4NLHA

Skich domain of human tax1bp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
115
structure length
115
Chain Sequence
GPSSPAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SKICH domain of human TAX1BP1
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Tax1-binding protein 1
total genus 15
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17751 SKICH SKICH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4nlhA00
2LFEA 3VVVA 4NLHA 3VVWA
chains in the Genus database with same CATH superfamily
3EXJA 1U8OB 2VDKB 1TZGL 3EJYD 2R27A 3CSPA 4X4MA 4AVKA 3QUML 3B2UC 5DK0B 4N85A 4Y8DC 3EGDB 1KXHA 4KPHH 3CE1A 5GGVL 2HG5B 3AT0A 4M5ZH 4UM8A 5I1EH 2F19H 2F7PA 4ZSOB 4XN4A 2GK2A 1IAKA 2K8MA 4P2AA 1RZ7H 4L1LA 5JDSA 4HCFA 5EOTA 3GMNB 2DIAA 1J9QA 3PHOB 4DEPB 4R4NC 3FQWB 3GNMH 2EUXA 3ES6B 4JPKL 2CCLA 2XU9A 3VFTB 4FQ2H 4ZYKA 1NAMH 2NX5A 4WCYH 2HCZX 4YE4H 5C6WH 3QIWC 5I1CL 1IX2A 2I60H 1I75A 5C0DB 2AJXL 4OCWL 3S5LB 4P46D 1OSYA 1XSOA 3BSZH 4ZFOL 2XKUA 1ITBB 3KGTA 4R2GB 4P9HL 5E99L 4H8WC 1EEZA 3EJUA 4UT7H 1S5HB 4BUQA 3B6SA 3EOYG 4NQCE 4XAKD 1LE9B 3EYVA 3WIFA 2WBJA 5EDSA 4IHOA 3WLWC 2JKJA 2DL2A 1BD2B 3JQOB 4HIEB 5AVRB 1WJ3A 3FCBA 1Z0NA 4KVNH 5IB5A 1ZEAL 1J8HB 3IU3A 3TX4A 5HGDA 5HJBA 3BFWA 3QORD 2R51A 4R96B 1LO3L 2ZICA 4PWJA 3RFRA 3MUZ1 2FSEB 1YCSA 2ZD0A 3VD7A 3NZ8B 2AK4D 3K2MC 2HX8A 2BSCA 4OIBA 1DN2A 1FZKB 4HZLA 4DVBA 2YAHA 1O9ZA 1WFIA 1JCVA 1NCBH 1UCBL 3ZDYE 1DP0A 3N2JA 3WS6A 1ACYL 1UKTA 2G75A 3ARRA 1WHPA 4LVEA 1KB5A 3KPMB 5DJ0A 2AW2A 1BYNA 4JRXA 1P7QD 3CFIC 3CSTA 4PRDA 4AIXA 4U2ZA 3LN4A 4ONHA 4FQLH 4UZSA 1A5FL 3O8XC 4MXWH 4DKEH 3AJ7A 3S97C 1CBJA 1MCOH 2DH3A 2EACA 4OGQC 3ME0B 1YUHB 3WAKA 4WTZG 1XCTA 3DMMA 4ANWA 4PVBA 3VRLF 3V8CA 4Z7OB 3AT8A 1XCTB 3DMMB 3HC0B 2MCMA 3UTTA 3MVSA 1M3IA 1FN4A 3Q5YA 2BZDA 4UNIA 5D9SA 3DO7A 2R1WA 3AUWB 5E4EC 1CZ8H 2BHZA 3I6GA 3QC5X 4E9TA 1M7IA 2LAAA 3RWIB 1RJYA 1X5KA 3Q43A 2GAZA 5KYUB 1F90H 3DK2A 1BZ7A 4PLOB 2Z8VC 3KYAA 2VLKB 3CIAA 2DQJL 1AQDB 1TT6A 2BVYA 2ZX5A 2DQDL 2X6UA 3TJPA 2BNQE 5EU6E 1A1MB 4UTAA 1G43A 4AQ8A 2AXJA 2DOCA 2GC7C 4LEXL 3HNTH 3FMGH 2GUYA 3DROA 4HUWB 1X5LA 4KKBD 3PG2A 3O81A 3KBFA 3GDCA 4DN4L 1UADC 4PCYA 1IBZA 2P5WE 5AG8A 4KUZL 3NPSB 3IJEB 2ZKHL 2G60L 5IZ7A 4QAWA 3BUBA 1WUNT 5FIEA 5LWYH 4BBWA 4G7SB 1K8DB 3I02A 3IDIB 4Y7MA 5EOCH 3L4CA 1V3KA 5JW4Q 2JK5B 4U6XB 3HBGA 4L8CA 1AO7E 1C5CL 3SE3C 3LZFL 3APDA 4ZBJA 1G6RA 1JNHA 3VQLA 2F74A 3ZDXF 1MI5B 1TTAA 1T6WA 1RJLB 3I3BA 4PJGB 5FOBB 1FFQA 5IMMA 4PP1D 3O3DB 5E8NB 1FNSH 2RMNA 5I2IA 5E00B 1W72B 4Y2DB 4XNYH 3FH8A 4MJIB 2YMXL 1MJ7H 3L6FA 3TPUA 4Q58C 3ELQA 3CH1B 5GJTL 5E9DD 3RVVD 3BPOC 5JPMB 4KRMB 2XA8H 5J12C 1JRHL 1S7SB 3CH1A 3QDJB 4PP2B 1LO5B 2ZOKB 1FLRH 5KG9A 5JPMA 1CXHA 1YEHH 4KZEH 2B5IC 2H3NA 5K9KA 4L18A 1UM5H 3LJ3A 1I7RA 5D1XB 4ENEC 1B2WH 2QSVA 5EOCJ 1T4KB 4ODHH 1SJHA 3FCTA 1RMFL 4R7VA 4XB3A 3QJFA 4KAQL 1U3HC 4TUKH 5FYLD 3UDWC 3HG1D 3MCLL 4ZTPL 2WVSA 5D5MF 3GEFA 3X1GA 4UINL 2EH8H 3G6AA 2L8AA 5E51A 1NUGA 2AEWA 1NCDL 5TH2B 4F91B 1N3NB 3RFZA 1DVYA 1R17A 5FO7B 2BRQA 2X4OA 2WB7A 4OFYA 4PJ5D 3U9PH 2E56A 4P99A 5JIHA 2DV6A 1NPNA 5E8OB 1Y18B 3AREC 4JFSA 5C0BD 15C8L 5DFTA 4N2NA 4AVIA 4Y16C 2C1OB 2ISDA 3SKNB 4AKPA 2D4FA 2EXTA 4M56A 1HXYB 1FF5A 2YD6A 3O6LH 1WD9A 2COQA 2AHIA 5DEJA 1T1YA 2XNAA 2XHNA 4LE8A 4YIQA 3OD3A 4F2MA 2QV2A 5C07E 1BVLB 4YJZL 4BH8B 1EGJL 1PD0A 5A1AA 2MNJB 3C5JA 5H94B 4X4ZA 3WBDA 1PZSA 3GRGA 4AQZA 5KVFE 1YYML 3H3KA 2X05A 2F1AA 1BFSA 4XVUC 1BBDL 1UOVA 4NBYB 4GSDL 2P7TB 4X0KB 4HMEA 1L7TL 1IGMH 4JUTA 2PR9A 5JPNB 4FI7A 3ULVH 4FQPA 1SDAB 4S10A 1K4DB 4ZTEA 5F88A 5LAXA 4WWKB 4E9WA 3OVUB 2F5AH 3LHPH 2X28A 4NNYA 4YDKL 5EBWB 2YKKA 1CTNA 2BSRA 1QUNB 3QUKB 2L0DA 5I5IA 4XO3A 1D7BA 3SPVB 3UAJC 1MCDA 2NCMA 5C09D 5JDJA 4Y9CA 3VO0A 2YPLA 3O8XA 4QRPA 4WHYH 1NBYB 3TVMD 2YBRA 5DS8A 1PEZA 3VXSB 1JZFA 4X8CA 2ICWA 5BRZB 2I32A 3L9YA 5D6DC 3UTSE 2BWIA 4C54A 2IBZY 1TU2B 1W0WA 2VE6A 1BFOB 3OZ9L 3WNOA 4P3CL 5FLUA 3FYEB 4EIZC 3GLZA 4JMNA 4AYEC 2XJLA 4BQ6A 4X42A 2DLEA 5I71B 3WFHB 1JE6A 1X5ZA 3S36X 5E6ID 2CLRB 4XC1L 5BMFL 1AKJD 5DSCA 5D5MA 2ZYRA 4YPGA 5E1AB 3PXLA 4UANA 3MRGB 5TFSH 1KEMH 1UGKA 3AGVA 1OGTB 1I85C 2QFRA 2WUBL 1MRFH 4M29A 5F7YC 2NXZC 2WPGA 3GSNL 4YZWA 5A2IH 2L4OA 5D6DA 3NJHA 5MENA 1BYPA 1UM4L 2HT2D 4OIAA 4B5EA 1TQVA 2X09A 4P23A 4HUXA 2E7LC 4NO2A 3QQ3B 4QO1A 3ZE1F 4G8GD 4F24A 3U2JA 1F3RB 3QDMB 1T03H 5AW7B 1E9QA 3SYPA 3QQ9D 3QFJB 3CFTA 3OX8B 4QWWC 5D1QB 3AVEA 1WHOA 3S96B 3T2LA 3C6EA 1U3HA 4FYRA 3N43B 1IM3A 4LPUA 3BWZA 3KGUA 1CDUA 2UWEE 3QUMA 4HJGB 2H9GA 1U3HB 4MX7A 3MJGX 3V6OA 3D85A 2DZEA 4Z77A 3VYPA 5MEOB 2F8IA 4KHXH 3OQRA 4GQRA 4JFFE 1AMXA 2Z1PA 1X5IA 4RZCB 1RUML 4RDQF 4NUJB 3U7YH 4L3EB 3TV8A 4PY7B 1XGQB 2EABA 1ECZA 4EUPG 5GXBB 2H1LM 4IGBD 4WO4C 4PJCA 4NUJA 2XWCA 1AP2A 1YNTF 2BVEA 4OZHF 1J9TA 1TETL 5TDPA 4PM1A 3MTRA 4R7DB 1S3KH 2HKHH 2IAAC 4WEEA 3EDJA 4XP6L 4Q8BA 3MJ6A 5IIEB 4XNAA 3SO3B 1R0AH 2X6AA 3TEXA 5C0AE 5JHLH 4OQ1A 5EN3A 1FVDB 2FIRT 3QZOA 1JZ5A 5CP3H 2DQIH 3ESNA 3M1OA 5BVJA 1CUOA 2ICEC 3FSOA 2DLHA 4ETQB 4IBYA 2EYTA 1D5ZA 1ESOA 3ZKXB 4X6FA 1Z7JA 5JOFB 3QG7H 4GB9A 3ENEA 1R5WA 4DIXA 1TTUA 3IMVA 3V0EA 1R5WB 1HS6A 2J72A 2RIKA 3O2VH 4KMTL 2FB4H 4GUQA 4HUCA 4MNHA 3NK3A 2UYLA 1BYOA 4G83A 3L4VA 5E8EB 3V5HA 3N42F 3PDDA 2QDVA 1AGEB 5FGBC 4KI5F 3C8HA 4MZIA 2ZF8A 4ZXBC 2XRAL 3RDJA 3MJ8A 3ZYIA 5I1AB 4LRIA 5F8QC 2QTVA 3CFUA 1W0YT 4F2FA 1RIVL 3WTWA 2O6CA 3JWNH 4QRFA 1I1AB 1UT2A 5CBEB 3QZWA 4IOFD 4ONFL 2NY6D 1PSKL 3E7JA 4IOFC 5GRYA 4FG0A 4F58L 4OZ4B 3QJSB 3WFBH 1W6WA 4BSVA 3MLXL 4GQZA 4YDLB 2X6MA 4I18B 5C6TL 2DD8L 1JGDA 1R3LB 3APMA 5KSAB 2O6DA 4PJIA 4RBPK 1KBGH 4MZRA 1N8ZB 1YMMA 3CN1A 4WHTA 5ISZA 3T6ZA 2JB5H 3BKCH 2Z34A 3FPYA 3QUXD 5T1KD 1OP9A 3W39B 1SDYA 1IGFL 4N68A 3WELA 3C09C 4LESA 3V7AE 3ISWA 1HQ4B 4LSPL 2XLLA 1Y0LB 1OWWA 5DK3A 3TN0D 5IEHB 1XXDC 3M07A 3BDXA 1QYGH 1E4KA 1KCUL 4LCUA 2OK0L 3K6NA 3EOBB 1NCWH 4PGCA 1VEMA 3PHQA 4LVOB 3OXSA 2EYRB 3RPBA 1BQRA 1ZHLA 4ZAKB 5DTFA 1EEYA 1RFDL 3PHQB 4O51A 3TP4A 5JMRA 2QQNH 2GSIA 4GW5A 5ACZB 2FHBA 3F7YB 3N1FC 3O8XD 3P30H 4NAJA 4QRPD 4E9QA 4PYHA 1Y6MR 4GAAA 2N1KA 1SUHA 4PD4K 4QLRA 1FE8H 4QRRD 1KXTA 5L7XL 3IN2A 2ED8A 1G7IB 1K6QL 2AC0A 1CTMA 2XY1A 3CVHH 1BVKB 2YBGA 4MTMA 4UWQB 4PLJD 5D96B 1CE6B 4D3CH 6FABL 5IHZB 1BXUA 3WNJA 1RUPH 5B3JF 1RURH 2E7BA 1PNDA 1RVFH 1HVXA 4U1SA 1FI8C 2CDFA 4GSQA 3TU6A 4HK3N 1R24A 2W9EL 4GAJL 4K7PL 5IQMA 4X83A 1OAXL 4ZDHB 4AQEA 3L4UA 3OWRA 5AVZB 4AEHL 3FUIA 5L6YH 3ULVC 1NGWA 3C5ZC 2EIZA 5T1JA 3Q3GA 1NGWB 3EH5B 4P4RB 4DCQB 5K9OB 2BERA 5DQDH 2HT4D 1ID5I 3DX8B 3ZTEA 1P6AB 3DRTA 5D7IB 4MNGE 3MUGB 1L9SA 2ITDA 4OZGE 5L4JA 1FFTB 2BWQA 3HG1A 3L3IA 4M8QB 4FFZL 3KL3A 1PPIA 2LQRA 1W8OA 3P3SA 4XVTL 3A21A 5DZPA 1AVAA 1JWUB 4KKAD 4N2AA 1G7MA 1ZHBA 3JTTB 5CGYC 2C7UA 4I5BB 5H8DA 3GIZL 1VKXA 4PMEA 5KN5B 2CA4A 2G2NA 3TCTA 4XN7A 5L9DL 1PEWA 4KV5F 4M00A 4PHXA 3BZEA 4KK6D 3DBSA 2R2BA 5CP7B 1N0XL 4G9DA 5C2UB 1UQSB 1YNLL 2HVJB 1MVUA 1JGEB 1OAUH 1INDH 1TCRA 1MFNA 4XCCH 2O72A 2XI9A 2BMKB 2HRGA 4MAYC 5L9DH 4YHPA 3L5WB 4JRYD 1U6AH 4N5EC 4NHUB 1JF6A 4AE0A 5MHSD 5T5NF 4RGMB 5F7MC 4BGLA 4BFGA 3Q05A 3CZSA 2NZ9D 2BY3A 4OJCA 3IMSA 4P3DB 4AQ1C 1ZLSL 2XIIA 5E8PA 4G80A 4XVTH 3NTCH 3RU8L 2ZIDA 4QJ5B 4AQOA 4YN3A 3DK0A 4FFZH 3DRQB 4HWBA 5MEQB 5I73B 1K2DA 1OAKH 4I9WD 3LN5B 1UVQA 1MCWM 4YDIL 2IXQA 3AAZB 4ZFGH 4NLAA 1P1VA 1CBVL 1CL7I 2W9DL 5I17B 2E4FA 5ERWB 1JS4A 3MTXA 4P9ML 2VR6A 1OOWA 1LMIA 3NEOA 3TCLA 2A99A 3M8OH 4HSAC 2HN7B 1TQCC 2W9EH 4GAJH 3IDGA 1OTSD 3K2UH 3AY2A 2XPZA 4LCYB 4I1PA 2Z8RA 2OR8A 3O2WL 3RKDD 3G6DL 3FK3A 4FAAB 1JZHA 1K4CB 1BBJB 3SGJC 1UJ3B 3OG4B 4F7PB 1XF3A 1RHHA 3ILQD 2ITCB 2VQ4A 3LRMA 4WY7H 5DD0L 5KBLA 3L9EA 5BUPA 4TL4A 1F3DJ 2PR4H 3KPRE 3ZQXA 3GSVA 4EXPX 4F57H 3ABKB 3K5SA 3O2DA 1RPUA 1KCWA 1BDYA 2WQRA 3UG5A 1ADWA 2OTUA 4PREB 4OCYL 1XZ0B 3RL1B 2EVFA 1SJMA 5HHNA 3MLZL 4J12A 1KFAL 2ZXGA 3ZBMA 2H1PH 3IPFA 5ALBH 5JOPE 5EF2A 3CIQA 3RL1A 2VSCA 1HNYA 4BA8A 3RGHA 1E9OA 1WWWX 2ITFA 1L9RA 3QORC 3HRZC 1IGJA 3U36B 5KUMA 1K3IA 1HYRC 3O9WD 3BSGA 3QNXB 5IM7A 3KPOA 4IRSD 1S2EA 4JAMB 1FGNL 3ZMEA 5IJCC 4JFPA 2LU3A 1U33A 4NCC2 4QYOB 2Q2LA 2QR0A 4Y8AA 3U83A 2GJPA 4HPOL 3FCSB 4H8UA 1RZJC 4IMKC 1CD1A 1HHKB 3C60D 3O4LB 4ABQA 5JIDA 4AJVA 4YDNA 2R9HD 2VISA 3GRWH 4FCAA 1EXGA 4NZTL 5E6SB 4CC1A 4GNKB 2Z0UA 2DD8H 5C0CA 3LRSB 3KPSE 4RRPA 3LH2L 2NXZD 5CMAB 2P24B 2VH5H 1DSFH 4ONFH 4MXVE 3RVWC 2BDNH 3LRKA 4W9HC 5I23A 1OGAB 3ASOB 3MX0B 3SDXB 3V0DA 1PZUB 2NY5L 5FHBL 3X3GL 5ADPL 4YS4A 4OZGF 5AWNH 2WLKA 1ETB1 3HKFA 4H8HA 5ICYB 3SQOL 1HE7A 3O9WC 3PDOA 2GEQA 2X4PA 4HC1A 3IETB 3B37A 4WJ5A 1P4BL 4TNGA 1VERA 3PP3K 4X4YB 1U95B 2OI9B 3IETA 5I0WA 4WJ5B 3E6HA 3IJYB 2Q87A 4TL5A 3EO9H 4HKZA 1XGYH 1J5OL 1EDYA 1F2XK 4OCSH 2X3BA 2IAMB 2Y6SC 4XH2A 5CUSH 5E7BA 2WXIA 3C60C 2VRAA 4PRIA 3STBA 1RZ8A 5I16A 3U4AA 2VDRH 1HH6B 3B3IB 3STLB 1E65A 4AEFA 4W6WB 1FWXA 1NGZA 2FEEL 2VB5A 3IDYB 3TWCL 4XODA 3GMNA 3CK0L 5FYKE 2GBAA 3T65B 3GSWB 1J12A 2YEVB 3KNBA 3I6LD 4QXTB 4UYPA 2HLFD 2A6KB 4EN3A 2FX8L 1DUYA 3M17A 4UOW1 5F1KC 3KWVA 2WZ0A 3EYUH 1HHHB 4Y4KA 3P2DA 1S7WB 1LDSA 2WGXA 5L4FA 2RA1A 5L4IA 1XB6A 1CG9A 1PZ5A 4L9LC 4UB0L 5TE7L 2RHEA 1WG3A 3ARGB 4X7TB 5IB1A 5C0FB 4FFYA 2NT1A 5K59E 4J5VA 5IG7A 2BY0A 4ZUUA 4KK9D 3DDFA 4MMYB 3WU1A 4HJUA 1R0AL 3S5LA 3DXAB 4TSBH 1LE9A 2H26B 4D8OA 1RUAL 1DQMH 4FZEH 5L8JB 2E7CA 3T3ME 1TETH 1B6UA 1GL4B 5A3ID 5CZKA 3PV6A 5EUOE 1KULA 4YK4C 1UH2A 2R29A 2JIXA 4R96A 4LSQL 1DBMH 3UG4A 1A3RL 5I1LA 3ZTCC 1WRFA 4DVRH 1J0YA 1FVEA 1U9KA 3OR6A 3MKKA 4UTBH 4YL4A 3A6CL 3RWHA 4K2UL 1JV5A 1MFMA 5DFWH 2X41A 4DKAA 4AVHA 1YSOA 2A1WL 3DSFL 2ZX9A 2XN9D 3R4DA 1NCUA 5TD4A 2P3YA 2R1YA 3HNVH 4FA7B 1FG2B 1PY4A 5EUKA 2G3NA 2EE0A 1T2QH 4X7CC 3IN0A 2JQAA 3INUH 4U1KA 1BM3L 1BQLH 1F41A 3KH4A 1A7PL 3D4CA 3RB5A 2X4RB 5D7KD 3GD1C 5AKVA 4ZPVB 3VXUA 2A77L 1Q1JL 3DGGB 3WD5H 2Y4SA 4KQ4H 4HALA 3AY4A 3VXUB 1OAZH 3OKOB 5FO2A 3MRLA 2DWDA 5IQNA 3RX7A 2YD2A 4NDMB 1BCIA 3OXRA 2VQ1B 3VD1A 4WI7A 4ZMLA 5IKCA 4DP7X 3R06A 3H54A 4HIEA 5D9SB 1KEML 1FRGL 2CSPA 3VXOA 1I9EA 5F7BA 2WINA 2QQKL 4H88L 3FB7A 4URTB 5LNDA 4NQDB 1WZMA 2C9XA 5CZXD 3SJVA 4ZG1A 4MAZA 7CGTA 4NQEE 1I8IA 4KU1A 4OJFH 2FWLB 1FNHA 2IV9A 4WK0B 3LVEA 2OJEA 1SBSL 1YJDH 2GI0A 5FECB 4QRRA 4NIKB 2HG0A 1I85A 4ODXB 4DQOL 3TO4B 2IPUG 3LTVA 2GW5A 2J88L 4KRPC 4RISH 5D7LB 3TO4A 4JFED 3CDZB 4R97C 5T1KA 2IANB 4A38A 1UZ8A 4HEPA 1WS8A 3ZUCA 4PRDB 5BW7A 2VL4A 2X0WA 3LKQB 3VMOA 1SMOA 1JZ2A 1SVCP 4Y2OA 4BFKA 1NMCB 3QJOA 2EO7A 5MEPB 1G7LB 4M7ZC 5JHDA 4ZMAT 3NZSA 3K6SA 4FDWA 2Y7NA 1BWMA 3DVNB 4I3GA 1MFCL 4E5XA 1YEGH 2UXVA 3H56A 4KO5A 4W6YB 4WSJA 5D1ZB 5IVZA 1SXCA 3B5GA 1E4HA 1RZFL 1FVCB 3ZL4H 5SWZD 1G6RL 2IH3B 2UWEF 1FL3A 3MRFA 1QWNA 4ALAL 1CFSB 3BUIA 4NPYA 4WTQA 4D0BA 4ZMQA 4QIRA 4ZNCD 5E23A 4J3WA 3PV7A 1TZHB 1A1MA 2HP4A 3BI9X 4FMKA 4HC1H 4A7SA 4OD3L 2O61B 4NRYB 2OXGA 3L95B 1S6NA 3QG6A 3ZE1E 4C56E 1QWHA 2O61A 4IIQA 3P3TA 4EDXB 1H3UA 4PYGA 3ZPDA 1D5BB 3SDDA 1KUMA 1L6XA 4UQ2B 4KROB 2A74A 3QUZC 1M6UA 1RIUH 4JM2C 3IGAB 4C47A 3LH9A 4AIZB 1GAFL 2XTJB 2HG5A 3II2A 3MRMA 3RDTC 5HVHC 4PGZA 3N0PB 2ICEA 5F0PB 2DYPA 1LE5B 1OAJA 2OZ4L 2CBOA 2UY7A 4X2UA 2J8OA 3FUJA 1EX0A 5HD8C 4CADB 3KWWB 2UY7B 1FH2A 2Z31B 4ZMPA 4RLDA 1LHZA 1ZVHA 1UD6A 2JXMB 3SD2A 5BS0A 1IO4C 4Y5YB 5HYQB 4AJWA 2GJZB 3QW9A 4NN7C 3TF7C 4M3JA 4WFFD 1WCBA 5D1QE 3CN0A 1B9KA 4OTXH 5DFAA 2XBTA 3CSGA 3ULUL 2DYPD 3T2NL 3LQMA 2V3FA 2N4IA 1CGSH 2PCPA 1UM5L 2R15A 4AM0A 4NUQA 2RBLA 3FT4B 2ED7A 1AHKA 2TRYA 4WW1B 4LCWD 2XBZA 4NKOA 3UTZA 3GQFA 1D3CA 3QQ4A 4Y19D 1HNFA 3SHSA 3GMRB 3VDBA 4GO6B 3INUL 1RV6X 4G71B 5EB9A 4FHKA 1E50A 1T2QL 1DQLL 1UB5B 3GZOA 5H94A 2VN7A 1PIGA 2EEXA 4B41A 1G7QA 1MIMH 3FUEA 1I7RB 5KVEE 2XWXA 3ZX1A 5DD6B 2A1WH 1M53A 1T3FA 3GUTA 3LEVH 4JFXA 1BAFL 5DZ9A 2FJGA 1AHWB 2A6JA 1BMGA 2AV7A 2Y23A 4GRLD 2P48B 5DRWA 3QNFA 2KL6A 5EZLA 2F61A 1B0IA 4IKNA 1JPSL 1A3RH 1GHFL 1NFDA 1K4DA 1R3KA 3II3A 4P5MB 4NN6B 2G75B 3SGDI 1Q9WB 3OLIA 3AABA 5EOCL 3FU6A 2PCFA 1F56A 2YQBA 4ABWA 2XQYA 1Q9WA 1OARH 2VLRA 3RWJA 2NX5E 3ELAT 3IS0X 4PJDE 5F88B 5LAXB 5BUGA 1CMOA 2PPEA 3LKSB 3LN4B 4AW4A 2G60H 2X0VA 3ZQ9A 3BP6A 3LV3A 5HJ3A 3O11A 3VI3A 1I1FA 4LCIH 1P4LA 2EVGA 2A83A 2N7BA 1DANU 3S3DB 5AAMA 1DFXA 2CKNA 3F58H 3UJTH 4JFOB 4UB0H 5TE7H 3EXLA 3KJ6L 3I75A 3RL2B 3BIBX 1F00I 4NHCL 3AXLB 3MRBA 3NPZB 4H13C 1XBDA 3EYFB 4EI5C 2EXYD 5I8CB 4HOMA 5A2AA 3TFKD 1AIZA 4K9EC 4PJDF 1P7HL 2IALB 1WS7A 1EFXD 3BPNB 3PABA 2HMIC 1E4XI 1KCVH 3GS0A 4NQEB 4OLWL 4EMZA 3AQZA 2BNRA 5EDXA 3P77B 4JRYE 2C1PA 1GSMA 2E7DA 3N50A 3KLSA 2CHXA 3ZDYB 1P4IH 4KMLB 1DVUA 4EPSA 4LO9A 1CZ8L 1AAJA 3SJVD 2EE3A 3HMWL 1GS7A 3WFHA 4ZMXA 3L5IA 4WFFE 5F7NC 1W80A 4PBDA 5FEBA 4PY8J 4FG2A 2XSKA 3TYGH 2Y5QA 1L0YA 3MOAL 4E36A 4WO0A 3LXBA 2V5MA 5CJQH 1P4BH 1NANH 5GRZA 2ZAIA 5C9JB 2GJ6E 1QUNA 4DKEL 2BP0B 4KKBC 3PNWA 3SQOH 3TJHD 4M48L 3RNKA 1RLBA 2Z92A 4LK4A 5GGTL 1RPQA 1V10A 3CZNA 5GRVK 1VESA 1XFPA 1CDGA 4OZIA 2K6ZA 4AXWB 2B0SH 3BGFC 2YBRB 3NIFF 4BWTA 2BDNL 4E41E 4BE5A 2B14A 4IRSC 3E6FA 2QEJA 3HG5A 3ZVVA 3BZDA 4FNTA 4U1NA 4TOYL 4A63A 3OHXC 1BP3B 5HHOD 3D85B 1SN0A 4J3OG 1KGXA 2YUZA 1IM3B 3TEYA 2FATH 2BWDA 5DRZA 3FO9A 4JCMA 3QCUH 3L1OL 1ETZB 2FWSA 2AEOA 3B8YA 1UXSB 2R9HC 5B3SB 3VQ1C 3AWEA 3V4PL 4DH2A 3U0PA 2VC2B 1IAMA 4MB3A 1F6LL 4OQTA 1FAKT 4JDZB 4M8RA 5IB3A 1YRKA 3WTVA 3RVXD 2F5BH 3G08A 3PWNA 1JHTB 1KLGA 1OGPA 1RSYA 3TJHC 3ZQWA 4WTZA 3KCWA 4HD9A 2X4SB 3S35X 3NGBC 3ZTJG 3LSOA 4NQSB 5IIEA 3L1FA 4P9HC 1J5HA 4IK7A 4HH9B 4N2GA 2CE6A 1ZE3C 4WV1C 1O6SA 1N6QH 1S9WB 4HS8L 2A6DB 3F12A 4D0DB 5L2KD 2WVVA 4OGAD 5SV3A 1WAAE 5F2FA 4YE4L 4F57L 1FNGA 4ETQA 1IBFA 1IL1A 4EN3C 3CBJB 4DGYH 1DFBL 3PL6D 4B50A 4DOHB 3KPRA 5IY5B 4X98B 4Y4HD 3TT3H 5JR1L 1SXAA 1OWRM 1E7VA 4DEPC 1E5UI 2AK4B 3O3EA 2NY7L 1AQMA 4HDIA 1RK1A 1SY6L 3I74A 4QT5A 1OF0A 4XNQB 4UU9B 1KBVA 3RLSA 4HDIB 3ARDD 3K2UL 2QADC 2LLGA 4YZFE 5E70A 3IJ8A 4OCRH 2TSBA 5ILTL 3CN2A 3OJ2C 4B97A 4OH2A 3QUMH 3UC0L 2K7PA 3WDIA 5K33A 4R2GC 1OTSC 2B59A 2B4CH 3D05A 5EORH 3OR7B 4M3HA 4WEBL 3FH5A 4AJYV 5DJ6A 5I8KL 4ZUSB 2NLJB 2D0HA 2NY3C 2XWEA 4P0DA 2PABA 1HEZB 3B9AA 4DHLA 2BNQD 4BWWA 4LL4A 2BSSB 5EO1B 1EXHA 1A4CA 3TV3L 3KM2A 1I1YB 2P5EA 4S1QL 4U4IA 4Q0XH 3R7QA 2ZUQB 2KPWA 3P4OB 1BQHA 3CZGA 5IQ9A 3F6LA 4BZ2H 1RUKH 5ITFA 5MERA 1OCCB 2Y24A 4FXGA 4ETYA 3GSOB 4LXFA 4JGUA 2ADIB 1G4RA 2D2OA 2G0KA 1P6WA 1H6UA 2NZ9C 4O5LH 4TM9A 3HVNA 1OQXA 1T7VA 4M9OA 5GS0D 5HJDA 5MENE 5BV7C 1U8NA 5I1IL 4V33A 5E5MB 1FBIL 4EDWL 4OFVA 3M45A 3CPLB 4ODWA 1QBLH 4LNRB 1HHJB 3OKEB 1DVTA 1NBYA 2IADA 3F6IA 4OKVA 2CO4A 1D6EB 1F4YL 1YEEL 1ZHLB 25C8L 4JQIH 3CDCA 3SO5A 3HC3L 4MJ5B 2H6UA 4HQQL 5ACZA 1XR8A 2VDLL 3LHAA 1SYVA 1ED3B 4FXLA 5INDA 1RUQH 4L4VD 3UYPA 1GS6X 2I9TB 1GGBH 4W9FC 3MXVL 4RFOH 4F92B 2OQJA 3IWVA 3NK4A 4TQIA 4J8RB 4FNLL 4X99A 3ECVA 5I5RA 4XOCA 4F9LC 3CUPB 2AQQA 3P4MA 1EK3A 4YPGB 2BC4B 4OBSA 4FMVA 2XV0A 1YMMB 3QULB 4FQJH 4LPYA 4PV1C 3WEAA 1G87A 4QOKA 1NKGA 1BD2E 2EIJB 4XX1G 4S1SL 4Y2DD 5DJZB 2R0WL 3RJQB 1RUPL 4LOUD 1R3HA 4OUUB 1TTFA 3EHBC 5FYKD 2H2SD 3NIFB 3BH8A 4U6YB 3W82A 4BZ2A 4RWHA 4OUUA 4AM0Q 5FUZH 3BH8B 1WH0A 1AGFA 5KBNC 2DRUA 1H8OA 1YN6B 1P5VB 4FLHA 3QDJD 1AZNA 3T3MF 4XVOA 3QRFM 4NO0B 3EFFA 1H6EA 4JHUA 4KRPD 2JELL 1T1WB 5DRXB 5E94B 3BIKB 1KPRB 4BFBD 1A7OH 3D39D 4Z3FA 1UWYA 1FAIL 4WHDA 1L0QA 2KQMA 4U2YA 3MJ9H 4Z0BL 2GSIB 4GW5B 4DCQA 5K9OA 4JDEA 2MOGA 2AZUA 3KPNA 5FS5A 4YHML 2R1XA 1E9PA 4GS7C 3GSQA 3SZ6A 4NOFA 4MZ2A 3NIGB 5GIRB 5CINH 4CMHB 4YBQD 3CFCH 4MAYA 1LP9F 2MOQA 2PYFA 3CVIH 1KGWA 4XE0A 3TBYA 5C07D 2OSXA 3N9GL 1BMWA 3GBML 4FJ6A 2Z7ZA 3CMOH 4Y2DC 2P5WB 4LSPH 2O5XL 3FFCA 3X12A 1IGFH 2YGOA 4G6MH 4XTRC 4C83B 4PJ5B 4UILL 1DEEA 4B53A 2VM4A 2ENJA 4E9XA 5JXAL 3ARDA 3GXMA 1TOXA 2MSPA 4X9FA 1EDQA 3UJJH 1MEXL 3QI9A 5ISZE 4FQIL 2YQ3A 2F7OA 2NW2B 3QEGH 4LPTA 3RDTA 4AQEB 5KVGH 2BOCA 4TULH 2R23A 3WFBL 4K7PY 1YDPA 1UEYA 1RIHL 2R23B 4LSUH 5BVJB 2Y07L 2AK1H 4GRWF 4KNUA 1USQA 2VWEC 2PWFA 3DX2A 3V4PB 3KLKA 4TLUA 5IB4B 1NUFA 1NOAA 2IXQB 1SEBA 4G3YL 4KI5C 4HFWA 3WIAA 3WUWB 2AQNA 4LLYB 3D3VD 5C09E 4KTDH 1TJIH 2YQGA 2J44A 3MLTB 3OJVC 4J27A 1DBKL 3FB8B 1A9EA 1XGPB 3EDFA 2WWOA 3TBCA 3VI4A 5KN5A 5E08L 3PRZA 2CIIB 3QJQB 3EF7A 1WDAA 4ZUTA 1KOAA 3LB6D 1T21A 5B7FA 4XVUD 4IRZH 2CIIA 4WWKD 1VZHA 4QDGA 3ULVF 4ODVL 3S4SB 1KJ2L 3O2VL 5AD0A 1OT4A 1GZQB 3SYAA 3K72B 4LVNB 1N7MH 3AG2B 1VFBA 4PJFE 4HP5A 3DX6A 4QRTA 3S3BB 5KSBA 4F9PC 5F89B 3WKML 1DSYA 3MCKB 4FXKC 1UJ3A 3QIUB 3S2CA 2BOLA 3L3OB 3NA9H 1GZPB 3FYIB 3TVMB 3WY2A 4BKTC 3L5JA 3EUDA 3LNFA 4P4KB 4AG4L 3WTTA 4G7VL 3UZEC 4HISA 2CJUH 3D34A 4CDHA 2EADA 1A14H 3ETBJ 1NCGA 2ZSVB 4IRZA 4LAQL 3VGGA 4A04A 4LU5L 3ZE0B 4L4VA 1OGSA 3ZE0E 1TDQA 2EINB 3UAEA 4ONOA 3RURA 3VFOB 2ZSWA 3LPPA 4AMXA 1S3KL 2ESVD 4I4WA 4MHHI 3VTMA 2J6WA 1PLCA 1TITA 1RZIB 3TFKC 1EBAA 1SYSA 2ZTBA 4M6NH 2D7TH 2IQ9H 3R1GL 1GJIA 3Q8FA 4N20A 4YSTA 1JD9A 3VFRB 4POUB 2VKWA 3ALXA 1C1EH 5K5YA 2P28B 4HKJB 3KXFE 1CD1B 1HHKA 4HIPA 3DI2B 4XP5L 4YHKL 5AZUA 3ZKND 1TZ8A 4R3SB 3QK0A 4EUPA 1SFDA 3PCYA 2PN5A 1NDMB 1ZPLA 2Z65C 4GMTL 1SEQH 5KVDL 2NY2C 1EEYB 3H8NA 3KGRA 2VW4A 4XZ4A 4OZIF 2PXYA 4P5TD 1ROCA 1FHNA 1AZBA 2EDHA 3QDMD 2IGTA 4ADIA 5DMIL 3HC4L 3D0AA 2ZYSA 2CAKA 4GUCA 4N0YH 5BZZA 5C0RH 5EEWA 5JQHC 4I3RH 2I7SA 1KT2B 5IV2B 4K5LA 2J3SA 3S8WA 2VL5B 1Q1PA 1UM4H 4MXQC 1H19A 2VDOB 2YHGA 1OW0C 1YMME 2B2XL 4I48B 2VIRA 3HMXH 3D3VE 2FQFA 4JVUA 1XD1A 5BOPA 3T3PF 2LU5A 4MFHA 1NCNA 3L3DA 3FO0H 3S3CB 1ETJA 4B27A 4NIYE 3E3QE 3WMQA 3DETD 3STLA 3P02A 3FQ2A 4QOKD 1MCPH 2NX5D 2M1KA 2WQXA 4P07A 4YGVB 4OZHA 1G9NL 2D7NA 1F8TL 1X7SA 5TGBB 2BFVH 4P4RA 5JIQA 3MCG1 1AD9B 4P3CH 4JJ5B 4LBEA 3ABZA 4H0HB 8FABB 2WZ5A 2ZZUT 1WAAA 1ROWA 3VGBA 3MOQA 1OO2A 2CCVA 4JR9L 3UBXB 1ND0A 3MR9A 2H45A 3CC5B 4IS6B 2DBLL 1TSHA 1I7TA 4GXUM 1ML0A 1KLFA 3PFUA 3IDYC 1PJWA 4P2QB 5ETUB 4N0YL 4IS6A 1ZAGA 2Z93A 3HE6B 3D52A 3UMNA 2DWYA 4F8LA 1JF5A 5T5FA 1NBCA 1MHEB 1LD9B 1DJSA 3VQMA 3AB0C 3NCEB 2FGZA 2QKSA 3L4XA 4N6QA 4RQQA 3V2AR 4KVCL 4J2QA 4L0PB 3MODL 2CR0A 4LQ1A 1BF5A 1GGIL 3GI8L 3OMZA 3ESVF 3CXHK 4Y9EA 3FQNB 3G5YA 3T3PE 4Q2ZB 1FDLL 7FABH 2GTQA 4GFXA 4XP9L 3SOBL 4AGMA 4DW2L 5IREA 1X6NA 4PY8I 4W70A 2ZE0A 1FC2D 2HKFL 4XMKH 3TZVC 3ULUE 1AXSA 3FN9A 1J5DA 4EBQH 4AIOA 4PJ6A 3F04A 3UBGA 1MLCA 5L2JA 1OAQL 2LVEA 4NRXA 3M7FB 3AAZA 4RMRA 4TSAH 1A8JH 1HHHA 2H6PA 3E9TA 4Y4KB 4Z7UA 2ZNWA 1MLCB 5L2JB 1LO4H 3MRDB 3L45A 5CEZH 4B9PA 4PVNA 5IT2H 1KDIA 5C0BB 2KZ1B 2DM7A 3IT8D 1U8CB 5DQ9B 2AF2A 4U1JA 3ZMRA 4AG4H 4XCYB 4LSVL 2WLHA 4GO8A 4WLCA 1WFJA 1L9MA 3MLRL 1DBJL 4GRLC 4XPTH 1JNLL 2EDYA 5GHWL 2Z4QB 5C0ND 3C6LA 5J4MA 4AT6A 3WKMH 4YFLI 4IHOB 3WO4B 5FFLA 3WS6C 1FZOA 4FTVD 1PGRB 4JPIA 4AT6B 3CMGA 4KXBA 1N7ML 4PMFA 1TPXB 2OW7A 1CB4A 1KJ2H 3DIDA 1HESA 4H1LH 5C7ZA 2R0LH 1A8ZA 3TO4C 3TYFB 1FVEB 1T7WA 2APSA 4K7PX 3FOLB 4IMLA 5PAZA 2VXTH 4BXVA 2EDNA 5DD3H 3ZE0F 5JLZA 5E08H 4U1HB 4L4TE 2Y5TA 3QHZH 4ELKB 3FO1B 2CPUA 1R5VA 2XG5A 4YPJA 1B2WL 3B1TA 3AY4C 4UT6L 4YBHA 5A16A 1WA1X 1FIGH 1H6TA 4Z0XA 4LLDA 1SLUA 5EPMA 2ZCHL 4TYUA 3HG4A 5HI4C 1JRHH 3MPCA 2VAAA 1ZVNA 5H37G 5ESQA 4O2EB 1A1NB 1S7UB 2XTSA 4FG6C 4ZPVA 4LEEA 4BFJA 1FYTA 1P5UB 4TULL 4X6DE 3K6SB 4XNYL 2B9AA 4MD4B 3FCSA 4X9YA 1FO0B 1TFPA 4MD4A 1S46A 1NEPA 3GEWB 3FT0A 1FN4B 1CDYA 1KCSL 2EXWC 4PJFA 4EF3A 1JHKH 2Z9TA 3REVB 2CR6A 3NOIA 1C5CH 3FBQA 5EU7E 2O30A 4FEIA 1Y1UA 3E38A 3EO0B 2X40A 2H3XC 1VACA 2WN3A 4FTDA 1CQYA 2Y6SD 3G5XA 3CFCL 2XDHA 1J0ZA 2DQ6A 4YR6A 1JWMA 4K7FA 5E03A 3G5XB 2HT3D 2BSED 4N0RA 3VI3F 3U1SL 4KUZH 3ESOA 4HFUL 4YHMH 4HBQA 3FSZA 3LAFA 3D8MA 2WLNA 3MJ9L 4Z0BH 4MWFA 4H1LG 2K8QA 3BT2L 3CFKB 3PJSA 3SCMD 4PJEB 3GFUA 3T0EC 1U41A 4G8GA 4N8PA 2D2CC 2H2PC 3GT6A 4HWEL 2HUEA 4G8GB 1RZ8B 4LCCC 5I16B 2DQJH 4GY4A 1WFUA 5IHHA 2H3NB 1DBBH 3ZTNL 4YNYA 1C12A 3WS3A 1R33A 4ZSOA 1S7XB 1MFEL 4KRNA 1DDHA 1NM4A 2CRMA 2HH0H 2R0WH 5AOKA 5C0IA 1IEHA 4NO5A 2VXSL 3W11C 2Y69B 3MLSH 4RH4A 5BZWA 1DE4B 1O75A 1BXAA 1DUYB 2X12A 3NZUA 5H37A 2JTYA 1XF4A 2WHVA 1S4IA 4JM4H 4P2QE 2PCPB 2VMFA 4Q56A 3VH8G 4H44C 2WQWA 4XMPH 4O02B 1EEZB 2RALA 4EN2A 1JPEA 2EKJA 3SSGA 1BECA 1T20A 4UAOC 1EDHA 4O02A 2FJUB 4KY1H 2DIEA 4R8WH 4RFNB 4WW2B 3C6LC 4NENB 5TQ2H 2XWBA 2WXHA 1URZA 3PV6B 1VFMA 2V5RA 2XFGB 5EIIG 1T4WA 2F53B 4O2CB 2ZPKL 4XP4H 1PW3A 3MV8B 4G1MA 5AKTA 4A7GA 4DERA 1AHWA 4QKXB 2ICEB 1S9XB 2ZCKL 3KS0J 3C5JB 2CK0L 2EE6A 3ZOAA 2YSSA 1QVOB 4NCC1 4WNJA 1T83A 5D4HA 5B38G 3KYOA 5AB2A 4PBXA 1HCYA 3FTGA 2K70A 3H9ZA 5HGAA 1IC4L 4O5LL 4DKDC 4Y5YA 3FU7A 5BS0E 3CVCA 1ZEAH 1IM9A 3BWAB 3JWNG 1ZLUK 4N87A 4HUVA 3CBKB 1BZQK 2KS0A 3T8XB 4BZ2L 3GXPA 5DA4A 2VLRE 3CVHA 1BA9A 1M71B 1GMIA 2PCFB 2DLFL 2FGWH 5CZXC 2X9XA 2X4RA 4WWKA 2C9RA 3FSAA 1NIFA 4NX0A 4U6HA 2F7QA 5AOLA 3WYRA 5FV2A 4EI5B 1MJJA 3APFA 4MCNA 3S98A 5HJ3B 2CDGB 2XV6B 5HGHA 4PGEB 2VQ1A 3OF6A 1NCAL 4Q6KA 4JRXD 2BCKB 1MLBA 1DJZA 3F7VB 2OR7A 5DZVA 3T9WA 5HP5A 3QXDB 3I75B 3DKHA 1AKJA 2B4CL 2QADD 1S3RA 2G3XA 1UG9A 3BAWA 3PXJA 4EIGB 5I66A 4P5KB 5C0CD 2UZXB 3QP3A 5I1DB 2PLTA 4WVRA 4APXB 1MCNA 5BVPL 2F19L 5JXEC 2P7TA 1TEGA 1AGBA 4LHQB 2AMGA 2W95A 4YHZH 1F11A 4U6TA 1NPJA 2FQGA 3M46A 4NI3A 3W56A 2W80C 4QTHB 3FCGA 5D7LA 3F7KA 3V4VL 3CDZA 2CLRA 5T1KB 4KZCA 5GGQL 3VG0H 3US9A 2MQ3A 4MS8D 1FZJA 1RK0B 6PAZA 2NOYA 2DIJA 4CSZA 3J07A 1VJSA 4K3JH 5E9DE 4IBVA 1IJ9A 1OCRB 1IGIL 4I89A 5DT1L 5MENB 3FU8A 3SBPA 2LT9A 4RWYH 1PZ3A 5DO8A 4NQCB 4AXWA 3I02B 4NSKB 4OZFG 1GRWA 4W9LC 4XOEA 3RWDA 5HY9B 4PU2A 3VACA 3TA3C 3T8VA 3K6FA 5CWSA 4NQEA 2IVFC 5HDLA 2W81C 1C08A 2H0EA 4OCLC 4KFMA 1U21A 1QLEH 3L1OH 3DETC 4MX7B 4DEUA 4XO5A 5E00A 4ZT1A 5GGSB 1W72A 4Y2DA 2CK0H 4FKEA 1D2OA 2YUXA 2A9NH 1IBHA 1QBML 5IUSA 2E3VA 2NY2D 3LS4L 3SQBA 1MVYA 3T8MA 4A2MA 5J1SC 2QLYA 5AEAA 4X5RA 2GUOB 5JUEL 3GXUB 3V0IA 3LQAC 4ZMWA 2EDEA 1IGCL 1WGOA 2J2ZB 2PCXA 2WV3A 3HS0A 1T2XA 2OFQA 5C9KA 5FDYA 5K1NA 2X1XR 4R8WL 5I0YA 4U49A 4RFNC 4F8TA 4KJQD 3NMEA 4X5LA 3GJFA 1W8EA 2BO0A 3DV6B 4IW4C 1EZUA 1XF1A 4GW1B 5E4OA 4ELMA 3V7MA 2VR7A 2KZBA 2R4SH 4FOMA 2VRKA 1KJVA 3SDXE 4QI3A 1WZAA 1E4XL 3P11H 3VXMB 2BS9A 4HHAB 1UD4A 1YQVH 4HJTA 1AFVH 1LWHA 2FBJH 4L0ZA 1HJBC 1F4WL 4AGNA 2VXSH 4TSCL 4BFNA 4JG5A 2R59A 4OLWH 5HPOA 1U3YA 5FKAA 1YC7A 4UOQA 4POZD 1AP2B 4ZK8A 1CXFA 3V0VB 3SKNA 2F54B 1Q94A 1O7VA 1YPZF 3IJSB 4UZUA 5A2JH 5IUCA 4XBPA 4RSVA 1JGIA 4AC4A 2X89D 3FU3A 3SE8H 2VMEA 3OF6D 1U92B 4ZUSA 2R0ZL 3EJTA 5AW5B 1BPVA 3HR6A 3D18A 4MMXB 4XTRD 4CVWA 1K5WA 5EULV 1AIFA 3HG0A 3S3SA 2CHWA 2IH1A 4BCXA 5E5RB 3VFPA 5D1XC 2OJZL 2YPVL 2DWEB 2WTOA 5KVEL 1HL4A 3DXAE 4C4KO 1DUZA 1E27A 2FX9L 3NCXA 5D7SL 4NWTL 1FFPA 1BJ1H 1BV8A 2BSDA 2JCCA 2BS71 4HWBL 3ZDZE 3WDJA 4MJ2A 4ZQTA 3UYOD 2VLLA 4XRCB 1IGTB 1BG9A 3B2PA 1BIIB 2L04A 2B3IA 3D4ZA 3IEAA 3OPZH 5D7JC 3TXAA 2Q8AH 4GXVH 5FFGA 3NACH 5DJ6B 3QYNA 2CLZB 1NLBH 2Y06L 3AXLA 4LSRL 4BELD 2NLJA 3A22A 4L23A 5DJDA 4DKFL 4Z3HA 4PTTA 4Z7UE 1HL5A 4KO6A 1PKQE 1UM6H 5I5MA 1GIGH 4NUPA 1HSBB 1I1AA 5DTFB 2J1XA 1JCKA 3ULUH 2WLMA 1NC4B 4BFFA 5J5EA 2WWKO 2WKLA 3MUHL 3P4OA 3CUPA 1DZBA 1E4KC 3UXFA 5I1GL 3OAWA 4M7KH 2YWZA 3QWOB 4UIMB 4I3SL 4ISVB 5DC4B 2APVA 3BJLA 3R8QA 2OTWB 3IFNH 2X1WL 5KS9E 3D51A 4K3HA 4HK0A 4GQQA 1KCRH 4YEFA 5EO0B 4F33B 3HHSA 1QFWL 2GYSA 3SB3A 1Y0LA 2ZWYA 3S8FB 1I9JH 3BO8A 2Y7QB 3HHSB 3MLRH 4FABH 1I8LA 3MRJA 2IADB 2JFCA 2CJSA 4K71B 2Y7QA 3CG8A 1MKFA 3C5ZD 4H20L 4KROD 5EZJB 3D0VA 1T66C 4M6OH 3CHXA 5C0AD 3RZCC 1XO8A 1XF5B 5DEFB 4JFTA 1DYZA 4JFHE 4WJG3 3IFLL 4JJOA 2FJHB 2EDOA 1Q0XL 2Q86A 2WLIB 3MQIA 3QUMB 3T1FB 1G7PA 3MGOB 4N25A 4HU2A 4G7YL 2VLJE 3MGOA 3FO9B 2OQJB 2R2EA 4D94A 2VXUL 4G6JL 1NEUA 3CFEA 4G8AC 4XMKL 2KPNA 3DX9B 1EO8H 2CHDA 2NR6C 43CAA 4G9FB 2ED9A 2GY5A 4G72B 5I18L 1VLXA 3FUNA 1CE6A 3STZA 2WIIB 3RPIA 1QABA 3B2MA 2IWEA 3ZHNA 1L6PA 4LEOB 4DTGL 4QTFA 5GSVB 1P7BA 3Q48A 1OV8A 2BNUB 1YY8B 2QPUA 4OT1L 1IBGH 3QI9B 3S0PA 4DP1X 1IBDA 4Y5XC 3AU1A 2W88A 4N1CA 1ONQB 2O6EA 4AKQA 2E59A 4IEFB 2GK0B 4M1CC 5FR3A 3LRHA 3AU1B 4NQSA 3O0LA 2APWA 3B8SA 3RP1A 2C8NA 3QIWD 3QJZA 1XL6A 5E56A 2Q7YA 5GZNC 4Y4FD 2W5PA 3OSVA 4TS6A 1FFOA 2DKSA 2R69A 3V4PA 4KK8D 5F1NB 5AYQA 3BZFB 2E7LA 4KC3B 3SGDH 4RISL 4NYLB 1XIWC 5F1NA 4JR9H 3DRQA 1Z5HA 2DJSA 2BW4A 2J12B 3ARGC 4AW7A 2J5WA 3TJEL 3DWTA 1FZMA 4ZUTB 4YXLL 2W07B 1PD1A 1M05B 2J4WH 3BVUA 1Q9LB 4G43B 1XGPA 5F7LB 3NRFA 2E9WA 3BGMA 5AW0B 1EZVY 1TQBB 4U0RB 4MNHB 5D7IE 3BWUC 4H88H 4OZGB 2Q9OA 1FRGH 3A4AA 4E5XG 3V5HB 3FO0L 2AXFA 5ABZA 4KTEH 1QOKA 4KDVA 1XF3B 3D2UD 4LRNH 1YDPB 3SKUD 1JTTA 2ADGA 4P3DA 1Q1JH 4R4BA 4LLMA 3BP5B 3QZWB 5L8KB 3TBWA 2PYEB 2W0PA 4XVSH 4LFHG 5DCCA 1K85A 4OZ4A 4LLUB 4QCIA 4BSVB 3AQYA 5BZDB 5DMIH 3Q0HA 1EFXB 1Q9KA 3LZPA 4KKLD 3GJEB 4QCIB 5KSUA 3GI9H 2Y1YA 3HIZA 3DX0A 2EE9A 3ZTDC 2VMDA 2OL3B 2K3TA 2YRPA 5EF1A 1WIUA 3PWJA 4GMTH 2EXYC 1AZCA 3FTWA 4O4YH 3OB0K 4AZ8A 4FP8H 2DQUH 2R7EB 2ZUUA 3LIUA 3Q2NA 4MAUL 1DBML 5FWRA 1C1EL 4LNRA 1G0YR 1KC5H 1EERB 4FCHA 4QNPE 5GZOC 5GZOD 5I75C 1MWAH 3VI4E 1G7HB 1QG3A 1QNZL 4F1SA 4FZ8L 1D5MA 4ZS7L 1GW0A 3SDCD 3NFNB 3KVDD 5CM1A 1RUAH 3P2BA 1KGUA 2GEEA 4PUBH 4UNVA 2BIHA 2GVYA 4TSBL 1CIUA 5L88L 4MSWA 4YDZA 4LU5H 1LNUA 4LAQH 2VRQA 3F6JA 4QY8B 3UAJD 5FYKU 2QSCH 4RMQA 4ZXBB 4QY8A 4ORGB 2PO6B 3VE0B 1S9VB 2EDWA 3D85D 3B2XA 1CD0A 2X6BA 1AMYA 2CK2A 2EKSB 3VSVA 1S8DA 1S9VA 3TIDA 1W8NA 3NA9L 1V8HA 2Y72A 2WXKA 4I2XE 3IMTA 3TOPA 2R56L 4Z8FL 1QP1A 1A02N 2HPOA 4WWID 2J71A 3UP6A 3TWCH 2NNCA 4V11A 2K7QA 4U6YA 3EJZC 4YSSA 4IJ3B 1HKLL 4JRLA 5JIMA 2QT6A 3MNZA 3HZVB 4EQ2A 1V05A 4ODVH 3WSQL 1FP5A 1E2WA 1H3WM 1JZIA 1PY0A 3BLPX 2J8UB 1U8MA 1I8LC 4OCXH 2XQYK 4JY5L 4AUJA 3BWSA 4W81A 3HMXA 5MHSE 3M1CA 5TGBA 5IFAH 1NGYA 4H5SB 4JZOA 4KTDL 3X11B 4KXDA 3FL7A 4RMUA 3FT1A 1UFUA 3SY0A 4HOWA 5AZEL 4F7EA 3D9AH 4URKA 5KJ7E 4PD4J 3FPXA 3WKQA 2Q10A 5BQDA 3BD4A 4I5BA 4GRMB 1S7WA 5F9OH 1A7RL 1L7IH 4X6EA 2CXGA 5CZVH 4I48A 1NFDF 4MJJA 4PG2C 4X6EB 3ARDB 4PB0L 5IBLD 3QPQC 1I3GH 3UJJL 5F96H 1MAKA 1C16B 1J0IA 3MRKA 2Y3AA 2WLZA 1AXIB 3LQAL 4UILH 5FO9B 4PRIB 1OE2A 4PRIE 1CIDA 3OC5A 3V6OE 2NZIA 1O5DT 4M6MH 3ZIMA 3U2SB 2MPAL 3KE0A 4TVSa 1FGNH 4MNQB 4QRSA 3LNGA 4D9RD 3CVIL 4JGJA 1QA9A 3FQRA 4UOZA 3CZFA 4TQEH 3X14A 3QCVL 2CO6B 1G0DA 4X7FC 5IOPA 4P2OB 2PF6A 3C6LD 4TVUA 1G84A 3V4LA 3MBEB 3HZMA 4PCKA 2JLPA 4YBQC 5K9JH 4OCYH 4NRXB 3WHE0 2XZAL 4LKCA 4LOEA 4PV9A 1U2CA 1DL7L 1JGUH 3FHEA 1JI2A 3AITA 4XCYA 5C08E 3TZVB 3HZKB 1C7TA 4Y19A 4RGMC 5I8EB 3QORB 4A6YB 1CU4L 1OSPL 1LD9A 2MHAA 2YXMA 3IDMB 3LIZH 1EXUA 1C8QA 1N18A 3JWDL 4MD0B 1S5IH 4Y19E 4Y19B 5FUZL 4O02H 1F58L 2Q3ZA 1X5FA 2CLVA 4PIBA 5F6IC 4E9VA 2J73A 5C0CE 5LUMA 4PJCF 5CIPH 1U8KA 4LARL 1CFTB 4GAFB 3E8UH 1II4E 3IKKA 3LMJH 1E7UA 3L4ZA 1U8KB 2XN9A 1IAIM 2JIXB 3R06B 1B4TA 3K81A 3AQDA 5C0EA 3ZDXB 4FNRA 3TC9A 1N59B 2RJMA 5FB8A 2DAVA 1AH1A 1JDAA 4G8EB 5C2BH 2LVCA 3KPSD 4J23A 4ZO6A 1NCOA 4RFOL 1FQ9C 1VCAA 4JLRB 4ZFGL 1XSJA 2BVOA 4W93A 2R1YB 4YDIH 4L8DA 1GYVA 3FO1A 5EPMB 5MP6H 1WP6A 2ZSWB 2AXGB 3QDJE 4HPYH 4NN5B 2ZG2A 4O2EA 1AZRA 3FW6A 3KJ4B 1T04A 3RWEB 5D71H 1IEBB 2Q3XA 3RU8H 1F4YH 1QUPA 1JN6B 1U8IA 4U1MB 4FNSA 1GC1H 1PQZB 2C4XA 4NNXB 4XXCC 2DWTA 1QBLL 1W72L 4GG6A 1AGCA 1U6AL 3P3YA 4AGLA 2DWDB 1MFUA 3VTTA 4EDWH 3UTPE 4CL7A 2HUHA 3HPLA 3H85A 1INDL 4TNVF 2XYBA 2O5YL 3V0WH 3MLWH 3MLWL 1FO0A 4TVPH 4TVPL 1ZSHA 2PKDA 3MRPB 1Q72L 5C7XH 2GT9B 4KKCC 4KKCD 4AOFA 3FKUS 1MCQA 3BMWA 1XTMA 3PNRB 3GSXB 5C3LD 2XV2A 1RUKL 4OV6F 3LZNA 4HGKC 1DQTA 3QWRD 4OGXH 3HJEA 4R84A 5GISH 1U93B 1R34A 3KW7A 1GC1L 1VACB 5EZIH 5TE6H 3SODB 2V9TA 2GQHA 2W0LA 3TV3H 2FJFA 3MC0A 3WJLA 2C3WA 1V3MA 4AK1A 4NOBA 2JLLA 3M7OA 5BJTB 3VW3H 1NFIA 4EZMA 5MP6L 3RPKA 3GXFA 4QRPE 1HL8A 4R0LC 1M9SA 2P80D 3BVDB 2K45A 1JRHI 3K3QA 2ZAGA 4XVJL 4PJBA 1OTUD 4X6BB 4Y2OB 3SPIA 5C2BL 3FO2A 3GS4A 3Q8BA 4ORZC 1G7LA 4HT1L 5CHNB 2MNUA 2YARA 2KLRA 3P0YL 4M9PA 4XCNB 5ILTH 4EVNB 5LN8A 4B3EA 1TEYA 3QNZB 3MNDA 3N1MC 4C59B 3Q8AA 3E8UL 3IDIA 5HHOE 4HWUA 5EOTB 5FA4A 1LE5A 4BINA 5SWSA 3OB8A 4MJID 3VGDA 2NY7H 2WWKT 2EDJA 3CLEL 1FVCA 3QCTL 4UAOB 1K6QH 3WN5A 4HMCA 3LIZL 1OSPH 2A4EA 1B3IA 2VJ0A 3CC5A 4DGYL 2IH3A 5HYQA 2ADYA 4PH8A 1KXQE 2NY4C 3HFMH 4YR6B 1MW0A 3D3VA 4HUNB 2FHFA 3ALPA 3RNQA 5GZND 3EW3B 1FSKB 3D3VB 4JS7A 3FONB 3WIIH 1N6QL 2QBWA 4OVVA 4A7VA 1XH1A 1NLDL 3W3BA 3HBZA 4HIJB 4X4XA 3LXUX 5FHAH 4IRJC 4A2FA 3NIFE 4UQ2A 3EGDA 3FQNA 5EC2A 3HZYB 4J8QA 5E2TH 3G5YB 3MV8A 4AQAB 3VFUA 1GJUA 1VEOA 3FSVA 5B3JE 4CSPA 4L37A 1H9VA 7PCYA 1ZSDA 5AFAA 3F85A 3I6SA 5EZOH 5L2KB 2VC2H 1S7XA 2YPLE 2D0FA 1BM7A 3UAAA 5HGAB 4PV8B 3BOVA 5IMLB 9PCYA 3BUYB 3GO1L 1WT5A 1AE6H 2JB5L 2YSSB 2Z31A 2M26A 5BZWB 1SLVA 4UDUA 5CIPB 1J88A 1KBGL 2AV7B 2VDMH 3TFBA 2YD7A 2X42A 2W92A 3QAZC 2HLAB 4G8FB 1CVSC 1TTCA 1I4FB 3RYMA 1M1SA 3ZUNC 2OKMA 3MLXH 4MA1C 1UKQA 1IM9B 3BWAA 4PJ8D 1OANA 2EDMA 2YXFA 3UJIH 1A7RH 1L7IL 2H32A 3EGXA 1B88A 1SPDA 3GGWB 4WFHD 1KIUB 3KCPA 1T7YA 4KFZC 4JO4L 5CZRA 3I9GH 5GGTH 5J06A 2PPCA 3UTZB 1BD2A 1I1FB 1AYRA 1BQHG 3UGUA 4TV3A 4BQ9A 4BV1A 4Y1AA 4H8VA 3NIDB 5HYEA 4PJ8A 4FQXB 3WFEL 1WWBX 1B0GB 4M7LL 4Y1AB 1T1ZA 5IESH 2YLKA 1F13A 4NFCA 1QKZH 1ZT7A 4MD5A 4ZFZA 3GBDA 4YSRA 4HX1A 1UT9A 4JFQA 1AXTL 5IP4A 5DRWB 4N3UA 1BQ5A 2E76C 5I1DA 2DMGA 1CLYL 4XXCA 4JJHA 2HFGL 2VT0A 4JBSA 1XH3A 2VXQL 2FAUA 3QR2A 1JFQL 1YNTB 4YSPA 5DUMH 1OLLA 1LQSR 1FIEA 1YNTA 4KGJA 3TBSB 1KEGL 1IKOP 3C75A 1DO6A 3VD0A 2GITB 4L29A 3NQKA 3KJ6H 7TAAA 5B39G 3O11B 3QAQA 4Q6IA 1A9VA 4R5XA 3TH4T 4WUUE 3MJWA 2YD8A 3C5XA 5CJOH 1OF2A 1EWHA 2AV1B 4KROC 4A2LA 4DSYA 4YSUA 5JHBA 1HWHB 2HKHL 3JWOC 4FADA 1HWWA 1P7QA 4GSUA 4FZ8H 3S9DB 4N1EA 2ZKXA 1QNZH 2J55A 3BD3A 4PRHD 4W68A 1YJDC 4Z7OF 4JQVA 2OULB 4U6XA 5T1LD 3GJFK 1A0QL 1ZA6A 2PW2A 3UYRH 4APXA 1JPSH 3LXAA 2NSXA 4WFGD 1OAYL 3TEZA 3LYRA 5DC9B 5F7EH 1A6AA 2NR6A 5T3ZD 1C08B 1BAWA 3KGSA 1BAFH 3IU4H 3QR1A 4M7ZB 2Z64C 3V8OA 2AFNA 4N2HA 3JTBA 5JORB 2Z8WC 4QRUB 2NW3A 3ARXA 2OXGB 1MIML 3U0PB 4P57B 4JKWA 2APFA 2OA9A 5DF0A 3HE6D 4NWUL 5MI0B 4E0RB 1KFGA 1J1PH 4L1HA 4P57A 1D5BA 3SDDB 4ZW5A 3VFGH 2ZCZA 4XVSL 1JWSA 4YFLF 1U3NA 3BRGC 1QD0A 1ZHNB 1Y7VA 4ESKA 3QEUA 4KRPB 4A7TA 3DNKA 4EAEA 2FBOJ 2FIKB 3L3JA 2X87A 3D39B 3LSOB 4PJEF 4OM1L 4UQ3A 5IW3A 3T2NH 1DVZA 5AW1B 5LHDA 1XIWA 1YPZB 4JB9L 1O6SB 4N2BA 3SDAD 2WCPA 3O3UN 2BVQA 3PL6C 4QHMA 4UOJA 1QTSA 1ZWIB 4HXAL 2EDFA 3BE1H 2JKXA 2BVQB 4PJXE 4XC1H 5BMFH 3MBWA 1UOKA 2Y5EA 3PWVB 5E6RB 3QFGA 1ODUA 2OMNA 2OCCB 2I5YH 3QUZB 5LBSL 3CZJA 5E2UH 1L3NA 3BYYA 4NGHL 1WZKA 2VLJB 3KXFB 1PDKA 4UU9A 1GAFH 2F54A 4WU5B 1KG0B 2IQAA 4XPAH 1P0SE 2FTAA 1UZ6F 5EMYA 2IOMA 2MQGA 2VKXA 4HIXL 1WT5C 2Z31C 4GLRI 3VXQA 5JZ7D 5KS9A 1T0OA 1UTDA 4WUUD 4QHLA 4NKQB 3HLKA 1T80A 4UMGA 5ID0B 1Y1DA 4XPBH 4ALAH 2OSLB 5F7DB 1I3VA 5B1JC 1NMBL 4MMXA 2ITEA 1MJUH 4NZFA 3FU7B 1QFUH 4UDTB 3BPLB 3ISRA 4F7TA 4M1CD 3GJFH 3O6KH 5BV7H 2Z35B 3V6BR 1RZFH 4JFFD 5HVHB 4UDTA 4PR5A 1DDTA 2ZG1A 1QATA 3KMDA 4PS4L 2ZX8A 3HPJB 5DJCB 5F3FA 3GSUA 1EO8L 4BUGA 1GC1C 2C5DC 1NDGB 3N41B 3NJXA 1DQQA 1EUUA 1NMBH 3BP6B 3GSNB 3LV3B 4G5ZH 2F7IA 3WJJC 2R4RH 4RRPM 1WZ1L 2VN5A 4RESB 3OMIB 3CFDA 1JPST 1YMHB 2ERJC 1URLA 1W91A 2PP7A 1H15A 4AL8C 2XQBL 2NY6B 2CHNA 4YX2H 4XPFL 4PBVC 3LPOA 4QXVA 3MRBB 4WTWA 5CCGE 5I1AA 3QDGA 1E8YA 1TZAA 1V3LA 3Q1EA 4HIXH 4MQXD 5ECJE 4GW4B 4NXKA 1CF8H 1DSWA 3LY6A 2WNGA 3FU5A 3QDGB 4NZ8A 4HPHA 5I66B 4P5KA 2ADFL 1RZQA 1QFHA 1GPOH 3BEWA 1GOGA 3U9PL 5I28A 4L4JA 3VFSB 4B9CA 2C7FA 3BEWB 1K8IB 2K9FB 3H0TA 2CRYA 3TN0B 3X3FH 1I7UA 2I5YL 5LBSH 5ITFB 1E40A 2Y2YA 3H0TB 3V0HA 2EH8L 2VJ8A 2X2YA 2YC1A 3ILQC 4UINH 2OYLA 4I3SH 4P2YA 3BE1L 4NP9A 1ZMYA 4GUPA 3MO1B 1OCZB 4ZJ9A 1THCA 5TTRA 2MQ0A 4WNQB 1RMFH 5IROD 3D25B 2B9BA 2UWEB 1OTTC 4WNQA 2SODB 1QQDA 2WMPA 4JANB 3RHWK 2WLYA 3BN9D 4AYBA 3BN9C 1A3LL 3F05A 2HX7A 4J3BA 1INQB 3WD5L 5ECGA 1UM6L 1AACA 3BUDA 4HJIA 4X80L 3MRJB 4QLWA 4RGNB 2XA8L 3MRCB 3RWDB 5LBSA 1L9NA 3Q2WA 5TE4L 1NLBL 2Y06H 1S78C 4MZ3A 1XD0A 3I3EA 3FN3A 3V52L 2QTEA 4R90H 3CDGB 1CE1H 2YMOA 2GHWB 2A0LD 1NBZB 5E5LA 2RFXA 1MCCA 4J39A 5FC9A 4PQXA 2NDFA 4IYKA 5SV4A 1CXIA 2P45B 2JJTA 3KPNB 4OJEH 3QI9C 5GGSA 2WJ5A 3NFPB 1C5DB 4OU3A 1GH7A 4K2UH 4PHZA 4NWTH 2J8UE 1QRND 1XGTA 4ELME 2ZXEB 3L54A 2EC9U 3TBYB 1Q4NX 4CU8A 3SYQA 3H4FA 5F1IA 4RIRA 2FSDA 4WEUD 4G9FA 3MRIB 2YPVH 2OJZH 4LFHD 1K3ZA 5IJKC 3RZCA 2AQ2A 5ESAA 4IBWA 4LDEB 5CU9A 2V37A 5I0DA 1ZS8B 2XXMB 4HH9A 4XX1E 5CN1A 4AYGA 4DP8X 4DN4H 4PJHE 1J8HE 4PJ7F 2EE2A 3EFFB 3OX8A 5D1QA 3SPHA 4ANUA 3N40F 2F08A 4C56D 3CD4A 1MJ8L 4KDTA 4IOSA 4KK9C 4I1RA 5BCAA 3VI3E 3KLLA 3DLQR 1FNAA 4DP2X 2GHZA 2XVKA 4M8QA 1OK8A 1NAMA 5DUML 2VW6A 3GTTA 3QQDB 3R4RA 3QIWA 3V9CA 3K0WA 4ZO9A 3QEQD 4CAGA 2Z91A 4G8IB 1M05A 5EU4B 2RGSA 5AW4B 1ZLWH 1EA9C 3AS2A 3OWEA 1BQSA 5CS7A 3CX5K 3K0YA 3WENA 1MCIA 2WGNB 5IQOA 3B7RL 3GB7B 2VTFA 2VDRL 3TO2B 3UADA 2H0JA 3BZEB 1AQKH 3GB7A 2X7LA 1BZDA 2R2BB 5CJBA 2HFEB 3F2LA 4LSTH 1YQVL 1WGVA 1NOLA 1TZIB 3EO9L 3OKMB 1JGEA 1O7DC 1MCLA 2WQAA 3P11L 4IU3B 3VVWA 2E27H 4K5PA 3WFEH 2G5RA 4FFVD 4EZJA 1OZTG 5DGQA 1MCOL 4XXDA 1M2VA 1S9YB 3DI3B 3I9GL 3GMLA 4Q9RL 1WTGT 3QO1A 3QPQD 2CUAA 1X7QB 1UATA 2NY5H 3O4OB 4JPQA 1JXDA 1A22B 1WPCA 2OMWB 5IB4A 5JOFA 2PYEA 1WK0A 1ACYH 2VH5L 4RAVA 1UCBH 3N41F 1ZOXA 3LH2H 3O3AB 4A2GA 3DUSB 1Q9KB 3PS6A 5JPNC 2ARWA 4OFDA 1QEXA 2D3NA 1A9EB 2VR8A 4MQSB 4WI8A 3DUSA 4JHBA 4BFRA 5B38B 3IGKA 1N19A 3SDCA 3GO1H 3EGSA 5IHBA 4P5TA 2FE0A 4N0CD 4KY2A 1HQ4A 2DW5A 2IFFH 4N0CC 4CN4A 2DWXA 5DHVH 3BVVA 2JKIS 1SOSA 2MPVA 3LNHA 3CFJB 3LKRB 3OKEA 1HDMB 4DK6A 4ZTOL 1C5BL 3IE4A 1E4WH 4JEGB 3UG3A 1RHHB 1LYQA 1DO5A 1BXXA 4TNEA 5FDWB 5FHAL 3MV7E 2F68X 1BMZA 5DT1H 4P9HH 3IBOA 4NQCD 5E99H 5DZLA 3VCLB 1OSZA 3O9WB 3VXTA 1KFAH 3WY4A 1QBBA 2I9TA 5J3HD 4MS6A 3QRGH 3A24A 3H3PL 2K6WA 4JO5A 3RX8A 2NY3B 2I60L 5AVUB 32C2A 3V5KA 4MCYB 3BAXA 3B9KB 4KMQA 3EYSL 5E6YA 4KWUA 2WM0A 1X9RA 5FA3B 5FF6B 1FGVL 4PJAB 5TF0A 3UBXI 3GNML 2A73A 3DHJA 4X6CA 2WIMA 3C60B 3CLEH 3V5DB 2XKNB 5CJXA 1N26A 3RJDA 1URIA 1CFQB 3EO1B 1P7KA 4IBLT 5EHFA 1R3HB 3QIBC 4ENZA 5JHDD 3TA3D 1Z32X 4E9YA 2GSMB 5I1EL 3VTAA 3WE1A 4N2MA 3O2WH 1ID2A 2X4NB 2WNKA 4S0SD 5BVPH 4I0PD 1RAMA 1JGVL 3RAJL 2I9LB 4HKJA 4FQQA 1YN6A 3L7EB 2J8UA 5LB1A 2QGBA 3M8OL 5EZJA 1GOHA 4N9GA 3L48A 1G7HA 3L5XH 3L3GB 1H0DB 2FEEI 4HJEA 1FCGA 4JQVC 3BIAX 2A6IA 1GZHA 3DX8A 4N2EA 4QXUH 3MYZA 1KIPA 3SY0B 3ECBB 3IDJA 1CBVH 1NCAH 1IMHC 3P3RA 2HSIA 3VRIB 1ZLVH 5KJ4A 3RY4A 2M83A 4N0UB 4ZFQA 1OAKL 5J8OA 3HI1B 3VW3L 2GIMA 4AL8H 3CFEB 4XNZB 4B0MB 1EHNA 5TDNA 1ZS2A 1UD5A 3ZIYA 1B90A 3CZKA 1JZ6A 5IQ7L 3IDNA 3SCMB 1DJIA 5D4JA 3SDAC 3VSQA 3ZTJH 2KUTA 1U95A 3MREA 1H5BA 1Q72H 1L9QA 1TCRB 5C7XL 1JNJA 4WO4A 3U0WL 4TVPE 2YEZA 4XCEA 4WTXA 4ANXA 1MW1A 5LBVA 4Z23A 5EBGA 2N1TE 2ZCKH 3U30C 2E7HA 3FFDB 3OPUA 1I7ZA 3ARQA 4PRPA 4XP4L 1WCQA 2FH8A 4KX8A 3VG9C 4YLBA 3QIUC 3NIDF 3WJJA 4Z5RB 4Y5VA 3W57A 4JZOB 4P3WA 1THAA 3ZE2F 1LEGB 3DPBB 5GGSY 1SEBB 1QRKA 4APQC 1Q90A 4KY1L 2B20A 1JAEA 2P8MB 4MB5A 3UZQA 1N64L 5JZ7C 3MLTA 1WLHA 4FYSA 3FHQA 5DQDL 2X0UA 1U8LA 2EO1A 3BAKA 3RY6C 4ENED 3DTDA 4MYWB 3KW8A 4W9DC 1J10A 4X7TA 5C0FA 4A6YA 4V1DD 1AHMA 2IBBA 1KJ3H 3Q7JA 2FO4B 2YWYA 3TZVA 3S4SA 1OAXH 2IO5A 2DYRB 4P2OC 1GYCA 4K7PH 4I87A 2EDXA 3MACH 2VDOL 1VEPA 5AZ2L 1F4XL 1QSVA 4JHAL 4FHBD 3VRJB 1FNLA 3POHA 2CLVB 5AW6B 1U3JA 2XN9B 1RURL 1MW2A 1ET7A 3NSCA 3P0GB 5AB1A 4H2AA 2W0KA 2OMYA 1J8HA 3ZTNH 1F58H 1MWAA 1UFGA 2I85A 4FQ1H 4O02L 4UTAH 3OR6B 1VPOL 5DHVB 1PLBA 1EJFA 2NYKA 1XQ4A 4Y2LA 4LLUA 3S37X 1NGXB 3WNMA 3Q2LA 3QDME 1NCCH 4O00A 3OKKB 1X4ZA 2XZAH 5IOPB 1D5RA 3HOGA 1V7NH 4GRWH 3WLWD 2WSPA 3BUPA 4QTIL 2QQNL 1UXMA 3F7RA 3PWUA 5IJDC 1RFDH 4R7LA 1HIMH 4G6KL 4QRAA 2N7SA 4JVPA 1A4JA 1EV2E 3IXTB 2E75C 4IKJA 3QNXA 5C0BA 4LPCA 1BJ8A 4Z7QF 3H7BB 4JX0A 1KCUH 2Y1ZA 5I8EA 4NQDD 1MFBL 2QGCA 5IW1A 4JFHD 2K6YA 2F54E 3QXWA 2XWTB 3PQYD 3L8QA 4L3EE 3C09B 4N2DA 2VSKB 2ADJB 3ME0A 4X5WB 4NDMA 5FAAA 5I6XC 2RD0A 5IKCB 1AGCB 3LQAH 2GI7A 1M1XB 2BY1A 2OP4H 2FECI 3PY9A 3R19A 3BKCL 4OFKA 5C0CB 3FB7B 4JPVH 2IAND 5FB8B 3FT2A 2DMHA 1JDDA 2BFGA 2Y36L 1BZ7B 3A6BL 1CGTA 2WBWB 1NPUA 2OJEB 4JLRA 2UXTA 4A66A 2VLKA 3I50L 4N5UA 4A68A 2PP9A 1IGJB 2Q6WA 1JWMB 4K7FB 5D7KE 5I24A 5IM7B 3DUUA 4L5FH 3KPOB 3IPBA 2M8XA 5I76A 4WHCA 4JFPB 5I0XA 2XRAH 2ZT9C 3FFCD 1HT6A 2HJKA 4LHUA 5DHXB 4PJIF 3L1GA 4NNXA 4TNWK 3MNZB 1WFMA 5DK0A 4XMVA 3FQTB 1JVLA 1UEMA 5BZXA 3IXAB 4H1LB 4J6RL 1AR1C 2E6PA 2UY6B 1HKLH 2IPKB 3QC6X 3TCXA 2ODHA 5K9QG 5D7IF 1UWEH 3Q8CA 4PJFB 3ZSSA 4LHUD 5CD5D 4WI5A 3QG7L 3WAJA 1LP9E 2QFPA 3VQ2C 1OTTD 5FK9A 3OHXA 2XUWA 2F7RA 4MDRA 2WW8A 3C8KA 2HRPH 5CSZB 4N0UE 4W9IC 1JTPA 1KY7A 2FL5B 2NY2B 2XPGB 4FFYH 4Z95H 2NQCA 5DWUL 3D4GA 2XTJD 5DQJB 1HXMA 2DL9A 5CEZL 2NPLX 3F01A 2HJLB 4MJIA 4MWFB 3GYRA 3POCA 3VDAA 2MCG1 3IJ9A 1NZRA 2H41A 1CXEA 4BE6A 3OBAA 2V17L 4G2AA 1Z5YD 4PJ7E 4PJHF 4XP6H 2ZJSH 3ML9A 1AZUA 5DS1A 4ZS7H 1LO5A 1VADA 2ZOKA 5KG9B 2YD3A 1Z9NA 2HKFH 1UENA 1G6VK 2W9LA 3CN3A 4K4KA 4UQDA 5K1VA 3PQYE 2UUDH 2IIJA 3WO4C 1MW3A 3BAEL 5GGRY 1KC5L 1C12B 1M6OB 1AC0A 3GK8H 2DYPB 3BCFA 4WO4D 2KYIA 5DMJB 2CO7B 4M8UA 4Z7NF 1RU9H 4ABVA 4FP8L 3CZFB 3J2PA 2B1AL 1E6JH 2CO6A 2NUPB 2JXMA 3CFMA 4ZYKB 3LS5H 4HZLB 1MSPA 3FZUC 1JHLH 4HKXB 3ZKXC 4DK5A 4P2OA 5EEXA 3A4FA 3HHRB 5GSRA 3FQWA 3WN6A 3GI9L 4NKDA 3EGXB 4AYFB 3D5OF 4OZFB 5DMGD 4MMYA 3SKMA 1AS6A 1RQ5A 2APBA 4AE1A 2XACC 1F3JA 3FONA 4MJ6B 1G9MH 4HEME 4TUOB 5G5DA 2ZAHA 2EUVA 1J5IA 1F3JB 2X2HA 3ZZQA 1T20B 3KCPB 4LRNL 1JZGA 1OCWL 3QDAA 1YUKB 3MSPA 3L81A 1T1ZB 4DFIA 4E2OA 1FL6B 5LCVL 1CJYA 1OXYA 5CFAA 5GJSH 4WJKB 4HX1B 1PYWA 1WBZA 3BKYH 3HJ0A 1MCPL 4F9PA 2WQSA 1UD2A 4BUHA 3FU9A 4G8EA 1E6OL 1AG0A 1MIEH 1BOGB 2L7JA 1DCEA 3KPRD 4Z3JA 3ARUA 1HSAA 3IFPA 2E8ZA 4X9BA 1QHPA 2GTWB 1J8HD 5CN2A 1NFDB 1CLCA 2CQVA 2YD5A 4EOWL 1IC0A 2CBMA 3B83A 3PGFL 1CXLA 5CR8A 4DVBB 3TASA 3T6QC 1M7UA 2B2XH 1XH3B 1IJNA 3UTTD 2W91A 4FL4C 2H32B 3MROB 3DMMC 4MB4A 5ESQB 3B4NA 5BXFA 5AB0A 2JH2A 3BP4B 3TA3A 4CC4C 1P4LB 4ONHB 4JO1L 3F7PC 2DEWX 4JG1H 4UBDD 3LEXB 3ARTA 1P7QB 2OCFD 3EOAB 4GP8B 3QXDA 3SJVB 1WEJH 1D6VH 2CGZA 3PGCB 5C92A 1R9FA 3ZZ1A 4PW9A 3TIEB 3EFDH 5KYUA 5KW9L 3B2VH 3CQPA 3EO0A 2F74B 1OSEA 3KLHD 4NN6C 3WNNA 4ADJA 1L7TH 2PXYC 5KVFH 2VM9A 1ECYA 2GAZB 3LKOA 2C1PB 2A9AA 3KYMB 1P53A 1FNEB 4JCWA 2A7BA 4F9LA 2ZP0T 3ECWA 2PO6C 1WAAF 4RNRA 5JHLA 3SE9H 2OL3H 2OMTA 3C87A 1XGZA 1PX8A 5EF3A 1EGJH 1BZ9A 4XCFH 1UASA 1JXFA 4FYQA 3W0WA 4D9RE 5HDBF 2VLKD 1YEIL 4GXUN 1KTDA 4ABUA 1I31A 2X9WA 3HS0B 1ZCRA 1A21A 5T3XH 1RULH 1JXJA 1M7XA 4MA7L 1T1XB 2YA0A 5HDQL 1N5AB 4OD2A 1KJ2A 3BUTA 4PRPD 4KGLA 4X50A 5CGTA 1E8WA 5ICZB 1MI5A 1NCDH 1EO7A 3AMLA 1RJLA 1ZA6B 2PW2B 2A2QT 4MNQD 4MQ7A 4L8CB 5ENWB 1WCBB 1Y6KR 3GRWA 3MCLH 3Q8EA 4XNBA 4ZTPH 2BSTA 3ZSTA 3BWUF 4RMSA 1O7DE 3D07A 2EO9A 3IK2A 2VCOA 2CIKB 4G9FD 3FQYA 2RQ8A 5HJGA 4NB7A 1BIHA 3RZWA 4IKLA 1B4LA 2ZXAA 3SDXF 2OAAA 3B9VA 2DKMA 2J6EL 5IB3B 3GPEA 2H0PA 1YEHL 4U4BA 1PY9A 4KI5D 1IC7L 4M1GL 3QEUB 3GSRA 1JZ7A 1MJ7L 3AW5A 1ZSDB 3HEIB 1IV8A 3OKNB 3NQIA 1MNNA 5HDBE 4HIIB 5E2VH 3RGVD 5E9DB 1EFQA 3T0EA 3PAUA 4E42A 4GAYA 4PV8A 3QEGL 3UTQA 2EQDA 2WVVB 1MEXH 1XB3A 6PCYA 4HWBH 3VXMA 4NQXB 1MREH 2JI2A 2P9RA 4G6ML 2OX5B 2O5XH 1R47A 3HPJA 1SOKA 5ICUA 5E6ZA 2I26N 4ZMTA 4F37F 3CNKA 4OUOA 3GSNA 1ZVSA 3FRPA 3GGWA 3H6AA 5CLWA 5JQ6H 3GTNA 5EIQA 5DJCA 4FNQA 3FUHA 5TQ0L 3VI3B 3FRPB 3C8DA 4YSOA 4Z7OE 3EDKA 4OF0A 2QSTA 3GMRA 1IGYA 2YZ8A 4OJDH 2LW3A 3CX2A 1ZRUA 4QF1B 2R0ZH 4LPWA 5LG1A 5DO2D 2IG2H 3IJSA 4WV1A 4XBPB 4LF3A 5FM5O 3S4SG 3RL2A 3FUKA 2VLKE 3FMGL 3K91A 1AOZA 2J5LB 2JQZA 1GMEA 5C6PB 3JV4A 2D3JA 4ACTA 4KUCF 3U6RB 4FMFA 4I77L 3AM8A 2DQDH 3U6RA 2PYED 1CFMA 2ERJB 3DX1A 1ET5A 4JG0H 2IDFA 3DARA 1CLOH 2RCSL 3UZVB 2Q76A 3UIYA 1NGQL 1F90L 4DZBA 2WB1A 4F7CB 2DWEA 2Q76B 4PR5B 3HBQA 3TN0A 3EDDA 3E3QC 3MRRB 4FQJL 5KSAA 5DK2A 1JVKA 3MRGA 1E4JA 2DPKA 3QZNA 4NNYB 2G9HA 3SE4C 4IBSA 4AV0A 2XCMC 4KZDL 2BK8A 4PLJC 4OQTH 4UYQA 1I9IL 4CSSA 3G5VA 3QIBD 5F44A 3QUYD 1ZLEA 5DLMH 4G70B 4HCRA 5C9JA 4YBLC 4XBGB 2J1WA 1ZIBA 2P80A 2EEFA 3EJJX 3MXVH 2V7NA 1ES0B 3MRHA 3VWJC 1JUFA 1INQA 1G5GA 3K8MA 2R4SL 3KR3H 3RNKB 2E5EA 2V7NB 1AS7A 5D2LF 1ICTA 1Q0EA 1UXLA 4FQLL 3NA4A 4K23L 5AVSB 4PGDB 2DN7A 2J8HA 4WSKA 3TESA 4KXAA 4PGDA 3OXSB 2Z0BA 1W0WB 2VE6B 2IWGA 4U1NB 4CDGC 5JUEH 5DJ2B 3REWA 1A7NL 4KKPA 4MNGB 4Q6YA 1IUZA 1ZLDA 1YY9D 4NJ9H 3CDGA 2I24N 4K8RD 1QBMH 2A9NL 3VXSD 5D5ME 5SWZE 1KYFA 4L48A 3CC1A 5D2NA 4ZNEE 3OKLB 1YO4A 1LMKA 2PTVA 5SWQA 2V5SA 3T77A 4HG4J 5CBAA 3GXDA 3IRCA 3OKLA 4MLIA 4QRUA 4WF7A 4IBUA 4FLRA 4P23C 5IVOA 1DEDA 4WK2B 3SBQA 5H37H 2OZ4A 1LP9B 2G3ZA 3KPPB 2WTRA 43C9B 3CXDL 5BO1H 4KJPC 5B21A 1JHTA 1KLGB 2P5EE 5IJBC 3MRIA 1NJ9A 1FORH 2UWEA 3PP4H 1LP9A 5JOPD 2CDFB 1WE5A 1M57B 3ULUC 3EAKA 3AFLA 5D70H 4RWYL 2Q5BA 3F62A 3TT1H 2YGNA 2H6OA 4TLKA 2HFTA 3NCJH 5IMKA 4LAJH 4JM2B 4YHNB 3VXRD 2AJXH 1MDTA 1Z6JT 4PJ9B 4TLTA 2X5PA 2F6AA 5FCUL 2DLGA 2DQCH 1WIPA 2IOIA 1E2ZA 1NAML 2JCWA 4MMXC 1NAMB 5EORL 4I8DA 3BZFA 4Z77B 4OLXH 2ATAA 2IF7A 4X6FB 4OLUH 2HWZL 2NUTA 3EUUA 4PWFA 4OCRL 4RZCA 3HUJA 4HLZH 3LRGA 5CKGA 5HHQA 4PTUA 4D7BA 5D1QD 2NY1C 4CNIA 5CSGA 1JYXA 5DFVD 3D7PA 4PJCB 4TNVK