4NLHA

Skich domain of human tax1bp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
115
structure length
115
Chain Sequence
GPSSPAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tax1-binding protein 1
publication title SKICH domain of human TAX1BP1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 15
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17751 SKICH SKICH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4nlhA00
2LFEA 3VVVA 4NLHA 3VVWA
chains in the Genus database with same CATH superfamily
3QJTB 3B56A 4UAHA 5CCJA 4O4YL 4KHTH 2AEPH 1QBMH 4BFIB 2W0FA 4JN1L 5D6CB 3C60B 4X8JA 1P5UA 5F0JB 2QDWA 5ECJE 4BFFA 1QBAA 3STLA 4HC1L 4F91B 5IB4B 1S7XB 2UWEE 1CLYH 2BRRL 2WP3T 3C6LC 3DHPA 2OR9H 4HIXH 3KXFA 1NWOA 5SX4I 43C9A 2AXGA 2EJ1A 4HT1L 4BD4A 2FO8A 1A64A 3MCYA 2VDNL 1E0OB 3KWUA 5JZ7D 4FHJA 5HGDB 1PAMA 1OB1A 4MWFA 5DJZA 1TJIL 2LGNA 5I1LB 1NMCB 4A6YH 5FCUH 3F65A 5DQDH 1N12A 1Z5LA 4K2UH 5IVXA 5FOBB 1H9DA 1XF2B 3C5SA 3BP4A 4BKSC 1RERA 4S1QL 2AKRB 1ZXKA 1BIIB 3AY2A 3B2MA 2GK2A 2G0LA 5I1CL 3HC0A 3QULB 1KFAH 3CCHB 3KDPB 4RAUA 2VISB 1T4KB 2CPCA 4LHUB 4K3DL 2QFPA 4R97B 3E8VA 3NH7L 3SGKC 2R29H 1K4DB 4Z77A 3CC5B 2JH2A 4XP6L 2XV6B 3QSKB 4GRLD 3CN3A 4GKZB 4X6DB 1NAKL 3DXAD 4HEME 5ANMA 2ZKWA 1E90A 4AJYV 5D96B 3UTSA 4HKZA 5IQMA 4U4BA 4KK5D 1FYHB 4TTGA 3G04A 3NZHL 5E2VL 3SPCA 3WS6C 4XXWC 3P73B 2X38A 4FI6A 2XZCH 5EDSA 2SEBA 1IM9D 3IDGA 3AZUA 4WFHD 5C08B 4HJ0D 5C9JB 5KANG 5IMLB 2DOCA 2DQCH 3CFEA 1M57B 2Y06L 3WY2A 3HS0C 2OZ4L 1P4BL 3ZKMC 5KZCD 1LNUB 1RURH 3D06A 4G7VL 5IVZB 1R5VB 3IMRA 4F9PC 3PWPD 4APQA 4Y5YA 2R1XB 5E1GA 4AMKL 3P11H 4GRLC 4OCLC 4EI6A 2OTUA 1Q94A 4PGCA 3OV6A 4A6YB 4BA8A 3LNEA 5I0WA 4GAJH 4MMZB 1UFGA 4RETB 1TQSA 1YN7B 4KK5C 5E5LA 5SWQA 3SGJA 1WYJA 4J3VA 2GJ6B 3BDYH 3QDJA 4WUUE 5IV2B 1KLFB 4ZW6A 4FZ8H 2Q87A 2JXMB 5LXGH 1T04B 3E1F1 4M4RB 5AVZB 2ARJB 1KTJA 2R39A 4HJ0C 1T5WB 3QJUB 2BIOA 3HI5H 1LEGB 4PUBH 4ZPVA 1I9RH 1IC7L 2ZF8A 1EUTA 1RK7A 4NKOA 4PS8A 3TA3B 3BT2H 4Y9FA 1EAQA 1NFAA 4UV7H 3D69A 4P9MH 1TR7A 3S3BB 5C0JA 5KYWA 2W91A 4PREA 2J5LC 3GI8L 3GHEH 3DDGA 2V5YA 4JFZL 1ZTXE 1SQMA 4EEEA 4XAKD 3LMJH 3EFDL 5D7SH 2BY3A 1A5FL 4HWEL 1P9MC 4KNSA 3IDUA 4B3EA 1WJ3A 4I9XA 1M7UA 5DJ2B 1ZE3H 2BSED 4B53A 3CFNA 3VSTA 3BAEL 5JUEH 3HG3A 2WTRB 4I0PD 4ORGA 4NNYB 3RL1B 4IRSA 4MA8H 1ADQA 2F19H 3ULSB 2E56A 4P23D 4ELMB 5DF0A 1JXFA 2W95A 1FAIH 3LEXB 4DN4H 2JB6A 4FG0A 3JTTA 5KS9E 1X5KA 3NFNA 4FNPA 5EO9A 4TTDD 1C7SA 5L4MA 3V8CA 3CAFA 3I02A 3KYAA 3SPHA 2G2PA 1J10A 5CLXA 4MRCA 3VXTB 4AX3A 2H6PB 1EO8H 1CDBA 4WWKC 1QSED 2Q5BA 2X4NB 5MEPB 3AS0A 4HJUA 3MLZH 3ZMNA 1YNKH 3G6AA 2GB2A 5ETUB 3CBKB 3VXNB 1RUMH 2PO6A 4OF8A 2OMYB 1FLRL 1ZT1B 4S2SB 3MRQB 4HFWA 3QH3A 4XMPH 1CR9L 3HR5A 2EE3A 2Y7MA 4ATTA 4BUQA 1Q8MA 4NQDE 1MIMH 5J13B 1AOZA 3AACA 7TAAA 1UB6A 4R2GD 4FF9A 5AYUL 3QR1A 3OHXA 2WQ8A 4GQ9L 4XNUL 4DPBX 12E8L 3AXLA 3F6LA 2NY4C 4A55A 3IGAA 5I5RA 1J5HA 5J6HA 4KXZH 1ZLSH 2OL3A 3QZNA 1YEGL 4MCZA 2AJ3B 3MV7E 3TWCL 1UXWB 3OPZL 3ARDD 3WFZA 3DX6A 2X4SB 1YYLH 3NJFA 3O11B 5LBSA 3RU8L 1EA9C 1XL4A 4JRLA 3MFGB 3FQ1A 5CJXC 1ZT7B 1UKSA 2CHWA 2HKFH 2MPAH 4IBLT 5FO9B 1D5RA 1D3CA 1AYRA 3O6MH 4POZC 3OKKA 4HUWB 1QRNA 2AJUL 2P1YA 3F3HA 1FFTB 3FFCD 3I6LE 3SO3C 4E41A 3D52A 1FG2A 1I8AA 3PNWA 2NY0B 4W68A 3X2QB 3LIZL 4JO1L 1F58L 4P2RE 2E7DA 5ESVA 1AIFA 3EFOA 3NN8A 3ECBB 3S4SG 4JFEE 1NCBH 3EYSH 3TFBA 4J27A 2A77L 4UI2A 1XFPA 3ETTA 3ARDC 3IMTA 2FHBA 2JCCF 4FFYH 4X6EB 6FABH 4GXVH 4WK4B 5E8EB 4Z78B 3PPEA 3QXUA 1B0GA 3TV3H 1FIEA 3WELA 3IMSA 4H20L 4PY7B 5HBBA 3KJ6H 3UADA 5CUSH 1R5WA 4V11A 2GJPA 2XJLA 4ZSOB 4JG5A 4Y16C 1SN2A 3F6IA 1L5GB 4P2QB 4Y5XB 5CFHA 3TBSB 4LASL 3IDMB 5JHDD 4JQVA 3EBIA 3UC2A 3RL2B 1WC7A 3DDFA 5FHAH 3HNSH 4JQIL 2MRYA 1NA8A 3NCXA 3E1ZA 2XZAH 4AMXA 3WIAA 5DSCB 4QUOA 4Z7VB 4LOUD 2XTSA 3KHQA 1CYXA 4D3CL 2R0ZH 4F7MB 1E40A 2OCFD 1JPSH 1L4IA 3KYKL 3GK8H 5GRXG 5H2BA 5T3ZL 3I75A 4C83B 5D7KD 2AVFA 2VR3A 3FHEA 4J2XA 2RHEA 3BUBA 4BFKA 5IMOB 2DMKA 1HAWA 5CD5C 3H4FA 1XCWA 1A4KA 1JRHI 1TZIA 4ZOBA 2OZNA 5MP6L 1OCCB 3FT2A 5K33A 4ODVH 3MCKA 5BCAA 1OGAA 1DUYA 1GR7A 3P0YL 1MCWM 2ZP9A 4HZLB 4UDUB 4M1GL 1MQKH 3D1MC 2D3NA 2JB5L 4KDTA 5FXCH 1MHPL 2QL1A 4MQXC 4HUVA 4NIKB 4F8OA 4X7SL 3WJJA 4JVPA 4LOUC 4XZUB 2WB1A 2BCKB 3WJMA 4ZTPH 1NANI 1P5VA 1INEL 3DJRA 3T6XA 2BVTA 2YSTA 2J5WA 1YNTF 3R06A 5E03A 1VPOL 3WNIA 1RZJH 5D7LD 1BPLB 1T6WA 1CFBA 5C0BB 3FW6A 5T5NF 1XR8B 2BERA 1LE9A 2VTFA 1E8WA 2XN9E 2BVYA 4NWTH 1MCPL 4NHUB 1YVLA 2NUTB 2CO6A 3BZ4A 3VXSE 2NMSA 5CO1A 1FYTB 3TBTA 4BRJA 1VF5C 3I9GH 1PZDA 1J9CT 4DZBB 4GKOA 3M1CA 1HIML 3FU3A 3EZ8A 3MBED 2PKDA 4E9XA 4V2BA 3VXRE 1F11A 1QFWH 1XR9B 2I85A 2NR6C 2VDLH 1DJXA 3MO1A 4MCYA 3TO4B 3VMPA 4ZMNA 1YJDL 1SRDA 4LLDB 3BCDA 5BPPA 3S4SB 2I5YL 7CGTA 2K6WA 5DEGB 3KE0A 4NUJB 2YEZB 3Q06A 4MNQD 2IOIA 5JPNB 2C4XA 3ZQXA 4UT6H 3DYOA 2V5TA 4BQBA 1OARL 3ZYIA 1JPEA 4OFQA 3FRUB 5TQ0L 3UTQB 4CAGA 5JQ6H 1A65A 3IDIB 3GSVA 4MHHI 1QFWM 2YD3A 3MJ9H 1H0DA 4RA3A 1R3HA 4LSSL 1Q90A 1NPJA 4U2YA 2J4WL 1FZKA 4X7TB 3WY1A 3MBEC 5ENWB 2DJMA 4LVNC 3DX0A 3SE3C 3WENA 1A6ZB 1QX1A 1CLVA 1ERNA 1U95B 3U4EA 3CFBB 2GUOB 1C9SA 4DH2A 1TZ8A 3UACA 1JV2A 2IWFA 2ZWKA 3OM3B 1KCSH 4XE5B 2J44A 5D7IF 5TK2A 5C0EA 3QNFA 4ZJ9A 1JSYA 2V33A 4HKBB 3BE1L 1JZ7A 2GAZB 4N0YH 5DUML 4LSQL 4XBPA 2OXHB 1RULL 4W81A 5I24A 2ARWA 3OLDA 4UYPA 1HHGB 3CMGA 3P30L 4JFFA 1R4XA 3DNKA 5BS0E 2NDFA 5AAPA 3NJHA 4UINH 5J6GA 4KZCA 2CIKA 3TNMB 5KSUB 2MOVA 3ARVA 1PYWB 4RWYH 5TK4A 5E1IA 1HNGA 2VDLB 2WCGA 2F1EA 2A6DA 2PTTA 2IH8A 1AVAA 2B39A 3JVGC 1HX0A 1DSYA 1FL5A 2NYYC 4FN0A 1Q0YL 3HG1D 5JQIB 1JPFB 3BSZL 1RFDH 3BPNC 4MYWB 2O5YL 3MVSA 4XBGA 1A47A 2CK2A 2H2SC 2OJEA 3KBHE 3H55A 1SDDB 3MRPA 4FHKA 5E1AB 4Z6AT 4ZUUB 1FQ9C 1JMZA 1XT5A 2DH2A 3G5WA 1P7KB 1NGQL 5F0MB 3KLLA 4PWHA 5GS0H 3P4OA 3L95A 4HALA 5BO0D 1MHEA 1F4YH 3LQZA 2YZ8A 3GIZH 3KCPA 1FZMA 1ZS2A 4N5ED 4FA6A 2GTWA 4U3SA 1BZ8A 1DVSA 4MRBA 3B6SA 2Q6WA 3IU4H 1N70A 2DWYA 2F53E 3GBDA 3QWQB 1JZ8A 3AG1B 4ZODA 3ZT5A 2AS5M 4HLJA 2W0KA 1RIVH 2ALAA 2C3VA 3LZPA 3CFKB 4AH2B 4MBOA 1EANA 1HN1A 2D0GA 3L3OB 4FZEL 4G43A 4YDMA 5FO2A 5I16A 3AXHA 3EYUL 4PB9H 4WI0B 4ZUTA 5MEOA 3SGEI 2EH8H 4DPRA 5EOCJ 2OLDA 2EO1A 4Z7IA 3AUWB 2IBZY 3KL0A 3QUMB 3T0ED 4Z7AA 3LRLA 2H6UA 4XX1E 5B7EA 2DYPA 3BGFB 5AG8A 4N5EC 5CKGA 4J3OC 3O3BA 4LGSB 1UCBL 4Z7WB 4PJCE 2NY2C 4Z23A 5MERB 1FRGL 2JWYA 3NJIA 3LZFL 3OMAB 3O0LA 5DJCB 4KFZC 3W5NA 3HAEA 5SV4A 1JXJA 4M62H 4XNYH 2ITCB 4NM8H 1F2XK 1Z1WA 1PD0A 4TNVF 2E7MA 3FH8A 4ATWA 2ESVA 2I9TA 1EIBA 2E46A 4KZ0A 3T2NH 3PDOB 3WN6A 5I82A 4X9FA 4YE0A 3A3YB 4Q8BA 3QJHB 4G7QB 4KJPC 2NT1A 1DTUA 4RFOH 1B4LA 3M7OA 5IKCA 3NSCA 5D7IB 3ASWA 1BGXH 3VXPB 2CGZA 3LZNA 2NTFB 1QLEH 3V7AG 2R1YA 3GLEA 3GB7B 2VQ1B 3DK2A 1WE5A 3NESA 3IS1X 5AW8B 4XPTH 1CVSC 4YVUA 2QFRA 2NY7H 3EDKA 1BQSA 2FBJL 4MXQC 2QQNL 3IN2A 5ERWB 3TXAA 1LTXA 2X3BA 3UBXA 4ZMTA 1E5AA 2XWJB 5FYKU 5HJ3A 1TNNA 4IBQA 4K5PA 3I85A 4YQXH 4D0DB 5D2LE 1VCAA 3QEUA 4O51A 1MCNA 3BPOB 1EGJH 1LDPL 3LHPH 1M2VA 2OMTA 3X3FL 5L2KE 1MCCA 1P2CA 2WINB 3PABB 4G8IA 3ZHNA 4TYUA 3RVWD 4PH8A 5C0IB 3KLSA 1L9TA 4M7KL 2UX6A 3MZGB 5LAXA 2X6UA 4BFBD 4KMLB 4M5SA 3N85H 1MLCB 4YSUA 3RGVD 3EJPA 4AT6B 1KJ2H 1SUJA 4PGEA 2QQQA 4YAQB 1S9WB 2PMZA 3N6YA 3SODB 4LLYA 1NJ9A 2P5ED 3D2UD 4GQQA 4PRHD 1MFCH 4X5WB 5JHLA 1MFAL 1TETL 3AFLA 4NQEA 3SKUD 1KPUA 4PGJA 3KEDA 3S34H 2X70A 1HAUA 3HVNA 5TJWK 2K8QA 1JI1A 3AQXA 2Z0BA 4PW9A 1YPZE 1XL6A 4AYFA 3OWRA 1CK0L 1FDLH 5DZVA 1A3LL 2JQAA 3MNDA 1J11A 4DP0X 3TIEB 5EIIA 2QKSA 1O9ZA 3DX4A 2A74A 2IALA 3RVWC 1J5DA 1QLEB 4KZDH 5IG7A 1B4JL 2BVPA 2P5WD 3G5XA 3QQ9C 1GYVA 1LK3L 2GFBB 1NOLA 2YAFA 3RGVC 4OIIL 3LPPA 5EZJB 2XHNA 1RSFA 4GFXA 2NNAA 3SJVA 1R46A 2A0LD 2WSPA 4WY7L 4WWOA 4NQUA 4YBQD 3QXWA 3FS9A 2MOGA 2YQ3A 5BNXD 4YXLH 3K2UL 3G5VB 4YHIA 1R5IA 3FB6A 3ROOA 3MREB 4A1RA 3K71A 3AGVA 5GIRB 3VWKB 2BSTB 5CFAA 1XH0A 1A22B 4DEUA 2ZWLT 3VWJC 2D8KA 5LB1A 2V7NA 4Z5RA 1FORH 2J6EH 2IGLA 4JKPH 4L0ZA 4L9LB 1CLOL 3H2QA 4ERSL 4NGHL 2KMWA 4Z7NE 2APVA 4HW6A 1KJ2B 3MI6A 4ZUWA 1DCLA 3JXAA 4IIQB 1TQCB 1W72L 4P5TD 5DZNA 1XGQA 2XOTA 3KYMB 5A2BA 3TF4A 4JDVB 2ZX5A 3EJTA 4MDIB 1XF3A 4HH9B 5C3IA 3KXFD 3L7FB 3MODH 4XPFH 5T1LB 4JREB 2X4QB 4YBQC 3MACL 4JUTA 4W9HC 4HDIB 1K6QH 1A6WH 2VUKA 2Z91B 5KVMC 4JRYB 2R8SL 2GIMA 2VLRB 4XBMA 1E3FA 1UGKA 4JKWA 4RZKA 1CFQB 2DICA 1UWGH 1FH5H 2W9EH 4Y2LA 4X4YA 5ALBL 3VD2A 2W59A 1I53A 3UG4A 4HJTA 1MEXH 5K39A 2OS7A 2EDXA 2Y2YA 2FWUA 2BSCA 3ECVA 3EJYD 4JCLA 1P5UC 5ICYB 1V54B 2TSAA 3FULA 3ZX1A 1QFUL 1S8DB 4P5TC 2GYSA 4YL9A 4JFWA 4FQJL 5IQOA 3BD5A 4Y1AE 3O81A 2YD7A 3WIHL 2VJXA 3RA7L 2DQDH 3IB4A 1H6FA 1PIFA 1XH3A 2FGWL 3KH3A 3MRJB 3KNBA 5TE4L 4KPHL 4WI2A 2BC4B 3K46A 1FG9C 5DMIL 4A38A 3HG4A 2BOBA 1FC1A 1MUJB 4LOVA 2TRHA 2QPEB 4M1DH 1HZKA 1UB5A 3RBSA 1WZAA 2AJSL 2EO7A 3CFCH 4KKPA 1OQXA 2WUCH 3SDXB 3GDBA 1D6EA 2HJKA 2YMTA 1KWGA 1IB5A 3DVNB 4K7PL 4JZOA 4YHMH 1EZVX 1TIUA 3GSXB 2A6JB 2A4EA 1U58A 4E9YA 1LK2A 2VLKA 3WBDA 3UDWA 2OSXA 5HHOA 5T3ZD 5FO8B 4TQEH 4PGBA 3UP1A 2Y9RT 4OLYL 3L3JA 2VT0A 2QMJA 3WN5A 4YSRA 1I8MA 1XWVA 2F5AH 1EERB 2CXGA 1GS6X 1FIGH 1DEEB 1EZLA 3PGDB 4TSCH 2KZKA 4LLWB 1MFNA 1N5YH 1AZVA 4JHBA 5DQJA 3RGHA 3UJIH 5CJ8A 2RH0A 1ACYL 2YPKB 4DGIL 4ZNEE 1F3RB 4GG6E 4WEUD 4WNSA 3D05A 2P52A 2NQDA 1A4CA 3ZZ1A 1BVKB 3W2DL 4Q9RH 1DE4B 4BFNA 4BE5A 1U3ZA 2VDOH 1YUHA 4IU2A 3I9AA 4WRLA 3ILPA 3MLUL 1M53A 3LB6D 3ZDXB 1H3PH 1P7QD 1S5HA 3VI3B 5ISZB 2YBRB 4GBXB 2JKLA 1AQHA 2FJHA 4IDJL 4LDOB 3SGJC 3Q48A 2ADGA 3UTTA 2MQ0A 2VXQA 2J55A 2YN5A 3BWAB 1A6VL 1IV8A 4KROB 5DZ9A 2YJQA 3OSKA 3WFHB 4L3EE 3AB0C 1UFUA 3ULVH 3NJXA 5I8OL 5EF2A 3QI9A 3U1SL 2DMGA 1SXSA 2MMXA 3CX2A 3VUAA 4X8CA 5T1KB 1VDGA 2HRLA 5AAWA 2F61A 3LSOB 1QHOA 3EGXA 3LH9A 1DVYA 2F8XC 4JK0D 2JKWA 3AWEA 4LLVB 1GZHC 1KXTA 5CSBA 1C8QA 2WGNB 3V0WL 1WLHA 1JDAA 4J3BA 2VLJE 3GBMH 2WXJA 2A6IB 4B9FA 5CGTA 2Q7YA 5JDSA 5DD6A 5HDQL 5EBLA 4AQ8A 4FGMA 4U1IA 4BRVA 3KVQA 3ENEA 4M6AA 2VQ4A 3GTVA 5FEBA 3PWVA 3P0VH 4BQ8A 5KTEH 1IJNA 1RUPH 5CILL 5LG6A 3FAXA 3HW7A 3H9YA 2MCMA 4IRSC 3QCTH 5DZJA 4PB0H 2LT9A 5AKSA 5CN3A 1SUHA 2VN7A 2ZSVB 4GSQA 2BIPA 4PJIE 1TTAA 3D48R 3G6DL 2BINA 3KWXA 4J39A 2VDOB 2QADD 2YGQA 4LIQH 2CNYA 4Y4FA 4BQ9A 1ITBB 2J73A 2D0HA 1NCTA 4FMFA 4F57L 4GQPH 3RUGE 2HH0H 1DBAH 3LQMA 3F64A 1QWUA 5C8JB 2KQMA 2X0WA 4ONOA 5KSBB 1A2YB 3KPPA 5DJXA 1XMWA 1FHNA 1IEHA 3J7HA 4JKMA 3P02A 3RNKB 1G7HB 2DIAA 1OEZW 2D31A 4I2XB 5CP3H 5E9DB 3GXDA 1INQB 1OCWH 1GRWA 2NZIA 1HCYA 2NXYD 2W60B 4LSTH 3NJGA 2L04A 4M93C 2H32A 3I6LD 4QY8B 4ODSH 3RWJA 35C8H 4OV6F 1ZD6A 4E41D 4HXAL 2DKUA 3OHXC 4JLRB 2VERA 4TKWA 3BI9X 1OPOA 5AUMA 4NNXB 1OAYH 2WOYA 2CK0L 3QIWA 5KSAD 1H3WM 2GCYB 2FJFB 3MRDA 4IKNA 4NKIH 3BRFA 1YNLL 3UZQB 2WYHA 3IJYA 1IAMA 1X5IA 1EMTL 3BP5B 1ZHKA 2GG1A 3QRFM 1MFDH 3ARGB 2HT2D 3ZTEA 1E67A 4A39A 1JGIA 2WP3O 3ZE2B 5IEKB 4XC3L 4XMKL 4P48A 1QW9A 1N3NB 1JVOA 2ZPKL 4OFVA 5C0FA 1JHLL 1PZ5B 2HVKB 3GGWB 3ZJAA 5A2IH 5DA4A 1ZGLA 2LW3A 4MNGB 2NXYC 2WIIA 3QQ4B 3H6AA 1U3NA 4XCEA 3D7PA 2Y36L 1UD5A 1CXHA 5E2WL 3NIDF 4OGYL 3U0TA 3V6BR 2UVFA 5F0LB 3F83A 3NRQA 5CBEB 1YEEL 1WBZA 1HI6A 4PVBA 3HMWL 1XSKA 3ZN6A 4PJAF 3MLPA 1QSFB 1NFDA 2OR8A 3MDJA 3O2WL 5HHQB 3VXMA 4R96A 5IESH 5GGTA 2IDQA 2VWEE 3ZSTA 3ELAT 3V8OA 1MWAL 2HT2C 2IG2L 4FFZL 4NC2B 2XBZA 3SKJL 2X4TA 2K78A 1QQDA 3O6KH 5BRPA 3ULUE 4Q52A 5JIIA 4LL4A 4Q6YA 3DSNB 3T9WA 1AGEB 3IE9A 3Q43A 4JZJA 2DQEL 4L8SA 3S98A 4O2EB 1P4LA 5C09B 1OLZA 2WTOA 5DWPA 1BQUA 4JQVC 4JO3L 3Q6FA 5C0CE 3OKOA 4WI5A 1HE7A 4UQ2B 1TOXA 4LGPB 3D39B 3CZJA 5A6LA 1LWJA 3QUYB 2RR3A 1JGUH 1TVBB 4H25B 3VE0A 2BHFA 2Z93A 3DROB 5EUOA 2WN3A 4AENB 5DJYA 3ARYA 2AJXL 4G8GA 3TIDA 3ZRSA 4FKKA 2IPTL 1A1OB 3NACL 1BEXA 2BS8A 5DR5H 1A6UL 4U1KA 3IPEA 4G9FB 4C56E 5IVOA 5CINL 1I3VA 1DBBL 1SEBA 1X5YA 3IM1A 1H3UA 5E08L 1UYWH 4JB9H 3DJZA 3EBAA 3BVVA 1OO2A 3UYRH 2DEWX 5J3HD 2XN9D 5C9KA 2LU7A 4XB8A 1M05A 3TTYA 3RP1A 2ZQKA 3ERXA 2AVGA 5AW6B 4CU8A 1I9IL 5DA0B 3MRNA 2OSLB 4KDTC 4B95C 2G75A 2ICWB 2OX5A 3O8XB 4UTAA 4DKEH 2H3NA 3WJJC 1T03L 1QLRA 4NO2B 4PJHE 1A6TA 1SVBA 4Y4KA 5D4QA 3O2VH 1OZUA 3N44B 4FADA 4QI3A 1S7WB 4Y2NA 5JLZB 4ZFOA 3CVIL 3MUJA 2EC9T 5J3HC 2D2CC 4IU3B 1RJLB 4K8RH 5I19H 2BPBA 2YPLE 1EJ8A 3H9SE 3HN3A 3OKLB 1KULA 4AEHL 3COOA 2CMRH 3QEQA 4O9HH 2IO5A 1I3GH 4IRJA 5I76B 3BH4A 5DK0B 3APNA 5HHNA 1EBAA 1A6PA 1CICD 2CR3A 4HV8A 1EHLL 1MI5E 2UY7A 2ALWA 5D8JH 4X6CE 4ZD3H 2NRDA 2OR7A 3DLQR 1FFQA 5EZPA 3EF4A 3M46A 2J8UF 4JRXB 5L7XL 3BAWA 5DJAA 5LG1A 2AQNA 3EOTL 5I75B 3KMDA 1ND0A 5DURB 1VB9A 4Z7OF 1VGKA 3DMMD 4QRSA 4N25A 5BS0D 1JZ4A 1N8ZB 4L37B 1SHSA 5K5YA 3BP6B 3MCG1 3MC0A 1IE5A 1RP9A 3LN5A 4ADJA 4MAYA 1CICC 4J8RB 2K1MA 2ZAIA 3JZ7A 1U3HB 4XHJD 1AZUA 1O7SA 2ZWNA 3BD4A 3EUDA 1RY7B 5E6SB 3VG0L 3GD1C 2OI9B 3ZKSD 4XPAL 1JGLL 1KB3A 2A9DA 4NC0B 5HYQA 1DUZB 3WEOA 3UABA 3MX0A 4WZ9A 4U6TA 2P7TB 3OR7A 1GMIA 1TT6A 3BQUA 1IFHL 1NLDH 3O2DL 1AO7B 3OKDB 1ANUA 3IFLL 4PJDE 4TVPD 3VTMA 3L4YA 2OTWA 3O6FB 4OGXL 1HL4A 4K7FB 4QXTB 4Y8AA 3BVTA 2Z4TA 1CC3A 3NPZB 2BW5A 2HFEB 4L1BA 3QQ3B 3QQDA 1IT9L 5EPMA 1K5WA 1S5IH 3APDA 4Z76A 2DTSA 5BXFA 1U8LB 4XHJC 3C6SB 1C5BL 2O1AA 2WZPA 1OAQL 1PKQE 3PIQB 3QNYA 1FFOB 4DJMA 2F6AA 1MCDA 5SX4H 3V4VL 2W07A 1AY1H 3FONB 1JZ5A 2C9SA 1BXXA 2AI0L 5EU6A 1HL8A 4F33A 2BNRB 1Y1UA 2E27L 4KKCC 4M9PA 4LCVA 1VZHA 2AK4B 1JNNH 5CP7B 3M1BB 3OKEA 3ZT7A 4YGVA 3FO2A 1Y7VA 4H8PA 3RY6A 3TWYA 2X1WL 5EN3A 2DWTA 3QDHA 4G6AC 4KKZA 3TT1H 3WKNA 2V8MA 3C08H 3ULUL 4KQ4L 4DEWA 3M17A 3O3EB 1LILA 1JCKA 3PE9A 5E2TH 1ZXQA 2EADA 5L8LB 3DIFB 2L7JA 5CZXD 4U7SA 1IQDB 2ZUXA 1T1YA 1AIZA 4PGDA 4GMTH 1NEZA 3GMNA 2V9RA 3O6LL 3VNZA 1F8TH 2HT4D 3CJJA 3SPVB 5LGJA 5B8CA 3KZ8A 3QRBA 4QRRD 1BYPA 2P8LA 5HGHA 4IEFA 4WU7B 3X14A 3EOBB 4ODHL 1QO3A 3AQDA 3MLTB 3TNNA 1AKPA 1IC1A 4OIFA 1A6AB 1MRDH 5AVVB 5JW5A 2Y0SA 3ZVVA 1SOKA 2BNUA 3DSFL 5L4FA 1AQDB 3BWZA 4XI5D 4P5KA 1AQ8A 3UJTL 1UOLA 3BKMH 1KXQE 4YSPA 3NRPA 3SBRA 1B0RA 3VFTA 2NY3D 4PY8I 5CZXC 5T3XE 3FCBA 2EEBA 1NBZB 1KJ3L 3L45A 1KYOK 1OE2A 3GSNA 3F7VB 3VI4A 1YMME 4U6HA 3O9WD 1Z3GL 1K85A 3G3LA 3HUJB 2J43A 4Z95H 1KPVB 1RZKC 2AZUA 2EKSB 4L1DA 4OCMC 1AZRA 2WMPA 5E6ZA 5AB1A 1DANU 4R5TA 4FQCL 4ANWA 1PNCA 1GGIH 1UVQB 3GMMA 4NCC1 2A9ML 2CJSA 3BC9A 3LN4B 4YDIH 1MRCH 1XAKA 1G7MB 1L0PA 1WIOA 4CMMB 4HK0B 1DN0B 1AC6A 3HG0A 4Z3IA 2RA1A 1YQVH 4FDWA 4HIEB 2YSSB 2NY3C 2X7LA 5EORH 3PFQA 3VD4A 1ORSB 1FO0A 2BP8A 3N42F 4GRLB 4LVOC 3O4LD 4TNFA 5LGHH 4FQXA 4GPVA 3DXAB 3FRPG 3SQOL 4Q89A 1XGUA 1HHIA 3L2NA 4MCNA 3NYKA 1LEKA 3SKNA 1AOHA 4LEXH 3QRGL 1PX4A 4PQXA 5AVRB 4XNQA 3KPSE 5CNHA 1IM9B 4F20A 3ZL4H 2BP5M 2NUPA 4HIJB 1RUAL 4OIBA 4WO4D 4HIHA 1J0KA 1I7TA 3NMEA 4NRXB 5I0VA 4WW2B 5KZCB 3PWPB 2OZ4A 5F3BA 3GM8A 4H0GA 4N2LA 1UQSA 5DCCA 5FKPA 4G72B 4HEPG 2GK0A 4I0CC 2ZUQB 1MRFH 4NDMA 4KJQD 2N0MA 3K6NA 4QNPF 1CUOA 3GUTB 4HPHA 3ZTJG 2RIKA 4JFQA 1CD0A 3DBXA 4JG1L 4DW2L 1GJWA 5BQ7A 3QCUL 3VDBA 2N7AA 1GGBH 2WLLA 1F13A 4UTBA 3D0VA 3N1MC 2HTKD 2D7TH 3EHBD 4XH2A 4MZIA 4XWOC 3E0GA 2VAAB 3CQFA 1ZLUH 4JG0L 3U9PL 3BZEB 4WO4C 4L4VA 4QLWA 3DBSA 1AE6H 5F7HA 1HOEA 3WYRA 1QBLH 2J8OA 2YRLA 3Q05A 4DEPB 1T1WB 4ZNCD 3OQ3B 3V6FA 1JZ6A 5DD0L 5CHNB 4ADIA 3L9YA 4KQ3H 1KTCA 4KJQC 3WNMA 1MFEH 2A74C 3HRZA 4NPKA 5BVJA 1MY7A 1R33A 4NN7C 4M5TA 1BLNB 3ZZLA 4RIRB 1IEAB 4NAQA 2IANE 5E51A 2HFGH 1U9KA 2UZXB 4BZ1A 1J8KA 4GW5A 2BDNL 2WUBH 2E9IA 3ZO9A 4KRMB 3B3IA 5B1JA 3W11C 4M03A 4JPVH 1XCQA 1AHWB 3V0VB 4I0PB 5LQBL 3B1TA 3V6OE 1FFPB 4JHWL 3CXHK 3ZTJH 4Q9QL 3FCGA 4P23B 4NC1C 2N0KA 1ZRUA 1CB4A 2B16A 4DFIA 3SDAD 3LD8C 4P5MB 3GBLA 3ABLB 4JFOA 4YR6A 3NA4A 5JHBA 2I27N 2EDMA 1OSZB 3ARXA 3M8OH 3VMOA 2MJWA 2X41A 4UOQA 3V4UL 7PCYA 3RWDB 4G8EB 4DGWC 2DQHL 1BDYA 1U8OA 1Q1PA 3B9KD 1JFQL 5D5ME 2JV6A 3WNLA 3Q44A 3X3GH 2JKJA 4P5SA 4MA3A 3NABH 1J8HA 4HBQA 1M7IA 1VADB 4XCFL 4QXVA 2HP4A 3ZTCC 1T0NB 2UUDK 4F2EA 3TESA 2V4LA 3FRPB 4YL4A 1YO4A 4TL5A 5KW9L 1Q9OB 1S7QB 4OLUH 4DK5A 3D18A 1F4AA 3BHBB 3K80A 1YEIH 3FT4A 1ADWA 1Y18A 4KC3B 1LE5B 3NIFB 4R7DB 3SDAC 4WLCA 4XCYB 2BW4A 3FYIB 4NSKB 1RMFH 4R2GB 1GSMA 1L0YA 2A2QT 2BOCA 3DOSB 4WSKA 2Z7YA 5E2JA 1QG3A 2E75C 3ZDYB 2RD0A 1I9EA 4W1TA 3CFQA 4CUCA 2Y4SA 5LO7A 3IJ7A 2CJUH 5J1AB 5T3XL 3ARDB 4YDJA 5IBLD 2KZWA 3TASA 1FNFA 4J5VA 2EVFA 4DGYL 4X6FB 5DFTA 2UXGA 4WWPA 4LQFL 3GXIA 4B7LA 1ZJAA 4LF3A 4NLAA 4AV4A 4BH7B 2QTEA 1OSEA 4L4TE 4PJEB 2VDPB 3MUZ1 4JVWA 4GKNA 4F24A 1JWSA 1E5BA 3FFCB 1W8EA 3LYRA 4G6KL 4UIMA 4MDJB 5JW3H 1V7ML 4JFDA 3MGTA 2OP4H 3JWDL 2AXFA 3UCQA 2X88A 1IGFH 1I1YA 1SF5A 4UIKH 4B27A 3LIZA 3RFZC 1IBBA 1RJYA 2D7MA 3EFFA 4GG8A 4QO1B 3EH4B 5I1EL 5I9QB 5KEZA 3TPKA 5I71C 4FKHA 3CDGA 2HTLD 3G6JF 2AHIA 3L4TA 1M7DA 6CGTA 1IGJB 1Z7JA 1HOCA 3MRMA 4JO2L 1PJWA 1Q72L 1MY5A 1MJ7H 4AYGA 5CZVH 4XN5A 1G7IB 5HJBA 1D7BA 2R2HB 3CTTA 1WAPA 3KPRD 4AQ1A 1U4FA 4PYGA 3UDWC 3MRCB 1GGCH 2JLPA 5FAAA 4OSUH 1NANH 3C2AL 5EBWB 5FUZL 5JHDB 1G9NL 4KV5E 1YMHB 1CDHA 2Q8AH 1GHFL 1W0YT 1M9WA 2ZX6A 3DX1A 3QJFA 3QHTC 4MHHG 1BF2A 4M56A 2Q86A 4PRNA 4XZ4A 3VRLF 4QHMB 4N8CH 5FGCE 3HI1B 4ZMLA 4ALAH 2X6VA 4PRDA 5FK9A 3IS0X 4A2HA 4R7NA 1HCFX 1H6TA 4GO8A 1D7FA 4UU9B 1WUZA 3IRZA 2YQ2A 3Q8EA 4GAGH 5DO2D 2JKSA 4GO9A 4HJJL 2LLLA 4AOFA 3CUPA 4BSJA 2X28A 1EZSA 3OAYK 5DMYA 2MCG1 1P7HL 1KNOB 1ETA1 1CZ8L 2VLJD 3MRFB 4P46A 5FUOH 4XP9L 3RIFF 2ED7A 1O6SB 4H4NA 5HJGA 2Y1ZA 4HKXA 4P3WA 4WUUA 4EDWL 3LEYH 3RZCA 5GRJH 3MJ8B 3D3VD 4HKJB 3CV5A 3MN8A 1I1AA 2BSBA 4XMZA 4ABWA 4DQAA 3SDYL 5I1HH 4KRPC 3UMNA 3QFGA 5DD5H 2CRMA 2IV9A 1X9UA 4FQ2H 5CEZE 2EYSB 2SODB 1IEBA 2Q3AA 2YA1A 2BZDA 5CGBA 3KWTA 3GMPB 1WF5A 3FTGA 3QI9C 2IVFC 1TZHA 1HQRB 2CCLA 2OTPA 2OBGA 3X12B 4HS3A 1OF0A 5AAWC 1JPGB 2L7QA 2GBAA 4OJFL 2AFNA 5AG9A 3F12B 4J3OF 3QO1B 1UD6A 2FIRT 2C7UB 1S7RA 3D0AA 2Z34A 3F5WA 4IKKA 5IIEB 3DRQB 4JJ5B 3ZL1A 3A6CH 2O30A 2VL5A 3T5WA 4AQ8C 1J9RA 1AZZC 3G08B 5AALA 3ROLA 2VDRH 2VN3A 1QPKA 2Z8VC 2ZJSH 4QIRA 3WFBL 3MBEB 3V6ZB 4LVNB 1NGXB 2F7OA 2C1OB 3KPOA 2FYYA 4XPHH 5CGYD 5IM7B 4YE4H 3QXTA 3LRSA 1U8JA 4Q0XH 3APMA 3FQXA 3FB5B 3TBWB 4QMEA 2XV3A 3S35H 2O72A 4CJ0A 4MNQB 1R9FA 3VU1A 3MNVB 2BX5A 4KAQH 3EO9H 1NDGA 4GFTB 4YK4C 1IO4C 4O4YH 4YLCA 4JN1H 5IQ7L 3KYNB 4HC1H 2R2BB 2BRRH 1KGCE 2DQTL 4NQDA 4WI8A 2E6PA 5D1ZA 5I1GL 3ARBD 4HT1H 2NY5L 3FTVA 4L8BA 5G4NA 4FCAA 2VDNH 2X0VA 2VCOA 3NGBC 4P2CG 4CDGC 5JMRA 2OMWA 2YGPA 4NQTA 1UA3A 1TJIH 3QWRA 4IGBD 1P53A 4WFFE 4PJGE 3SPGA 1MCJA 3QIWC 4MYPA 2GTZA 3MV7A 1ZA3B 5LAPA 4NKMA 3TU6A 5B7FA 4S1QH 4HLEA 1BQHG 5GRVK 2IAMA 3FUDA 4WI4A 1BOGB 3MGOB 5I1CH 5G5DA 2XICA 3IBOA 4F2FA 2VDRB 1FZJA 4LVHB 2YPVA 4NKDB 1AXSA 3IYLW 4N0RA 3HBQA 4FQHB 1A1NB 3R0NA 3WSQH 2DH3A 3ARBC 4JR9L 4K3DH 3NH7H 3SGEH 4DKFL 2IMMA 4OB5L 4XP6H 1XGRB 1X4XA 4FE9A 4F7PB 4GW1A 4G8FA 4MB3A 4P2RA 5C0CD 1NAKH 1DBKL 4IGBC 3HG1B 3EGSA 2MQGA 3L3GA 4LPCA 1SXZA 3NZHH 4XX5A 1NGWB 4GUPB 1A9VA 3SE6A 1SLUA 2IDUA 4TQHA 1KN2H 5DMGC 3H0TB 5DD3L 2L4OA 2XN0A 4AIOA 2Y06H 4G8GD 2XNAA 2NOYA 1P4BH 3NIGF 1ZHBB 43CAB 3TJHD 4K71C 1E65A 4G7VH 4C56D 5FF6A 2EINB 4QOKE 3DX9B 1WBXA 5K59E 1NGZA 2CRIA 1CYWA 3WU1A 4AMKH 1FE8L 4JZJC 5IQ9A 4L8SC 4KI5D 4JRFA 4NO5B 1NCIA 1T80A 4L3FA 2I7SA 2MHAA 3C87A 3EJZD 3MJGX 4GRWE 4OUUA 4MJ5B 3VXQA 3LV3A 1NPNA 3PHQA 5JW4Q 3I84A 3GSWB 5L0QC 5IJDC 1OK0A 2BO0A 1IC7H 4PP2A 5ICZA 1CG9B 3TJHC 2VABB 1FL6B 1CFTB 2X9XA 4I5BB 3T0EB 1U8IA 4HIIA 4MXVF 3S3DB 3WV0A 4PCTA 4I48B 1E5ZA 3THMH 4JPIB 4F37K 2KPNA 1A0QL 1AMXA 4L3CB 3X13B 2XFXA 5JPMA 1N7ML 1JZGA 2YPLD 2CUHA 3H9SD 4C57C 4KI5C 3GI8H 4TNWF 2APWA 5E8PA 5CEZL 3S5ZA 4WCYL 3EJZC 1A5FH 3BO8A 2DLIA 1JWUA 2EQDA 2WANA 4HWEH 5BV7L 1MI5D 2XX0A 3CZKA 4NM4L 3BAEH 2HKHL 3ZU8A 1CPUA 4OZFG 3CK0L 3AABA 3HPJB 4RAHA 1NIFA 5LNEA 2X1QA 4NO0D 2KBGA 1MCLA 3V5KB 3DTUB 4CN4A 5L9DH 2A9BA 1C5DA 2CIIB 5KYXB 1QVOB 1U42A 1OGPA 5C0AD 4XNMB 1BQHB 3L16A 3GHPA 1SYSA 1Q9LA 5ADOL 2ZXGA 2VKWA 3ARZA 1N5AA 4O2CB 5IVXF 4OD2B 2YQGA 5CMAA 1DANT 1G7PA 4QPEA 5I8KL 1MW3A 4UDTA 2TRYA 3RTQA 1DZBA 3V4PA 4Y8DC 4IRJC 5E6YA 4H5SA 3HNTL 4XCNB 5DQ9A 5C07E 5TDOA 4MB4A 4P4KD 3VFVB 4X6DE 1QASA 3DRTB 3LVTA 4IW4C 4HZ1A 2PWHA 5IP4A 5F3HA 1XMEB 4HU2A 1CI5A 1RZGA 2DN7A 5CM1A 4S0HA 1FLRH 1CR9H 4PJ6A 4U6XB 4M29A 5IHHA 4H26A 1BZ9A 4QTIL 5KBPA 4KKNA 2IH9A 1S9VA 4LOEA 4CGTA 5KJ4A 5AYUH 2NYKA 4U4IA 1L3WA 4UM8A 5D1QA 5ESQB 5GGUB 4HUNB 5AENA 4XNUH 5MENB 12E8H 2N3JA 1CFVH 3H4HA 4AV5A 1RZ7L 4PRHB 2P5EB 3D2UB 3MTXA 2B3IA 4OZFH 1JNJA 1YEGH 3MBXL 3TWCH 2B1OA 3DUUA 3OPZH 1XIWA 4OFYD 1KJVB 2VO5A 3IXTB 3RU8H 4JFTA 1KB5L 3TBYA 3FF8A 3MROB 2N56A 1VACA 1B3IA 2G4EA 3GFUA 4ZXBA 3IJEB 4F7TA 5EU6D 3VFUB 4BK5A 4HMCA 1DQDL 2XY2A 2P5WB 3SDDD 3TFKC 2AJUH 4KNUA 3FQ2A 1HEZA 4G3YL 4Q2ZA 3P2TA 2EC8A 1PQZA 1RSYA 4LNVA 3QNXA 3FMGL 4JO1H 1F58H 3RI5F 5BW7A 3PPSA 1QATA 1MELA 2AEQL 2D3LA 3EO1A 2J12B 3VTTA 4OZHB 2A77H 2AV7B 2NY6D 3L5WB 4ONFL 4XT1C 2BMKA 2GQHA 1HKLL 5KJRL 2GSIB 1TQUA 5EHFA 3I3DA 4H20H 1SXBA 2ZYIA 4RMQA 1O9WA 2EDTA 4G6ML 3QUGA 2H5UA 1DL7H 2YMXL 4QGTA 3Q1SL 3SDDC 2WW8A 4N24A 5EDXA 4KHXL 1QTPA 3TGXA 4LASH 3NP3A 1CFMA 1UZ6E 2KHAA 2UWEB 1OTUD 4P5TB 5GS2D 4JQIH 4ELME 1UEMA 2BLFA 3D4ZA 2V2WA 4OZFB 2F74B 4N85A 4DP2X 3BKCL 5G55A 3KXFB 3X1GA 5T3XD 4NYLA 1G7LB 3BEWA 3TYFA 5F88B 2NY6C 3IDNB 4PTUA 1FVDB 1HYSD 4OLXL 1FJ1B 4DP4X 4D3CH 5JDJA 1C5CL 2BFGA 1JNHB 3KYKH 2I07B 3L4XA 5T3ZH 5DK2B 2EE9A 4HUXA 2NSXA 2Y72A 4P99A 4QYOA 1H15A 3CVDA 4YSOA 1H5BC 4XO4A 1FNEA 3CVHL 3I9PA 3WFEL 3CX5J 1IFGA 3OR6B 4FJZA 2J1YA 5MP6H 4L05A 1NZRA 1NC2B 3QUKA 4PBXA 4UUJA 5GXBB 5E8NB 2BY0A 1D5XB 1JAEA 1K9TA 2PABA 3P0YH 3V5HB 3C5ZD 3L1FA 3ECWA 1DQLL 4M1GH 1K5NB 2DI8A 1EHAA 1YZZA 4JFYB 3VCLA 2F08A 2JB5H 3D51A 1MHPH 4B60A 3ZL2A 4CRPA 4X7SH 1N59A 2YUZA 4GAYB 3S8WA 3VGAB 1INEH 1H3VA 3MUGA 4PJCA 4TSAL 5BVPH 4ELKA 1X5FA 4L1TA 4HS8L 3FQNA 3IMUA 1IBHA 1VESA 3KPSD 3PDDA 3B5HA 4OF7A 3VH8A 5FOJA 1VPOH 3ZTNL 3GRWL 2ZE0A 5E5MB 5ABDE 4FFTA 5DDHA 1LM8V 3FU7B 3O3DB 2ITDB 5B38A 2V37A 1MCPH 4BKTC 4ZS7L 5IHZB 5A6MA 3KM1A 3WUWA 4BUHA 1BREA 3T6ZA 3P4MA 5ICUA 4WI9A 3NJMA 1ZEAL 5FHBL 1L9OA 3SIKA 4FS0A 1HIMH 5A16A 2OTUB 4PJ7A 3DX7A 1FV1A 1P84J 1AHMA 1T3FB 5DTFA 4ODUB 3OAZK 4XN2A 1YJDH 2CPUA 2XKSA 5A6IA 2I5YH 3ZE1F 1BVZA 2OSWA 3HZVB 2GTQA 2OM5A 5E0QA 4FFVD 2ICES 5D2LA 1WS7A 5FA3A 1FLTX 5JIDA 1DQVA 1OARH 5D4HA 5TQ0H 2XVLA 1UUSA 4HOMA 1BMGA 4YS4A 4WHCA 3U9UB 2NW3A 4PW3A 2AEPL 4P2QE 1JS4A 3FUNA 4PYHA 2YGVA 3T04D 1CLYL 1O7DE 4HIXL 4HJGB 3D4GA 4L9DA 5HHXH 1W9XA 3VACA 1P7QB 1MHCB 3DECA 2V9UA 4PCYA 4Q6IB 3RGBA 3WKYA 1WHPA 5D72H 4FXKA 3WKQA 3BE1H 2EABA 5DUMH 5FCUL 1UXLA 3R7RA 3SE4A 1TQTA 4LSQH 2R51A 4M7LL 1JWMA 1RULH 3OB8A 3TL5A 5CSZB 2FO4A 2FZ3A 2LTQC 5KS9B 1YPZA 4X5QA 1HXMA 3P30H 4QAWA 3RNQB 5SWSD 3GSUA 3VVWA 5IHUL 3DO7B 3CU7A 2H9GB 2UYLB 3QFDA 2B3RA 3R1GL 3HRZC 2B77A 3TZVD 2OKMA 4N87A 1DJZA 2FK9A 1NPUA 1KN4L 5E7FA 1E5UI 1LL1A 5J11C 4P2OD 1XF5B 1Q0YH 5KVFE 3PFUA 3LKNA 3QWOA 3LPGA 4KUCD 3BSZH 5B1JC 1O6VA 2Z7ZA 4EUPA 2O5YH 1ZS8B 4X9IA 2NZ9D 3S8GB 4FAAB 5DEFA 2Q20A 2O5NA 5IK3B 4DP1X 2QMKA 3QH3B 5F21B 5JORA 1KXVA 3MNWB 4M93B 5C0BE 3AWFA 1HVXA 4XP5L 3OX8B 2QADB 4JM2A 3B7TA 1WV7T 2H4EA 4X5LA 3TZVC 4UQDA 3IETA 1LYQA 4KKAC 4X4XA 4OD1L 4XHQA 3GJEA 2VXUL 5AKRA 5E8OA 3GC3A 2WBJA 2EXTA 2DWDA 1VLXA 2HRGA 1VENA 2DLEA 3FYEB 4HU8A 1IZKA 5EC1B 2VN6A 2QELA 1SM3H 2PPFA 3ABMB 4LZKA 4NZUH 5FM5M 3ARFA 3QDME 3SOBL 3EYUH 5AL8A 5PCYA 4A2FA 2GY7B 1AQMA 1UA7A 2NXYB 4KY1L 4JFHE 5KJ7E 4WU5A 1QTYT 4PG2A 4XXDA 4X99A 4PUBL 3FB7B 1E50A 3MRGA 5MEQA 4UQEA 4WWNA 2R4RL 2UXVA 4K7PX 5IHBA 2JCCE 4JFDD 1UCBH 4F2MB 3MMEA 5KSAB 4OFDA 3W0WA 4JFEB 4P9ML 3TEZA 1FRGH 3QG6B 4WTZA 4HS6B 2YC1B 3LZFH 4Y1AA 4WK2B 1W0VA 2CCWA 3GHEL 4YLQT 1ZMYA 3ESVF 3CG8A 5J0BA 4LEBA 1RZ8B 1MXGA 4DP7X 5I73B 1E9OA 4RISL 1LO5B 4M6OL 4NN6B 3E7JA 4PD4K 5EFIA 1OAKL 1IRAY 2CHNA 1S7UA 3L3HB 1CD8A 3HI6H 3MOBL 1F3DH 1I7ZA 3KPLB 1DQTA 4A7GA 2BVUA 1EWHA 4C58B 1T1XA 4UBDD 3OBAA 4GRMA 2A6KB 4W9FC 1FAIL 1TO4A 3DVFA 4MMYA 4M8UA 4DN4L 1G1YA 3WL9B 3GBNL 5JQHC 3MRLA 5FUCE 2X05A 1IGYB 4O2FB 2YUXA 5DS8A 3OWEA 1NFKA 4KDVA 2FBJH 4B97A 5F7BA 2QQNH 4IMLA 3LPOA 4UT9L 1FCGA 2OMUA 5J6SA 3F7LA 3T0DA 1DO6A 1NDMB 3BIKA 4HMDA 5IEHB 4P07A 5DHVH 1HL5A 4K94L 1F97A 1WFOA 3MLZL 3QFJD 3X3FH 4AQ1C 4P3DA 3HHMA 1ES0A 3WO4C 1WGOA 1NOAA 2CDEB 4OT1H 1AGCB 4KJYB 4TQIA 4AM0A 1MH5A 3FO9A 4PRBA 3POHA 2R27A 2QV2A 5E9NA 4UBDC 3RZCD 3A6BL 3U36A 3JTBA 4A04A 3UPRB 4PJ9A 3DURB 4OZGA 2GSGA 2K8MA 5HVHC 4GS7B 2NPLX 3LZLA 4TULL 3HHRB 3PGCB 3JWNC 5HXMA 4Y19E 4OR1A 3MXVL 3WLBA 1E8YA 4MMXA 1MFAH 1TETH 1V3MA 1VZGA 5CD3A 2QKIB 4MJID 1ZLSL 3VD5A 3WAJA 1D9KD 4NUQA 1XV8A 4U1NA 4ENZA 1D5ZB 1ONQA 5TDNB 1YYLL 1CK0H 2JVUA 1A3LH 2UZYB 3NFPA 1ZJBA 4P46C 2IMNA 1BZ7A 1ZVNA 2WJ5A 2XN9B 5FPIA 4PJ5D 3RZCC 4EOWL 4U0RB 1B4JH 3B2UC 3CDFA 3X11B 4BK8A 4FNLL 1LK3H 1I1AC 4K3JL 1KLUA 4FTDA 4OIIH 2ADYA 2BS71 4Y4HB 4U1JA 3JWOC 3D4CA 4JW3A 4I3SL 1HILB 3TVMA 2Y7OA 4FXGA 3LAFA 2DQJL 2Y6SD 4ZK8A 3OHMB 5DHVB 1NCBL 3GXNA 4AYDC 3K2UH 1LO3L 1D6VL 5AW2B 2IWKA 5BZXA 1HSBA 3C5JB 5KVFL 3UBHA 1M71B 3REWB 5IOPB 1JE6A 5KVGE 4U7MA 1CLOH 4ERSH 4TVPH 4LLMB 4NGHH 25C8L 4MVBC 4AYID 4DK6A 3I6SA 2K4WA 4IOSD 1X7QA 5HYJE 3QC6X 1W72H 3SKOA 1KGCD 4HWBH 5D7IE 4E2OA 1CICB 1LD9A 2JNZA 2WXNA 3B7RL 4PJIA 4JGUA 4RMUA 3GXMA 3GJFA 3MACH 3GS4A 4KVPA 5F72S 4KU1A 3RVTD 3SKMA 5CJBA 1ZAGA 4ETQA 4U1SA 5GSRB 1GY2A 4O02A 4PLKC 4DPAX 5C0EB 2R8SH 2R0ZL 3ARWA 4JPKL 4N2FA 4NERA 4B9CA 4Z3JA 5ALBH 3IFPB 3W3BA 3IMWA 1EBPA 3DMMB 4HUMB 3K7UA 4RNRA 3FN9A 5BS0B 1F86A 4GKSA 1FGVL 1MFVA 2FHFA 3MBWB 2BWIA 3EJSA 1Z5YD 2PPAA 1MG2C 3A6OA 3WIHH 2VM9A 4QJ5B 3RA7H 4Z0BL 3C8DA 5D1ZC 2AQSA 2FGWH 5TE4H 3RVTC 4KPHH 1TVHB 5INCA 5KYUA 2R23A 5DMIH 5EU3B 1LLAA 1GMEA 4MJ4A 3BUTA 1L9NA 1PLCA 3K72A 1RZKH 3LS4L 3S96A 4HIPA 4HGWA 2JJSC 4MBRA 2YXVA 3IEAA 1G6RH 2AJSH 4ISVB 5HYEA 4NQQA 2WKGA 4FHBD 4XVUC 4YIQB 5EU4B 4LBEA 4OZIA 2UY6B 1U8MA 3GMLA 4AKPA 1W72B 4R3SA 4WVRA 1Y0LB 1OY3B 3UTOA 2EKJA 3L3DA 3N3EA 4GQRA 2NXZC 1AR1D 4YHNA 5K1VA 2O5ZL 4KK6D 3QEHA 2CO4A 1XGPA 4JX0A 4K7PH 5EF0A 2F53B 3EG9A 1J9SA 4KX8A 2KDYA 2QVMA 1E2ZA 3KWVA 2LE9A 2MH4A 4AEFA 4ECNA 5CN1A 3O4OB 1ZIBA 1L6PA 1OD9A 3LIUA 4OLYH 3HZMB 4XWGL 1QFPA 4K0OA 4RDQF 1RHHA 1KBPA 1MREL 2X2JA 4FYSA 3E6FB 1C08B 3T4AA 3B7YA 4NO3A 2ZUVA 1DR9A 3L1EA 4OV5A 1PZCA 3OXRA 2RTTA 4XN7A 2YRZA 5D93C 1KTLB 3Q6GL 4GAAA 1ACYH 1EHNA 1NUGA 3GKWL 15C8H 5DRXB 4DGIH 5A2LH 1AR1C 4HBCL 3QEGL 5DYOA 5F97E 4AKQA 4WDIB 2P4AB 4QXGL 4YFLF 4R4NC 4F5CE 1WQVT 2KERA 1WFIA 4QRRB 1RQ5A 2ZOKB 2DDQH 3MLUH 5EU7E 4LT7A 4HHAB 1G6RB 5TF0A 4IDJH 5TH2A 1JZHA 4IKLA 2P43B 3V7AE 1R3LB 1Q9WA 1Z9SA 5KOVC 2DQ6A 4JRYE 1SJMA 5GGSB 2NY3B 4CA4A 5CLZA 3CHXA 3LH2H 3QS3A 5I8OH 2AW2A 3U1SH 3ARPA 2X09A 4NT6B 2J2ZA 1ACXA 3O9WB 4JRWA 3CDZA 2DPKA 3FZUC 2NQ3A 3L08A 4TUJB 1OGSA 2ICWJ 5T1DL 1ITCA 5K9QI 3QUML 5E6IA 3V0WH 5JNYA 2PYEE 3T77A 5KUKA 3D25A 3PXHA 4H13C 3WMQA 3RTQD 1TZGL 1MKFA 5HDQH 4ZDHA 4PJHA 1F6AB 2WNWA 4PJ8A 2R9HD 2W65A 4O51B 4H0LC 3V5DB 4TUOB 3HPLB 5CILH 2OPCA 4NENA 1FN4B 5K9KA 5J1SC 1VFAB 2EECA 3O4LB 1Y6NR 3A21A 3HE7A 4I18A 2OXGB 5KVGL 3U7WL 5E8DL 2Z1PA 5KYNA 2PYFB 4M48H 1S9XB 1RUKL 1U2HA 3G6DH 1CLZL 3FTUA 3SDXE 4PJFA 5E7BA 5IROA 5F9DC 1HQ4A 1QI5A 2J71A 3QW9A 4M5YH 1F4YL 1YEFH 4YSDA 3O45A 2ZF9A 5GS1B 1BVLB 3A4FA 1HZLA 1UJ3B 3RTQC 3W37A 3ML8A 4C59B 4WO4B 4YHOL 3RX7A 3DGGA 3OXSB 1MIEH 1EO5A 2CJ3A 2R9HC 1F4HA 3HFML 1RIVL 3PWUB 4H0IA 3CFJA 2BSRA 5DHXB 1OP5H 2KLSA 3VFSA 4E9RA 4YSSA 2I7OA 1H3TA 3EYFA 5AW0B 4TS6A 1TMQA 3L3KA 2LV4A 4K5MA 3OKNA 4I1RA 3OLEA 4Z3EA 3FFOA 2P8MA 4DUXA 4CU6A 5CEXA 4HXAH 5D1QC 4BDVB 5FGBA 4IBVA 2ADJA 1SHWA 2AQRA 2CK0H 3EHBB 1MXDA 4U3CA 3S5LG 5JOFA 1SJHA 3AITA 3W56A 1CU4L 2FJGA 1YNLH 4NPYA 3V2AR 4QRFA 1HHHA 1QKZL 1XIWC 4W93A 4CADA 4QHKI 5H4YA 3HE6A 5H94B 4XC3H 3KBPA 4XMKH 5DVPA 3ZE0F 3F04A 2ZPKH 1LP9B 5ID0A 1JHLH 2VXVL 3BKYL 3BUYB 2G9HA 3AMLA 3ZGHA 1JCVA 1YUKB 5ACZB 3WLWC 4ZXBC 2DMCA 2Z31A 4HETA 4BK5C 4Z7NB 2Y36H 4MS8C 5E2WH 2HLFC 2C1PA 1WEJL 2Q0ZX 2O6DA 3QZWG 1YEEH 3A4DA 3ARRA 2VLLA 3HMWH 3MYZA 1AGDA 2EDYA 4XN9A 5HVFB 1FNGA 1FHGA 3VXUD 5EZIH 5HDBF 1IGCL 3O2WH 4JFXB 1DJSA 1VZIA 2EEAA 3G5YB 3WTSA 5I6NA 4KGJA 2P8PA 1MWAH 1J8SA 2IG2H 2D2OA 4FFZH 5H35B 1PKQA 3SKJH 1OKEA 1HKFA 1TEGA 1X5ZA 2N01B 3NDYE 3SDAB 2LAGB 4J4PA 5AWNL 4N0FB 2X40A 5EOTA 4A2LA 1KDJA 2W0LA 4N3TA 2WSDA 4W4OA 5I1DB 1JV5B 1EXUA 2ZTBA 1TO5A 3CSTA 3B9KB 5CN2A 1RLWA 2L3BA 3KW8A 4JO3H 2PETA 5DFWH 5JIMA 4OF6A 3QAZC 5E00B 4C8XA 4UQBA 5BUPA 2IPUK 4KWUA 4AEIL 4KBPA 5L8JB 5FB8A 4OVVA 1KJ2L 3U7AA 4EN3A 1DLFL 1NTDA 1G9MC 1AGBA 3WMPA 2AJXH 3AAZB 3HA0A 3D9AL 2IPTH 3H7BA 3NACH 2VW4A 4EO5A 5FR3A 1A6UH 1E28A 3WTWA 3IU3A 4QRUB 2O6FA 4NQCA 5CINH 1DBBH 3FOMA 3FUIA 5E08H 4UMSA 4FQLL 4MASA 1JF1A 2E86A 5KYYB 4OZ4B 3RFZB 4U1GC 5E9DE 1KZYA 4F8PA 2XQYA 4Y5VA 5JXAH 1NKRA 1ETB1 4PLJD 4AV0A 4DP9X 3ZRFC 2WM0A 2X53A 2MKWA 1I9IH 1P0SE 3UAJD 4N2CA 1JHTB 4Y2DD 4MD5A 1MWAB 3RWCB 4XE0A 4J3TA 5MI0C 1NCGA 3ES6A 1T03H 1S9YA 3CIQA 1JBJA 2IQ9L 2AGJL 2AQTA 4PFEA 4PJBA 3SPJA 5GHWH 1FH2A 4JKNA 4JO8A 2HA1A 3QWNA 3S5LB 4J7RA 3W9DB 4E5XG 3BX7C 2JQMA 3P4NB 1OF2A 5FKAA 1WZMA 5LCVL 1QUNA 3X1EA 5IHWA 1JFHA 1W2KT 4IS6B 4TN9A 4ONHA 3CVIH 2WXGA 1U93A 5B22A 4FQQA 1FFRA 4JHAL 1LEIB 2VSMB 2C4FU 4F8NA 4F8QA 3FNKA 4AEHH 4GG6B 1I1CA 2ATPA 2JTYA 2FSEA 5F71A 4FP8L 4HJSA 2D7PA 3ZPDA 3I6KA 4DKTA 5K9OB 4OJAA 4YMPA 1B0WA 1EDHA 3FCSB 4J6RL 3TH3T 5F8QC 2NW2A 1OT2A 3KPRB 1T83A 2GITB 1D5MB 2O26U 2K45A 3QZWB 1VJSA 2CDFB 1CN4A 3VFMA 2A3TA 5L7XH 4AMWA 3WHXB 3EOTH 1IM3A 1G87A 4MAUL 5HDBB 4L3EB 1UWGL 1SMAA 1NFDF 3QA3B 5FM5O 4ZTOL 3A5VA 5B1KA 1WSST 1NCCL 4PLOB 3P77A 2B4CC 4ZFZA 5KAQF 2UXFA 1NBQA 3EYOB 3FCTB 5DRWA 1MNNA 1WIUA 1N0LA 3EGXB 5IR1A 5IJVA 3S3CB 2VLJB 5EZOL 3IDJA 3VG0H 3DJ9A 1JZJA 1YYML 1DDHB 2XT1B 4UV4L 4XPAH 5JXED 5HY9B 1JGLH 4ICWA 4RESB 2VE6A 3D3VB 2KUTA 4BSWB 3SQBA 1A4JA 1NM4A 4IKIA 5DYFA 3RWEA 2YRPA 1AXTL 1IFHH 1UXSB 3O2DH 4RMVA 3SE4C 3IFLH 2V5MA 2JKRM 1AG0A 3RZWA 4OGXH 4A66A 1UD4A 2VR5A 2X9ZA 1YEDA 2VR8A 3CFCL 4G6JL 4G9FE 4WUKL 1DJHA 5EUOF 1SXAA 3T8MA 3ZY7A 1PIGA 4QXUL 1RJZA 1IT9H 1PLGL 1RUQL 2HJFB 2P47B 3HC2A 3IWVA 4LAQL 4DVBA 5C1MB 3GWJA 3N91A 1S78D 3TO2B 1C5BH 1WFMA 2IANA 1T89C 2NLJA 2WXLA 5TTRA 3RUGB 4YHML 3CQPA 3V4VH 2FLBT 3UTZA 2GUYA 1RD6A 3BSHA 5TD4A 5CBAA 1S7TA 2AI0H 3QNZA 1OAZL 4WK0B 4V1DE 2E27H 3KL5A 4YK4B 3T65B 1JPTH 1I3RA 3ME0B 4JFSA 3N43F 4DERA 4OVUA 3N41F 1TTRA 3QDMD 1X4YA 5F1IB 4ZYKA 3ULUH 4E5XB 4KQ4H 4WHTB 3QS2A 5C6PB 4JFHD 3OSVA 4AYEC 5IF0A 1KLGB 2QVKA 4OUOA 1V8HA 2N4IA 1N5YL 3C12A 3MRRA 4RZCB 1XH1A 3KEHA 3NGBB 2BVOA 3GS7A 3PUCA 1AS7A 3OGCA 3LKRB 3O6LH 1S78C 1AD9B 4ZO6A 2XPGA 4X4ME 5D5MA 5ICXB 2JJTA 2VIRA 4OLZL 2CBMA 2WBJC 2H2PD 3HZKA 4X4KA 2VDOL 2CALA 4ODHH 1DSWA 3PQYE 1A02N 1H3PL 3BOVA 2WB7A 5BRZA 4YSCA 4U3XA 3T8XA 1LO4H 3DSFH 3TBVA 3GLDA 1U8KA 1IIIA 4TNGA 3ARFC 3BH8B 4LCCC 2YXWA 3NIDE 5DRNA 3R0MA 3UJTH 4RFNC 4JRXE 4KK8C 4PJXA 2DD8L 3V9EA 1XZ0B 4BZ2L 4N1HB 3G7TA 3ARBB 2EDNA 3FB8A 3CZEA 5C0DA 4PG2C 4C4UA 4KO7A 4HGKC 1U8NA 1F3JB 1KG0B 5SWZA 3U4BH 3LEVL 4IGBB 4NUGH 4OLEA 3V4VB 1Z3GH 2R69L 3CWGA 4XN1A 5HVGB 1UH3A 3IF1A 3LKSB 3QUZA 2VSKB 2H2PC 2XACC 1PF3A 1VHPA 2EACA 1DVFA 3ZHKA 4FQCH 2MCAA 3VA2C 2P5PA 2UUDH 2GW5A 2A9MH 4HOXA 3S88H 1L9RA 8FABA 4G80B 3ZXAC 5CEYB 5DJ8B 3Q8BA 1UXMA 4FTVA 3O3AA 1QR1B 3GEWB 4QF1B 1RXLA 3P0VL 1HDMA 1QWHA 2OMVA 2Y7NA 4K55A 3B2VL 4AVHA 2XWTA 4X5XB 4CW1B 5C0CB 5EO0A 3SQOH 3AT9A 3F7PC 3FQTA 2XIDA 4EVNA 5TQ2L 1NKOA 3MKGA 2R83A 5DZPA 3TC9A 5CJ5A 4R7LA 2VR9A 4UM9D 3LNGA 5DK3A 3LQAC 3PUUA 1A1MB 2Z93B 2GC4C 4H1LG 1RUAH 3BXNB 5A3IC 3JBG7 1ACZA 1NCWL 3IDYB 4NZTL 3ZHDA 3GSOA 1VGEL 1JGDA 1JOIA 3NJVA 4C56B 2BNRE 4EI5D 1O5DT 4X6BB 5D1XD 4IRZA 2ZXWB 1FP5A 3HN8A 1W0WB 2RACA 5L2JB 2FJUB 4I1NB 1SJEB 3N43B 4PRPA 4JG1H 4DW2H 2VOTA 3N41B 3QCUH 4PJ9C 1HH9A 3T1FB 3VXOB 3DV4A 1Q1JL 5F1KC 3M86A 4YHPB 1PMYA 1IBGL 2KKQA 4JG0H 3MYJA 3QIBA 3U9PH 3K5RA 4QWWD 4TUUA 4MMXC 2AERT 1I8KA 4Z0XA 3RDTA 2VJ8A 4AITA 4JY6B 1VFBA 5JW4R 5D1XC 4JDEA 4UT7L 4OAWA 5FFLA 5GSVA 2JLLA 5DD0H 4ZFOB 2YD0A 1G7JB 2HVJB 2YPLB 3H9SB 1UZ8A 5I17B 3GMRB 1XF4B 4H1LH 2YD1A 2I60L 3AU0A 2ZG1A 5IB2A 4M8RA 1ZA6B 4XTRD 3GMOA 5HYJD 2G2RB 4S10A 4I7ZC 4OFPA 1RK0B 1TTUA 4O5LL 4G9DA 2BDNH 3TN0B 4L0YA 1PKOA 1Q9KA 3KPQB 1JK9B 2P24A 4DP6X 1MI5B 4KH9A 4HV8B 4X6CB 2G3NA 3TVMC 5LQBH 4QWWC 2OSYA 3QCVL 4FXGC 5E24E 3EYQD 2Z92B 1CDCA 2Q76B 2WPGA 3PJSA 4Z7OE 4Q9QH 4L1LA 1A9BA 2FQEA 1VKXA 3BPCB 4NO0B 2ZCHL 4W9LC 2AV1A 1QEWA 5T1MA 3X1BA 2KLTA 4N2DA 5C0AB 3U82B 3VI4F 3DTXA 5GRUH 1OCZB 4EZMA 1T21B 2R7EA 2CAKA 4ZW3A 1KIRA 1LO2L 1R24B 3T6WA 3ZHFA 4U31A 4RGMB 1JFQH 2YGNA 3DPBB 2FWOA 4YNYA 4HCRL 2VM4A 3QYMA 1BQKA 3VQLA 4P4KB 1PW3A 3FTYA 1JXDA 2B9AA 3DXAE 3LKQB 4BXSV 1B9ZA 3D0LA 3SCMD 4NN5C 4K9EC 3VNYA 3L4VA 3SY0B 4N6RB 3EYQC 2HN7B 2V0AA 4FNSA 4FULA 1JGUL 4M6NL 5CKAA 4QXWA 4CGUB 4F93B 5PAZA 5HYSG 2NX5E 4LP5A 4ANKA 3OAUH 2I9LA 1L6XA 3OZLA 4UAOC 1WZ1L 4PWGA 4E0RA 1SYVB 1EFXA 4H1LB 4NRZB 4PJDB 5IJBC 5I2IA 1U30A 3AS3A 3NT0A 3D85D 2A9NL 5AD0B 4FQIL 4HCFA 1RI8A 2OTWB 2WXOA 4YPGA 5JTWA 3PWPE 5GS2H 4G1EA 5AYTA 1M4KA 1SY6A 2B2XL 3UYRL 2DB8A 3L8QA 5IFJB 4ZO7A 2XV0A 3US1A 1RIHL 5T3XH 4JY4A 5AW7B 4DGYH 3SCMC 4PSPA 4LQFH 5IFAL 1ZV2A 3ETBJ 4LL1A 4M3JA 4DKEL 3NVQA 1GOHA 4PJGA 3PXJA 5EC2B 1IC4L 1NWPA 3SDDB 3BH9B 2MWCA 4G6KH 1E30A 5EN2B 4N9GA 1HCVA 1V7MH 4U1LA 3JWDH 3KG5A 3N0AA 3K8KA 5FYJU 2QGCA 1QTSA 3H42H 3OB0K 4KUZL 3V0EA 4OM1L 1HXYA 2XKNA 4HP5A 5I1EH 3F7YB 2J56A 1XXFC 5ES4B 4BGLA 1B4TA 3GIVB 3QUXD 2PW2B 3QC5X 2CWRA 1BZQK 4I4WB 4JO2H 1ZHNA 3II1A 1DQJB 2WKOA 3FQUA 1H5BB 4OGZA 5F89B 2X4PB 4P8QA 1R3JA 4QHUA 2YK1L 4IEFB 3VJ6A 3C2AH 4TSBL 5FUZH 2FO1A 1G9NH 5EUKA 1QI3A 1RJCA 4JG9A 2PP9A 3Q3GA 1GHFH 4OJCA 4DCQB 3RX5A 3DYPA 3T4AC 4BCYA 1X9RA 2XTJC 1N2RB 3IFOA 3W82A 5B39A 5GRZA 3MKKA 4Z7UA 3U9WA 3W81A 2KS0A 2B59A 2EDJA 4L29A 4QOKA 2VRQA 5LGYA 3D2TA 1YMMB 1A7NL 2RFXB 3VFOB 2HJLB 4JAMB 3QPKA 4X2UA 3TX4A 4B0MM 4D0BA 3ARQA 3E9UA 2DIBA 5DHMC 4HJJH 1AD0B 2OMXA 2BNQA 2BOLA 3ESMA 1C1EL 4XCCH 1QSEE 3ASOB 2PYED 4X98A 1CZ8H 4AZ8A 3B1UA 4XP9H 3HN5A 3SDCD 1M1XB 3HMXH 3CVHA 4WTQA 2YBGA 1U8HB 5ITFB 4C4KT 4EDWH 2CUAA 4B9IA 3C5ZB 2MTPA 4JS7A 5HJDA 1VIWA 3SDYH 1TFHA 3O0RL 5HYSB 1NDTA 2PCXA 5E4EC 5L6YL 3RB7A 3B3BA 1FO0B 3INUH 4CBZA 1XEUA 4BFIA 5D6CA 3C60A 4PRIA 1CJYA 1XHHA 3U1QA 4ZBJA 3U0PB 5IB4A 3QJOA 1S7XA 2Z7UA 1PZ2A 3KPSB 4OJFH 1T2QL 2E6QA 2Y2TA 4B0MB 5CU9A 4Z3HA 1IQWL 2JI1A 5E6IC 2Q3ZA 3FL7A 2V3EA 4N0UE 1DFBL 4X80L 5HGDA 2DQGL 1AY1L 2CO7B 2WC7A 1ZSDB 2L7UA 4PJEE 2MQ3A 4AVKA 4QNPE 5I1LA 4EZKA 2X1OA 3KLAB 5FOBA 2ZAGA 5DJ0B 1XF2A 1UQSB 2QSCL 2QQLL 4MA7L 5ABZA 2AKRA 2B08A 2J88L 3WFBH 4A2GA 4I18C 1MZZA 1BIIA 2DWEB 4JPSA 3S2AA 1KBGL 5J89A 4LLAA 4B5ZA 1N9PA 4JFQB 4DNLA 4OGAD 3QULA 1DHKA 4G42B 3CCHA 3NAAL 5IROC 4LLUB 4AXWB 1I7UB 1T4KA 2VISA 4GMTL 4LHUA 3FOLB 1WD9A 2C9QA 4J1UB 1WT5A 1K4DA 4FYQA 3CC5A 1TJHL 2HLEB 2D03L 3O41B 2C4FT 4GKZA 4X6DA 5B3SB 5I15H 4H88L 4MX7B 2LOEA 2F54E 1FNSL 5IW6B 2W9DL 5F9WC 2H1LM 1N6VA 4LEOB 2R0LL 4M3KB 5JHDE 2UZIL 3P73A 2DQTH 5C08A 5C9JA 5I1GH 5IMLA 1UOWA 1GKEA 4KKLD 1MJ8L 1PS3A 5F6IC 2ADIB 1LNUA 3B9VA 5IVZA 1IX2A 1R5VA 5I23A 3F62A 5FGBC 4L48A 4F92B 1XF1A 2R1XA 1KIQB 5HDOA 2DQFB 2F5BL 4FYTA 5D7KE 3MV8D 4Z95L 4OBRA 4A6YA 2C7FA 3FQWB 4QHPA 4MMZA 5H4ZA 1NAMB 3BRGC 5SWSB 4KTGA 1YN7A 3CN1A 1GGIL 2C9PA 2GJ6A 4WGWB 4X7DC 1W6WA 5DS2A 3JWNG 4M61B 5IV2A 2XWBB 1RU9L 1WZLA 2DM4A 4UZGA 1E9QB 2JXMA 5EOQH 1T04A 2EIZB 4M4RA 2ARJA 3TZVB 1T5WA 4JR9H 4AYMC 4NXKA 4OB5H 1LEGA 4PV9B 4XB3A 2F68X 3KCWA 2W80C 2Q2LA 5I18L 3BFOA 4YWGL 1FWXA 4QRPE 3EKCA 4P2OB 1X5AA 3P69A 4JGJA 3TA3A 4W9CC 2R29A 2BCMA 1R47A 3OJDB 2WNKA 3QDGE 2YJLA 4X9HA 2JIXD 1GY1A 2L7EA 5I6XC 4XO8A 3BUQA 1TJXA 5DD3H 4CVXB 1VERA 3K0WA 5D7LE 4Z7QF 5LGKA 1BAWA 1X5MA 2J3SA 5DJ2A 1CTNA 4JN2B 1QYGH 5D2NC 5LBGA 3J8F7 1FPTL 2XY1A 4YHYB 1E4JA 2WTRA 3VA6A 2EDDA 4NNYA 1FE8H 3RL1A 4W4OC 4BV1A 3ULSA 4ELMA 3FH7A 1OM3L 3LEXA 1U2YA 3JWNH 4P4RB 5HGAB 4QRQB 4CU7A 2EDKA 4OKVB 2PLTA 3PWLB 1UC6A 1MLBB 2D7TL 5LWYL 3VXTA 2H6PA 4MNQE 2XU9A 2NCMA 1JWSB 3MZTA 2X4NA 5MEPA 3MLSL 4ZO8A 4YBLC 3WS3B 4AKOA 2NY1B 5C0GB 1MDAA 1K4CB 4J23A 3MGTB 1R0AL 1BWMA 1A0QH 4Y9CA 5ETUA 2FD6L 1N7MH 2XZQL 3VXNA 4XNZC 3BZFB 2OMYA 1ZT1A 2CE6A 4S2SA 3MRQA 3GSQB 4Y5VC 2JJUA 4RWHA 4YPJA 5MHSD 1D5IL 2XG4B 2AF2A 5AB2A 3PHAA 3NCCB 5KSVB 4YSEA 2X89D 4D8OA 3GMQB 3EOYG 5BV7H 1M3IA 5HDWA 1IKNA 3L17A 4NM4H 2HKHH 4JGMA 1NC4D 3MV9E 3WO4B 3UZVB 2AJ3A 3VRLE 3CK0H 2ZXBA 1UXWA 2X4SA 3O11A 4AIZA 1BQ5A 2VDPL 4OCRH 5KN5B 5ADOH 1J9QA 3W9EB 5FGCB 5HVHB 1ZT7A 3KBFA 5I6MA 2XXMB 4BFJA 2Q8BL 5FO9A 4MA1C 1L6ZA 3M8OL 5I8KH 1YCSA 4GYBA 2DJ4A 4QTHB 5DGQA 1A9EB 3UL4A 2PXYD 2WWKT 4KO6A 4UT9A 3HNTH 3A4AA 3C2SA 4R0LB 5ADPH 3UXFA 3QFJB 4KNTA 4UOZA 2Y5TB 4NQXB 5IFHL 2IH3B 1OW0C 3UPAA 4M1CD 3L4WA 3T4YA 4XPBL 3VD7A 4X6EA 3VXSD 4H40A 3FO1B 5D7JD 4QTIH 5DFVD 4Z78A 2MNUA 1LQSR 3APFA 4PY7A 4KK9C 1OHQA 4MZ2A 3ZLQC 3F7KA 1FCCA 4YFEA 4ZSOA 1L5GA 4NB7A 1RZ7H 4P2QA 4Y5XA 3TBSA 3H7LA 3MBXH 2PXYC 4GW4B 3IDMA 5BV7B 4MJIB 3HCVB 1FSKB 5F7FA 3RL2A 1D9KB 1Z2KA 4ODTL 2YUVA 3P3TA 1IAOB 1KB5H 2LHAA 2LQRA 1YEJL 2QJDA 4FJYA 1UTDA 2PCFB 5DSCA 4M1CC 2F15A 2X6AA 1SN5A 3OAZH 3ZKNC 4Z7VA 5B3JF 5KBLA 4ZOEA 4V1DD 2EDBA 3QK0A 4PJ5B 3V0HA 1UWXK 3BW9B 5BJTB 1DQDH 2B1AL 4IQHA 5DFVC 4JFPB 3ET9F 4C83A 4G3YH 1BJ1H 3U25A 5IMOA 1Q0EA 3FMGH 1BAGA 5JW3L 3ROLB 1MNUL 2ZUWA 2YAMA 3GNML 2AEQH 2H6OA 2CKBH 3MR9B 2V2XB 4GO6B 2QTVA 4ONFH 4HZLA 4UDUA 3OF6D 1CI3M 3BAIA 1HKLH 4ZPTB 1GKOA 2V5RA 5KJRH 3BWUC 1AKJD 3CPLB 1M6UA 5CJOH 5T5FL 2IDTA 3EIFA 4PWIA 4FFYA 4XZUA 4G6MH 2JI3A 4ZUSB 2BCKA 4BHUI 2YMXH 3PQYD 4Z3TA 1HK6A 4GT7A 5DWUL 3CU1A 4FQ1L 3HBPA 5E94B 4ZMQA 5F9AC 2Q8AL 3NZ8B 1B4RA 3BKCH 4N1CA 5B1AB 5EMYA 5C0BA 1OB0A 1XR8A 2JSFA 4N8CL 2I32A 4Q4IA 4OLXH 1KB5B 5DRZB 2EDRA 3PGFL 4NHUA 1C5CH 2NUTA 3WTUA 1A4BA 1FYTA 1AZBA 4K9JA 2XG5B 4GRWH 3L9RB 4PP1C 1N4XL 2E5EA 2CLZB 2JJTC 5F70A 4DZBA 3L7EB 2X2UA 4GUQA 1ID2A 1PD1A 3WFEH 3MA9L 3UIZA 3ARED 1XR9A 3FSZA 1PEZA 3TO4A 5DI8B 4LLDA 3S4SA 5GRJL 1DQLH 1PFCA 5ELIA 1VFOA 3RWIB 2CKBB 5DEGA 4NUJA 2YEZA 1NMBL 4FTVD 5JPNA 4Y9GA 1SHMA 1E5YA 5HHVL 3CH1A 3OKYA 5K9QG 3R8BB 4P5RA 1URIA 3FRUA 4YXKL 2FEDD 3UTQA 5IMKB 3B7UX 3BFWA 3IDIA 5ILTL 3IJSB 2YGOA 4PRHE 4TSAH 3KWWB 4HS8H 3EUUA 1T5XB 1TTGA 3CN2A 4QT5B 2XWRA 4X7TA 3QUZC 1KT2B 4K4KA 5ENWA 1HHJB 3ZTNH 3GRWH 1TFPA 1A6ZA 1DVFC 1U95A 2D3JA 4LARL 4YGAB 3CFBA 2GUOA 3W39B 5I66B 4FLHA 2PWFA 3VGEA 2COQA 4N2NA 2F7PA 1NCDL 3RPIB 1FFNB 4ZS7H 1U8CB 3UYPB 2E7LA 1NKGA 4HKBA 1AR1B 2GAZA 2ILLA 4DZ8B 2P5WE 1KTRL 1ZEAH 2OXHA 3FH5A 1TPXC 2BXZA 1ML0A 2FEDC 1HHGA 1OPGL 2DLTA 2I26N 1YRKA 4GRWB 1TZAA 2ZNXA 4QRBA 3IRCA 2VKXA 1U3YA 5KSUA 3TNMA 3VSUA 3ZIMA 2VSDA 1OK8A 1PYWA 3ZMEA 4NFDA 1ZLVK 1IGTB 2BXYA 2TAAA 4MKMA 4TVUA 1VEMA 4UOW1 1WHOA 4GKLA 3RDTD 3EO9L 5F2FA 4A68A 1TKWB 5CZKA 1X5XA 1QPXA 1JPFA 4HIIB 4UT6A 4UNVA 2RBLA 1TG8A 5ACLA 2FX8L 1BLIA 2VR4A 1KTDB 4FOMA 3P9LB 5E1AA 1SDDA 4XMVA 4ZUUA 3MJ9A 1P7KA 1W80A 3H1ZA 2FGZA 2APFA 3KXFE 3RX8A 2EE0A 4LKXB 4PV8B 3VTAA 4P49A 2FT7A 4ES9A 3SBPA 3SE8H 1LDSA 4WGKA 1TUPA 3AT0A 2ZKXA 4J28A 2CCVA 3GQFA 1AYOA 3QIBC 1Q38A 2IADB 4M7LH 4OLVL 2XVBA 5LLIC 3RDTC 5IVXE 2JKXA 4AH2A 4JFVA 3L2LA 3CFKA 2LU4A 5IHUH 3R4RA 4ILDA 4E9LA 4LPUA 1KJMB 2C8NA 3L3OA 4NOBA 4WI0A 3PHSA 3QGVA 3ZKMD 2J1WA 4BWWA 3M07A 3R1GH 3WSQL 1G7PB 1MHHB 4HX1B 1KN4H 4LPYA 2EYTB 3DX3A 5C07B 1MQ8A 4YHLL 4RGND 3HR6A 4F58L 5IJKA 4Z7WA 3AS2A 4BEIA 5ANME 4FX5A 2E4FA 4S1RL 4PI2A 5MERA 5C0RL 4G7RB 3UTSE 3LKOB 3OQRA 5DJCA 1ZGLP 2NX5D 3FUFA 5IVNA 1B90A 1KN2L 5A7BA 1OP9A 2Y7QB 1SNRA 4FERA 2ITCA 4YN3A 4XP5H 4PJCF 2EUVA 2AK1L 4KKBC 1DVUA 2G4GA 2WXIA 2W92A 2ZCKL 3PP4L 3PDOA 4IOIB 3DGDA 2ICEB 4PWFA 5CWSB 4OD1H 2VXUH 2VM3A 3MOAH 3QJHA 2GJZB 3WDJA 1CBJA 1JK8B 4YO0B 4BSVB 4BINA 4U05A 4GEJA 3VXPA 4RGNC 2NTFA 5T3ZE 4HWZB 5DJ6B 4BH8B 3GB7A 2VQ1A 1TEYA 3SOBH 4CKQA 2F0CA 1WA0X 2FBOJ 1T6BX 2QPDB 3QDJE 4KY1H 3WUWG 1ED3B 5ERWA 3DIDA 1WFTA 2XWJA 4PJ7F 1XVSA 2IXQA 3RLSA 1JXKA 4HULB 3I3EA 4D0DA 2Y5EA 2MNWA 1MSPA 3TPUB 2R4RH 4DUWA 4AGQA 5BO1L 4AQZA 4RX4A 3SZKC 2X4OB 3THML 1MDTA 2WINA 3PABA 3RIFK 5D2LF 4GY4A 2FAUA 5C0IA 1NGPL 3CDYA 1OP4A 1TCRB 4XGZB 4RISH 3QO0B 4ZFFB 1JZ2A 1MLCA 5K93A 4AT6A 4M6OH 1CF8L 2WKLA 4WWKD 5AOKA 4MQSB 4YAQA 5F7UA 1OAKH 1S9WA 3S37H 3UC0H 3MOBH 4X5WA 5TDPB 3MRIB 4KMQA 2EIJB 4OJEH 1BD2D 3EDEA 4F15C 1DQQB 2ZD0A 5L9DL 3QAZB 4IBYA 3GBNH 3LX9A 3VXUB 3TIEA 5I1AB 3ARUA 3VQ1C 5F6HI 2VMJA 3ZIYA 1HS6A 3L5XL 4AW4A 4UT9H 4YDLC 2NY4D 1YPZF 2ZX9A 1XH2A 2GFBA 1IIKA 3RIAF 4XN4A 4XMUA 1TITA 4A7SA 1T66D 5IB3B 4NAJA 5EZJA 1GOFA 4IJ3B 4K94H 4N8VG 3VM7A 2BNQD 1OTSD 4YLBA 2X12A 1C12B 1ASPA 1EGJA 5EO1B 3ZRCC 2ZONA 4B5EA 2ATKB 2R1WB 2GHWB 3A6BH 3C09C 1XCTB 3G5VA 3MREA 5HGGS 5GIRA 3VWKA 2BSTA 4POZD 1KTKE 4R9HA 5C3TA 5GGRY 3VCLB 1IBZA 3CFDB 1CFNB 3UX9B 1SJXA 4TULH 2YOAA 3T0VA 4L9LA 4OCNC 4ODBD 3MXVH 1CFVL 3C9NB 2ZUUA 3PG2A 2CBQA 5KG9B 1KJ2A 4F5CA 3GM0A 4PRID 2NNXA 1T66C 3S3JA 5C86A 1QNIA 3RPBA 3KYMA 4XPGL 4JDVA 3E8UL 4MDIA 5DVLA 1OTSC 1WWAX 4HH9A 4JM2F 2G2NA 3L7FA 2P9RA 2Q7AA 5T1LA 1TVDA