4NLHA

Skich domain of human tax1bp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
115
structure length
115
Chain Sequence
GPSSPAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SKICH domain of human TAX1BP1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Tax1-binding protein 1
total genus 15
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17751 SKICH SKICH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4nlhA00
3VVWA 3VVVA 2LFEA 4NLHA
chains in the Genus database with same CATH superfamily
5T5NF 1SUJA 3HE7B 4JS7A 1NCHA 1ZEAL 2GJPA 5L7XH 3V2AR 4L8CB 1X7QB 5DRXB 3FT2B 4YAQA 3JUZA 5KN5A 1KPUB 1IGMH 3BVTA 1F56A 3BH8A 1KTLA 2FUQA 3EYQD 1WAEA 5F9JB 1U8IA 3TO4B 1T1YA 1ZAGA 3ZQXA 3UZEA 1OTUC 2WIIB 4GG6A 5EC1A 4PHZA 1CPUA 1WAAA 1TQSA 2ZT9C 5DJYB 4Y4FB 2VN3A 3RVVC 1SMOA 3BGFB 1WBYA 4R3SB 4UIMB 3DROB 3FK3A 3UG5A 4G9FB 4NN5B 3SCMD 1NGXA 3PV6B 3VXQA 4WSKA 2FB4H 1KELL 3D34A 3E9TA 1R3JA 1IV8A 4DPAX 1WZAA 1JN6B 5IVXF 2YXVA 1M9WA 3BQUD 2DYPB 4LLUB 2IGTA 5HHQA 5DJYA 2QZQA 4DGYL 5FK9A 1ZIAA 2J88L 3GSXA 4HKBB 4MQXD 1WBYB 2E56A 1F0LA 1R19A 2H32A 3CZKA 4G7YL 3BE1L 2MQ3A 4R3SA 4PYGA 1OEZW 4UBDD 3BP6A 1YEGL 4WO4B 4YR6B 1XR8A 5E4OA 1MFCH 2E27L 4WHYG 3UDWA 4Y1AD 1X7QA 3SDDD 2Z1PA 5MEOA 3CFDA 3BEVA 3RWJB 3G5XA 2BX5A 2ZKXA 3EO9H 4P23C 1HEHC 2UXTA 2XN0A 3APMA 2APBA 1FIGH 3C5SA 3HRZC 3MBEC 1MNUH 1N6VA 3LZQA 5F7DB 4GKNB 3BEWA 4PBXA 3IGKA 3BN9D 3QXWA 4N9GB 5HVFB 4JJ5B 1RL1A 2MJWA 2EO1A 4GUPB 4M1GH 2ESVE 4NKOA 4ZMLA 4MGXA 1IT9L 3KVPA 3DETD 3MGOA 4HGWB 4JDZA 2WLLB 1QG3A 4IRZL 1KTKE 3RZCD 2C3VB 2GBTA 1SBSL 3DTXA 3G7TA 5CD3B 2DQDL 2KL6A 2QELA 1HOEA 4UTCA 3U79A 4UOW1 2NYYD 3OR6B 2NXZB 5DS2A 3TBVB 5HYEA 2CK0L 5DZPA 3MV9A 3FUMA 4O2EA 1MFDL 3EO0A 2YAQA 2ILLA 2XBDA 1S7UA 4EVNB 4CL7A 4QT5B 1E5BA 1C16A 5FUOH 2BVOA 1T5XB 2BXZA 4WO4A 4YR6A 3ZTJG 2O61A 1HI6A 3UP6A 4ODUA 4PJBE 4PJCE 1K4DB 2FO4B 4G80A 4UOQA 4IS6B 4JRLA 5ILTL 1KBKA 3B43A 3BSHA 3FB7A 2OI9C 2WV3A 1R3KA 3W5MA 2JKIS 4IOIA 1J5HA 1H15B 5D55A 3F6LA 5SX5K 4GSDL 3GI9H 5ECGA 3V79C 1EDQA 4KQ3H 2FEDC 2CHNA 2R7EB 1XX9C 1Z7JA 3KZ8A 5GXBB 3PWPB 5IMKA 4H8WL 4XB3A 4B53A 2Z7ZA 4OM0L 4YBQD 3ZYJA 2HTLC 4OGYL 5ANME 2ZKHH 3T4YB 3DURA 4HJ1A 4Q2ZA 1VKXA 4AYBA 1U3ZA 2EYTA 2X4SA 3DMMA 4YIQA 1WIUA 3MOBL 4LQ1A 3RJDA 3SPVB 4G7VH 1KJVA 1JE6A 5F7BA 1R6VA 3D0LB 1M71B 2CGRL 4LEOB 4EI0A 5L4JA 1F4XL 1YPZE 3OR7B 1TZHB 3TZVA 2Y6TE 3OKNA 5AKSA 1TTFA 2OKMA 4QHUA 2OL3A 3D09A 2XSKA 2ZX9A 1RZJC 1U6AH 5FO7B 2LW3A 4KTDH 1BF2A 3NEXA 3AACA 4X5QA 4ZMPA 3L1EA 8FABB 1NFIA 5IMOB 2Y0SA 4HMCA 1LP9B 2W80C 4M1GL 4NX0A 3T0ED 3CPUA 3KPSD 4MS8D 3V4PB 1GPOL 2BCKB 1QO3B 2AQRA 2JKWA 3BHBA 4FJ6A 4PV9B 4YFLF 2LR4A 2YA0A 1OOWA 4I2XA 3EOYG 5E9AA 5ICZA 3FTZA 3L1OH 2H3NB 2X7LB 3E9UA 6TAAA 4AVIA 3S48A 3IJSB 3WY3A 1O5DT 2OQJB 2R51A 1P7QA 2EIKB 3KL5A 5F7EH 4H26A 5GS0L 1WGOA 5IHHA 3D0LA 4FXGB 3SE9L 3Q44A 1VESA 5DD6A 5D2NB 4WI4A 1JS4A 3F05A 1JJUA 3I9PA 4N3TA 4DGYH 4LVOB 1VDGA 1XR9B 2CDGB 1K4DA 1L9PA 2GBVA 1DUZB 2WBJA 2YK1L 1PZBA 2V33A 5C0GA 2A1WH 2HVBA 5C97A 3O6FC 1LEGB 2VR6A 3UGUA 2KT6A 2WW8A 4FKKA 2X4UB 4PD4K 4U1IB 4UM9B 3RX5A 3FO9A 2DM7A 5EZOL 4G8FA 4P3CH 5I1IL 2OMXA 4KGJA 1J1XH 1A7QL 1UZ8A 3BMVA 5EG6C 3PHOA 5JUEH 2OMUA 2EIEA 1T5WB 4RWHA 3MJ6A 3QFDA 1BVLB 2VDLB 1J05B 1CGSL 3WS3B 3K2MC 4K55A 2DH2A 4OLVH 4WFGD 3RLSA 4BINA 4L4TA 1QI5A 2Y23A 1M7UA 4KZEH 3E6HB 5D7LB 5I5JA 1YDPB 2IPKB 2AQTA 1EO5A 2NOYA 3EYFA 1TSRA 1VB9A 1AS8A 3IDIA 3L8QA 1N6UA 3ZE0E 3P30L 2OMWA 3U1SH 1CF1A 4LFHG 4L4VE 1XH1A 4UT9A 5ESAA 1I9JL 4I3SL 4MJIA 3D2TA 4I8DA 4HIHA 3QRFM 2WLMA 3SKNB 3DMMC 15C8L 5GJTH 1MIEH 2R2EA 4BXVA 4M56A 4WV1B 1XIWC 3MNDA 3SE3C 5C0CD 1BM7A 1P5UA 2OA9A 4S0SD 2YEZB 2YKLH 3G08A 5JHBA 3FN0H 5FA3B 2F15A 3H8NA 1I8MA 3K72A 1QFPA 2WGNB 2PXYB 5E6IC 2AEWA 3MSPA 2R0WL 3ERXA 4LSQH 2DI8A 2ZXGA 3T8MA 2V2TB 4HIPA 3NPSB 1H3PH 2KHAA 2NY6B 4W1TA 3VXNA 5TQ2H 5E6IB 4LCVA 1DQMH 4GQQA 3MRKB 4IKIA 4JKNA 1DDHB 3FB6A 1E30A 1YMME 3IGLA 5J8OA 3E6HA 4GOSA 2AXJA 3MV9D 4PV8A 3WMSA 1R5WA 3MXWL 4IBWA 4LHUA 2PXYA 3ZTJH 3BWZA 3RX9A 4EUPB 5I1GL 3V5KA 3PJSA 5DQ9A 3Q6GH 2CO2A 3EBHA 5B39G 5ILTH 4ETYA 2BW4A 3R8QA 3WAKA 1HSBA 2BFVL 4HDIA 3O0RL 3GHBH 4QXWA 5JHDA 3NJJA 4AYGA 4IMLB 5C0BD 4OCWH 5J89A 1OF2B 5ICUA 4B0MB 3ULUL 5IHZA 1CLOH 3Q2NA 3QORD 2GJ6D 3FHQA 5E5MA 1S9XB 3MRGB 5BO1L 2AQPA 2VMEA 5B1JC 3VXSD 2F08A 3CTTA 3WKQA 1Q94A 2HT3C 5HJ3A 1CICC 3QSKB 5B3NA 4P4KD 3P02A 3SODB 4N8VG 3RX7A 1J1PH 3LKNB 3GT6A 5T1LD 3EGSB 2YAHA 4P2QE 4H13C 3UL4A 2D9CA 4KRPD 4LVNC 4RFOL 4CA4A 5E6ID 1I85A 4O51A 3GNMH 4LCYB 2BLFA 1INQB 1PFOA 1Q94B 4GAGH 1M05A 3DHJA 5AVTB 4MZRA 4OH2A 2PPDA 4KVNH 3NABH 5I71C 4NNPL 2ESVA 2FHBA 1SFDA 2KPWA 4NI3A 4C56B 3EGSA 1C12A 4PJEB 3CFJB 2Z93A 2WOYA 4NBYB 1IEBA 3LVTA 15C8H 2L4OA 3N2JA 2N0KA 5GJTL 3W2DH 1GTFA 1OHQA 4XVUC 1G1CA 1I8MB 2X70B 3TTYA 3QDJA 4UMSA 1FORH 5EN2A 2CLZA 4LIQL 4E9LA 5EEYA 5CJQL 2GVYA 3HUJB 5J4MA 4WWID 2A83B 2DV6A 2V5TA 2ADYA 2IALB 1E9QA 3CNKA 2W9LA 5EHFA 1P5VB 2UZXB 1NCJA 3GLEA 2X70A 1QSZA 4PJXF 5FYLE 5I1KH 1A9EB 3O4LD 4MMZC 1A3RL 4PGDA 4TNVF 4F9LA 3CDGA 3WYRA 4I48B 5GS1A 1RHHA 3OMZA 1U8KA 2AK4E 4FLOA 1E3ZA 2APVA 2YGPA 4FI6A 1VJSA 4K71B 4P3DB 4P5TA 4DGIL 3FHEA 4JM2B 2BY2A 5DZAA 1X5HA 5L4IA 5DUMH 5C07D 2NX5A 5KG9B 1JWMB 3P0YL 3VXRD 1GOHA 2BW5A 2CDFB 3WJLA 3NCYP 4K94C 5GS1B 4I0PA 3O3BA 5LBGA 4JZJC 4DP5X 1G9EA 2OMZB 1QKZL 3QFJE 1JAEA 1KB5B 1KENL 2XETA 3TBSB 1ZA6B 3ZLQC 1O6TA 3B5HA 3L2MA 3GSQA 1U8JB 3HI5L 3C2AL 1YG9A 5DFTA 1MI5B 2CRIA 1K6QH 1XEUA 2UUDH 3VWKA 2N3JA 2XWTB 4NPKA 4E9VA 3WTSA 3CDZB 3SDDC 5AKTA 1D7CA 1A7BA 2H3KA 2OMBA 4QY8B 1UD4A 2J5LC 1CTOA 1IGFH 1B3IA 1FL3B 3ESOA 4JANA 3SDYL 3VXMA 3AG1B 5C07E 3GMMB 4R26L 3MRMA 3QYNA 1VEOA 3BQVA 2NTFB 4N0RA 4A2DA 4AK1A 4JO4L 1IM9B 3N9GH 4JDTL 4CVWA 1B9ZA 2NX5D 2B5IC 5HDBE 5D8JL 3S5LB 5KEZA 1BQHB 3BVVA 4R7LA 1HH6A 5D2LF 4AQEB 1JGEB 1F4HA 1XT5A 3O9WC 4UIKL 3NZ8B 4I5BA 4E41D 5TQ2L 1M1SA 1WA2X 1I8KB 1S7WB 2NQCA 4UV4L 1WT5A 2BSTB 1C7SA 2KLRA 4EIZC 1WO2A 2R2BA 3TBWB 2K3TA 4RFEA 5IB4B 3O3UN 2X28A 4FQXC 4I13B 4ORGB 4UOJA 4DN3H 2WO2B 4IOFC 4DGUA 3QO0B 1KEML 4HIIA 1G7HA 3TEWA 2I32A 1BA9A 2JJUA 3CD4A 4P57A 5I0XA 1JI1A 1S9WB 2YMXL 5IOKA 4HD5A 4FA7B 5SWSB 3FCBA 4KKBD 3L3KA 3PWNB 1R24B 5F8QC 4EZKA 1IC4H 1RK1B 1OD7A 4N5EC 3EGXB 1MCRA 4NUJB 1UWXK 5F0JB 2EE0A 4PJHB 5KZCD 1N3NA 4NZUL 2AJ3B 4ONGL 2Y5EA 1L9SA 4F2FA 5GSVA 4F37F 5JMOC 3V6FA 3TF7C 1TG8A 1VFMA 3FTVA 5AD0A 3GPEA 3CFBB 1QSFB 4FQQA 2ZP0T 3T04D 5HYQB 1N19A 3JQOB 4HFWB 5DYFA 1CFNB 1R3KB 3GJEB 1WBXB 1TTUA 4BZ2H 4DETA 2H9GA 2EDDA 4OF3A 1BP3B 3GK8H 3VFNA 1MPAL 1O7SA 2J1XA 2NCMA 5IB4A 4CJ1A 1TVBB 2DQMA 1UJ3C 3D05A 5D7EA 3U0TB 4FNLH 5ITBL 1I31A 2YGQA 2V8MA 5J56B 3BH9B 1EEYB 2YD6A 4KVCH 3LKOB 2JLLA 3ARXA 3S4SB 2P5WD 3OXSB 3PWJA 4Y4HD 1SBSH 1KT2A 3TJEL 4PJXA 1NC4D 2EYTB 1ZHKA 5AW5B 3SIKA 1NUDA 1XHHA 1EZVX 1QTYT 3LV3A 2YWYA 2EEBA 4PCKA 1SY6A 4WFHD 4IEFB 3BKJL 3BMWA 4ODWA 5ACZB 4AH2A 3PWJB 2K3HA 4MX7B 5IV2B 5T1JA 4L8DB 1MHPL 2AEPL 2UX6A 3J8F7 3Q5OA 3EYSH 4KC3B 2AV7A 3HG1D 1LO3H 2LU5A 1D5IH 3D1MC 3GYRA 3OAZK 3VUAA 2CKNA 2WBWB 4OT1L 4WTQA 5EUKB 5C0AA 1HWWA 3EZ8A 3L3HA 2YKKA 3LQZB 3UTSD 3D12B 3GMRA 5I0ZA 5CBAB 3BVNA 1G9NH 1URLA 1IAMA 5JW5A 1OARH 1ZLUK 1WEJL 1P0SE 2K4WA 4OBSA 4ZOAA 1E2WA 3S3SA 1LDPH 4M8QB 4MJ6B 4ZQKA 4H8UA 3IKCB 4XBMA 4R5XA 1PF3A 2JIXB 4Z7IA 3L3KB 1DQQB 4JCMA 2VSKB 5H35B 4K5NA 4EZLA 4RMQA 3SYPA 4L37B 2PR4H 3VD2A 4Z6AT 5HHXH 2M1KA 3SDXA 1NAMB 1NDGA 1CN4A 5BQ7A 43CAA 3FT2A 1JBJA 1ZSDA 4OZHF 4HGWA 4JDZB 1A8JH 4PU2A 5GSVB 5KTEH 2ITCB 3PNRB 2R1YA 2ZX6A 3DTXB 5CD3A 4Y19B 4ZUVA 3L4CA 3ILPA 4X9HA 3QFGA 4X6EB 1WBXA 2EDEA 5D2LA 2UZYB 1JUFB 2CM5A 5E5LA 1ZY9A 2IDTA 5I5RA 4AW7A 2QSTA 1NANI 2W92A 4G8FB 3U30C 3WCYA 1ZT1A 3RWHB 2QVTA 4UV7H 5SWQA 4EI5B 4F33A 1F11B 3CVHA 5ITBH 3ILPB 3M1OA 2Z65C 1BF5A 5CCGE 3OXRA 3PV7A 4E41E 3ZDXB 3UTSB 2J8UB 1LJMA 1JF5A 2C3HA 2LLGA 4ISVB 2N0MA 4TNVK 2NNAA 4XNZC 4WWOA 4Y89A 3RVWC 2H47C 1KIPA 3HC4L 2UZIL 1GJUA 1GW6A 4MNQB 5KVDE 2GKIA 3PGFH 1GGUA 1DBML 1UEYA 4MB3A 5F0MB 2P7TA 2YQBA 3X13A 1EO8H 4OGAD 4L37A 5KJ7E 4W81A 4NQSB 3PABB 3VGDA 3FRPG 4U33A 1JXKA 3NK4A 1T7YA 1RZJH 3IFNH 3WJJC 2XX0A 1DJWA 2YPKA 3IGAA 4UILL 1OGPA 2EZ0D 1MWAB 3B7TA 1BZDA 1WCQA 2WIIA 4GI6A 5F0LB 4M4RB 2P7TB 3ETTA 4LLMA 3CFKA 1X7SA 2NT1A 1J86A 1VACA 1QFOA 1TR7A 1HZKA 2XZCH 4GMSL 5AW7B 3STZA 4FQPA 2D7TL 1L0XA 4A2EA 2R2HA 3QORB 3KJ6L 3HLAB 4CKQA 1T83C 5FO7A 3BZ5A 3ARRA 1KJMA 1YN6B 3V9FA 4RGND 3LRSB 4IOSA 3PYCA 1XEDA 4MXQD 4PG9A 1IARB 4UM8B 3DSFH 5KSUA 3SYAA 5I75B 2F5BH 3GKWH 4ZUTA 4AEHH 2F6AA 1E7UA 2KZBA 5FW6A 4HPHA 5B3JF 3F5WB 1VA9A 5IVXE 1UM6L 3CFKB 2DM4A 4YDIL 3ECVA 3ZE2B 1SVBA 1EEZB 2XY1A 3AM8A 4XWGH 2NUPB 4X6FA 3MLWH 3VACA 1T5KA 2FSEB 3FUEA 5I30L 4PI2A 1XSOA 4ZUTB 2XWEA 4BGLA 1BZ9B 4MZ3A 4YSPA 1HESA 2ZOOA 5I8CA 5DSCB 4GG8A 4LCCA 5HGGS 5JIIA 1V7ML 1KNOB 1KSRA 2CNYA 3I3BA 4DPCX 4LCCC 5F93C 3GXPA 4S11A 3QWQB 1SYSA 3D7PA 4K7PL 4BFFA 4QT5A 3U7WL 3MBEA 1K8DA 3BEWB 4KKAD 5KVFE 5DA4A 2BHFA 3V0DA 1LGVA 4C56E 2Y1ZA 1BQSA 3SE8L 3QHZL 4A7TA 4BFOA 5FGCE 5BRQA 4WY7L 2DRUA 3HG1A 1F4YL 1QUPA 1FFNB 5D2NE 3QJHB 5DJDB 5DO2D 4NAJA 5DWPA 3SHSA 4LRIA 1R5VA 1MAMH 4Z0XB 4QHMB 3ZE1B 5BV7C 1N64H 5TF1L 1IFGA 1KEGH 3FO0H 2Y22A 2W60B 2A99A 3WNMA 1KCKA 3EIFA 3W81A 1OAZL 3TN0C 4WCYL 3VXME 4L4TE 4KTYA 1OSZB 3C8KB 3OPZL 5D7SH 2YSTA 3QJHA 3BC9A 4F7KA 3EO1A 4FP8L 1NA8A 4GW5A 3EXLA 2CIKB 3NJMA 4H2CA 1MCHA 1XDTT 4WLCA 4DGWC 1AHKA 4KROC 3E8UH 5FDWB 4MMXA 3QUYD 2A9MH 2YMOA 2WTOA 1R34A 2UVEA 4G8IB 3BWAA 3WUZA 4OVVA 2R7EA 4M5YH 3VU2A 1YNKH 5IB1B 4NRZB 4KAQL 4Y9BA 5I8KH 5CSZB 3TA3C 2PYFA 4OCWL 3WMQA 4NNPH 5BJTB 3CN0A 2XN1A 2EO7A 2ZWNA 4XPFL 2F53D 5TE7H 1K72A 3CXHJ 3X14B 1F97A 1PU0A 3AS2A 1IZJA 5TDOB 5DVOA 1VCBC 3OC5A 1GZPA 1OO2A 4IBLT 5GS3A 3FFCD 5DURB 3NGBC 4Z7AA 2X9YA 4J3OC 1YMMB 1QO3A 5D1QB 1PKQB 2WXIA 3D52A 5C0ND 3NPZB 1SM3H 1F18A 4NM8L 4X9BA 4XVSL 4A2MA 1VPOL 3VXUB 3U2JA 4LCCB 3SDCC 4PJFF 4IKLA 3HC0B 1DJGA 1D5MA 1IGFL 2WLKA 3FQNA 4WNQB 4L05A 2XACC 1SF5A 4RZCB 4GAGL 1QLEL 2ATPB 2XWRA 2ZCLH 3AQYA 3ISYA 1I3UA 3SE8H 4QHKJ 1F6AB 1MLBB 3EZJB 3LEVL 3HE6A 2ZXDA 2QPEB 5AB0A 1LQBC 3HHMA 1UWFA 5J9PB 1DL7L 5CSZA 1QQDA 1FYTD 3EJQA 1E6JL 1U8PA 3GMMA 2OCFD 2J2ZA 1NC2A 2QSCH 4CKVX 2JKJA 5TDOA 1RIVH 3PY9A 3OB0K 5GRVK 3QPXH 4JFTA 4FYTA 3FO1A 1KLGB 1DN2A 2Y4SA 4MB1A 4OLEA 3DWTA 5FO8B 4AGOA 4U1LA 2F53B 2SODB 3K8LA 2W81C 3P4NB 3MRQB 1A66A 4ZNEE 1TMQA 3FMGH 4NT6B 4WAFA 3QI9A 2JB6B 4ZK8A 5J6HA 3GBMH 2M2DA 4NHCH 5ESQA 4BQCA 4X8JB 1V27A 3TN0D 3QNYB 5D5MB 5ETUA 4S1RL 1DDTA 4H0IA 1DVFC 4J3OD 2CJTA 4P3CL 3RKDD 3IMRA 3F8UB 3TYFA 2YPLB 3CDCA 4LCWD 4YWGL 3B4NA 4DTGH 4NC0B 3AB0B 3EBGA 1OF2A 4HJTA 3M8OH 3MRJA 1FZOA 1A2YB 1QA9B 4BFJA 4WTXA 4ZUUA 4N2NA 1QSFA 1QW9A 2FO1A 4UB0L 4ZDHA 1A9EA 3L9YA 1XTMA 3ARBB 3QQ3B 5E4EC 4B60A 1JRHH 1PCSA 5BUGA 3N43B 2PLTA 4N9OB 2IAMB 2DIJA 1FFTB 2E9IA 5DVNA 2CCVA 2F8XC 1MCBA 3MLXL 1C5DA 2PTTB 2BP8B 3I6KA 7PAZA 4JQIA 2RJMA 3SE4A 3INUL 4X5XB 2XA8L 3LXCA 5D7JA 1UA6H 4I0PB 3RFZB 1HJCA 3C8HA 3CFEB 2WZ6A 4GUOA 1O9VA 2NXYC 2E74C 2FECL 4YFDB 3VWJD 4RAVB 4PTUB 3X3GL 1BD2B 5CINL 6FABH 3MUGA 3K6FA 4JFSA 4L8DA 5D7JB 3KJ4B 5F3BA 3RJOA 2F7PA 1CWVA 4N0UB 3U48A 2OSLB 3S36H 5GS0H 4I3GA 1KLGA 2ZCKL 2UYLB 3P9MB 1A6AA 3NN8B 5ANMB 3ESVF 2RFXA 5EOCH 3S7GA 4UTBH 3ZGIA 1KTBA 2BC4A 2XLLA 4NC2B 3VD4A 5DD0H 2DYPD 8CGTA 2IAMA 4YHNA 1NMBH 4N1HB 5FYJU 3ZE1E 3IMBA 1T03L 1A3LL 1ZLSL 4ZPTA 4R97B 3HIZA 2R0ZH 4IBZA 3S8FB 2VLJE 4QYAA 2BVPA 3LY6A 5TDPB 2P5WB 2B0SL 4PJFA 3EAKA 3V55A 4NZUH 1T21B 1A6AB 4LEXH 5EOQL 5ACMA 1KXVA 4OZGA 1CXIA 4YFLI 5JIDA 4ACTA 2ZCLL 4FFTA 5DUJA 2VDMH 4P3DA 5DQJB 2ZXBA 2WNGA 1PFCA 3WIIL 1BD2A 2ZOTA 5GGQL 5L4MA 5D8JH 4FZEL 2WOBA 4OFQA 4QDGA 5J12C 4KHTL 4P46A 4RDQG 3UYOD 1Q72H 3QA3B 3QHTC 3QIWD 1DVYA 2EEXA 2FEDD 2MRYA 2NY2B 4TSAL 4KKQA 3T2PA 4DK5A 2E7CA 4GRWB 2V7HB 3DO3A 5LN8A 3SKOA 1WHPA 2FVNA 1JHKL 1LXMA 3IDJB 4IM8A 1EGJA 3II3A 4C83A 1JZ3A 1SJEA 2P80A 4N2OA 7CGTA 5AL8A 1FLRL 3MJ8B 2X89A 1Z0MA 4Q6KA 5F1SA 2ESVB 3H9SE 2H1PH 3STBA 1KIRA 1DBJL 2I27N 3EOBB 4PRHE 4BUHA 4F57H 2FATH 4X5WA 4BHUI 1Z1WA 4KI1A 4X5XA 2H2PD 4ZUWA 4YGVA 1SXNA 1NCAH 3D39A 2XT1B 3RY5A 3TU6A 4JFPB 1J9SA 1TTAA 5E08L 2EEFA 1DEEB 2DAVA 2R1WA 3NJGA 2BIPA 1BJMA 4LAJH 4R4BB 2KUTA 3HMXA 2RMNA 2D7MA 3L4UA 2QPFA 1OWWA 2F2HA 3DRQB 1FGNL 3DTUB 2V3DA 4M93B 3BSZL 1ZE3H 1N68A 1D6EA 5GZND 2F61A 3EXJA 4X7TA 2HLFD 4JM4L 5ISZE 4HWNA 4FQXB 5MEQA 1FN4B 4KFZC 3QDHA 2Q86A 2HJFB 5EO9A 5F7FA 1E0OB 5D5MF 1SOQA 4U1NA 3TBTA 4ABWA 3GK8L 4LOUC 4XOCA 3MV8D 4JRWA 1FE8H 4JMXA 1QPPA 3PU7A 1A8ZA 1ZPUA 2A6IB 3F12B 3C6SA 4JVUA 1MI5D 3MUJA 3OLEA 4D3CH 2BNQA 3A6BL 3GBML 3DC0A 3SBQA 5D1XA 4WO4D 3CDZA 3V0JA 4IJ3B 1ZWIA 2DLGA 3EFOA 3LMJH 4JPVL 4AUUA 1QLFA 2IQAA 2ZE0A 4L0ZA 2QADC 5CLWA 4R8WH 3HZVB 3WIFB 4HEME 5E7BA 1JZ4A 3DLQR 2BP0B 4BCYA 1F1GA 4M8RA 1RZKC 1J11A 2VITA 4HLZH 4KROD 1OTSD 4S1QH 3ALPA 3CHQA 5D4HA 5GRVL 3GMLA 1TLKA 3FQRB 5CBAA 1X9LA 1NCTA 3W3BA 2CO7A 4UINL 4ZT1A 4ANXA 4PW4A 2Y6SD 3DIVA 3WXWL 2EKSA 2R69H 1IBGL 2LAGB 3FT3A 4WJKB 5D1ZD 5IQ9A 4DKEL 2JELH 4ELME 3U9UB 1SFHA 3CVCA 1P7KB 1EQWA 4YHPA 4XPGH 25C8L 2IOIA 2X1QA 5CEZD 1LEKA 3HB3B 3DX6B 5FA4A 3EYQC 5IF0A 4LKXB 1EUUA 1ZHLA 2Z7YA 4G8EA 5SWSD 3N85L 3VFVB 4NZDA 2OMNA 3NGBB 4P59H 1FCGA 3D2UD 5K69A 3APFA 3OHMB 5AEAA 3FQWA 4ZOBA 3FXIC 3PGDA 4OZGF 3U36A 3Q8EA 4XMWA 1N3NB 3TT3H 2XN2A 2Z1KA 2V5SA 1HSAB 2GC7C 2DQ6A 1E5UI 3QJVB 4G8EB 4MXVF 4NQEE 1JDDA 1I82A 2VR4A 5EU4B 5JHLL 3LQMA 4X9GA 1CICB 4WW2B 2EDKA 3IDXH 4KMTL 3FHAA 3JVGC 4HUWB 4A7VA 1M1XB 3IJ9A 2DY2A 4KJQD 1XGTA 3ETBJ 3UC2A 1XBDA 2QMJA 1QLRA 2Y5TA 3EGXA 1OK0A 1JERA 3E8UL 5DJ0B 4YE4L 2C4XA 4HK0A 3GSWA 5FKPB 2HTKC 4ZW5A 1LMKA 1D2OA 4P23D 4DGIH 4R7DB 1YUHB 2FBJH 4B95C 1NH6A 2FH6A 1LO2L 1WFMA 3OB0H 2H1PL 1JWSB 3RVTD 3D3VB 4BZYA 2HH0H 2OTWA 1RKRA 2J71A 5DMKA 1DUYA 4J6IA 1NCOA 3PGDB 3RDTD 1J9RA 4XNAA 4N8CL 3K6SB 1I7UB 5MERB 4MNGE 1F42A 4XVOA 4PJ5B 2OX5A 5LBSA 4IRZH 4GRLD 3LDBB 4HS3B 3DVGA 4JZNA 3B9EA 2OJEB 3CX5K 4JRYE 1NCWH 1DVXA 5B39B 2UZYA 1QVOB 1KXQE 4PVBA 3QCTL 5SV4A 4TUJB 3GEFA 25C8H 3SY0A 3Q7JA 3TBYB 4AGQA 4G5ZL 3PHQA 5DZJA 3CN4A 4LF3A 2H2SC 5C0RH 1NOLA 4OLUL 3V6OE 1MJ8L 4DP7X 3MRBB 2Z4TA 5B39A 4E42B 2DEWX 3FTXA 3A6BH 5E5UB 5GGVL 2WLJA 3M1BA 3HI6H 4B9ZA 3UAJD 4Z7VB 3ECQA 3V9CA 4KQ3L 1DEDA 2IBZY 2W07B 4F9PA 1NQBA 4Y19D 1DQKA 4KK6D 4JM4H 1CFSA 5L6YH 2XX1A 1GOFA 1HOCA 4XVTH 3B1UA 2ZUXA 4HXBL 2ZJSH 1GYAA 1WEJH 1OPGH 1KBWA 3A47A 5LNDA 1T4WA 4B9CA 1QSEA 4P5KB 2XTLA 3ARFA 1FAIH 2CBOA 3MZTA 4NRXA 4GRWH 1Y0LA 2OAAA 1OOAA 3DX9A 5CLYA 1F11A 3CVHB 3RDTC 2AQSA 2YRLA 5FO8A 3K2UH 4ENED 4ZMWA 2X09A 3IRZA 4G9DA 4X4YB 3FU5A 3HVDA 4HPOL 2QT6A 3D6GA 3LNDA 4WEBH 2E3VA 5EEWA 2HMID 4DK3A 4X6EA 4AMXA 4XXCA 5IJKC 5C0BA 2EUZA 1NAML 3U4EB 1FO0H 2GEEA 4GS7C 2ZWKA 1TVHA 3TVMA 4P59L 1JZFA 1DN0A 2R69L 4E36A 4KXAA 2WLLA 5DQDL 3UPCA 2X4TA 5FF6A 2CCWA 4NGHH 3ZO0A 4WFEE 3HS0A 3ILEA 4RFNB 2YSSB 3SEPA 1VZHA 4PJGA 4H20L 4HJGB 4UV7L 4QWWC 4BQ6A 3FCUB 2GUOB 4P9HC 1LTXA 1VSCA 1C1EH 3OMIB 5JXEC 1VF5C 2CLVA 3C8DA 3MQIA 3MV9B 3P30H 3OL2A 3DV4B 2FT6A 3MROB 4JHZA 1H6UA 5EZIH 4CBZA 2AVFA 4PWFA 5DC4B 1QEWB 1KPVA 5AZEH 5JORA 3IVKB 1ILSA 5DZVA 2X6CA 4I88A 3RNKB 4OW6A 2FO4A 4G80B 4FNUA 4F37K 3MRBA 2AQ2A 3CX2A 1NAKL 4QXTB 3K8MA 5C0JA 1LE5B 3MRNA 2DQCL 1VFAA 2Q6WA 3EUDA 4QOKD 2V9TA 5C0BB 1OK8A 1V05A 2XZQH 3GEWB 1RZFL 3LHPL 4LVEA 2VC2B 3GIVA 1DVTA 3MRLB 2EDOA 3R06B 5I82A 3NZSA 3U2SA 4APQC 3NIGF 4XVJL 1OCWH 5CIPB 4C59B 4PB0L 1MIML 2P49B 4ZAKD 4KZEL 3CN1A 2X1PA 4P8QA 4Q97A 4JFZL 4IOFD 4PGBA 5A40E 4XVTL 3RTQD 4YDNA 2C7FA 5EC2B 4HCGA 5CFAA 1I1RA 4QXVA 1V3KA 2NR6A 3SJVA 5AW3B 1NBYA 3SGJC 3OR7A 3WO4C 2A6DA 2Y36L 3B2MA 3HUJE 4WI6A 4D9LH 2C9PA 2FJFB 1ZV9A 3SBWA 4FLHA 2GHZA 4IKJA 2APSA 1I75A 2J57A 3P4LA 5E1GA 2OV0A 2WHVA 4NYLB 3GTNA 4U4IA 4GJTB 3WFDL 1QBML 5FDWA 2KERA 1RK0B 5L8JB 1AR2A 4N2AA 2NDGA 4MDIA 3V4UL 1EH9A 5GZNA 5DHVH 3TEUA 5EEVA 3MC0A 3FONB 2CDFA 3GS4A 1XH3A 3K81A 3R1GH 4TSAH 1ZT4B 3KYKH 1NMAL 4B96A 2D7NA 3IDYC 4TVPD 3UH8A 4S0HA 3FFOA 4FFYH 1QPKA 3RWEB 5IR1A 1T1WB 4U2ZA 3NJNA 1ZTMA 1PZDA 2UX7A 3LRMA 4LBAA 4M8UA 1ZCRA 3D18B 3GMNB 5FPIA 4LU5H 2WWKT 3BPLC 3D3VE 4YHMH 4AENA 3T6VA 3VRJB 2WLIA 2X44D 2MKWA 1AXTL 2IFGA 3BT2L 1WUNT 1I1YA 3NPSC 4OLZL 2N7BA 3NTCH 3RWDB 3ZKXC 3ULVH 5AUMA 4NLHA 2B9AA 4C83B 4ZTPL 1JYVA 4WI0A 1N4XH 3BKCL 1AI1H 4OD2A 1JDAA 4R97C 1A3LH 1NKRA 2EDFA 4ODUB 1K4CA 4BFBD 4AL8H 3TWYA 2E6QA 4KV5F 4ZFOB 1MJUL 1RZGA 3UX9B 4ZMAT 5HBBA 1J5CA 3OWEA 1GYWA 3IN2A 3AVEA 1XF5A 2ICEC 5I74B 1INEL 4M5TA 3HE6B 4X8CA 5ALBH 3C5ZD 1VFUA 4PIRF 3BUQA 2WWMD 1N64L 5TF1H 5HJBA 1P1ZB 2YBRB 3V4VL 4JFZH 4IGBC 2ARJQ 3ZRSA 3KYOA 4G8GD 1XSJA 1XF3B 2WTPA 1VGEL 4MDJB 4EAEA 1MUJA 4FKEA 3UYPA 2WLIB 5D1QA 5IB2A 3V52H 2SEBA 3CBRA 1Z9PA 1RZIA 5F0PB 3VFTB 1T1XB 5DFVD 3VXPB 5I6KA 5CP3H 4DCQA 3G5YA 5SWSA 3A3YB 2IC2A 1DZBA 1YNLL 4TQEL 2EIZB 2PWFA 3ETSA 1R24A 1MCQA 3OKKB 5DR5H 3ZKQD 4BFRA 1FA4A 5F89A 1V7MH 1KGJA 5GZNC 1Y7VA 1HNYA 1TFPA 4DKTA 4MA1C 1AHMA 1QOKA 1JGLH 2W0KA 4MYWB 4ELKA 4P2OA 4OCRL 4UQ2A 1K5NB 2AJ3A 4J3XA 5A2BA 3C5ZA 4LGSB 4X50A 5IMOA 4MZIA 4W9CC 3US9A 5J9PA 5EU6B 4U7KA 4PW3A 2H2PC 2UY7B 4TMPA 4YHZH 2HJLB 1ACXA 4MA3B 1S4IA 4WWPA 2PKDA 2R4SH 1RUQH 3KPQB 3NK3A 3T09A 3ZY7A 3QFJA 1TCRA 3GDCA 4U6VL 4KX9A 2PABA 3S3CB 4IMKA 2Y7QB 5F9WC 5ADOH 4PJ9A 2P5WA 1FZKB 2B14A 2VLKB 2FR4A 3QUMA 3G6DH 1A3RH 2EXWC 1F13A 3EBIA 4F91B 3V0VB 4QLRA 4NP4L 1GS7A 3S88H 4ZO7A 1OE3A 2AK1L 2ADJA 5KSVB 5KYYA 4LRNL 3MV7B 1F6FB 4K8RD 2XZZA 4XZUB 4R4FH 3FQTB 4JFHD 1RU9H 4WWKC 4NQXB 3G5XB 4GSQA 3JVGA 4V11A 1T89C 5SWZE 1UTDA 4XNZB 1Q9WB 4GXUN 4QGYA 5D71H 4KPHL 4PRPA 5L8KB 1EHKB 2VDOL 3H53A 1NWOA 3EH4B 1SXBA 3L7EA 4LIQE 5DJZA 5LXGL 4GXVL 2FCBA 1B0IA 1ZRUA 1JXGA 2B59B 3FULA 2BVYA 4UQ3A 4HZLB 2ZD0A 1RAMA 2AS5M 1SXSA 3W38A 1J8SA 5EU5B 1EGJL 1P1ZA 2YBRA 5C0AD 4FTVA 1XF4A 4NNYA 2DLIA 1KWKA 2BO0A 2VQ1A 4GBXB 3BVNB 5DT1L 3FB8A 3RWCA 3VH8B 1LO0H 5EU3A 4AUYA 1A4KA 3Q2WA 2OSWA 3AADB 1PBYA 3Q06A 2HFGH 4Y2DB 4JHVA 4X7CC 4HJJL 3V0IA 4N90D 1E4KA 1GY1A 1VIWA 3MHZA 3K2KA 5B1KA 5MEPB 1BBDL 2C1PA 1MJ7L 4LKCA 4QJ3B 1KC5H 3WNOA 1KGCD 4LDOB 4JKLA 1UYWL 2VWEE 4KXDA 5KANI 1E9OA 3FZUC 4JO4H 3TOPA 2EADA 3VSTA 1CVSC 4WK2B 5JXED 3KPPA 4NQXA 2Y69B 1D6EB 1WAPA 3TX4A 1JNNH 5AQ0A 2EVHA 3NFNA 4F7EB 1IKFH 1RUPH 3TO2B 1FZOB 1QA9A 1AHWA 3KCPA 5C3IA 1FC1A 2WNXA 4O02A 1A6VH 5EN2B 1IGYB 4I1NB 5F7WC 1G6RA 1HQRB 2WKOF 3D0VA 1MFVA 3LRGA 1E9OB 1MDAA 1XTLA 4XMPL 3VO0A 2BP5M 4GLRI 4EBQL 1NCWL 3LOWA 5IMKB 2Z7UA 1FIEA 3PRZA 1P9MC 5T5FA 4Q0XH 5DJXB 2YFNA 4B5EA 1GMEA 3L4TA 5A3IC 2X0VA 2D7QA 3GXTA 1CGSH 4N5UA 2IO5A 3GO1H 5EIIA 3PNWA 1HNGA 1NDMB 3IDUA 3LXUX 5KSBF 2NY5L 1YEIH 4XWOC 3ZE0F 2GY7B 1JF1B 5FXCH 1KIRB 1O6SB 3LB6C 3UAFA 3VXUE 3QEHB 4QI3A 3GHBL 3JWNG 2VDKB 4JO1L 1FZJB 2Q1EA 5MHSD 1WGVA 5C8JB 3HC2A 3L7EB 5KTEL 1ADQA 1JNHB 3K1DA 5IREA 1E4KC 1B88A 4I7ZC 3I02A 4BK4A 4J5VA 1TPXB 1PZUB 2X3BA 5HXMA 5F3HB 5FLUA 1XB8A 2E46A 5F1OB 1A4CA 5D96C 1BIIA 3NP3A 5CS7A 3QIWB 4OZ4B 3CG8A 1YEHH 5JDJA 4OZIF 4HF5L 3IPBA 2H3NA 4DGVH 1NGWB 4ODSL 2GC4C 4UQ9A 3GSUB 3GS0A 5HY9A 3O9WA 1A02N 5E6SB 3EOTL 2DW5A 2N7AA 5BQDA 5AOIA 3ZVVA 3GI8L 3PL6B 5KAQG 2XBZA 5JDSA 1JZ8A 4Y5VC 3NSCA 2WXHA 2XWJB 1I1AB 5E7FA 5AZUA 2X12A 3V4LA 4UDUA 4X0KA 4HKXB 3O2DA 4ZTEA 3VGEA 1LWJA 4U1SA 3RP1A 4ZS7L 3VI4E 2EDWA 5FGBC 5DDHA 2K6YA 3F83A 3WIIH 3GM0A 1YYCA 4W9IC 4CRPA 1CTMA 4XBGB 2DL2A 1VFOA 2X4OB 3D69A 3KWXA 1GZQB 3FUNA 3N42F 4Z3GA 4U1JB 1A6VL 2FQDA 1O5PA 2EYRA 4LSQL 4PP1C 1SJEB 5DD3H 1JRHL 1PIFA 2HFTA 2VR7A 3N1MC 3ZZSA 3CIQA 2ZYSA 3WY1A 4OB5L 1LNUB 3WEOA 2VXSL 1ACYL 2D03H 4ZD3L 4XE0A 3AXLB 4UWQB 1ZHNA 5BZDB 4DVBA 3B9KB 2YN3A 2PF6A 2YAFA 1JV5B 1QBAA 2AW2A 2EP6A 5SWZB 4HCFA 1AS6A 3X3FH 3WENA 3TS8A 3T0EC 2XQYA 4U1JA 3S8GB 4XCFH 4KTGA 1NDMA 3E3QE 3EDKA 1KB9J 2JK5B 3IDGA 1RVFH 3MV7E 3C6SB 2XG4B 1LQSR 3VI4F 1UEMA 3WNPA 4ZMVA 5KW9L 4CNIB 5D9SA 3NZHL 4TTGA 3W39A 1AZVA 3TA3D 3RNKA 1PZAA 4UNIA 5F7LB 2KZKA 3KLLA 3U7AA 4B9KC 1E9PB 1GXEA 3CFMA 2JFCA 1MCOH 1EJFA 1FFNA 4LL1A 2HX8A 4IIQA 4JFDA 1GGIL 2BOBB 1D5BA 1KB3A 5G2NA 2K8MA 2JXMA 1MAJA 2C9RA 2XFXB 1HSAA 1KYFA 3QAZB 4RA0C 1DFBL 5G5DA 3UBGA 3PWUA 1ZHNB 4KH2A 2DEYX 1PNDA 4R90H 1YECL 2GJRA 4QOKE 1QLFB 2IQAB 4MAUH 4N0YH 4DZ8A 4Y4FC 3MBXL 3N44B 3VTMA 4OF8A 2CUMA 4PRNB 2JQZA 1HCVA 2Y7MA 3AMLA 2VITB 3U0TA 5A2JH 5B4MD 4MWFB 1XQ4A 3CU1A 3ESPA 5D9SB 2G4GA 1NCAL 1N7MH 4PJIE 2ZUVA 4RNRA 4Z0BH 4NUPA 3LN4A 5GGQH 4UILH 3GQFA 1CDBA 3FUIA 1RUPL 5LBVA 2XTJE 1JZIA 1A4JB 5IQ9B 1GZQA 3VWKC 1HH6B 4K9EH 3OKMA 3KXFB 5KBPA 2V2WA 4K0OA 5CEYA 4E41A 4S0TD 2FL5B 4OZHE 3P69A 4MDIB 1A6UH 4QIRA 2WVTA 3F7VB 4JDVA 4JPKH 4K2UH 5IFJA 3ZL1A 1K2DB 1U8QA 3EKCA 4AV0A 3VRLE 2WXQA 1J9TA 4PREA 5JOFB 5GRZA 4LSTL 5AWNL 3FQUB 1NGXB 2DJ4A 3PV6A 4G7RB 2DB8A 4K73A 2AJUH 4E0RB 2OSXA 3QIBA 4UTBL 4F5CA 2VZOA 5J6GA 1E4XH 1HCFX 3EDJA 5KBNC 2HFEB 2HJKB 4JG1H 1F2QA 3FQNB 3L5HA 3MNZB 1IAOB 4BUGA 5IROA 4D2NA 5BZZA 4HK0B 5GS1C 3UZVA 5E0QA 1S5HB 2IWKA 3HMXL 3WXVH 4HLEA 3NAAL 5CP7B 3K71A 1BIHA 3V6ZB 4NDMB 1KCUH 1XGQB 3FJTA 3NVQA 3RWIB 4PB0H 3AXHA 4RRPA 2GTWB 5ALCH 5H37H 1G0DA 4N85A 1DVUA 4NKMA 4LCWB 3BUTA 1YEHL 5D7SL 4JE4B 3S34H 1THCA 1ZXQA 4ZNEA 5BOJA 2QFPA 4UNTA 2HVJB 5EUOB 4WW1A 4DZBB 2F7RA 3O9WD 1MCCA 2R29H 4HS3A 1EDHA 5IZ7A 3MXVH 4JB9L 4GIAA 2EUXA 2N01B 4G42B 1EIBA 2YQ2A 4ES9A 2NNAB 3IGUA 1KB5H 3CVIH 3UMTA 2JI1A 1OW0C 4ZOCA 3T1FB 3QI9B 1CZ8L 4ANUA 1JSYA 4ZO6A 3ABGA 3FTGB 3D9AL 3TBVA 5C0CE 3L4WA 2QVMA 2K7PA 4JRXE 4JY6A 4JEGB 4CSSA 3K46A 2JKRM 4DEPC 4FL4B 2CO6A 2WK2A 1MHPH 2KC0A 3ZX1A 1AGCA 2YN5A 1V7NL 1N5AB 2BRRL 4GSXA 1P6FA 4PGBB 5KYUB 4JHUA 5LDSA 2CIIA 3MUY1 1GYUA 3BVUA 1YMHB 1O9WA 1P4LB 3BDBA 1F3RB 3E1F1 1YCSA 3H2QA 3HHSA 4FG6D 3LQAL 4PJAA 4X6CA 5DK0B 2F5AH 1XGYL 2X4NA 2D7PA 1AGCB 3POCA 4H8HA 5DHMC 1JD7A 5CLTA 3GWJA 5JTWA 2MHAB 4PG2C 1ZANL 4OJDH 1DHKA 3QDME 1N2RA 4XXCC 3UAEA 4F7PB 5JYLA 2WSPA 2WLZA 3TJHC 3HA0A 1YZZA 1TJXA 3VE0B 3ARGD 1T89A 5KVMC 2QLVB 4LCUA 1IE4A 3OG6B 2WBJC 4IBTA 4MD4B 4JREC 4JAMA 5K9KB 3E6FA 4XC3L 5I1CL 5CD5C 5I18L 1XH3B 1ND0A 1W72A 5AW1B 1EFXA 3K1KC 4O2FB 2A0LD 4ERSH 3L6FB 3MV9E 3VWJA 1CFSB 3IDMB 1U93B 2GTWA 2QQNL 5IBTH 1L6PA 4WHTA 2ZYRA 1J9QA 2Y2TA 1CXHA 2VR8A 4IMKC 4KJQC 5ES4B 2VXUH 1OXYA 1I7RB 2VMJA 1AQDB 5L88H 1JUFA 5AOZA 5B38B 2ICWA 2X4TB 3ARBD 5EU6D 5FF6B 2H32B 5LCVA 1UADC 2B5IB 3NIGE 2VM3A 4CDHA 1I4FB 5MENB 2B1HH 2BC4B 1GTNA 2BCKA 2IAMD 2JI2A 4OLWH 3VQ1C 3SO5A 4FHJA 2IG2H 3N3EA 4KGLA 1T6WA 4NO0B 4PTTB 4CMMB 5FWQA 1K8DB 2OR9H 2R15A 2X40A 3Q5YA 3QUZA 4G5ZH 4H1LG 2HH0L 4X8XA 2P4AB 4ZOEA 1EMTH 4FLRA 3FCSA 3BZFB 3WY4A 1TT6A 4BSVB 4CU8A 3TEYA 4Y5XC 5F7DA 3CSYB 1NFDB 3UJJL 4ONHB 5EBLA 5F9AC 5I17A 4G1MA 2IADA 3VWJB 1A21A 3WV0A 5EORH 1XIWB 2BRRH 3OC8A 2HG5B 3JV4B 4O02L 4H25A 5FYJD 1LWRA 1H3XA 2IPTL 3C6LA 3D48R 3LJ3A 4XN8A 3VA2C 1MELA 2V2XA 4QRPD 4PBWD 5KVGH 4Y19E 4JNXA 4IKNA 4KOCA 4PBDA 4YHZL 5F7KC 5IKCA 3F7YA 4K3JH 4P0DA 4XI5D 1RZIB 2KKQA 3D0VB 5IR1B 4WDIA 1BZOA 3QEQE 1WAAE 3MN8A 3OHXC 2ZX5A 3BO8A 1TOXA 5F6HI 3BQUA 3C9NB 3IFPA 1IL1B 4M6OL 3PWLB 1L9MA 5GSRB 4JRYA 5DHYB 1RI8A 3HZMB 5CO1A 1JXFA 1JK9A 3GTVA 4OJAA 5D7LA 3EGDA 1TEYA 4JAMB 2P5PA 3SPGA 2CLRB 2NSQA 4IRSA 1SDDA 3KD4A 1MI5E 3GSVA 3IDIB 5EBLB 4WQOA 4GKSB 4RAHA 1RZFH 4RZKA 1ZE3C 4U7SA 5D71L 3HE6C 3HKFA 3EG9B 1N0XL 2DWYA 3FPXA 1KXTA 1QX1A 3APNA 5KN5B 3AQXA 4KMQA 5K1JA 4HIHB 3QFJB 4HJUA 5CGBA 2VLRD 4TSCL 5AZ2L 4MMYA 1CDUA 5AW2B 3PGCA 5HDQL 4HEMA 5EC2A 4LARH 5CZXC 3GHEL 4QR7A 1XXFC 1PKQA 2LT9A 5IMLB 1NCCL 2X4PB 3RVUD 5G4MA 3NT0A 3BKYH 3LKSB 5KYXA 1M7IA 2K0RA 3KVQA 5H37A 2DYRB 4JJOA 4MXVE 3CAFA 3OZKA 2BSSB 2YAEA 4Q9CA 4MMYB 1CGYA 2ZWZA 3V5HA 4RGMC 3RBSA 3C87A 3FB6B 2OI9B 4M03A 2ATPA 5K1NA 2NXYD 3RL1B 3QDJE 3EGDB 1SVZA 3BJLA 1CXFA 2L8AA 1KTRL 2VDNH 1OF0A 4FXKB 2IFFH 3RU8L 3UGXA 4ALAL 2X6MA 4X4XA 3SBWC 3C12A 4M48H 5I1EH 3LNHA 1T0NA 2P47B 5GRJH 1G7MA 2NMSA 4HKXA 1S9KC 4H25B 5FV2A 3UMNA 3ZDYE 2XOTA 2DQJH 2XFGB 4Q9QL 4BKSC 2X3AA 4Y2DA 5FS5A 5HHQB 4KKPA 5D1ZA 2FD6H 4YJZL 4N2BA 4HUUB 1GGBL 1FYHB 4PRID 2HKHL 2DYSB 2W60A 4OCYL 5FM5O 1TTCA 5TK4A 3VW3H 3O2DH 2PCFB 1RJYA 4D8PB 1XBRA 3I75B 3LDBC 1R47A 4L1BA 4X83A 1RJLB 2OMYB 1L9TA 3V4PH 3ZIMA 2D7OA 4NWTL 5C0GB 3HBQA 5K39A 4WWKD 1DSWA 4D94A 5DI8A 3UABA 1V5JA 1ZHLB 1RV6X 4NZRH 5JQ6L 2PPEA 1OZTG 3VMPA 2VN4A 1GMIA 3MNVB 4KK8D 3WN5C 2C5DC 4A6YH 3D2UA 3ES6B 3VVWA 4Y1AB 3SDDB 3DO4A 2Z92B 2BOLA 1UCBL 2A4EA 3WSQL 4JFFE 3X1NA 3VQ2C 4ELMB 4FQJL 2ZONA 1SEQL 4ELKB 5I1DA 2GFBB 4MQ7A 5T3ZH 1KPRA 3RUGB 4KK9D 5M7QA 5I2IA 1JG9A 3N44F 1T7VA 3ARBA 3H9SD 4D0CA 3KPSA 4WUUA 4QMEA 2OP4H 5E9DD 3IJ8A 1IGTA 5JPMA 1T5XA 4R83A 4P48A 1WZLA 2XCMC 3TH3T 2OYPA 4HG4J 1IO4C 1U6AL 4QPEA 4A2FA 4N0FB 2ZUYA 1IC7L 5HI4D 2CDEB 3QXTA 3FQ4A 3O4LE 4TOYL 1DJSA 2RGSA 2X2YA 5DLLA 1DVFD 2YAMA 3UPRA 2MIZA 4D7BA 1KCVH 4M7ZB 4P99A 4XVUD 1YY8B 4Z3IA 1GYVA 3MO1A 3RDTA 3IYLW 3DXAD 4PVNA 1PGRB 2CDEA 5DC0A 2B9BA 5DFWH 3AS1A 2FK9A 1YJDC 2IDSA 1MW3A 3VRIA 1PSKL 3ECWA 3EYUH 3R0MA 1KCRL 3P73A 3QDMA 1VFBB 2UYLA 4J12A 1CDHA 2NY1D 4LSPH 4QJ4B 4OCSH 3HBPA 3MA7B 3PIQB 5FCUH 3DYMA 1P6WA 3OAYK 4LEOA 2DQTL 3DK2A 1PKOA 1HL5A 1AKPA 4YHNB 4ZO9A 2XTJD 1CXLA 3MRDA 4L5FH 2OMYA 2VUYA 3MLRL 4M6OH 4PJFB 1YECH 4WV1C 3RKDC 1O75A 2XVGA 1UENA 4OLXL 1XGUA 5MEPA 5KOVC 5ALBL 5EZOH 5EDSA 4AC2A 2PN5A 1S7RA 4QRTB 5TK2A 1GGIH 3BPOC 3THML 2JJWA 3VGAB 4WKZB 5IIEB 3F3HA 4A66A 4PS4H 1ZGLB 1LEGA 5CFHA 2AJVH 5CP7A 2V7HA 1JV5A 1JWUB 2VAJA 1HOCB 3NJKA 5CNHA 5T3ZD 3W0WB 1NOFA 5IOPA 1NIBA 2CO1A 4QYOB 3ZKMC 1W0VA 5D2NA 2DJUA 4L9LA 5I0DA 3L5XL 3S6CA 1NGWA 2X53A 5EZJA 2A73B 4HGKC 4KNUA 4YDVB 2ICEB 3CZUB 2EECA 2A7BA 4CSPA 5I6PA 3VJ6A 2BP8A 2J56A 4EIUA 1J8HD 4JFUA 4XR8C 4X99A 1MWOA 3EJSA 3EDDA 1HHGB 3GSOB 5F9DC 2ICES 3A67L 2FLMA 2Y1VA 3QPKA 5BV7L 3CSPA 4AIOA 4Z7OB 4FERA 2Q7AA 3VFGH 1FZJA 2ED6A 3QCVL 5KVEL 1ZLVK 5IGXL 1MRDL 2DEXX 2C7UB 1RJCA 2GTZA 3U0WH 2CE6A 4XBEH 4HAGA 2VM9A 5IBUG 4FG6C 1HE8A 2VQUA 3QDMB 1HXKA 1WA1X 4OLYH 1ID5I 4JN1H 1AZCA 3GSRB 2WZAA 1K9TA 5BO1H 4IJTA 1ROWA 3FT1A 5K33A 1B2YA 3SGKC 4P2RA 4HC1H 2VDNB 1E28A 1PX3A 3AREC 2R0ZL 5LAXA 5JHLA 3EJRA 4D0BB 3U4KA 3TNMA 2X4NB 3K6OA 5T1LB 1OP5K 4LFHD 2VL4A 1I1AD 3KLHC 4YHOL 3WN5A 4YBLC 3S4SA 4Z7QB 4DP1X 4H1LA 4YUEL 1AE6H 2HKFH 1J9CT 3O3AB 2I7OA 3N06B 2DMKA 4ZMQA 4R0LB 1FL6B 3QR0A 2E9JA 1JNNL 4L0YA 1ZGLA 3L3JB 5JW4R 1RURH 2IVFC 2VYRE 3IETB 3O8XB 1IT9H 5KBDA 5CHNB 5DRXA 1E6OL 3UG4A 4WW2F 1Q9LB 4W93A 1P7KA 3PJSB 4HJSA 4ZRGA 5CJQH 2XFXA 3BN9C 4OF6A 1T22B 1ZT7A 3V95A 5DZOA 3OQRA 1UJ3A 4ABQA 5GS0D 1IBYA 2D2CC 4Q89A 1KBGL 4G1EB 3D9AH 4V2BA 4K5LA 4X2UA 5DS8A 4WGVB 3KHQA 1HAWA 2YUVA 3GSNB 5AFAA 1X44A 2AEIT 2MPAH 2VLME 1V54B 2NSMA 2PP7A 3X2QB 1XAKA 4PCSA 2CAKA 3VFMB 3L9RA 4OZFB 5FM5M 3NCEB 4BWUA 1FPTL 5J6HB 4YDLB 5L4FA 2XG4A 2ID5A 3HMWL 3WNIA 3LVEA 2NY7H 4MJID 1MCWM 4GINA 4I9XA 3VD5A 2E7MA 2HZHA 3RVWD 1UXWA 3NFSH 3ZUCA 3EJZD 2Z64C 4JCLA 3LN4B 4TQHA 1NEZA 3JWOL 4MAZA 5HJ3B 2AXFA 4DP2X 1FRGL 5AW8B 2GG1A 3BP4B 4JGJA 4JG0L 4NC1E 4HG4K 5EO0B 1RUAH 3RWEA 3RWJA 1UXLA 3DVIA 3P3SA 1IQDB 5IJBC 2O5NA 1CYGA 3IBEA 4X4ZA 4BFKA 1AZZC 1W16A 6PCYA 3GSRA 3B6SA 1T03H 3SDAD 2ROYA 4M61A 4FOMA 1X4XA 5EOCL 1INQA 4HOMA 5HHOD 4K7PX 4G6MH 2EICA 1G7LB 5H37G 2WXMA 5AVUB 2BNQB 2IQ9H 4YBQC 1BJ1J 2N59A 1MFAL 3A22A 4YLQT 3UC0H 1XF1A 2C3WA 2VDQL 4EI5A 5I6MA 3W56A 3C75A 1MHEA 4A2GA 4MMXC 3GM8A 4EZMA 1A1MA 5D6DA 2XG5A 2PWGA 2VSDA 2YD3A 5BRZA 3QS2A 4XCYB 3WMPA 4YC2B 3QG7H 1IM3B 4YNYA 3U6RA 2CKBL 3OF6D 4JKPH 2BNUB 4PJIB 2DLTA 3OGOE 4GKOA 5B21A 3ROLB 3P0VH 3Q1EA 2DPKA 1KN2H 4N9GA 1IM9D 1U30A 3FL7A 4HUVB 4N8PA 1ZK5A 1Q9LA 3FS9A 1NANH 2ZNWA 1RZPA 1AY1H 3RAJL 4CMHC 2OSLA 1QI4A 4QRPB 2DQIL 2BIQA 4IU2A 1MVUA 4N2MA 4I4WA 4HCIA 1OGAA 2D7TH 2FO8A 2YD4A 3DYPA 1RHHB 2VO5A 4Y16C 4OLZH 1WG3A 1CK0L 2UVFA 4XPHL 3UCQA 1FDLL 3LKSA 1QWHA 1UA3A 5KYXB 5A7BA 1QBMH 1WV7T 3L6FA 1MQ8A 1TJGH 3SDAB 2EIZA 3OKDB 4NUGH 3GLAA 1P4IL 4XAWL 3WNLA 4Z7NF 5ISZA 4YHKH 4LLWA 1T0OA 3QRBA 4YZWA 1CXEA 4DUVA 1REIA 2QFRA 1TPXC 1MCPH 4Z7OF 2JTDA 3PFQA 4FJYA 5HI3C 4ZAKA 5I8KL 3CH8A 5D6CB 4YSSA 4HUXA 1KTLB 1EUTA 1CDYA 1IGIH 4OM0H 4WW2A 4X80H 1NFIB 1NIAA 5JO5A 1XGPA 3SQOL 4P2RD 3ABLB 2BSBA 2NW2A 3AT0A 2F1BA 5DFAA 3ZO9A 1ITCA 5GHWL 2I9LA 2PCPA 2WXPA 4JFEE 5JQ6H 3VGBA 3BI9X 1HZLA 1TZHA 4LBEA 3ZTNH 4XN7A 4NDMA 1BGXL 3GJFH 3I6LE 2DH3A 3HI1A 3NG5A 4HS6A 4P2AA 3FPYA 2NW3A 3ZKMD 1RUKH 3D08A 5D5ME 5JHAA 2PMZA 4Y1TA 4X6BA 1M57B 1G1OA 2YKLL 3IWVA 1G84A 3RVXD 3WTWA 3LEVH 2PTUA 5CJBA 2CRMA 2E47A 4KX7A 4NBZB 4N22A 4G42A 3I85A 4UIKH 2J5WA 3BHBB 4PV9A 1DQML 2H2SD 3BYYA 4XOEA 2Y3AA 4OM1H 4GBXA 3UTSA 4N8VB 1OARL 5I2IB 1QEWA 4AC4A 3RRQA 4MJJA 3VMNA 2IPUK 2CBTA 2Q0ZX 4ANWA 3RFZC 2DTML 4LHUD 1YEWA 4A63A 3TZVC 3NCWA 2VDNL 4FXGA 4EMZA 1L3NA 5B8CC 4OFYD 3KLKA 1OSZA 3AWEA 4Z8FL 3BAEH 4P4KC 4NO5B 4JHWL 1DANT 4J3SA 2F1EA 1B4RA 4D9QE 3VYNA 5I9QC 2DJMA 3JWNH 5D1XE 3UXFA 3EYOA 5HGAA 5AW4B 3FO9B 5H94B 3JT2A 2W9DH 2GAZB 5D6CA 2FGWH 5C0FB 3C60D 3LHAA 4CJ0A 2Y07L 4BKLB 4L3CA 5FUZH 1HU8A 3T0BA 2MQ0A 4P04A 3HTLX 1PKQE 2YAOA 5KSBE 3PAUA 3EHBC 3X14A 4ATTA 5DK2A 3QXDA 1PZ5B 5JW5B 1RZKH 4HUCA 2PW1A 4EI5D 1T04A 4JPSA 5E8NA 3M17A 1T0NB 1CGXA 3ARZA 5E6IA 4NO0D 4O58L 3OSVA 2NSXA 1PL3A 4MJ6A 2ADFH 5KYWA 1WPCA 3TCXA 1OP3K 2AJZB 5E9NA 4LHUB 2CLRA 1A65A 3LYRA 1NAMH 2YOCA 5EBWA 3F01A 4JKKA 4JM0A 3D0AA 4PJCA 4PJBA 4E5XG 3DGGB 1ZT4A 4Q9RH 4XPTH 1U2HA 3GMRB 4WZ9A 3F2LA 3C60A 3ULAB 5E5RB 5BUPA 2XKNA 2VH5H 1DO5A 4L4TB 1A14H 5HYFA 1CG9B 3DMMD 4TVUA 4RWYH 3G6AA 1BAFH 2H45A 1GGCH 3V0FA 1S6NA 5I6XC 3HNSH 4PV8B 2NY1B 5C0RL 3RWDA 4QLWA 1OHZA 1XZ0A 5F97E 2OFQA 3C60B 1WWWX 4LLDA 4WI0B 5FYLH 3WO3B 4IHOA 3AQDA 4IBQA 2QPDB 2DQHL 5KSAA 1INDH 1KGYE 1Q0XL 1W0WB 3G6JA 5B7FA 2WCSA 1H0DA 3QJUB 5MP6H 3CXFA 5INDB 2PP9A 3IJSA 5EZLA 1MCWW 1PG7X 2ZOKA 5TJWK 2DLHA 4YMPA 1XCQB 2MKLC 4TXVB 4NLAA 1T7XA 1SDDB 2JKXA 1HWHB 4H88H 3MCLH 3S37X 4S1RH 2BVEA 1OW0A 2QSQA 3B7YA 4ICWA 5DTFB 4Q6YA 3W82A 4GUPA 2X1OA 4WUUB 1ZJAA 3MRLA 1G7MB 3ATEA 2WWMC 3R06A 5F9WB 1JRHI 3MRPA 2AEQH 4N68A 3Q8FA 5CUSH 1OPGL 1OD9A 2BVTA 2EEDA 5T3ZL 3L4YA 4AMKH 3U46B 5BRPA 1XCQA 3QUMH 4NQVB 4S10A 1NM9A 2CIKA 2J8UA 4Z7QF 2C9AA 3C2AH 2W38A 1WISA 4IIQC 4C4UA 5JZ7C 1D3CA 1J5DA 1ZMYA 3M45A 1F41A 3R8BB 1XSIA 2J1YA 5GRWA 3VFPB 2NY2C 5EULV 4KK8C 1ETB1 4KRPB 2FJFA 3MLVL 1QWNA 1J05A 2AF2A 4OVUA 2MOQA 2BY0A 5DRNA 3HZKA 3GC3A 3M46A 4HPYH 4PP2A 3T0WA 3SOBH 4AJVA 1M05B 4R26H 3LIZH 1EVTC 1JPGB 2R4RH 3MLZH 3TESA 5KAQF 3G5VA 5E4IA 3QUHA 2E7DA 1AVAA 1IBHA 4ZS6C 4NENB 4PB9L 3VFPA 4AY0A 1IEHA 2GSGB 2XU9A 5JHDD 2XHNA 1H3VA 4LIQH 2EAEA 5DMGD 3ZXAC 1Z5YD 4JHWH 5IW3A 3HC3L 5H2BA 1A25A 3GJFA 4MA3A 2L7JA 3BSGA 2JQAA 4P07A 1VHPA 4YK4B 4XB7A 3T4YA 1EHLL 3JV6A 3QG6A 4P5MB 1T3FA 4W4NA 4FNPA 1R33A 4UQDA 3KS0J 5C2BH 4J3WA 1W6LA 4PRIB 3G08B 2D8KA 3QNFA 4Z3FA 4Z7UB 4AENB 5IW6B 1VEPA 2IH3B 4KZ0A 3ZMNA 4BIKA 2A9AA 3DX9B 1HYSC 1JHTA 3O4LB 3NSXA 3PQYA 3FQYA 3BUDA 2AXHA 2BSRB 4R7NA 3L5JA 5CJOL 2UZPA 3CC5A 3ZTDC 3IMWA 4NQUA 5C0CA 4Q74A 5J1AB 3K4AA 5I18H 4XI5C 1SJHA 3TA4D 4G7QB 4JM2A 1TO5A 2XBTA 1UZGA 4EQ3A 1SOXA 2V17L 3GPSA 4FQIH 4U31A 2GPZA 3BZ4B 1JPSH 2XA3A 1AG6A 5HI4C 3ZDXE 5HDQH 2GFBA 2OMZA 3QNZB 5C6WH 2F53A 3KDPB 3S5YA 2A6JB 5T1MA 5IQ7L 1UGNA 5F44A 1E9QB 1YEDB 5TE7L 2LHAA 1ONQB 1NSNH 1VGEH 4LNRA 1BQHA 1LO4L 5B8CB 5D1QD 2PWHA 1RIHH 1GC1H 3MLVH 4HK3N 4MHHG 2BVQB 4M62L 3BCFA 2OL3L 3U1PA 1A1NB 3NIFB 4ZG1A 3G04B 3RGHA 1ORSB 3GFUA 4PJDA 3IDNA 4XMKL 2ZWLT 2ZOUA 1SHXA 3ATBA 5TD4A 2CHWA 3G5VB 2JKLA 3RZCC 1DSFH 5FHAL 3F65A 3UPRB 2EH7L 1HEZB 3FDWA 4NQDB 3MRJB 5C0EA 2YRPA 1TNMA 3H54A 1XO8A 1Q9OA 3EHBD 3SYQA 3WDHA 3VAEA 3ZDZE 1MQKH 1DO6A 4DKEH 3W37A 4APQB 1A6UL 1QZ1A 1TSHA 1E6OH 2AZUA 2MPVA 4BWWA 5AVWB 3A6CL 4ADJA 2ZKWA 2VH5L 5EOTA 4PWJA 2HLAA 3QC5X 1KGXA 3G9VA 1Q9OB 2M83A 3JTBA 3LPFA 3N55A 4KI5D 1G7HB 1KBGH 3AU1A 5KS9A 3I50H 3SJVB 2K78A 5DD6B 4C57C 1GKOA 4RIRA 1W0VB 3MGTB 3TYGH 2HRPH 3I2CL 3II1A 3FYEB 3WD5H 1H3GA 3KYAA 5FGBA 3ZKNC 1GL4B 4B7LA 1ETZA 4GMTH 4NQEA 3SKMB 4BFIA 3VJ6B 2Q20A 3SJVE 5B1AB 3BVWA 1HZHL 2XQYK 3CUPA 3K6DA 4QTHA 4QXGH 5AOKA 5ICXA 1EAPB 1QW8A 3VSUA 2CBMA 3ABZA 5E2JA 1G9MC 1PAMA 2X10A 5IY5B 5HI3D 1Z5LB 3D4YA 3ARBC 4JFDD 1S9VA 4GP8B 2R56H 3WSQH 2C1OA 3AREB 3VU1A 1JZEA 1BIIB 1JFQH 1OLLA 1NGZB 5A2KH 1T80A 4M6MH 4J2XA 1DDHA 1JXJA 1I8LA 3D85B 1LDPL 3OMAB 3GMPA 4XMLH 4UANA 2JJSC 1YMMD 5AVQB 1J1OH 3VFMA 2CHDA 4RZCA 4APQD 3AU1B 1X9UA 4GRMB 2BNRB 4LPWA 4BH8B 3JXAA 3VXUD 3GBDA 4TNEA 2Z31B 1II4E 4Y16B 2W8CA 3TBSA 2IV9A 1F1AA 4QHLA 4TNWK 5D7IB 5HGDA 4X7FC 2XA8H 2QHRL 5JXAL 3INOA 1OV8A 2ENPA 2F8IA 2LTQB 4P2QB 1FUNA 2I9LB 2PCPB 4XHJC 3LKPB 4ODWB 4ABVA 1J7VR 3WE1A 3RKPA 2V7NA 5TGBB 4LRNH 3U6XS 4E5XA 4MD5A 4X6DA 5GZOD 1DJYA 5D5MA 4N6QA 3IU4H 1JDCA 4LP8A 2DMCA 3BH8B 3VDBA 2LU3A 3DO7B 3AXIA 3SGEI 4H44C 4MJ2A 3J07A 3QUKB 2VERN 1PMYA 5EPMB 2OYLA 3BAKA 3SZ6A 1EXUA 5BZDA 4XNQA 4L4VD 3KYOB 1EHLH 3LNGA 4JY4A 4YSCA 3DJZA 5FYKE 1NFDE 1MUJB 3UYPB 1UT1A 4DP8X 4I5BB 1MCNA 2R1XA 3DIDA 2BNRA 3MU3A 3TM6A 4QCIA 4HBQA 3PNWB 3RVXC 2VL5B 4NO0A 2H0EA 4U3HA 5ACLA 3ASNB 1FAIL 5FAAA 1BCIA 2QKSA 1HINL 4IW4C 5JR1L 4KQ0A 1TETL 4OIFA 1G1YA 3L9BA 2R8SL 4Z7VE 5F88B 3W57A 4LAQL 3ULUE 4NN6C 5GGSY 4FRWA 2VKWA 4PRIE 3AS3A 2DQFB 4KBPA 5ITFA 1Z5LA 2XXCB 3AG4B 4MQXC 4Z7WE 1J18A 4R0LA 4QRPA 1XMWA 1DLHA 1IVTA 2KZWA 4PRPE 2ZCKH 3QWRD 2E9GA 1UB5A 2FNWA 1WQVT 2KYIA 3R19A 3IETA 4FHBD 3RTQC 4FFZL 4EUPG 2R83A 3K6NA 3MGOB 1OTTD 4HT1L 3HS9A 2YLHA 5E2WL 4B9YA 4F33B 4OCXL 5DD1H 3L1GA 3QUMB 2DLFH 3IFPB 1QWUA 1XH2A 1I1FA 4H7VA 4Z7VF 1OP3H 4FADA 1WFUA 3V6OA 2J21A 4F2EA 1R17A 5CBEB 4S1DC 1KMGA 1O0VA 2K6WA 5CILL 5JOPE 2QHLA 4F57L 2MFNA 4O00A 3O45B 3KEDA 2KBGA 4NUGL 3T0EE 2NQ3A 3OXSA 5L2JA 5GGVH 2X87A 3VVVA 4M7KH 4G9FA 1NAKH 4BK5A 3UIYA 5BRZB 4KRMB 3PHSA 2PW2B 1SYVA 1IAKA 3MFGB 3TONA 4Z7NE 5D93B 4CN4A 3L9EA 1OT2A 2XWBB 2G2RA 4JDVB 5E8OA 4O5LH 2KLTA 5DEGB 1L9NA 3LH2H 2AXWA 4HXAL 1OM3L 4ZFGH 3H0TA 1P5VA 1FJ1A 2UZXA 2EDLA 3QRGL 1NKGA 3NIDF 3PWPA 2XWTA 4JGUA 4J3BA 5J7CC 2O5YH 2WXNA 1B3JA 3PJNA 1JYNA 3LPPA 3Q0HA 3B6SB 3FUJA 3MV8A 3WL9A 5JNYA 4YDZA 2YZ8A 4BZ1H 4FMFA 1TTBA 3QHFH 2CGRH 2VXQL 2XQ0A 1JNJA 3L3HB 2BNQD 3LQZA 1FZMA 3P77B 4M43L 5CGYC 3MJ8A 3OAUL 3PXJA 4W9LC 2WKLA 4OUUA 1M71A 4WFFE 3IJ7A 1BVNT 4LVHC 3H7BB 1XGRA 4H5SA 2QQLH 4L8BB 2GCYA 3QZPA 1A6ZB 4PYHA 2MEJB 4POUB 4JO1H 4HPOH 5DSCA 1OCWL 4NAMA 1OTTC 4KDTC 5EUOE 5TE6L 2R0LL 4QKXB 1USQA 3F62A 4ZS7H 1BVOA 4KROB 4BM7A 4YK4C 2R2BB 4JHAH 3OWRA 5A2IH 1D5BB 3K5RA 4ZSOE 1BYNA 1NCCH 5DJCA 5CEXB 4BDVB 1J12A 3RWFB 3GRWA 3SCMA 4GO6B 2VM4A 3BN3B 4GEIA 3WKML 5I1LB 3LZRA 4AW4A 3P2TA 3B3IA 5E2UL 3V6OC 4JE0A 4XPGL 3IFOB 1BD2E 4YNYB 4TTDC 3U6RB 4XCFL 3RWHA 5EBMB 1OT4A 4XPFH 2VUKA 3VG9C 4HV8B 4U3SA 5I66A 5FWRA 1SF3A 3H7LA 1FPTH 3V6FB 1RHFA 4A7GA 4J8RB 3HZKB 2ZSWB 3IN0A 5KYUA 1H9DA 1GW0A 3LXAA 2FWOA 5HPOA 1HH9A 1GS6X 3P11L 4WVRA 3QZWG 3T8XA 1F4YH 1UURA 4XO8A 4MVBD 3H9SA 4ORGA 1L3WA 4JJ5A 3PABA 1RP9A 4ZMTA 2AMUA 5DEFB 3HS0C 1KIQB 1D5ZA 2ADGA 3L08A 4F80A 3CSBA 2G60L 2OM5A 4HSQA 1UWGH 2PW1B 5D1XB 2GK2A 2WWOA 1KYOJ 4N8UA 3MLUH 4U6YA 3C8KA 3OKDA 4FJZA 4GUQA 2DL9A 4RMBA 3KNBA 4G6ML 4N8VA 1MPAH 3CZEA 4AWJC 5T5FL 3KPRA 1MFUA 1XFPA 3E6FB 1N5YL 3QQNA 4FI8A 4Z7VA 1FFQA 1KIQA 2DQGH 2YPLE 3AS0A 5E1IA 3KW7A 1QR1B 3FQXA 1C16B 4LBEB 4M3KB 4V2CB 4M3JA 1FVDB 5EBMA 1UASA 1YPZF 1FRGH 1SJMA 3F84A 1JGUH 4QTFA 2VDQB 2GYSA 12E8L 4PJ8A 1GVIA 3RURA 2OTUA 4IBVA 2OJZL 2CUIA 2VLRA 4WNQA 3MA9H 3V10A 5TH2B 4FNSA 5JO5B 2AEQL 3FQXB 4PG9B 2Z35A 4JHBA 3H9SB 4MHHI 4APXA 5HSFA 4NQDD 1T2QH 3WFEH 1NDTA 1RZ7H 3RNQA 5JPNC 4NWTH 1T0MA 1LO4H 4PI0A 3QFDB 5DZNA 1BVLA 4BFNA 3G6JB 3ULSA 1E5YA 3K2IA 3ZTEA 3BZDA 2FEEI 3ENEA 5F96H 5D4JA 3VGHA 2R4SL 4RCAA 4ZQKB 5GZOC 4QRSB 4NZ8A 5I1JL 1AGDB 2RAMA 4IOSD 3HW7A 1H3UA 4LNRB 2ED9A 2G3ZA 2R69A 4R2GD 4EN3B 2B08A 4HULB 4NFBA 2P28B 4PWIA 5GISL 5C3LD 3S88L 5DS1A 5CJ5A 5IBUB 2BVQA 3FUDA 3DKHA 3FN0L 1ESOA 3HUJF 4RSVA 3VXOB 4BHUA 1ZSDB 3NIDB 3QAQA 5HYJB 2A74B 4HJIA 4C58B 3STLB 2ZSWA 2E4FA 4M7KL 5GRJL 2R2EB 2VLLA 4TULH 4AGLA 5L0QC 5AKVA 2P5WE 2WSDA 1SXAA 1P7BA 3JWDH 1HNFA 2YEZA 1ZLEA 1HQ4A 4G9FE 5IVOA 3WE6A 3BYTA 5DA0B 1X5GA 3H9HA 2IDCA 3BOVA 1AGFA 1S7VB 3FU3A 2OZ4L 2A74A 4Q6IA 4GO9A 1QACA 3FO1B 2IMMA 1J0ZA 5I6XB 5DZ9A 1HYRC 1KIUB 2AGJH 1HHIB 1RERA 2AK4D 1NBCA 2MOGA 2JIXD 5F9JA 4RBPH 1I53A 4Z5RB 1D9KA 4GQ9L 1XZ0B 4ZUUB 1M7DB 2EXWD 1VLXA 5I28A 4AI7A 4BRJA 2OYKA 4P23B 1H6FA 1BZEA 3CX5J 3Q13A 2R0LH 4A6YL 1LO2H 5ALCL 2MTPA 5IFHH 2Z31D 1KFAL 4KK5C 4L3CB 4QHNA 4QRPE 4TN9A 4C56A 4YDMA 4BEIA 3KBEA 2VXQA 1AANA 4HK3J 4P2QD 3F6IA 2ZPKL 3UG3A 1XAUA 2FJSA 3T6ZA 5KVDH 4G8IA 5LQBL 3AU0A 3ARVA 1BZ7A 4CMHB 4JFXB 2BH0A 4P5SA 5EU6A 1CE1L 1T6BX 2J1KA 4WTWA 1QHOA 1WIOA 3MLSH 1GIGL 1R0AL 1NGZA 3JYCA 3ETBF 3FT9A 5FR3A 2DOCA 2QGEA 3CHPA 5A2CA 3CC5B 1UWEH 3PPEA 3TNMB 5I8OL 2H26B 1JZHA 5EIVA 1WS8A 1LWHA 3B34A 3QUYA 3M7OA 1DBMH 2WO3B 4QXUH 2WQSA 3D8MA 4M1DL 1F58L 1FHGA 1YVLA 2AJVL 3QNXB 3IU4L 4P4RA 1Q72L 4EOWH 1O9ZA 3WEXA 2ZOKB 2UV3A 1NEUA 4CDGC 2Q2EB 4NENA 5KBLA 1QRNE 3BAWA 4HKJB 5DRZA 5AAMC 3WELA 3PFUA 3H2PA 5T3ZE 5K59E 3QCVH 1Q4NX 4MBRA 3GSNH 2DIAA 5HI5D 1A2YA 2LU7A 3OPUA 5HHOE 4Z3TA 3CLFL 2YPVH 1A4AA 4XNYL 1AP2B 3RFRA 2X3CA 4Q56A 3D5OF 2UY6A 3T4AB 4OR1A 3TV8A 4GI9A 2NLJB 4KK9C 5E51A 5T3XE 3GF8A 3IDNB 3QYMA 4G9DB 4D9RD 3LH9A 5HHOB 1S5IL 3QJRB 2B2XL 1NMBL 1K4CB 1VCAA 2AEOA 3PWLA 3EADA 3Q6FA 4XPAL 2CQVA 4XP4L 3VB8A 1J8HE 5AVYB 4PS8A 1ZA3A 2CMRH 4KUZL 4AJYV 4YUEH 4FNQA 1JOIA 2XUWA 1F4XH 1ZLDA 4TSBH 1DR9A 1JGIA 1UWXH 2V5YA 4WO0A 4N2EA 5IBTL 3MRQA 4OKDA 4EDWL 5C0JB 1LE5A 3HUJA 1IAIL 3EG9A 3T3PB 4GXUM 4QKTA 1CIUA 2Y07H 4TYUA 6CGTA 4KO7A 4QHKI 5GRUL 2X4SB 4YIQB 3K8KA 3WFDH 1BFOB 5IM7B 2FE0A 4PS4L 2B1OA 4XOAA 4YL9A 4OF7A 1NEZG 4HJ0C 4YGVB 5EO0A 3FFCB 1BJ8A 3QS3A 5DURD 1B0GA 4M6ML 2VDMB 1UA7A 5BW7A 1JGDB 1GR7A 5KVEE 2CUHA 4CN6A 4LU5L 3MJ7B 4AZ8B 3VXNB 4NSKB 3EO1B 1I3RA 4F8OA 2BSSA 3WJMB 4QRFA 1YLBB 5LGJA 4ZPTB 4PSRA 3RX8A 2DWEA 3OX8A 4K7PY 4KKLD 4PJ7F 1KEMH 2P43B 3OLIA 4H0GA 2IGLA 3C09B 3ME0A 5DJXA 4PJXE 2LU4A 5FO9B 3ZE1F 3ULVL 2X6BA 3A4DA 4NKDA 1JWMA 3ZBMA 3M6DA 4JFFA 4KJPD 1BVKB 4UDTA 3C09C 1CIDA 3OAWA 4IJ3C 3APDA 4NP9A 4YPGA 4G5AA 4J39A 4WNSA 4HUNB 3KS0H 3OX8B 4NUJA 1DQLH 2IEPA 3H9YA 2ZTBA 1Z9SB 4WHTB 4PMEA 4PRBB 2HT2C 5A16B 2PO6A 1WBZA 2J8UE 2Y7QA 4KAQH 4ZFZB 1TZIB 5ABDE 4Z3HA 4NQCE 4N90E 3UOAB 2ZCHL 2D0GA 4GKZA 1IMHC 5HPMA 3DX2A 1AIFB 4KNTA 3V4VA 1UACL 5DEGA 4DNLA 4LARL 4O9HH 1CE6B 4WGWB 3RGBA 3QZNA 4AJWA 2WJ7A 4FI7A 2J1WA 2PO6B 3O81A 3MRRA 3QDGE 1NLDH 1PDKA 3LKPA 1YQVL 1DP0A 2G3NA 4L0PB 4I77L 5H8DA 1F2XK 3TZVD 1L7TL 5KSAC 2VDRH 2WUBH 4B3VA 2E9BA 3VFSA 3V4VB 4BXSV 1EHAA 1YNKL 4ZYKB 2LLLA 4QO1A 1NCDH 4UT6H 5IIEA 1CJYA 1PD6A 3T5WA 3ZHKA 5JIPA 2IADB 5EH1A 3ZSSA 5CCHE 2BS9A 5C08D 1IAIM 4XP6L 3TASA 1HEZA 1M53A 2WZPA 1Z9SA 2CO4A 1OAYH 3LN9A 5I1EL 3C60C 3FC8A 3TPUB 2FWLB 3QO0A 2NY2D 5AOMA 2Q76A 5KSBA 4BZ1A 1H5BC 1UKSA 3MRCB 4ALAC 3D51A 5F7NC 4EDXA 2LAAA 1M6OB 4JO5A 3AJ7A 4KOBA 2BSEA 5ESAB 3RAJH 2A73A 3OJDA 3N1QC 1CB4A 3EDFA 1U8JA 4H4NA 1AO7D 3IXAB 3ZE2E 5C2BL 1R75A 1TZ8A 4EXKA 4F92B 4BQ8A 5FA3A 1RZGB 5D1XD 1XSKA 4KX8A 3HG4A 5ETUB 1I8UA 1T20B 2WBJD 3IKCA 4ES8A 4UI2A 1UA6L 1BFVH 3QRLA 3RU8H 1IKOP 1CLVA 2H6PA 2EYSB 1OT1A 1IGYA 1SOSA 3IM1A 4HH8A 1A3QA 3BGMB 5HD8C 1RUMH 1TIUA 2ALWA 2DZEA 3OJ2C 1IKNA 2FBJL 4L3EE 3LNEA 3DX0A 4YDLC 3T0XA 4AT6A 3BRDA 2HLAB 3C5ZB 3H42L 3GZQA 1FC2D 1TZIA 3DGDA 3VD1A 5JIKA 3T1WA 4OGXH 2O1AA 4W9FC 4X0NA 3Q9QA 4N8CH 3DJSA 5F1NA 1T66D 5EUKA 5C0AB 4RDQF 2ZJSL 3FT4A 4BCZA 2VGLM 3QDAA 4DJMA 1ZT1B 4F27A 4RFOH 2ADGB 5DO2C 4PIBA 5JYMA 1W72H 1WCBA 1KCLA 2BZDA 1RU9L 4UZSA 5T1DL 2COQA 1NUGA 2IQ9L 3VXSE 5IG7A 4I0PC 4LDLB 5F1NB 2GJJA 2QTEA 3C08H 1RJZA 5E2VH 5E5MB 4MA7L 4CGUB 4BGDA 1PQZA 1HILA 3AT9A 2FX7L 2DLEA 3QI9C 1PLBA 5FM4A 2VC2L 1XGZA 4J3TA 3MA9L 1PG7H 1NDGB 3O8XA 1P53A 4HXBH 2UUDK 5LCVH 2P52A 1NSNL 5F3BB 3GSUA 3CFBA 5DMYA 1R3JB 3LIUA 3WNJA 4KTEH 4QAWA 4BE6A 3KH4A 4M4RA 4RA3A 4OJYA 4QRUA 2BMKB 3N50A 1M6OA 4M5ZL 3FB5A 1CGWA 4NOBA 2X41A 4YX2H 1PTZA 4K2UL 1AS7A 3QAZC 3GSXB 3V9EA 4EN3C 5I6NA 4D8PA 1HN1A 2UZIH 1R3IH 4U49A 3RWCB 3VH8A 1D9KD 1A9VA 5EZJB 2EZ0C 4PEEA 1CFTA 3ARPA 1K2DA 1U8QB 1ZVNA 4NIKB 1G5GA 4XPHH 3L3OC 2I07A 5D4IA 5T1KA 2FX8L 3UEQA 1Z32X 3EH2A 1TVDA 1NCNA 1FGVL 1O7DE 5GRYA 3KHOA 1AGBA 2WWNA 2NX5E 4BYHA 1MFEL 2XVBA 1XCWA 2YS4A 1WHOA 5JIQA 1XB6A 3CN3A 3MUGB 5ACZA 4AH2B 2Y3NA 4OY9A 3O2VL 4LPCA 1MEXL 4AEHL 2C9VA 2C7UA 2GTZB 3TJHD 4WF7A 5FB8B 2R27A 5ITFB 3X11A 4YDJB 5AVVB 3P2DA 4DWHA 1KENH 5FCSH 3E1ZA 1DLHB 4G6JL 1G7PB 4L1TA 2WPGA 3GBEA 1UOLA 4Y88A 3WIHH 3FB5B 1AD9A 2G60H 5AB2A 5B3SB 1WK0A 2J6EH 4N5ED 1MCIA 1U8KB 2ENQA 4FE9A 3U36B 5L88L 1G7LA 2PWEA 4EJ1C 5EF3A 3IFOA 2VJXA 3JT0A 1R3LB 1L7TH 2WNKA 4RBPK 2AZAA 2BVPB 4HMEA 1MCDA 4R5TA 4Y5YB 2VKXA 2QGBA 5H4YA 3LMJL 1JVLA 4JPVH 4AV4A 2F8VA 3CVIL 3UERA 5FUCE 1F4WL 1SLVA 4Z7NB 3IF1A 2ADFL 4MAYB 1AD0B 4WSGA 2F5BL 3B9KC 2DKSA 3W9EB 2FDBP