4JNXA 3RY5A 3K6NA 1ZJBA 4MDJA 5CFHA 2XV2A 1RAMA 2RA1A 3IB4A 1J12A 2HFFA 4ETYA 1DTUA 1BMWA 2AVGA 4N9OB 1LLAA 2F53E 5D4JA 4FYTA 5I8EB 3KCWA 4QT5A 3FO2B 4MD5A 1VFAB 1W91A 1NAKL 4XB7A 4XP5H 2FLMA 4KQ3H 4ZD3L 3ULVH 3NJNA 4PHZA 4ES9A 5AAMA 2BIIA 3CBRA 2CLRB 5ACLA 4PJ8B 3FZUD 4QJ4B 1N5YL 3A6OA 1ZIAA 3S37X 4G8FA 2YMTA 2X9WA 3MZTA 4Y16C 1XSOA 1R1CA 1DQTA 1HNYA 3GBEA 2BS9A 3BYYA 3SGJC 4ZXBB 3IFPA 4XN7A 3WELA 3LEYH 4FTDA 4KH9A 4I4WA 3BWAB 3REVA 5GSRA 3WHXB 5BUGA 4OIIH 1S5IH 2M26A 3INUL 4KO6A 1Q9WA 5E94B 1DEEA 2DQTH 2QFPA 5JQ6L 4ZSOA 5T3ZH 2A5UA 1N6QH 1GAFH 2ATAA 4L37B 5GS0D 1N0XL 3O4OC 3QUZD 5IMKA 1EJOL 3TT1L 2WLIA 4GRLA 3E1ZA 2W60B 2CA3A 2DPKA 5DEJA 2CGRH 2K45A 4FTVA 1KLFA 2DQCL 2LR4A 1MW1A 5MEQB 3T2PA 2X41A 1URIA 3RUGA 2OMYB 3T6XA 5FX3A 1KDJA 4WUKH 5CBAB 4N0FB 3MNDA 3QDGE 1NWPA 1IGFL 2XVBA 3UBXG 1XTLA 1R6VA 3MV11 3Q6GL 4PCTA 3TVMD 4IU3A 5DZNA 4AQ1B 5C7XL 1J8KA 1MIML 1NC2D 2H0JA 4AQAA 4A04A 1TJGH 5KN5B 1MDTA 2PCXA 4XO9A 5J6GB 4BFNA 5JIPA 5KSBB 3C9NB 4OFKA 3CHSA 5DQDH 4KAQL 4G1MB 1NAMH 4R26L 4NJ9L 5C0AA 3HR5B 3DIFB 3ZZQA 4E42B 4EN3B 3ET9F 3AY4A 3ESNA 4ZUSA 2GUOA 4MX7A 5IV2B 4I3RH 4KKNA 3PABB 4KKZA 5IJBC 2VM9A 1E5CA 5B8CA 1UOWA 3SBWA 4RIRB 1HHHB 5TJWK 3KPMA 1M05B 3ZL4L 1NBYA 1ERNA 3HS8A 1OAJA 5IFHH 4MKTA 3CVHA 4OFQA 3M1CA 1F1AA 2HJLA 3M8OH 3JWNG 2H6OA 4LCVA 3BN3B 5T1DH 1XF5B 3UEQA 1F3JB 2QGDA 4HKZA 3D18A 1G9MH 1IC5H 1CT8B 1PJ9A 1ZTXH 3QEHB 4S0HA 2WV3A 4Q9CA 3STLB 2DQJL 2KC0A 1RUKH 4NYLA 3WLWD 5GZND 2VT0A 4Q9QL 4IOIB 4FF9A 4GAGH 1G7HA 4WFEE 4FQCL 3KXFE 1G4MA 4LL1A 4DGVH 5IREA 1E3XA 3CLWA 1TENA 4OJDH 4W6YB 5B39G 1UVQA 3EJQA 3CFKA 3AVEA 2VZUA 4N3UA 2J1WA 4YHYB 3MHZA 4YN3A 2VDKB 3P11L 1GSMA 4M1DH 3IMSA 5JR1H 4FQJL 3TO2A 2XPYA 4R5VA 1UM5L 3BCFA 2HYMA 2AQ1A 4HF5L 1QKZL 5D4HA 1CFBA 1DSYA 2ICEC 4KUZH 3RWGB 1IFGA 1UB5A 3GSNL 3PL6B 3FU6A 1JXJA 1MHHA 2MFNA 2NY3C 4Z77B 4ZFFB 3TU6A 4ICXA 1FNGA 3IM1A 3V0DA 2XWCA 5HYJB 4Z78A 4YDMA 2HVKB 1SXSA 2EO9A 4K94L 3KBHE 4AT6B 3OXSA 1HL8A 3JWNE 1GC1L 2AC0A 2YAOA 3CX5J 4YXLH 5AOIA 2OZ4L 1NQBA 4UF7C 3TBYB 1C12A 3O41B 4OV6F 1J5OL 4AL8L 3ILEA 3RVVC 1YEJH 3D3VE 4M5SA 2A77H 4E41E 3NIFE 2DYPD 2YPKB 1UH4A 2OMBA 3WNKA 4OZIB 1F1DA 4NM4L 1LMIA 1MHEA 5IJVB 5HJ3A 4YMPA 1Q38A 2CIIB 4KJWC 4NJ9H 4ZAKA 3RWGA 4HPHA 2P26A 2F9BT 2ZWLT 1EHNA 3QO1B 4KMTL 4CU6A 4IIQB 2FUQA 4P3WA 2F6AA 2MCMA 4YSSA 1NGPL 4IRJA 3HTLX 1Y18B 3J8F7 1MI5A 2X9XA 2KYIA 4JDVB 2AV1B 4Y2OA 3T77A 5I1IH 2OMTA 5AFAA 1HEZB 4JPWL 3CZNA 2C3VB 5IROC 3WTWA 3WS6A 3RPKA 5IMLB 3ATAA 1JZ5A 1RP9A 3MOAL 2CDFB 3VH8G 2ZKHH 3A4EA 3BKMH 2NLJB 4G8IA 3T4AA 3HG3A 1TDQA 2I9LA 4N8PA 1LXMA 1R4XA 2EXYC 3O6FA 5IJKC 5T5FL 4KUCD 2F7OA 3WS6C 3MRDB 4PSPA 1NCTA 1E3FA 5GRUL 2WGXA 4AEHH 4PP2A 5TK4A 3W5MA 2DMKA 4DEPC 4YC2C 4K23L 5E9DB 3FPXA 2HFGL 3MRKA 1P84J 1AQKL 3QDMA 2ODHA 1ZEAH 2IDSA 3HZMA 3LRGA 2WVUA 1HSBB 3UBXI 3W11D 5J06A 1YUHA 4NQEE 4TYUA 3VFWA 5AW5B 3S9DB 1KEGH 3UPRA 3KLAA 4JFDA 2GTZA 4TULL 1RCYA 4MJIA 5F9DC 4RRPG 1MY5A 1QVOB 2WNGA 2FT8A 3BJ91 1WBXA 5H37A 3F7VA 4ADGA 4AK2A 3FRPB 3K6OA 4RWHA 3CG8A 1MCPH 3CXFA 5AWNL 3VXMA 4GT0A 1CURA 2YSSB 2OYMA 3P30H 2UUDK 1PZBA 5I18H 4LCCA 1DBMH 3NACL 1SF3A 5IVXE 5F7AA 3F7YA 3WXWH 2BY2A 2VZSA 2XJKA 4KK8C 1QI3A 1ZVYA 1RHHA 3CAFA 1F4AA 1XCTA 3NQIA 4WY7H 4KFZC 4DH2A 4NHUA 4PBWD 1AFVL 1UFUA 1XB3A 3NJVA 3SDDB 3TPUB 1CF1A 35C8L 1TR7A 5AENA 3DX7B 1KZQA 3MYJA 2NZ9D 4BA8A 2XZQH 1JOIA 1P0SE 4JEGB 1CQYA 1YA5A 1F58H 2IGFL 4IEFA 5IROD 1T7ZA 4FQPA 5C0GB 1KB5B 4Y16B 5KVGH 1FCCA 5C0DA 3S36L 4QHLA 2Y5TA 2IAAC 1E28B 3QAQA 2YGPA 5CJXA 4WHTB 3E8UL 5F9OL 3O45A 4J3BA 2OTUB 3L9YA 4E9LA 2B1AL 2F5BH 4XMLH 5D7LD 1E9PB 1QNZL 3RTLA 4ETQA 2DYPA 3CVDA 4OIFA 3QZOA 4FEMA 4P4KA 5K39B 5C0DB 4LLUB 2R0LL 4HIIB 1XV8A 5FYLH 1Y6KR 3UTSA 3L08A 3D06A 5CO1A 4ZTPH 4KKCC 2WXPA 4RRPM 4UM9A 3ZKND 1BD2E 2VNCA 3P9WB 1I8IB 1DJGA 5CLTA 5JUEL 5M7QA 3D7PA 2YAEA 3QCVL 4OJEH 5CZVH 5H2BA 3FTGB 4WV1C 1IT9H 5GS1C 2V17L 5I8EA 1MVFA 2RCSH 1JNJA 2BVPA 5B1AB 4ATWA 1DZ0A 2DQDH 4UM9B 4WO0A 3V5HB 1WYJA 3FUEA 4QGTA 3GHBL 1WWAX 5KSAC 1KUMA 3B2MA 2BP0A 3EYOA 3W81A 2E7LC 1G9NC 4M1DL 5IJCC 4X5XA 3VDCA 1HHJA 3FSOA 3WEXA 4LASH 4UUJA 4Z7OF 4GO9A 2YAFA 3ATFA 5CCJA 3UADA 1PS3A 5EDXA 3QUYB 4GUOA 2NY7H 2WK2A 5FB8A 4JFEB 5KJRH 3RDTD 4JM0A 2WXGA 3FCBA 5BUAA 4XP6L 1SMDA 3TTSA 4P3DA 2BZ7A 5EU6E 5A7BA 1MRCL 5BVJA 5I1AB 2FJSA 2J88H 3L3KB 4WY7L 1CGVA 4DGVL 1DBKL 4QOKB 4UNVA 4OW6A 4M7KH 4XHJD 4XXDA 1I7TA 2I5YL 3GXNA 1A3ZA 2AZUA 3G5XA 1E9QB 4JBSA 3QPQD 1PEWA 1QW8A 2VDRL 1RFDH 2YXVA 2WLHA 4KC3B 1AR1D 5GRXG 1A6WH 4HUWB 1N59A 1RHFA 2IFFL 2MTAA 1DE4A 3NOIA 3VXMD 5I1AA 2NY1B 2VABA 3NIDB 4K3EH 2OMYA 3GSQB 4ICWA 2VXQA 1LK2B 1NCAH 3DXAB 3EGXA 3CFJA 5HVWA 1TSRA 1A6AA 5E9NA 4JGMA 2HLFD 2NY2C 3VGGA 1A0QL 5C0JB 3GJFB 1C5CH 1T7VA 1PZSA 3CBKB 5ANHA 4YHYC 2XKNB 2XTJC 3G6JB 5BVJB 1AOHA 5FLUA 5DO2C 5GXBB 2HTKD 1AGCB 3LV3B 2MQCA 3L2LA 4NENA 1FORH 3CMOL 3E1F1 3CX2A 4RGOH 4WJKB 3NIGE 2E75C 2K3HA 1KYFA 1X5KA 4NO3A 1FVDA 2JH2A 1EMTH 3IDGB 3BI9X 4H8WH 4JRLA 1AC0A 2EYSA 4N2AA 3L5HA 1XR8A 5IEKA 2EKJA 2V17H 4QF1A 1FVCA 3UZVB 2CO4A 1T5XA 3HHMA 4C56A 3IGFA 2VDLB 3QO0B 3C6LB 3OB0H 2CBOA 4M43H 3FT3B 1I1YA 2DLHA 4NN6C 4Q9BA 3S3CB 4GAYA 2VXUH 4S0SD 1W15A 2J5LC 4YSRA 2VISA 5CMAA 4BQ9A 3FNKA 4I3RL 4HHAB 3AXHA 3ISRA 4X4MA 2CPCA 3HE6C 5J13C 1DVTA 4UZGA 4PG2C 5LAXB 2QZ5A 2YGVA 3LQZA 2DS4A 3WUWG 3PNRB 2HKFL 2IOOA 3G9AB 4FQIL 3N3EA 4JHWL 4P99A 5F72S 5SWZB 1GHFL 2OMVA 3UG5A 1P69B 2FHCA 2RH0A 5EB9A 3HB3C 3DWTA 1DQJA 1F11A 2D2CC 3FT0A 3HCVA 3ETBJ 5H4YA 1XGQA 4FQ2H 1KJ2H 1CXLA 1FUNA 1VPOL 5LN8A 3GMMB 4L1DA 3S2AA 5K59F 3EGSB 5GJTH 2W94A 1M7DA 3GRGA 4XCFL 1FYTA 1J5IA 2XWTB 3SOBL 1K2DA 2KDGA 2B59A 3WU1A 1ZHNB 4F9LA 2HJLB 4GRWH 5DJXA 3OXSB 2IF7A 4AEFA 3IU4L 1INDH 4JG1L 4I2XA 5JQHC 5FO8A 1SGKA 5I75B 1QKZH 4UT6H 1EERB 2OSXA 1NFKA 5DUBB 3SDXB 4PJ9C 4YHLH 2KLSA 2EC8A 3QIBA 2DMGA 2JIXB 4HH9B 5LDSA 3KDMB 3VSQA 5LNDA 2JJVA 4KV5F 7CGTA 1QBLH 1QI4A 2CR0A 2LV4A 4M7LT 1EXUB 1LDSA 4CDGC 2FX9L 4KVCH 1XD1A 3O3DA 3DPBB 3GZKA 4PJ5D 3SDXA 1NCCH 1UWGH 2TRHA 2YRBA 4FJ6A 3TA3B 4RZCB 5GHWL 1E6JL 1H6TA 1S9VB 2R29H 2XWRA 3EUUA 4LCWB 4OFVA 2X1WL 4X6CF 5DJZB 1KFAH 5DJXB 4YZFE 2FK9A 4Q2ZB 1OAXL 1EK3A 1DQKA 5FA4B 3TLRA 1ULVA 4M1GH 1I1AA 4NBZB 3U4AA 4O02B 4UB0H 2XTSA 4BJLA 3Q43A 1FNHA 1P7QA 4XAKE 4IKKA 4JPKH 3NA9L 3VRJB 4J8QA 3MRDA 4TUOB 4MLSA 2CAKA 1CLVA 2YUXA 3LNFA 3DOHA 1SM3H 5DK0A 5JHLA 2O93L 3D4ZA 1OP9A 3NAAH 1PZ3A 3O4LD 3IK2A 4L3EE 5CINH 4ZMAT 4MB1A 2K78A 4N20A 4P2RB 4BK5A 4ISVA 3D39D 1EAOA 2PR9A 5AVVB 4AITA 2AERT 3MA7B 2MHAA 3IFOB 3BD5A 3JVGC 1PZ5A 3QFDB 2VDLH 4LLYA 3TZVB 1QR1B 3TIDA 3UP1A 3FU3A 3C6LD 4ENEC 1I8AA 5DMKA 1JGVL 1U8IB 3WIHA 3DUSA 5B7EA 1CI3M 2K6WA 3K1DA 2NT1A 1UC6A 2KS0A 2EUVA 1RUPL 1H15A 1NCDH 3H55A 3FUFA 1UUNA 4FYRA 4NNYA 1M1SA 3L5JA 5DZLA 3QXDB 1JI1A 3MRJA 2HAZA 5EUOB 4ZRGA 4HXBL 4YOKA 4KDVA 4N8CH 1M6OA 2FL5B 2F74B 1WTGT 1J88A 5ERWB 5MENB 3NJLA 3OAUL 5IB4A 4F8LA 2YS4A 4WHTA 4NHCL 2W0FB 4XGZB 2DQIL 1M4KA 2UXFA 3L2MA 4ELME 3J27A 1IVTA 1MCRA 5HYFA 3APCA 4KY1H 5L4IA 1H3WM 5KWYC 5C0CD 1OCZB 4P4KB 3I75A 3FQRA 2ZXBA 3U6RA 1MOEA 4D8PB 4HWZA 5GHWH 4LDCA 3SPIA 2AK4B 1Q9OB 5KS9E 1A7PH 4YHKL 3V5DA 3LD8B 3ZZSA 2BFVL 1I9IH 2UWEE 4NZTH 4WDIA 2DQGL 5JPNA 4YNYB 1QLEB 1BLNA 3BLBA 5MERA 3NCMA 4DETA 4TVPE 4GRWF 1ILSA 3TEZA 2FIKB 1KBPA 2XICA 1QUNA 5FS5A 5AD0A 4C4BA 2YAHA 4HPYL 3AQDA 4XXDB 5K5YA 2GJ6D 1C5BH 1YEFH 1M05A 4PJDB 1F0LA 5D1ZI 3FB6B 4WWKD 1L9TA 3HIZA 3GMPB 1OHQA 5CP7B 4YJZL 2NY1C 3LZRA 1EO5A 1U8OA 2YAMA 3Q5TA 4G6KL 3LAFA 4MJJA 1RIHH 1YMHB 3FXIC 3C5ZD 3UTZB 3H3BC 4GJTB 1I8KA 5IHZA 3UPCA 1U3HA 5MEOB 4MDJB 4BE6A 2LQRA 1MCOL 1VSCA 4XPFL 4UOJA 1JF6A 2PNDA 4BUHA 5F8RC 3QQXA 1OE2A 1E43A 3KD4A 3PWNB 4LFHG 2ZCLL 1VCAA 4G72B 4V2BA 4F7CA 4NQUA 2YARA 1KTDA 2C3WA 4FI8A 2GI0A 1WLHA 3WIHH 3ROLA 5FW7A 4UILL 1JZ2A 2YEZA 1T1WB 3WKMH 3RJOA 3AU0A 3CVCA 3QA3B 1RQ5A 3E7JA 1QNIA 3L7EA 3QUKA 4APXA 2ZX7A 4AMWA 1NGQL 3VRLE 1YEHH 2YD3A 1R3KA 3G5ZA 3LKRA 2Y72A 4MJ5A 3S8WA 4R3SA 2GPZA 3S3JA 2IGLA 4CNIA 2YOAA 3ML8A 3KPTA 3KH3A 4L8SC 3UYPB 3VD3A 1SMOA 3REWA 2VLRB 3PV6B 4ENZA 3BEVA 2CO1A 2DIAA 5D6CB 2N4IA 5HHVL 2QSCH 3LRKA 3PGCB 4XVTL 4FZEH 2YMOA 4JUTA 3HG1D 3MJ7A 1BQLH 5I8CB 5I26A 4S10A 2VXVL 2AFNA 2DMHA 1P5VB 2K3TA 1AO7D 5IUCA 2XZAL 1Z5LA 3KPSE 2QADD 1ZHLA 2WLIB 5DUPL 1FL6B 3SY6A 5E95B 1TCRB 2WANA 1ZY9A 4M9PA 1CS6A 2FEDD 4A2GA 5I66A 1TQTA 3HPJB 3NZ8A 1LL1A 4X5XB 3TBWA 3B7RL 3TN0A 2A83A 3ZRSA 3NJFA 2JJSA 1C12B 3O41A 4N2EA 1A66A 4EE2A 4NKOB 1CL7I 4S1SL 1LE5A 3H4HA 4P2QB 3MN8A 4Q4IA 4KRLB 3R7QA 4OCRH 3I3EA 4AQ1C 3UYRL 4L8CA 3LMJL 3V6BR 1BVKA 4HH8A 5FWQA 4Z7UE 4AVHA 2Q0ZX 2H26B 2I69A 3IETB 4HMDA 1QABA 1A0QH 3GBNL 1JF1A 3GUFA 5JPMB 5HP5A 3QJHA 3MMEA 3BAKA 1UA3A 3EH1A 3ZE0E 3HUJE 1G9HA 1F6FB 3ENEA 3LKNA 4P48A 1CIUA 3QNYB 2OJEA 1Z6JT 3PDGA 4UV7L 1VFBA 4R0LB 3UERA 3OXRB 3R1GH 5FO7A 3TN0B 4G59C 4MS8D 3ZXAC 1MJ8L 5M95B 4YXHH 1OWWA 4RA0C 3WN5A 3AREB 5BZZA 5T3XL 4HSAC 4QCIA 1IEHA 5AQ0A 4E5XG 3NSXA 1ZA3A 3RBSA 4BWUA 4OLUL 4WFED 3MJ9H 4G8EA 3ROOA 3WXVL 1N68A 2M1KA 5DD0L 1KGJA 2LTQB 4RFEB 1I1AB 3L5XL 4JO4L 1JZGA 5J89A 3ZQWA 1P6WA 2OKMA 1P4LB 2XA8L 2VDNB 2XZCH 4X6CE 4PJEE 5D8JH 2D73A 1J5DA 3N06B 3E3QC 3UTTB 5FDYA 3NP3A 3QI9C 2CDGA 3X3GL 1CD8A 3ECUA 4MYWB 1SDDB 5G5DB 3KWWB 2FEEL 4POZD 4Y19B 3TESA 4FLOA 4B41A 2NX5E 4LNRB 4BK4A 5L8KB 3EOAA 1ZGLP 3VGEA 5FW6A 1HXKA 4KDTA 2Z92B 1TPXB 3SDAD 2HTKC 3FULA 3LH2L 1GGTA 5KSAB 3MRPA 2VQUA 1Q1PA 4CU8A 1E5AA 1VAHA 3QWRA 2YFOA 4ZUTB 5SWQB 3NK4A 2KERA 1PPIA 2DEYX 1PIGA 3K2KA 2IGFH 4NDMB 4XVJH 4Y2DB 3MR9B 2DM7A 1NM9A 3BH8A 2J1ZA 4JHAH 5F97E 1RJLB 4B7IA 1WD8A 4NKQB 4ZS7H 5JW3H 3KLDA 1IEAB 2CIIA 2EDJA 4HS8H 2QQKL 1XGPA 1AQDA 5EOCL 1JHTB 2B1AH 3UO1H 3LB6C 4WF7A 1SBBA 2DYSB 2VSMB 3OSKA 2ZSWB 2NXYD 2WLYA 4HKXB 3ZE1F 3ZT6A 5B1BB 1ZK5A 3FCTA 4WAFA 2IQ9H 3GC3A 3ASWA 3FTZA 3NQKA 1Z9LA 1ET5A 3T2LA 5CLZA 2LAGB 4UM8A 2FBRA 3PFQA 4XB8A 5KYUB 4MVBD 1HXMB 1VGEL 3PQYB 3SDXF 5K9KA 4R7DA 3BP5A 3QIUD 4IBQA 3TCLB 1UXWA 3AS3A 2XWDA 5HGBB 3X12A 5I8KL 4FMVA 4GXUM 4JO8A 4MXVE 5AYUL 1KIPB 3UJJH 3EYFA 4WNSA 3N04A 3TH2T 2LTQC 3KR3L 4WK0B 2F19L 1J05A 4OF6A 5EU6B 4P06A 5E2JA 4DUWA 1J8RA 4LL9A 1MLCB 1KCUL 5FXCH 4C54A 1QD0A 2LABA 5MEPA 4PLKD 1PD0A 3BN9D 1WA2X 3VXPB 1CFSB 1AHWC 4M62L 3ZDYF 3RWHA 5IBUG 5L8LB 3K0WA 3S88H 3Q7JA 4TLTA 3H3PH 3T0WA 4ZTOH 3BQUA 3BZDA 4G71B 5E00A 1UEYA 3CFEA 4YFDB 3D25A 3HZYA 3OPZL 3VFMA 3NVQA 1W72H 2ZONA 2WNXA 5EWIL 2QSTA 3SO5A 2VAJA 1SJMA 4PRHD 2EE2A 1U41A 5AL8A 2OMZB 1MXGA 1OGTA 1IM9B 4DVBB 3P4NB 2PCPB 2HT4D 1BSIA 1RZKH 3RYMA 2EC9U 1FG2A 3P77B 3I84A 5D7IB 3U2SB 2Q6WB 4FQHA 4P46B 2CO7A 4WWOA 2GUOB 4JHAL 1WWBX 3N44F 4GFXA 4MMZB 5DWPA 2B14A 4HZLB 1IBGL 1KTDB 4K73A 4XO4A 2O6PA 3DXAA 4MA1C 1C5DB 5I1HH 3WNJA 1KG0B 3Q6FA 2J5WA 4HG4J 1Z66A 4WWPA 1E4XL 3SE4C 4ACTA 4K8RC 1JSYA 3KJ6H 3ZVVA 1YEKH 3UTTD 3Q1EA 3ARGB 1JK9A 2FD6H 1S7VB 2L0DA 3VU2A 3NGBC 1DVFC 3PG2A 1HHKA 1LEGB 1N4XH 3NIGF 5AKVA 3T8XA 2JWYA 4XNXL 2DWDB 1NCGA 3S3DB 4HQQL 4U1HB 3U7AA 4FHJA 3UG4A 3VXME 1BOYA 5BQ7A 1XGYH 2X6AA 1BYOA 4YIQB 3E9UA 4RMVA 1F8TL 1MI5D 4AZUA 2WXFA 1YPZA 5IOKA 1B88A 1QLEH 4MMZA 2WSDA 4GG6B 3TO4C 1KB3A 4H8UA 4OIAA 4N3TA 3LPWA 2VLKB 1OCCB 3OKDB 5GGTL 3ZKNC 3X3FL 3B9KD 4XVSL 5AG9A 1MH5B 4R4FH 3MLPA 4WUUB 3QIWB 2UY6B 3ARUA 2RAMA 2AVFA 3HMWL 4H1LH 1Z7JA 2FJGA 2PW1B 2O5XL 1Z9PA 5DHVA 2X09A 4WU5B 2IPTL 2O5YL 4LPTA 4Y7OC 4CDHA 3L7FB 3GSNH 1X9RA 3ALXA 3K2UL 3DVFA 4W9ZA 1XAUA 4ZUVA 4OZHA 3II3A 4JRFA 2OL3A 4JANA 5KJ4A 2E76C 5EO9B 4YBLB 2WXNA 3QAZC 3PP3H 2FE0A 3F01A 1QSFD 3QIUB 4UNIA 3IU3B 3SSGA 5FGBA 4IJ3C 4NKOA 4JFDD 4X6BB 3QWOB 4YHZL 5BMFH 3FO9A 4WKXA 3RZCC 3HI5H 5JPNB 5CBEA 3NIDE 1F97A 2XDHA 3VFVB 3BUQA 1JCKA 3ZDXB 1NCUA 3MRIA 5H4ZA 3BVXA 1KXQE 2XVKA 3PY9A 3ZUNC 2ZKXA 1U30A 2BHUA 4OJAA 4AYMC 4M6OH 4PJ8C 1JP5A 2EABA 3GGWA 3VFGH 3WNMA 5DSCB 4I8DA 4ORGB 4HV8B 5C08D 3TO2B 3FRUB 5D71L 3P3TA 3HG2A 2H8PA 2OA9A 4UT6L 4GP8B 5HHXH 3IDNB 3WKML 1DL7H 4U2YA 1CK0H 5A7EA 4G8GB 4M93C 2VXSH 5DHVH 3MNWA 4O4YH 4TSBL 1YPZF 2C4FT 3TF7C 3DHUA 1P5VA 1GRWA 1A6AB 3FTVA 4FFVD 5HGDA 2LE9A 3RIFK 3SGDI 4YXLL 1EEUA 3MRBA 3GZOA 2EXTA 5JHDD 2PWHA 3RGBA 2IQ9L 3H54A 1G6RL 2CDGB 3LH9A 2ADGA 1O9ZA 4M5ZL 3LRMA 1B9KA 2H7WA 4W4OA 3RNKA 2ZOUA 1KY7A 5DHXB 3ZKXB 5DR5H 1W0WA 2VXVH 1ZVSA 4PS8A 3LZQA 2WJ5A 2EIMB 5EIQA 5CEZH 3LIUA 5L0QB 2X70A 5FM5O 4FG2A 5EOCJ 5GISH 5C0RH 4G3YH 3A4FA 2HJFB 3ZOAA 3OHXC 3HBPA 1BXAA 4UM9D 1IGCL 2I60L 2BX5A 4WEUD 3KYNA 5JHDE 4NN6B 3N5AA 2PWDA 1BD2D 1MFBH 3UGEA 4XNMA 4KUCF 1F4XL 4HIXL 4ZUWA 1AZCA 1TZGL 5EEZA 1PTZA 1PG7H 2PLTA 4HMEA 4UIMB 2IDTA 2HJFA 1C8PA 1KYUA 2FH6A 2NYKA 5IBLD 5ESQB 4ZDHA 3RWDB 1KJVA 2EVHA 5CSGA 5FGCB 4N1HB 1KCSH 1CB4A 5D1ZB 5D7LE 5F9WB 4OF5A 2G2NA 2EDXA 5JXAL 3ZE1E 4YSUA 2Y6SC 4BHUA 2JKRM 2D31A 2WBJC 4NQTA 3WY3A 4IQHA 2A9NL 4I1RA 4G42B 1ZPUA 1EAQA 3IJSB 2A6KB 3OG6B 4XC1H 2QHRL 3SBPA 4U1GB 4UDUB 1AKJD 5ELIA 2YD0A 5HHPA 3MAWA 1JXFA 3RTQA 5SV4A 2ALAA 4I0KA 3ZGHA 3HG1E 2AK4D 4NO0B 4WNJA 4WFHE 3S8FB 4WU7B 5BO0D 2QPDB 3PAYA 1DVXA 1EVUA 3U7WH 3X13B 1CLCA 3P4OA 1AS7A 4MNHB 4NNXB 3IAPA 1ACYL 2BXYA 2Q20A 3QDJA 2WKGA 4Y2OB 3QUMB 3WFDH 4QJ5B 5HPMA 3CUPB 1QNZH 1FH5L 2K8QA 4MQSB 3FF7A 4LKXA 3ZZLA 2C3GA 5D55A 3VB9A 2EICA 4TV3A 3L17A 4MCMA 3OBAA 5CLXA 1MVUB 3LSOA 4AQ8C 1FZMB 2ZXCA 4OSUL 4Q74A 1H0DB 3MROB 3FSZA 4GEJA 2WLZA 3SDDA 3BPLC 1XD0A 1MFMA 3EYVA 4PWFA 4CN1A 3VMOA 3APDA 2Y06L 5L2KB 1PZ5B 3QFDA 3TZVA 5DYOB 3GYRA 3MFFA 3JTBA 2HT4C 1I53A 4WI8A 3FN9A 3COOA 2QT6A 1NC4D 3SIKA 2IAMD 3QG6A 2M83A 2OR9H 3BW9A 1TCMA 4PM1A 3SCMB 1VFMA 5EFIB 1NFDB 2ICWI 3IJ9A 2MPAH 3QORA 3B4NA 1RZFL 1S3KH 4M56A 4J3WA 3IJYA 4G83A 5DJDB 3MO1A 2YD7A 3BJLA 2ZOOA 2D7NA 3HC3L 4AJYV 1UADC 1CXIA 2JK5A 3QFJB 3MRGA 3MKKA 4ZQKA 4C56D 4FJYA 3SE3A 3H2PA 1DQQB 3HAEG 1L6PA 1WZKA 3GIZL 5KYWB 5E8NB 1A02N 1OTUD 1OCOB 2SEBA 1A6VL 2HT3C 3ARBA 3LOWA 4HJTA 1QFWM 4GMSL 4HT1L 4NQXA 5DC9B 1E2WA 4PJCF 3VXUB 2XBZA 4QDGA 2A0LD 1TETH 1GL4B 2E3VA 5IQ9B 3L9BA 1J9RA 3FPYA 4LPWA 2KQMA 5C1MB 4M3JA 4LSQH 5JLZB 3V6ZB 5KJ7E 3VXQB 4Z7WA 3H9SD 3MV9A 3F7YB 2XBTA 3BAIA 4OCXH 3JV6A 4A2MA 1P5UC 4TUKH 2VL5A 3IMVA 1JHLL 3QISA 3CSTA 4F2FA 2L7QA 3ABGA 4U1JA 4CC4A 1Q9OA 3HC4H 4R7XA 5ISZA 4OF0A 5BS0D 3K6SA 3LV3A 1ADQL 1X7SA 1Z1WA 3FUNA 3AWFA 1BXXA 2DBLH 3V10A 3QUZC 2YXWA 3DUUA 2XNAA 4M62H 1GJUA 1BV8A 3D08A 3MREB 4TSBH 3HE7A 4I18B 3QYNA 4CC4C 1MW3A 3ES6A 1LWJA 3WXWL 4ZS6C 1VFOA 3BWSA 5EDSA 5ERWA 4Y4HD 1U6AH 3RVTC 3VG0H 3DX3A 3G6JF 3LNIA 4HIJB 1RKRA 4AV4A 4MZIA 1Z9OA 5CJBA 5CBAA 5JIIA 5KEZA 4MQ7A 1JPST 3SKNB 3MUY1 2YK1H 2XU9A 4NLHA 5TDPB 1HAWA 2YUVA 4LCYB 1R3HB 3QJXA 3PL6D 3ESPA 1KYOK 4NKDB 5FYLD 3WKNA 1RK1B 5DHYA 4M1CD 4HUVB 2C1OA 2G3ZA 3L3KA 3S36X 5LAPA 1XB8A 3KJ4C 4MCZB 4JJ5B 5JPNC 1I3RA 4FNSA 3L3GB 1ND0A 3BWUC 3WHXA 2LLNA 3Q1SH 3QDME 3TV3H 3QRFM 3BIKB 3NJHA 4XWGL 3HA0A 2H2SD 4WQOA 5A2AA 2F7QA 4QXUH 2MIZA 3UTQB 3CVIL 1ZHBA 1ZMYA 2D3JA 1F4XH 4M5ZH 4PJIA 4QRQA 3BKYH 1JZDC 1I1AD 1DJIA 2J72A 3FFCB 4N2KA 2A9BA 4YXKL 5FUOL 4ZZKA 3ZRFC 5IOPA 4JRXA 4LRNH 1ETZA 2B0SH 4W9GC 3IKKA 3KDPB 3BUDA 3QWNA 2AMUA 1S7TB 3V7AE 5GGRA 1L9PA 3SPVA 5I0ZA 1I3RB 3QT2A 4BKLB 4YDNA 3RBGA 1XSJA 3D51A 3T4YA 5L88H 4G5ZH 4GSXA 2F54D 3WNPA 3SDAB 1PBYA 4U7KA 2FX8H 5EBWA 5TDNB 1XH1A 2VGLM 3B37A 3VXNA 4Z7UB 2O61A 3R19A 2P8LB 3QYCA 4Z7QF 4YX2L 2OQJA 3VXSA 4Z95H 2YKLH 4F57H 1NZRA 1G9NL 2GK0B 1XZ0B 3IS0X 4Z3GA 2IPTH 1JPSH 1Y1DA 4WGVB 3N40F 2ZKYA 4PJAE 4WK2B 1A4JB 3BWZA 2AV7B 1OT2A 3IGAA 4BELD 1FGVH 3FBQA 3QEGL 3WBDA 1XIWA 3P0VH 4HUCA 4P5MB 4XN1A 4AKOA 1NUNB 5T8IA 3SYPA 2B4CC 3H9SA 3MV9D 4XI5C 5DVOA 1CFQA 3G08B 3F83A 5CEYB 5I6XB 3HRPA 4Q7DA 4Q2ZA 2NUPA 4Z1PA 4YDVB 2IBZY 2ICEB 1A6WL 1F90H 1AH1A 4IU2A 4PSRA 3MCKB 4ODUA 5DI8B 1MG3C 5IW3A 1BW8A 4D9QE 1E0OB 2JJSC 4ZNEE 4Q9RH 2YPVH 3U36A 2GC4C 2WLLA 1KN2H 4JFYA 3RVTD 4XCYB 2G4GA 4KKRA 4DHLA 1FV1B 3DVNB 5E23A 1UGKA 4UT9L 3LNGA 5DUMH 1A7RH 1TSHA 3M86A 3PGFH 3Q1SL 1ORSB 4M61A 1DVZA 1QATA 1U91B 1G94A 5ICXA 3N42B 1QBLL 2BNQD 5AEAA 4GI8A 2Y24A 2FLBT 4O2CA 3N1FC 4X7TB 1GIGH 3NRPA 1BLIA 5C07B 5JPMC 5T33H 4P9HC 3U0PA 4WEBL 4PYGA 1T0NB 4XN8A 3CJJA 3I6LE 2J73A 3LPGA 3NN8B 4M4PA 1OM3H 2D0GA 3QUXC 3U82B 1JVOA 4MGXA 1IAIL 3HPLB 1IZKA 3QHFL 2CUAA 3L3HB 1HCYA 4OZ4A 4X9GA 3BKCH 2EDEA 3E8VA 3BKJH 1VKXA 3WY4A 4WSGA 1QSEB 3I9GL 3VI4E 2NY5H 3HNTL 3GMQA 4K5NA 3AY2A 3NUKA 1OAUH 5CGTA 3OQ3B 4JQVC 1QOKA 3N0AA 4YGVA 5FAAA 3GI8L 1D5RA 5AW0B 3STZB 4HK3N 2J2ZB 2J6WA 1DQLH 32C2A 5IVZB 5IB3B 4IIQC 3FW6A 3VA6A 5CGYD 1OT1A 1UJ3A 3GHPA 3IDXH 4ZW6A 3OKNB 1X9QA 5D1XE 4KRPC 3B2VL 3JTTB 3TEUA 2VXTH 5T1MA 3Q8AA 1HH9B 1FP5A 4ZOAA 5AVSB 2CA4A 5ADOH 3RWHB 1IC0A 4Z7IA 3FO1A 5K93A 4Z7AA 3NPSC 2F08A 4HD5A 3V2AR 1FNEA 4NNPH 1JIBA 5F7FA 3SOTA 1YN6A 1K6QL 1PZAA 5MEPB 3GJFK 1JPTH 5CEXA 3FQRB 2PPCA 3OR6B 3DGCR 1DVUA 1JL8A 4PJXB 2Z4QA 3JV5A 3SCMA 1DUYA 1MNUH 4HX1A 4ES8A 3C60B 3STZA 3D9AH 2WZPA 4G9DA 3RPIB 3MUUA 4WFFE 4MZRA 2OCCB 1LNUB 2DQEL 5FKAA 5GGQH 4GUQA 1C08B 2WSKA 3PWPE 1EDHA 2R4RL 1DVSA 2IBZX 1T20A 3JTTA 4QHLB 4RGNE 4JFFD 3ZN6A 3VDAA 4GSDH 5IHWA 2R2HB 3C5SB 1JHLH 1H15B 2C7UB 2APFA 3IU4H 1J7VR 2CO6B 5DUML 1EAJA 5A3IC 4FXGC 1SLUA 3GJEA 3W38A 3LSOB 1PVHA 2G60H 3BGMA 5H8DA 1JGDB 4AUUA 5BVPH 5I6KA 1HYSD 4V2CB 1S7VA 3IRZA 5TE7H 3F64A 4QRPA 1QI5A 2JKIS 4JZOA 2WVTA 2BS8A 5B8CC 4QT5B 1WF5A 4XO8A 3BSHA 2ZUYA 4PJHE 1N0LB 3K6SB 4GRWB 5EBMA 2IMNA 2YC1A 1U8CA 5D5MF 5E2UH 5TQ0L 5LN4A 5GRJL 4Z23A 3SY0A 5F2FA 1BFTA 2MSPA 3T6WA 4JG9A 3DTDA 4BIKA 2NNAB 1RJLA 4HLEA 4Z3IA 1FYHB 4JO3L 5DC0A 3RZCB 1KPRB 2X4QB 3C6SA 4LVNC 1RJCA 4S1QH 3GSRA 2XN9B 1IAKA 4U6TA 3R06A 1NGXB 1EZVX 2ENJA 4I7ZC 3EKCA 5DMJB 2IXQB 5KTEL 1YMMD 4ZFGL 5HDLA 5GIRA 3FL7A 2X4SB 1EFXB 1JV2B 1G7QA 4XN4A 5EORH 5I76A 3BUYA 2BVOA 2GEEA 3H1ZA 2IPUK 1J0KA 5AVWB 3AGWA 2COVD 4LLMB 4ZFZA 3QI9D 4U1IB 1XIWC 4C83B 5I15L 2VXTL 1K3IA 3TO4A 3O2WH 3HN3A 3RWJB 1G7QB 2KQNA 5C0FA 1MQKL 2W60A 2DEXX 2FECI 4TRPH 2P8MB 5I16A 1F4YL 1MN4A 4ANKA 3HG4A 2ILLA 2OCFD 3ME0B 5IJDC 4HIIA 3WEXB 2XN9A 2PTUA 2XV6B 3P1VA 5IFJB 5GZOA 4GKZA 2X3CA 3WTYA 2FEDC 3HAEA 1XVSA 5D7IE 3LDBC 3HI6H 3L5WB 1YNTB 1E9PA 3GKWL 1KJ2A 4X5WB 1SXAA 3HR5A 4P2OA 1G9MC 1R3JA 3C5JA 4YDZA 2UX7A 4EDWH 2QPSA 3LPOA 2QVKA 2QPUA 3G7TA 4BDVB 4JB9H 2H1PL 5KSUB 2EDWA 2EYRA 2FX8L 2JJTC 5L0QC 4QRPE 1CDBA 3QZMA 3HBGA 3O2DL 3DGDA 4I4WB 5HGHB 4EUPG 1LQSR 3KGUA 4HCRH 1MRDL 4P23C 1Q94A 3QUXA 1F02I 1KGYE 4HJEA 3KWUA 2XX1A 3DYOA 5HHMD 3V8CA 3WE1A 5BJTA 3QWRD 1QBML 4JJHA 4EPSA 1L7IH 5HVHB 4DPAX 4E36A 3VI4A 3QXAA 2NXYB 1RK0A 4F80A 3DX0A 2VLLA 1NAKH 1BREA 1RVFH 1WIOA 4X6FA 1N8ZA 4LARL 5EU3B 3GUTA 4KI5C 3J7HA 4WCYH 3D85D 4MD0B 3OLDA 1E4JA 4XRCB 2XCMC 2NW2B 3EG9A 4JQIH 1U58B 5DD3H 1A25A 1DLHB 5IHBA 2QEJA 4N8VB 1DLFL 1JWMB 3D2UD 3PQYD 1QSFE 3GI9L 4MNGA 5F1KC 5FYLE 1IBZA 4PH8A 4BSVA 1IAIH 1JV5B 1PKOA 4ODTH 12E8H 4OBRA 5CJXC 3BP7A 4KXBA 2HT2D 3RHWK 3UYRH 4DZBB 4MJ2A 4UQAA 3DX4A 4AH2B 2D03L 5TTRA 2NZ1A 3BAYA 4UT9H 2WWMD 4U1HA 3U36B 1XZWA 1E8XA 4G7YL 4YDIL 1N10A 4KMTH 1S7UB 4HOMA 3SE8H 1GAFL 3VU1A 4PJFA 3D69B 4XMTA 5DJ8B 3OF6A 3KLKA 4P2YA 4MQ7B 3S4SG 2X10A 5G4NA 2TAAA 1YJDC 5HYIA 4OFYD 5HD8D 3QAZB 4XMZA 4QHUA 5LWYL 3GK8L 3LEYL 3ZPDA 4X6CB 5E8EA 3P3SA 3D0AA 2PW1A 5DRNA 3MLYH 2I7SA 3HNSL 4OCLC 4IBYA 3BRFA 3MNMA 3X2QB 3LS5L 2C9XA 3AWGA 4U1NA 2N01B 1UKTA 2XTJE 1DN0A 1AGBB 3A21A 4L0YA 3P54A 3FB7B 2L7UA 3HLAA 3V0AC 1KMGA 2UUDH 1TJGL 4CVZA 1JGUH 4DGUA 2BY1A 3RLSA 1X3DA 5I28A 2ARJB 4WWKC 1UG9A 2RB8A 1NGZA 4FQQA 4YZWA 3EFDL 1J1PH 2TSBA 3T9WA 4G8IB 5BV7L 4N9GB 5HPOA 4LSUL 3VFPA 1QQDB 4GI6A 5I1JL 4L8CB 4K9JA 1CICC 5FUCE 2W92A 3UC2A 4B6ZA 2EDMA 4X0NA 2PABA 4CBPA 3ULUH 2BVUA 3RGVA 3W2DL 4ZUUA 3VXRA 4RLDA 3GTVA 1HEHC 1T2QL 1A7QL 3MGTB 1UUSA 3V0WL 1AGEB 2PXYC 3THMH 4AIXA 1UQSA 4MCYA 5CEXB 1CXEA 5KSBF 2R7EA 1FZOA 1HOEA 1IC5L 2HRLA 3KPRE 4OCYL 3TBVB 1OY3B 5K1JA 1DBJL 1THAA 1G9EA 4F9LC 3TOPA 4XXCA 4LLAA 4N1EA 3EXLA 2P24A 1MSPA 2D0HA 3FO1B 25C8L 4I1PA 3NZHH 5GGUA 5D72L 2OR9L 3FOMB 3PLYA 4U0QB 1K8IA 3V6OA 3ZE2E 2DY2A 1P2CB 3QG6B 2GEQA 1SOXA 3QPXH 3VYPA 4D0CB 3NCJH 5FHAH 3DJRA 4K0OA 1QWNA 5TF0A 2HWZH 5EU4B 5BRQA 3VE0B 2RALA 4W9LC 3GKZA 5DYOA 1ONQB 3PU7A 3H7BB 3IMTA 3PHQB 2OMWB 2EDBA 1ZXQA 1MZZA 4XXWC 4PJIE 1K8DA 2X4RB 2Z0UA 4QRUA 3C2AH 3B9KA 4DWHA 1NC2A 4HIEA 3CH1B 4M6NH 3IN0A 4TNVF 1PZCA 1KCRL 3U1SH 2NY6D 2Y7QB 2XXMB 3PHOB 3D33A 4JCWA 1FA4A 3BGFB 3CIAA 5B4MC 3BPNB 3I2CL 2GKIA 1KWGA 2Y23A 5JNYA 2O26U 2UY7A 4Z78B 5FYJL 2MH4A 4ADJA 5L2KE 3V0VB 1A21A 2YZ1A 1IGIH 3DRQB