4NLHA

Skich domain of human tax1bp1
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
115
structure length
115
Chain Sequence
b'GPSSPAHVIFQNVAKSYLPNAHLECHYTLTPYIHPHPKDWVGIFKVGWSTARDYYTFLWSPMPEHYVEGSTVNCVLAFQGYYLPNDDGEFYQFCYVTHKGEIRGASTPFQFRASS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tax1-binding protein 1
publication title SKICH domain of human TAX1BP1
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 15
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17751 SKICH SKICH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2840 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4nlhA00
3VVWA 2LFEA 3VVVA 4NLHA
chains in the Genus database with same CATH superfamily
1KGXA 3C09C 3DMMA 4MDJB 2FZ3B 4AUJA 2H7WA 5HHVL 1KJVA 4QOKD 5CJOH 4BQBA 4NRYA 4M1DL 3RX9A 4PJ5E 4PY7A 2UZYB 2X3AA 1JK8A 1TZOA 4PTUA 3RNKB 2YA0A 2JCCA 3FFCD 2GSMB 4IOIB 2WCPA 1MFAL 2ZP9A 2XN9E 5K69A 4YHPB 3QJHA 2G5RA 3FH8A 4WJKB 1NBVH 4APQC 1QWNA 4KXAA 3PGCA 3VRLF 2EEDA 5FECA 4YUEH 2HG5A 9CGTA 1D5ZB 1RCYA 4EUPG 2HZHA 3CFKA 2DYRB 1PW3A 3VU1A 1CPUA 3AWEA 4APQA 3REVA 4PLJD 3HZKB 3UTSD 4NAMA 5CGMA 1AZRA 4X9IA 3MV9D 2PO6D 3TBVA 1Z6JT 1A0QL 3APNA 3QUML 3VFNA 1N64L 4H26A 1TTCA 4OD3H 2PCXA 3I85A 4MJIB 1RZGA 3QHZH 1IGFL 1FBIL 1MFEL 1QKZL 3ARSA 4YC2B 1A2YB 2KBGA 4HMCA 3TV3L 2J8UF 5FFGA 1K9TA 1P4BH 2YBRA 3SE9H 3Q1SH 3QCVL 5DJ8A 4CILA 4HPHA 1W8OA 1UD5A 1QSFD 5IV2A 1CCZA 2DQIH 1SXZA 5JQ6H 3OAYH 4LLUA 1CICC 3F84A 1YQ2A 2WTPA 4PV1C 4CDGC 5LNEA 4NZUL 5L2JB 2Q7YA 3KVDD 4OCNC 4F9LC 3EDKA 3FCSB 1WT5C 1P7QA 3IMTA 4R5XA 4X5XA 4CVUA 4WZ9A 2PP8A 2YAEA 3DVGA 3U7WH 1CICA 3VI4B 2V9UA 1RK0B 5F9JA 4ZPTA 4W9EC 5TH2A 2HT4C 3X11B 4F9LA 5HVHB 1U2HA 1WT5A 5E2WL 5F7HA 1H6FA 3F8UB 1QYGL 1E5BA 4PJDF 1YC7A 1JTOA 3BDXA 2BWQA 12E8H 4O00A 4UINL 4Y88A 4GKSA 3MRJA 5DZJA 3FU7B 4X9HA 5CHNA 4J3XA 4UT9A 3NIGE 2BNQB 5K1JA 1N70A 5HHVH 1CFTA 4WW1A 5ESVB 3RDJA 4XRCA 1D9KC 3HG0A 5ID0A 1XBDA 4FQXB 2AP2A 2C9PA 1TENA 1NUNB 3HG3A 2FT6A 3X12A 1I3RA 4Y19A 5EZIL 2F54B 1BM3L 1DJIA 2N59A 3RP1A 1KCWA 4KI5F 4ORGA 1D9KA 3TCXA 5HSFA 5HBBA 1KPRA 4Y2DC 4N0RA 3QXAA 3WJMB 5DUML 3V0JA 4HKZA 3VGBA 5F3HB 4AKOA 2VABB 3FOMA 3SYQA 3U83A 2FGWL 1XEDA 1PLGL 4G7SB 5T1LA 3BGMB 3GSWB 4Y2DA 1SMAA 5GGSA 1E5AA 1ML0A 4MBOA 1NCNA 5C6TL 3EGXA 4HX1B 3R06A 4PWIA 4PS8A 1A0QH 5C08A 3H85A 1A6PA 3QUMH 3W0WA 1MHCA 5FDWB 2WKOF 1N64H 2FHBA 4HUWB 1NBYB 3BXNA 1I7UB 1BIIB 4Q6YA 1OHQA 1IGFH 1FBIH 1MFEH 4OH2A 1QATA 1OT4A 3IS1X 3TV3H 1OT2A 2YBGA 4LP8A 3ZR6A 1OSEA 3QCVH 3HAEH 2PTVA 1I7ZB 2MSPA 3RURA 9PCYA 3C6LD 2JKTM 4TL5A 1ZLUK 5C1MB 4XZ4A 2DL2A 3D50A 4XN7A 3QXDA 5ENWB 4LEXL 5CBEA 3CFQA 3T2OA 2Y6SD 4NZUH 5IK3B 1M05A 3L4TA 5KBKA 1AH1A 3ARUA 1WS8A 4M5SA 5DEFA 4WUUB 3FUKA 4HC1L 3RTQC 4Z3FA 2PXYB 3RWIA 4N90E 1MH5B 3OAWA 3SQOL 3GJEA 3TH4T 4AGNA 5E2WH 3KPOA 1QYGH 3LB6D 8FABB 3FB8A 5E5LA 3RTQA 4UINH 5A2FA 1MHHB 2Q6WB 5I0YA 4QHLB 4A7SA 4GXUM 1Y1UA 4XGZB 1FYTD 2H1LM 2GBAA 4KRPD 3RKDD 2VDOL 1T03H 1AO7A 5EZIH 1BM3H 5B7EA 2ESVD 1WZAA 4DZ8B 3I50L 1PU0A 2WIMA 3T4AC 1T5WA 1ZS2A 2VDRL 1FZMB 3CHSA 1L7IL 3ECWA 5LN4A 1DBBL 1BA9A 2ZKXA 3CMGA 4BV1A 3SDAD 4NUGL 3BJ91 5DUMH 1AZUA 1GW0A 1FORL 4KDTC 3WFZA 3T4AA 5IB4B 4LE8A 2FGWH 3CVBA 3VJ6B 1E6JL 3T4YA 1EA9C 5JPNB 2VJ8A 3UAAA 1IAMA 1O6TA 2VQ1A 3VXOA 1DLHB 4PW3A 3DHMA 4XNQA 5KYUA 4P23D 5C6TH 3O0LA 1UJ3B 1VERA 4KDTA 2J5LB 4EUPH 5FO9B 3FQNA 2AV1A 3OZLA 4PD4J 2K78A 1WLHA 3K46A 4FQ2L 1ZTXE 3MRMB 1LO3H 4S1QH 3PWVA 4HJGB 3B9EA 3N40P 4JFFD 4F5CA 4BFNA 4CA4A 1Q8MA 3UG3A 1A2YA 3F5WB 3G04B 3HNVL 3IWVA 3WHXB 3MNMA 1NGXA 3A6CL 3QO1B 5I6LA 4YK4C 3VSQA 4LEXH 4WI5A 3GSXB 4R0LB 5LXGL 3PWPE 1AP2B 5A2JH 3RBSA 1CI5A 3T0EB 4URKA 1J1OL 1HWWA 1I7RB 3RWCB 2MOVA 3WNKA 3AG3B 3GMMA 5GRZA 1VA9A 2NSQA 3ESUF 1KLUB 2EAEA 4NN7C 3CDZA 3Q7JA 1E5UI 3SQOH 1NCTA 5TD4A 2WXQA 1WO2A 3P1VA 4NLAA 3MRCB 4H8VA 4WJG3 4P49A 2JJUA 4PRID 2F18A 2LU4A 3PQYB 1S7XB 3P02A 1JWSA 4JX0A 4JZJB 4MS8C 2FH6A 3NIFF 1U8HA 3SOTA 1FCGA 1I85C 5BRPA 5GQBA 4P2RB 5MEOB 4G9FE 3B5TA 4ZYKB 3FU7A 3CX5K 3GMPB 2IC2A 3GM0A 3HMWL 4M43L 2VDOH 5MENB 3MXVL 1XB3A 3EBGA 4JM4H 3D0VB 1I85A 4FC3E 3EOBA 1E5ZA 4OJYA 3DVNA 3EOAB 4QNPF 4I48A 2AJUH 3T04D 4DFIA 2CO7A 5AW6B 3I50H 3NSJA 4QHNA 1DJWA 4FGMA 1N8ZB 5AOLA 3KAAA 4HJ0C 3LEXA 5EU6E 2VDRH 1L7IH 2AXFB 4E42A 1DBBH 3VYOA 1ZGLP 1VFMA 1T3FA 4NUGH 2QR0A 3KVPA 1NFIB 5A7EA 4Z7UA 3BVNB 1TLMA 1FORH 5L7XL 2GK0A 3B9AA 2ZCKL 2Y24A 4LEBA 4L4VE 1E6JH 1OOWA 1U92A 4IKJA 2FIKA 1HILB 3UBGA 4AYSA 2EIMB 4RGNE 2XWCA 2NDFA 4FFVC 3WFBL 2EECA 2CM5A 2HG0A 3QNYB 3UZVB 4HX1A 3K6SB 3TURA 4LHUA 3B7SA 4BKLA 1AQHA 1I7UA 5DA4A 2VXUL 5EIIA 1BECA 1KUMA 4XOBA 6FABL 4DESA 5MI0C 2EZ0C 3JWDC 4LLAA 3HNVH 5HI5D 1YEIL 4YN3A 3RUGE 3V4VL 1TJMA 3A6CH 4G8AC 5H2BB 3B34A 5ICUA 4BKTC 3ZTEA 3L1GA 3QDGA 3K74B 3QWQB 4I2XB 3SDDB 3IWUA 5LXGH 2R0WL 2KLRA 3FCTA 1QVOA 1NQBA 4G8EA 3KYOA 4M7ZC 1J1OH 1V7ML 5BS0E 1X44A 4RIRB 1VZHA 3LZFH 1JPTL 5IK3A 3QUHA 4LASL 1IMHC 3DJSA 4ONGL 2WKGA 1G7MA 1HS6A 2BHFA 2N56A 3V6BR 3VD1A 5I73B 4NPKA 5ESQB 3S3BB 5AG8A 2JLLA 4AWJC 3ISRA 3T71A 1HZKA 1CD1A 2WZAA 4KUZH 2DIEA 2WAHA 1SQ2N 3GIZL 4FEMA 4ADGA 3H1ZA 1P1VA 2VLJD 2WQAA 4JO3L 4M43H 1L4IA 4JO2L 2AABL 3MXVH 4W9CC 2B14A 3T6VA 2VLKA 3NDZE 1NEZB 5DGQA 2EE6A 5JZ7C 4PJ7B 1XAKA 4FYSA 2A3TA 3CFEB 2ZOUA 3ELAT 1EFQA 1T7XA 4F8PA 3AVEA 4AL8C 5EOQL 3DV6B 4LF3B 4X83A 5D1ZI 3LNFA 1WV7T 3A47A 5C0EA 2XBDA 3IFOA 1XV8A 5DYFA 3VVVA 2XKSA 2ZCKH 4U1JB 1LEIB 1DVFC 3QORB 4ERSL 1JK9A 1M1SA 1QFUL 2BVYA 1TCMA 3VFOA 1J8KA 2VSCA 1NCIA 5IB4A 5JPNA 3DPBB 2DPKA 5D7HA 3NCJL 2J2ZB 2KYIA 4NQDD 1DVFA 2ENYA 1HFUA 3WFBH 4BH8B 3I9AA 3H53A 3MOBL 4OCYH 4WI8A 1JWMB 3UGEA 3WEMA 4ZJ9A 2WOYA 1W2KT 3GB7A 4KQ0A 2E0PA 1VFBA 1HWGB 2VXUH 3A4FA 1DBML 3HZYB 4FTVA 5C0CD 1EXUB 4FJZA 3K4AA 6FABH 1Z5LB 3OKNA 2WZ5A 2R23B 1YEIH 5I16A 1KLGB 1A6TA 4DTGL 5T1JA 5DYOB 2F8IA 3C87A 2IGLA 3QO1A 3SB3A 2R0WH 5F0LB 4Z5RB 4HSCX 4IRZA 2A9BA 1ZT4B 3ESVF 4G8IA 1GYWA 1S78C 3E7JA 1VIWA 4GLRI 3CUPB 3S88L 3GSXA 3QNXA 5DFWH 1JPTH 4FQHA 1SLXA 5F6IB 4LASH 4ONFL 4PSPA 5I1EL 5F3BB 4ONGH 4MZIA 2AQSA 4GG6B 2AQRA 2EYSA 5I8EA 4F15B 4M6OL 3H7BB 1SY6L 2WB1A 3RE0A 1XH2A 3X13B 5LBSL 4IK6A 3OG4B 2Z9TA 1RUAH 2AVFA 2W38A 4UBDD 1NPJA 4O2CA 4X98B 2AEQL 5DK0B 3SBPA 3GIZH 3E80A 1UFUA 2P45B 3QXVA 1PZCA 1CFMA 2WQ8A 2HLFD 4NQSB 4JO2H 3MV7D 3T0WA 1DQQB 3VI3B 4PJFA 1U91A 5JHDB 2CKNA 1N3NB 1QSZA 1GYVA 3QUMB 1IGYA 3U0WL 3ZYIA 1L9QA 3DX4A 4DK5A 2A6IA 2OMYB 3C9NA 1WG3A 5DJCA 1NOLA 3TZVB 2WCSA 3VXME 1A47A 1MHEA 1SBSL 2IIJA 4JFEB 2EIBA 2VIRA 1YMHA 1TNMA 2CR0A 4L8DB 4WEEA 5DU7A 2GI0A 1CFVL 1T1YA 5HGAA 5EC1B 1V3LA 1XXFC 1JDAA 1QFUH 3Q2VA 3CFCL 3QZMA 1E42A 2Y5QA 3BVNA 1RIVL 4NO5A 2MHAA 4FI6A 3L95B 3LKOA 2AQTA 4NO0A 4OKVB 1JRHI 4HAGA 4Y9CA 2VXSL 3O3BB 3NCJH 3P3RA 4KROD 1NH6A 3D07A 3IJ7A 4BK5C 3L4CA 3MOBH 1ONQB 1T2JA 1T5XA 4YHKL 1PNCA 2JE8A 3EH1A 4P46C 3SDXF 4C4KT 1DBMH 3T3ME 4HBCL 5IHZA 4BK5A 2LT9A 4XX1G 5I74C 4ZMYA 5INDA 3BKCL 5B1AB 4IRSD 4OCMC 3S3JA 4GAYA 2ATPA 4DTGH 2QADD 3CFDB 4P46A 1OGTB 1GGTA 3FYEB 1A1NA 5DUPL 1WWAX 1M7IB 3PNWA 1HE8A 3B5GA 4FXLA 1FL6B 3T0AA 3WS3B 1M7UA 1AG6A 2FWSA 4MQSB 2CHNA 3S88H 2D7NA 5ESAA 2LU7A 4ONFH 5I1EH 5B1JA 3CPLA 3K1DA 3GXTA 5BZWA 1Q9KB 2P5WD 4U1KA 4LT7A 3BIKB 4W9IC 4YNYB 1TFPA 1AY1H 3AAZA 1JXJA 3LH2L 4CKQA 4M6OH 4NZTL 1A6UL 4I0CC 1SY6H 3BW9B 1OF2A 3DJZA 2I27N 5LBSH 3O11B 4ZNEE 1XCTA 2GTWB 1IBZA 2JQMA 5SWSD 5SWQA 1SJXA 3DETD 2ODIA 2N1KA 2AEQH 1ROCA 4Y8AA 4YSRA 3HE7C 3MA7A 4IDJL 4P4KC 3WNIA 5JORB 3IRCA 3BCFA 4QT5A 1BVKA 3KW8A 1SJHA 4EUPB 2WAQA 3U0WH 1G7LB 1DN0B 3HE7A 2LVEA 3KXFD 1I3VA 2H0JA 4P4KA 2XV3A 2C3GA 2FNWA 1JIBA 2B3RA 1SBSH 1M6UA 3C6SB 3KPSE 3NN8A 2MEJB 2QKIB 1A7NH 1CFVH 4Z7WB 4OLWL 5K9JL 2C1PA 5GZNC 1DQVA 1NGYA 1JNLL 1KGYE 5JW4M 2WB7A 1XGRB 2XWTB 4HDIB 1SF3A 5F89A 2J20A 2Q87A 2OK0L 5BRZD 3L3GB 1BFTA 3FO0L 4X6BB 3M86A 3UBXG 5EORL 2FBJL 5GZNA 1WBXB 4JO5A 3P11L 1BAGA 4G7YL 5PAZA 3V4PL 4XO9A 1C08B 4YHKH 3KNBB 3VH8G 5EZPA 4HBCH 3QWRA 3LZRA 3PGDB 5E99L 1AS7A 3K4ZA 4FA6A 3HI1A 3S8WA 3BKCH 4OR1A 3H9YA 5JW5B 4N8PA 1GL4B 3CX2A 2EE9A 3I75A 3LNDA 3G3LA 1Q9OB 1TITA 5DUPH 5BZXA 4QI3A 3FTSA 1KLGA 2WO3B 1EVUA 4X7CC 5DHYA 2JB6A 1HYSC 3HBZA 2D3LA 4MNGB 2IPUG 2YUXA 4JDEB 2Y9RT 5AENA 1UB5B 2WLHA 3ETTA 2BS8A 3PL6B 4IOFC 4OGQC 2DQHL 2G3ZA 3CXHK 4I89A 3HBPA 5DS8B 4C58B 5DJYB 3LH2H 3OD3A 2DIJA 2Y5TB 4NZTH 2XN2A 5IJKC 4B3EA 1TVHA 2VDRB 3QUZC 3OTTA 4LLVB 2JKLA 5HHNB 3SCMB 4Z23A 1OW0C 3BZ4A 4R97C 5IMLB 2G2RB 1I9JL 1S9XB 4UDTA 3X13A 3I2CL 4N0UA 4OZIB 4OFQA 5IJKA 5JHLL 3OC5A 1DTUA 1U3HD 3LRHA 1NBZA 3QUZA 1DZBA 4IDJH 2I32A 3GHBL 2FUTA 1OW0A 1SJVA 2XWRA 4Y2OA 3NIGF 4WU5A 3SKOB 3SKNA 3WN5C 3BYYA 1D7FA 2VE6A 4NAJA 4KNQA 4PRHB 4KDWA 3VFRB 4YE0A 3EYFB 3GXMA 3FN0L 1AXSB 1AXTL 3A5VA 3FO1B 4N3UA 2YOCA 4XCEA 4HU2A 4PJGA 3BDBA 3Q48A 3WN5A 3IVKA 4HETA 2K9UA 1YDPA 3VO0A 4A39A 2ZUTA 4OLWH 3EYVA 1KJ2B 5JLZB 5I5RA 2IVFC 1RUML 1JNLH 4JHAL 4NGHL 3HAEA 3UEZA 1KPVA 4HWUA 2OK0H 2KDGA 3FO0H 5D1QD 5KJRL 2MNJB 1J87A 5EORH 1NFDB 2FBJH 5D96C 1OHZA 1MFCL 1MRCH 3B7TA 4G7YH 2NY1D 3OAZK 5LB1A 1A7BA 2AGJL 1E5YA 1XF3A 1MW2A 4B5EA 4EI6B 2X42A 5E99H 4HS8L 2D9QB 3RVXC 1U95B 4W9JC 1PJWA 5E6RB 2F7RA 5AZUA 3X14B 1OAQH 1S5HB 2JJVA 1QTYT 3DA0A 2LV4A 1LMIA 2FD6L 4WWKD 3CFDA 3U6RA 5H94A 2NNXA 3GIVA 2I9TA 2MCPL 3L4WA 4GRLD 3EDJA 4A2DA 1GGUA 1JV5A 2Z31D 1CD8A 3R8BB 4NWTL 2DQHH 4NZ8A 3OSKA 2VQTA 2H0EA 1ZLWH 1XGQA 5EU5B 4RGOL 4QRSA 4Y5VB 1MRDL 4E5XA 3ATDA 1ZTXL 4DNLA 5GSRB 5AAMA 1A66A 1D6EB 3BIKA 4IS6B 5TE6L 4G83A 4FQQA 1I9JH 1JMXA 1FUNA 2C9SA 2HN7B 3I2CH 4YHNB 2LLLA 4ZXBD 5JHLH 4HSAC 2A9CA 1LO4L 1U8QA 5LAXA 4DVBB 2B77A 2JKNA 3GHBH 3HHSB 3QHTC 3TEXA 5ID1A 5IVXE 2VSDA 1SDDA 5I30H 2LTQB 4AEEA 4KAQL 2H1PL 3MUJA 4R7NA 2PN5A 3OMIB 4GXFA 5KBMA 2JF1A 3QPQC 5D7JC 4HA1A 3W2DL 3FN0H 6PAZA 1AXTH 4ZODA 4IHBA 1G7LA 5SV4A 2ATAA 4HS6B 1MWAB 1CL7L 2CCVA 2ZP0T 3DGDA 4MCZB 3PV6A 3WI9A 1DCLA 5AW9B 4L1LA 2CQVA 5D7JA 3PHQA 3ZT5A 1BXVA 2X4SB 5DEGB 4JHAH 4NGHH 1K3ZA 4OLXL 3T0BA 3SGJC 3U2SA 3N85L 2CO1A 4OGZA 5KJRH 1QEWA 3ZBMA 4Z7NE 4A7GF 2XWTA 1MFCH 1IEAB 3B9DA 3MCKB 2OZ4L 1W72L 1I9EA 3CU7A 4FHBD 2AGJH 4Y4FB 5G55A 5HHOE 4CVWA 2F6AA 2X70A 4HC1A 1NCWL 1NGWB 1Q38A 4UQIM 2YAPA 4HS8H 4S2SB 1NUDA 3CC5B 1S7SB 4MNQB 1M7DB 1A02N 1XCQB 1IC4L 2PYEE 3QJUB 1OTSC 4J6RL 2CWRA 2ZKWA 2FD6H 1RLBA 1QRKA 4XXDB 2EDMA 2OMVB 5D1ZC 2X41A 5CJQL 1DDHA 1T1ZB 3CK0L 5B7MA 2IDUA 1EXHA 5KW9L 2XVLA 1CVSC 3TVMD 4NWTH 3QDJD 2KPWA 5EDSA 2A5UA 4AXWA 1ZE3H 4WIQA 3VFWB 1Q9WA 2HLAA 2OQJB 4HUKB 4NSKA 4IOSA 1II4E 1EZLA 1MRDH 2P4AB 4X99B 5D1ZA 4LCWA 2ZSVB 1ZTXH 4O58L 4LSTL 4D0DB 1I8KA 3VNZA 5JR1H 3DARA 1LVEA 4HJJL 3RNQA 1FL5A 2CBPA 2AZAA 2X6AA 3EDDA 1LP9F 3V6OC 3AM8C 3JUYA 1LO4H 5BRQA 5IMLA 1BYPA 2JB5L 2RACA 4YDNA 3BWUC 3UACA 2NX5A 5J13C 4DEPB 5C9KA 3AXIA 5JOPD 4KAQH 3V6OA 2E59A 3AM8A 1D5IH 2JQZA 2H1PH 1KBBA 3WE6B 4NEHB 4PW9A 1IE5A 5C9JA 3R8QA 3W2DH 3MLXL 5F7MC 4AJYV 3M1CA 4PJCA 4M4PA 3JWNE 3SODB 1CL7H 1WZKA 4JVUA 4GW4A 1ZSDA 2FE0A 5IBTH 2NXZB 2NT0A 4U6YB 1CE1H 3ZO9A 5D5MA 3KGTA 2A2QT 5FFOA 1JHKL 1UH2A 2ZXDA 4X5LA 2XWJA 4OLXH 1HHGA 3VXUB 4G8GD 2KUTA 2O5XL 1I8MA 3N85H 4ABQA 1CLVA 1C1EH 3WUZA 1MCHA 1C7TA 4M56A 4F2MA 2ITFA 3DX1A 5BVPL 5DEZA 2OZ4H 3L16A 1J88A 3DGGB 1NFDA 4P8QA 5LHDA 2WWMD 1GIGL 1NCWH 4GAAA 1AGDB 1XZ0B 5CZVL 3CFMA 3DX7A 4XO3A 3DKHA 3QUXC 4ES9A 1WCBA 3VMOA 1BOYA 5KUKA 1FO0L 3BN9C 2ZAIA 2QGEA 4J6RH 2Y1AA 1DUYB 1AC6A 1KBWA 1NDMA 3BKML 1YEKH 3LX9A 4GRMA 3QUGA 5HGBB 5CJQH 3RUGF 3QUXA 4PJ8B 3CK0H 1RJYA 5IFAL 2OMTB 3RFZB 2EUVA 4H0HB 4JCMA 2BCKB 2F53B 5FAAA 4Z3IA 5LWYL 2GJZB 2VZ3A 3FTVA 2UWEB 3VXRD 1I53A 2YSSA 4O58H 5JPMB 3LRLA 4HEPA 5LGJB 4LSTH 1F4HA 2DQFA 3L48A 3W37A 2OYPA 1NWPA 3SPGA 4HUVB 2CALA 1E3ZA 1JP5A 2DBJA 3K6FA 3ULUD 4POZC 2DH3A 4J8RB 3KDPB 1OM9A 3EOTH 2GPZA 5HJGA 4BQCA 4P05A 2FR4A 2IQAA 4OB5L 4QPEA 2JB5H 1QD0A 3WLWC 2DM7A 3PFQA 5TDPB 2JI2A 3DX3A 3P3SA 5KYYA 5E6IB 4OJFL 2JFCA 4YBQC 2HTLC 4BELD 3MLWL 5I9QB 1EAOA 5DQJA 3G5ZB 1OQXA 2IBZY 4AX3A 3MLXH 4IKNA 2Y2YA 4JANA 4F7MA 1WIPA 1KXVC 3LQZB 1E3XA 4B97A 1X9LA 2AF2A 2EE3A 1BZOA 4JZNA 3P73A 2XA3A 3KZ8A 2B4CL 4YOKA 4M00A 3VD3A 2CA4A 5C3LD 1WPCA 2KC0A 2VZSA 3II1A 4MCZA 1JHKH 4HUNB 1A9EA 1KXVA 1JZIA 1RFDL 3HE6C 4LKXA 5HHME 2O5XH 4EXPX 4PJHE 4C56B 5D7KD 5BUAA 3V4VA 3C2SA 1IL1A 4ZSOA 2A73B 4B6ZA 3FONB 1ZKAA 3NFPB 5FXCH 1F3JA 4B3VA 5BVPH 2VNCA 1IAIL 3RGHA 3HC4L 2UZIL 2DLTA 4DGVL 1SQMA 1A8ZA 1L9PA 4PJIA 3X3FL 1GIGH 2CH8A 1Z3RA 2WXJA 4JDTL 4JDZA 4OKDA 5CZVH 4QY8A 3LVEA 4PRAA 4XN5A 2YD6A 2XY1A 4X7TB 1FO0H 3OKMB 5DDHA 2ZWKA 1KYOK 3QEUB 3ZVVA 4AC4A 1XCXA 2QGDA 3ZGIA 1RHHA 2J8HA 3BKMH 1ZGLB 1OP5K 5IFAH 1XIWD 3CFBA 4LL4A 3MJ8B 2NUPA 4AEFA 3LRMA 4AMKL 3IU3B 4M4RB 3HC0A 5KVDE 4PH8A 5E7BA 5DT1L 4LPTA 1HIML 1Q0XL 1JDDA 1YRKA 2DMGA 1SJEA 2DMCA 2IQ9L 2Y36L 4RFEA 2G9HB 5K9OA 4G82A 3SZKC 3BIAX 4KQ4L 1XWVA 4X6CE 2AK4A 2CK2A 1N0XH 2W65B 5F9AC 1JPFA 4AQEA 1KCLA 3BFOA 3T08A 1RY7B 2XHNA 2WWKO 4OB5H 4DEPC 2EIDA 5A16B 3U2JA 3N44B 1LEKB 2XUWA 3OKLB 5HVGB 1KACB 1QASA 1MG3C 4OF0A 3SIKA 1KTLB 3QA3B 2YHGA 4OJFH 4XC3H 2NLJA 3EFFB 1ORSA 3FQRB 5F1IB 2OP4L 2WXMA 3ZQXA 1KULA 1Y1DA 5J6GA 4A63A 2HUEA 4HWNA 3ESPA 3DTUB 3H6JA 4A7QA 1KG0A 2IPUK 4XR8C 1MQ8A 2CUIA 5J3HD 3CD4A 1NBQA 3JSSA 3TO4C 4LRIC 1TU2A 2B4CH 3D85D 4BWWA 1RFDH 4UQCA 4KMQA 4GUOA 2H32A 3MJ6A 2VLRD 4F80A 4LRIA 4MYWB 4ZW6A 1K8DA 4MCYB 2X6BA 5KBNC 4EDXA 1IAIH 5SWZD 3HC4H 4L8BA 2UZIH 5C0AD 5F70A 4DGVH 5HYJE 1IGIL 1U42A 1J12A 1DCEA 3VXPB 3FZUD 3OV6A 4G6FB 4UM8B 1A6ZA 1GZPA 2XG4B 1J8HD 5KVFE 1IQDB 5DHMC 4AM0A 7PAZA 4WU7A 1BV8A 1KTRL 2ED9A 4LAQL 4KJPD 2I7SA 2CDEB 2B59A 1MAML 1PFCA 2MQGA 4KTYA 3BWAB 3D08A 3I9GL 1OXYA 3T3MF 1RZ7L 3VTAA 4KY2A 4W6WB 2ZYIA 3GHEH 5LBSA 1UD6A 4CMMB 4LPCA 2IDFA 2X4PB 4JM2D 5B39A 5KTEH 3VWJC 5KVEE 5J5EA 3UO1L 2BVTA 3MCLL 4ZMZA 4J3OD 5DS1A 4AMKH 3APDA 1ZHKB 4HIXL 2OMTA 4AIZA 3FW6A 1M7XA 3O0RH 5DT1H 2IDTA 3VWJA 1HIMH 1GC1L 1Q0XH 3NCCB 2IQ9H 3GS4A 2ZOLB 3QWOB 2GITA 1HOEA 2R51A 1UB6A 4KQ4H 2DEWX 3GJFH 1I1YA 2NY5L 2PNDA 2V8MA 4X80L 4F1ZA 1PS3A 1WBZA 3ZUCA 5FWRA 1TPXC 3C5ZB 3N43B 2GSIB 1ZT1B 3AQYA 2O5NA 3NPZB 5EUOB 1CFSA 5IVNA 1G0XA 4A2LA 4L3EA 1KY6A 1MFBL 1YPZE 2H47C 4PJAE 2P8PB 5CGYC 5K93A 2K7QA 1SXSA 4GS7B 1BMZA 3N42F 2HT2C 2YPLE 1AFVL 2OP4H 3DO3A 3NJLA 4TQIA 1BXXA 5BOJA 4NJ9L 3H9SE 4W9LC 3KJ4B 4PJ5A 2G75B 4OZHE 2V7NB 5CZXC 1AHMA 2BVPB 2QVTA 4MMYA 4G9DB 4N86A 3UBXB 4MCNA 2XN9A 4V1DB 3F2LA 1LO0L 4LQ1A 3VH8B 4XMVA 1UXWB 4Q9QL 4ANXA 2JLPA 5JDSA 3B37A 4H25A 5E2VL 5KYXB 4C56A 1B4JL 4WEUD 1IT9L 3EHBD 3RB5A 1IGIH 1JMZA 3GS0A 2Y7SA 3JYBA 3KHQA 4WRLA 4KXDA 4RGMB 1T1XB 3MKKA 4LAQH 2DQDL 3WTXA 1KC5L 1MAMH 3QQDA 3I9GH 3VQMA 1BX2A 3J07A 4MB4A 2N0KA 3HHMA 3QIWB 2QTVA 1XGPB 1F8TL 3BT2L 4DOHB 4L37B 3QJQB 4GUPB 3ME0B 3UO1H 3MCLH 4RFNC 1DL7L 3PDOB 1WJ3A 1ZGLA 2WPGA 4NBZB 2VGLM 3DC0A 2ZXAA 3MLZH 4HIXH 2X4QB 2QPDB 2H9GA 4D3CL 5E1AB 1GC1H 2E86A 4FX5A 2WMPA 1XSIA 1MCJA 3VMNA 4HK0B 4FYQA 4FFTA 2X3CA 3C5SB 1QMUA 2NY5H 3O6FB 4AUUA 4X80H 3E6FB 3V7AG 3E3QE 4WHTB 2J8OA 2A4ZA 4H20L 3BUDA 2VRAA 4R5TA 4XP5L 3F6JA 5KSAC 1I8LC 2DYPD 5HGHA 2GJ6D 5DJ6A 3OKYA 3D30A 4GAFB 1AQ8A 1AFVH 1G1CA 5I18L 4N2GA 2R39A 4ZTPL 5KANI 2YD0A 4NJ9H 4DP2X 3GTTA 4LOUD 1P2CA 1I8LA 4M8UA 2OX5A 5DZVA 5KSAA 3ZHLA 2BNUB 1CGYA 5BZZA 3MRBA 3Q6FA 1THAA 4YX2L 4B50A 1IM9B 1L7TL 3PJSA 2PWEA 4RDQF 4F7TA 3V4PA 2X4TB 2FJHA 3NPSB 2YIHA 5CEZL 1V05A 3D18B 2ALWA 2DQEL 2XWDA 4M29A 1LO0H 3OKKA 5ACMA 3C8KB 3WNNA 3FHEA 4GH7B 2IADA 1IU1A 4Q9QH 1MFUA 2CRMA 5FGBC 1IM3A 4QRPB 5E6SB 2MPAL 5E2VH 1B4JH 1IT9H 2DIBA 2BP8A 2XTJD 4BFIB 2H6PB 2EEFA 1A21A 2VN4A 2EDHA 4GP5B 5FGBA 3PCYA 4H13C 2VMDA 1UOLA 4FCHA 4ODWA 1U8KA 4U7KA 5C09B 3DURA 2ENJA 2DQDH 2XVGA 3MRPB 1C16A 2I60L 1KC5H 4TN9A 2BSTB 3H9HB 1KELL 1BEXA 4OLZL 2HFFA 1U6AL 4M1CC 3GI9L 4N8VG 3BT2H 3ZKXB 4X42A 1PZBA 3O8XD 2ARJQ 1CXFA 1DL7H 1L9TA 2YWYA 3EIFA 3GI8L 2Q3ZA 3JXAA 4K2UL 2X4PA 3MRRB 5INCA 4IW4C 4LHQB 4PD4K 4AOFA 4YXLL 1D7BA 2JTDA 3AGVA 2E7BA 3ALXA 4CNIA 2PW2B 4QYOA 3L3DB 1X7TA 3CBJB 4CVXB 1S7UA 2FX7L 2LU5A 5KYNA 1BLIA 1DVSA 3D06A 4CBPA 4JEGB 3NG5A 3U36B 3H9ZA 5LGHH 5D6DC 1KB3A 1WF5A 2W07A 5F6HJ 3QZWG 3AS3A 1FN4B 3Q2LA 4H20H 3QHFL 1FL3B 4L9DA 4XP5H 2CO6B 3VCLB 3KBEA 2FEDD 2R2CA 3WD5L 1JZ4A 3DUSA 1HOCB 3ESMA 5D6DA 2OFQA 3V79C 1E4XL 2A74C 5I18H 1JZDC 2BIOA 5IHLB 4ZTPH 5DO2D 3RWFB 1ZMYA 5DK3A 2R0ZL 5JXAL 2AXJA 5TF1L 1CS6A 1UXMA 1MIEL 2A6KB 2X87A 2XKNB 4N85A 1OE3A 5IVXF 2J1YA 5SX5K 4J4PC 2KMWA 3VB9A 4A2EA 4B0MB 5TDNB 2A74A 4YX2H 3AG2B 3MREA 1L7TH 3P0GB 1G7HB 1TQUA 2BK8A 4TNFA 1BVLB 2Y0SA 3ZY7A 1AANA 2VLMD 5CEZH 1GZQA 1FNEA 1NIDA 5EMYA 2DQEH 2E75C 2X9YA 4L8SC 2UXGA 4F7CA 2BVPA 3B3BA 4J4PA 4G1EB 4OV5A 1N10A 1KIUA 4V1DA 2TSAA 2K4WA 3Q13A 2FCBA 3NT0A 3PYCA 1TG8A 3L2LA 3T3PE 3STZB 3LYRA 2YAMA 4L8SA 1ZE3C 4LEEA 4RBPK 3NIDB 4XNUL 1D2OA 2YXFA 3SDCC 1NCHA 3IDNB 4NM4H 2YPVH 3DMMD 4Z7NF 3G6AB 4PBWD 2EVHA 5ETUA 2I60H 2W94A 5C0IB 1MSPA 4R4ND 3RPKA 5CMAB 1KELH 5MERA 1BQSA 1JNHB 1PAMA 1T20A 3C5JA 1JGVL 3F58L 4NFBA 4OLZH 2ADJB 4LMQI 3SDCA 1H6TA 4FNLL 3V5HB 3GI9H 1YAIA 1B0GB 4HHGA 5KOVC 3IEAA 5CLXA 3FT1A 3NEEA 1N6VA 5DRZA 5E95B 3ZKMC 5D7LB 1UM4L 5E94B 3GI8H 43CAB 2N1TE 2OYMA 4K2UH 1S2EA 5ISZB 5F7NC 4YXLH 4ODXB 5C86A 3IMBA 4HAFA 4RA0C 1G7IB 3BQUC 2QVMA 1BZEA 4FTDA 4A2MA 3PWPA 2FX7H 4JM0A 1U8IB 4R2GC 4J3VA 4APQD 3W5MA 3RRQA 2RH0A 5E1AA 5T1KA 4UUJB 3ZT7A 3EG9A 1KTDA 2Q86A 1XH1A 3BQUA 1UD4A 1ZCRA 3ATEA 3QHFH 4AVIA 5IQ9B 1JAEA 4X7SL 2KT6A 4Q9CA 3WD5H 3KYAA 4BSJA 5IUCA 4XVUD 3ZSSA 1NIBA 1K6QH 1TSHA 2VQ4A 4HUUB 1E4XH 4HKJB 3UERA 3DPDA 4G9FA 5JXAH 2OJEA 1TTRA 3E6HB 1MIEH 1GZHC 1VKXA 2VUYA 2ICCA 1Y7VA 3ZRFC 4ZOEA 1OALA 4KRNA 2OZ4A 1W72A 1YN6B 2E7MA 3A67L 5IVZA 2BIMA 4OZGB 1U8JB 1OTTC 1P7QD 3DTXB 1GZHA 5EU6A 2I25N 5A6LA 2ZG1A 3WELA 3MXWL 5CGBA 4ETQA 4PP2B 3HPJA 1CICD 2OJZH 2X4RA 3L5JA 4N6QA 4U1IB 4RGNC 3U82B 4NKOB 2DWEA 4L4VA 2DMHA 3S3SA 4BUGA 4L3CB 4HUXA 1NWOA 2AQ3A 1R6VA 2V17L 3F64A 1BQ5A 4XNUH 4UOJA 5FIEA 4BFJA 2WN3A 2NY3B 4A7UA 1B2WL 2E9IA 3O45B 2HSIA 2B20A 2YQ3A 4HFUL 1A6AA 4W9DC 4XAKD 3S5LG 3VXNB 2AEOA 4I3GA 3JWNH 5FO8A 3BZEB 1F56A 1JZHA 3D09A 3PE9A 4Y4HC 2QBWA 6TAAA 1JGVH 1UGNA 2W1NA 1FSKC 3F58H 3QJVB 5EOCL 4X6DE 1O7SA 4YVNA 4Y19D 3H9HA 1X5FA 3FO9A 5KS9E 4U1GC 1UM4H 3IDMB 1D9KD 3IDGB 4Y4HA 5ELIA 3BUYB 5DC2A 3RUGA 2F15A 4HV8A 3ZE0B 5JOFB 1F1DA 3N2JA 3U46B 5JMOC 4JR9L 5C0DB 1GTFA 1JFHA 3DUUB 3BD4A 2C3WA 4MJ6A 5M7QA 5FK9B 5BS0A 5T1LD 1LNUA 4R7LA 4Y2DD 3U4EA 3HVNA 2WZPA 2PCPB 4UM9B 3NP3A 5I5IA 4X7SH 5C08D 3W0WD 5DLML 3VE0A 2CLZA 3GXFA 4JG1L 1FLTX 4FLHA 3F7VA 3ZTDC 1QFWL 3ABKB 2VDKB 1YEJL 4QRRE 1JERA 2CO6A 3KDMB 4Y5XB 4XN8A 5GS1C 1P1ZB 1J05A 5CP3A 3EH3B 3UZQB 3N50A 4MKMA 3RU8L 4EMZA 4PLOB 4ZAKC 3ZDZF 3CIAA 3TEWA 1P5UC 5KVDL 3VGAB 3APFA 1ERNA 1HL8A 2O6PA 3ECBB 4MMXC 3VYNA 5GS1A 4CC1A 5E8NB 5GGSY 1CGSL 1N0LA 1X5AA 3RGVC 2XWBB 1RJLA 1F11A 3A67H 3FN9A 4ZAKA 2P5PA 4BZ2L 1LE9B 3W5NA 3PDGA 1P5UA 1PDKB 1G7HA 5GRJL 3MXWH 4C55A 4MMXA 3ARBC 1H15B 5DJZB 5DHVB 1XO8A 3RGVA 2VM9A 5IEKB 1SRDA 4TS6A 2V3DA 4OF8A 1FO0A 3KPMA 5D55A 1KF9B 4PRPE 3MGOA 4UQ3B 1YEWA 4PJHF 3RTQD 3ARBA 2V17H 3NZ8A 4CMHB 3STZA 3MOQA 1JSYA 4JJOA 4KK9C 3IPEA 1B2WH 2DJ4A 4HFUH 1IARB 2YZ8A 3VSVA 5GZOC 2I9LA 4MS6A 1GS6X 1OCWL 3NCMA 5D2NB 3IDNA 4JNXA 5T1MB 1PNDA 3G7TA 4K73A 5DCCA 2JKJA 1ZTMA 1PG7W 2GSGB 3DYMA 5EOCH 5K33A 1AO7D 3D33A 1U8LA 3PWJA 5GZOA 4QCIA 1KIQB 2ZUQB 3FRUB 4WNQB 4GKZA 3GMNB 3IDIA 1Y18B 2ADJA 1W0VB 3G6JE 2UX7A 2GYSA 4U7SA 1B0GA 3S3DB 1R3HB 4HJUA 4HGWB 3FH5A 2F8XC 1NANH 3ES6B 4K7PY 4YSUA 3TNMA 2XQYA 2MMXA 2VAAB 2YJQA 4JR9H 4G8GE 4NHUB 3EGDB 2ZJSL 5L9DL 4QF1A 4RNRB 3ZX1A 3WEBA 4M93C 4ATWA 2B4CC 2K6WA 1HCZA 3ESOA 4ZMQA 3OKEB 1AQKL 2WM0A 1MI5E 5EOTB 1TVDA 1DE4B 2X38A 3ATAA 4JG1H 4TUOA 1QFWH 3MLTB 3QUYB 1YEJH 1YVLA 4JHZA 2UX6A 1N4XH 1FVEA 2HJKB 3G5VA 5KVEL 2BVQB 2EDYA 3SGDI 5DURB 4F92B 3JZYA 2VOTA 3RU8H 1FIGL 1SOQA 1TVBA 4XXWA 1M3IA 1KSRA 5KVDH 5TFSL 4N28A 2VTFA 3HZVA 1CGSH 3CXFA 4RZCA 4ODUA 3NH7L 2DJMA 4BZ2H 4E9WA 3TEYA 2X3BA 2EEBA 4KK6C 5EBMB 1JI2A 1X3DA 3N1PC 4XMWA 4NQEE 5GRJH 4AGQA 2FSEB 5F3FA 3VXMA 3QFJE 1U8JA 1HZLA 1TEFA 4LKCB 3ULUE 3NZSA 1IC7L 2FJGB 3VSTA 2XG5B 3TA3C 4JRYB 4FQCL 4LLWB 3BP4B 5ICYB 2NY3C 1I4FA 1UGKA 3GMLA 4KMTL 2V3EA 3BSZL 5F1OB 3QG6A 3PWLA 1UG9A 5C6PB 5DTFA 3TA3A 4IRJC 3UPAA 2NYKA 3ILPB 4PGCA 4MS8D 4PIRF 1S4IA 3KJ6L 4HH9B 3NGBC 4PAZA 4TUUA 2ZD0A 3R19A 2DF3A 4OJEH 5D1XB 2BVEA 2Y7LA 4U33A 5CEXB 3GJFA 4IRJA 1JNJA 3KL0A 2YKLL 1T21A 4NKDB 3STLB 3BUYA 2BP0B 4JK0D 4AGLA 2ZJSH 4AGMA 4K71C 4TMPA 2IFFL 5L9DH 4FMKA 3GSVA 4HJ0D 4HWZB 3U46A 4H7VA 4A6YL 1K85A 1INQA 4KKCC 2J8UB 3VFUB 2JI3A 4RVBA 1UUNA 2JXMB 3ASWA 2R4SH 1HHHA 3ARDB 3VD7A 5GS0H 1NJ9A 2E6JA 3UCRA 4UIMB 1XEUA 1DBAL 2IAAC 2W0KA 3NRFA 3P0YL 4LHUD 5KVEH 4HIQA 4IBSA 4QEGA 1HAUA 2WGNB 1FIGH 1YMMB 3HRZC 2KL6A 3ML9A 5IHHA 4PJAF 4X0KB 2C9QA 2A4EA 1UFGA 4MJ5A 4H8WL 5C2BL 2IOMA 1JPGB 2QGBA 5KG9B 4LCCC 5TFSH 1KGCD 2DRUA 3RJQB 3O4OC 3CNKA 2IGTA 3QDGD 3HRZA 5EUKA 1XF4B 2DLHA 2ED6A 3NH7H 3G6DL 4UYQA 2X6VA 1SN5A 3PREA 3P69A 1IILE 1MFDL 3QULA 1KGJA 4OZHF 4PJDB 1RUQL 5EH1A 2OYKA 4UQ2A 2VYRE 3PPSA 3SYAA 3VXSB 2E56A 4LNVA 4WO0A 3KPSA 4U0QB 1EBAA 2B8OT 3JWOH 2JK5B 1OM3L 3VD4A 2IWEA 3MLPA 3FPXA 1RZ8A 1IC7H 1QR4A 5AVYB 4RQQB 5FO7B 4FQCH 5GRUL 1FFNA 1XR8A 1C9SA 2HB0A 4KMTH 5IF0B 2AERT 3BSZH 2ZX7A 2CR3A 2EP6A 5FYJU 4NQVB 1P4LB 2PKDA 5AW0B 4Y1AB 1O6SB 2AV7A 2V2XB 2F61A 2VLKD 1BMWA 1NTDA 4NCDA 3MACL 5EF1A 3B4NA 4NO2A 1GGBL 2WBWB 4UQAA 3A3YB 4Y5YB 2YKLH 2YPKB 1MEXL 5AVSB 2LE9A 1TQBC 4LGRB 4NQXB 5JZ7D 1PLCA 2AI0L 5T3XD 1R3HA 4WI6A 1OCZB 2IFFH 1RZIB 4XP4L 4CADB 4DKEH 2EH8L 4DF9A 5LBVA 2MIZA 5HGGS 4FLOA 5IQNA 5SWZE 3X17A 4I9XA 5F21B 2O5YL 1HHJB 4FN0A 2Q76A 4MSWB 4GRWF 1DVFD 5A43C 3MFGB 2ILLA 3F00A 4PG9B 3T0DA 1U0QA 1DBAH 3P0YH 2WWOA 2BY2A 1GVIA 3Q2CA 4J6IA 3ZKNC 1E4HA 4FTVD 2ZXCA 1NCAL 4OIIL 5EO9B 2COQA 3I3BA 1N59A 5C2BH 4H8WH 4ZO8A 3LRSA 4ELKA 5TJWK 1KCSL 4I7ZC 5E8OA 5C07E 5I8KL 3WXVL 1ED3A 3LHAA 3ZDXE 3G6DH 4X0NA 3QQ9C 3QXUA 1E40A 1MFDH 1OQOA 4XC1L 1RUQH 2PW1B 2V2WB 3ILQC 5IB1A 4LVHC 2MNWA 4QKXB 3GSOB 4HIHA 1B0RA 5D2LE 1OM3H 2OMWB 2AQ2A 5GRVL 3C60B 4DUXA 2R27A 1S78D 1ILSA 2I26N 5GRUH 5K1NA 1I1AB 1SF5A 4PJ9C 3L3JB 5L2KE 3DVFA 5CEYA 1AGCA 2FJGA 3NJMA 4N8VB 4U1NB 4OVUA 3DJTA 2BS71 1YSOA 2FWUA 1ICTA 5DVKA 1HKLL 2OV0A 1PYWB 1JWUB 1NEPA 3EGSB 4PJ9A 1WHOA 2GJPA 5JUEL 4GPVA 3MACH 4WO4B 1QLRA 4CN4A 3ARXA 4ODTH 5LBGA 2P7TA 1P6FA 3L6FB 5DA0B 4BE6A 3DXAE 5ACZB 1LILA 2DJSA 3NEXA 3QZWB 3ARFB 2AI0H 5F7AA 5I6OA 2HRPL 4LNRA 1CXLA 3RQ3A 4XP4H 1HINL 2JH2A 2EH8H 2QTEA 5FA4B 1PKQB 3WIHL 1EANA 2YGPA 2C7UA 2Z8SA 3LKPA 4FL4C 2BIIA 2O5YH 2RFXA 2ITDB 1EQWA 4NO0D 2AXWA 5CLZA 3BPOC 5DSCB 4DN3L 5DRWB 1EZSA 1C12B 5DJDB 2OXGA 4OLVL 4BFEA 5IJVB 1ZPLA 2XX0A 5DUBA 1KEGL 2FH8A 4JPKL 1CDYA 3FUHA 3VFMB 3BVVA 1AS6A 1NCAH 3SKJL 4X9FA 2OZNA 4OIIH 4B96A 1QFPA 1T22B 2WXPA 4KXZH 3S2AA 4D9QE 1YMMA 4JKNA 5DWUL 5IVXA 1KCSH 4P5TB 4LVNB 4P46D 5I8KH 3GZKA 5AG9A 3QQ3A 5FYJD 3WXVH 1RP8A 1JHTA 3AREB 2ZP8A 1QI4A 1AZCA 2ALAA 3I9PA 4XC1H 4XPFL 5CUSL 3T65A 4OGAC 5IB2A 2LR4A 3WDHA 3NIFB 4AK2A 4F7PB 1S8DA 1EAPB 4IHOA 3WFEL 3EJSA 3SGEI 4JFWA 3VXSA 3WHE1 4YSTA 5SV3A 4AVJA 4HMDA 4POUB 3MC0A 1ETZA 3WO3B 3L5WB 3D34A 1K4CA 1BQHG 4AIXA 3D39E 3MUY1 4JG9A 1R3JA 2MTAA 5EZOL 1HKLH 4XMPL 2DY2A 5HDBE 1QA9B 1GMEA 4P2QB 1MCBA 5I1LA 5JUEH 5HHOA 2YC1A 4LOEA 1BEYL 1BQKA 3HE7D 1BQLL 1L5GB 3DO7A 1DJHA 3AU1A 3ZE1F 3FQWA 1N6UA 4P4KD 3CDGA 2PYEA 3QCUL 3T5WA 4F58L 1CVRA 2ARWA 4CC0A 2J1KA 5T33L 4PJBE 2HRPH 4U1SB 1VGKA 1IO4C 1HINH 1MELA 5CO1A 5EPMB 1F3DH 5IMKB 4CVZB 4JFDB 4ABVA 1MUJB 4MD0A 1OAZL 3GDBA 3K8LA 3L3IA 1RXLA 3FB7B 2C7FA 3D3VB 4BWTA 4RRPA 3KLQA 4DN3H 3K2UL 3T09A 2UY7B 3ET9F 4MASA 1T4WA 4OLVH 5GZND 5CIPH 4WW2B 5I19H 1JPSL 2BSBA 2FLMA 2ZUXA 1KEGH 4ZUTA 3QWRD 3SKJH 4MNHB 2D4FA 5IEHA 1YEGL 4AH2B 3QXTA 5DWUH 4Q89A 4MZ2A 1Z5YD 4FNRA 2VN5A 3F7YB 2W0FB 2ZX5A 3JWNC 2R1XB 3OPZL 1LQSR 5L6YH 3MAWA 4JDVA 1RLWA 3O3DA 2NY2B 2ZWNA 4TLKA 1TYJA 3MRQB 3T9WA 2UXFA 4XPFH 3FRPG 5CUSH 2VDPB 2NNFA 4MA3A 4GINA 3UIZA 2WBJB 3HI6H 1B6UA 5I6XC 3IDYC 2Z93B 3HG1E 4AI7A 2Z91A 2FQDA 4W68A 2XWXA 1MIML 4NCC2 1AIFB 4K8RC 1NGQH 2J6WA 4NUJB 4F3FA 3S5LB 3WFEH 1HYSD 2F2HA 3BH9B 1QR1A 2XU9A 1E2WA 5FF6B 4E41B 3D25B 4WFHD 4IOFD 4PGZA 4F33A 2ZXEB 3RPIA 4F7EA 4PW4A 4HFWA 1X5ZA 1AC0A 2NY4C 2HJLB 4OGXL 5EZOH 2YAOA 4B60A 4CW1B 5CSZB 1P53A 3QUZD 3IGLA 2V2TB 2ADIB 1A6VL 2BNRE 3JTSA 1IEBB 4JREB 4BUHA 2YGOA 4RWHA 5A2KH 1TQVA 1QI3A 1UCBL 1IC1A 2KH2B 2NYZA 1BEYH 1BQLH 1E8ZA 4WO4A 3REWB 5EO1A 4PR5B 4DP1X 1ET8A 4E9RA 3FU8A 4X6DF 3QCUH 2NCEA 2PWHA 2WXLA 2AQ1A 3SEPA 2WBXA 5T33H 2G60L 1RJZB 1FFQA 3R18A 1HSAB 1E0OB 4DKAA 4HW6A 3CFJB 2FJSA 3POCA 4J27A 5E1HB 5DMIL 4DERA 5IR1A 1TZIB 1QRNB 1EEZA 1YAZA 2D7OA 4Z3HA 2IJ0C 2KPNA 1OAZH 1B9KA 1KTJA 1ANUA 3WU1A 4JY6A 4Z0XA 5FPIA 3K2UH 1S3KH 4FXKB 1GOGA 5ANME 2XV2A 2V3FA 1JPSH 2QSCL 4GUQA 4TPRH 5AD0A 4LBEA 3FDWA 3WNLA 4PV8A 3DOSA 2WQXA 1YEGH 3FTWA 3WXWL 5IMMB 4HP5A 1WZLA 1Y6MR 2UVEA 1ES0A 1T22A 2WINA 3ZU8A 2J71A 3OPZH 2FHFA 2Q3AA 2UY6A 4L1TA 4MD4B 3RVXD 2EUWA 1T0MA 2VKWA 4NFDA 2CR6A 3RY4A 2O4EA 2EYTA 2RMNA 2QSVA 1JTPA 5TE4L 1MIMH 1BWWA 1SBBA 4PHZA 1KIRA 3ZDYE 1EAPA 3JVFC 2Q7NA 4ZFGL 2ZQKA 8CGTA 5IOPA 4XCNB 1AHWC 3RZCC 4I13B 3V0WL 1LD9A 5K9QG 1EZVX 4ZMPA 3FFDA 1N6QL 4PJHA 4ONHA 1U41A 1D5MA 4D9LL 3L1OL 4K9EC 4WLCA 1F18A 2UXVA 4ZUSB 2VZOA 4PVBA 4OTXL 3TJPA 4OGXH 4OFVA 4LLYB 4X8JA 1AHWA 4AVHA 3RZCA 4EVNB 3SJVB 1A6VH 1LK2A 5D9SA 2PTTB 2A83B 1R4XA 2NCMA 5IT2L 2A0LC 1OCOB 3RDTC 1UCBH 3PU7A 4F91B 1DVTA 1JYXA 5DFVC 5BXFB 3QDMB 2N4IA 2Z65C 4LPWA 1I8AA 3IGAB 1FFPB 2G4GA 3F7QA 1BWMA 4EAEA 2XDHA 2G60H 3RDTA 5JHAA 1ZXKA 3G6JF 2ZIDA 3LKQB 3QPQD 5ABZA 5D7JD 4IBTA 4JAMB 2XZAL 4PGBB 3T6QC 4LCIL 2KKQA 4L29B 1C5CL 2ZOKA 3VD5A 2CKBL 1CQKA 1JF6A 3SDXB 4LBAA 1CQYA 4NENA 1DJYA 1UQSA 1HH6A 1NAKL 4NT6A 2BSRA 3ULSA 4QLWA 1W16A 3BKYL 2UZXA 3EF7A 4UDUA 4E9YA 4X6CA 4HU8A 1SVCP 3FN3A 1YEDB 2QSCH 4N5EC 4K5MA 1AGBB 4LHJB 2DKUA 3D9AH 4D0CA 1FYHB 1RL1A 1MCQA 2ADGA 3CSBA 1KJMA 3DI2B 4XMXA 5D4HA 2Y3NA 4XNZC 4RAUA 1EMTL 2OTWA 3WXWH 1X9QA 2ROXA 1KB5B 3UG5A 2UZPA 2ICWJ 4HLZH 1FC1A 1BBJB 1ZK5A 2CHZA 2P8LB 4G6AC 5MEPB 4YDJB 3V0HA 1IGCL 1EXGA 2EYRB 1ASPA 4KNSA 5EU7E 3IFLL 3D87B 5T5FH 1P0SE 3E0GA 5KANG 5J9PB 3MNZB 5TE4H 2BOCB 1OTSD 3N0PB 3O4LE 1QSEB 2PPEA 3V10A 4Z78B 4IOSD 5D1ZD 4LCWD 2W91A 4GEIA 3T8XB 3LN5A 1X5HA 4KK5C 3V0WH 5C08E 5IGXL 1XDTT 2DWXA 4KVNL 1N6QH 1WP6A 4MDIB 3QYNA 5FCUL 2GIXA 4D9LH 1E9PB 3ULUF 3FUJA 3PWNB 2HH0H 3K8MA 5AVRB 3BAEL 2ZYSA 5DFAA 4OTXH 2NTFB 4F93B 5HYJA 4NN6C 2NX5D 5E4EB 5J11B 3B3IB 4AYID 2XN0A 4CDHA 5IT2H 4KX9A 4AV5A 1P7KA 1HNFA 4XCYB 3OXRA 5EDXA 1FAKT 4GBXC 2EIZA 2QLYA 3J2PA 2OMZB 5DJ0B 2EDKA 3W1ZA 1UZGA 3I9IA 1ZHBA 1PZ3A 1G7PA 2YGVA 1UWXK 2AAVA 4JJ5A 4YHMH 2HJFA 4GBXA 3BHBB 5BO1H 1XH3A 2GUOB 4YIQA 1JDCA 2XZAH 1J86A 3DRQB 4LCIH 1A7PL 5IROA 3S5YA 3ABGA 2CKBH 2G5UA 5HHQA 4FNQA 1CF1A 2RTTA 2Z1PA 1S7VA 1I1CA 1NAKH 1E27B 3BD5A 4Y16B 3CWGA 3V5KA 1BZDA 4PYGA 4DP4X 3BKYH 3Q8BA 4FFZL 5IW6A 1O9WA 3TBBA 1TZHB 4UV7L 1G5GA 1XMWA 3FSAA 5I75C 4YPGB 1MVUA 2VLLA 1EMTH 1S7TB 1YPZA 4JN2B 2FX8L 4PJAA 3I02B 3DWTA 2KS0A 1UACL 3H3KA 3ARRA 4L18A 2YPLA 3CVHB 2ZUVA 1IGCH 3H9SA 5I0ZA 3IFLH 3LKNB 4O2FB 1ECZA 3QUXD 4QHUA 3GKZA 3HA0A 3NABL 4XT1C 1E28A 1OLLA 2MNUA 3BN9D 5E8EA 5IBLC 3ENEA 4NC2B 3UYPB 2BMKB 2XLLA 4FG6C 3O9WB 4KVNH 1KOAA 3BPLC 4PP1C 2CBOA 2Z6FA 3L2MA 4MA7L 5FCUH 3BAEH 3HNTL 3OR7B 3JV4A 1MCEA 5AW3B 5H35A 3ORJA 1QZ1A 5J1AB 4GMSL 4MJIE 2VO5A 1AGEB 2CIKB 4LLYA 1ZA3A 4POZD 1MKFA 5F9WC 2EINB 5IW3A 4YE4L 2MKWA 2HWZL 3GGWB 4W81A 4A6YA 1KIPB 1EV2E 1E9QA 3A22A 4WDIB 2DLIA 3IRZA 4JFOB 3WLWD 5CIPB 3MRDA 5I6MA 4I3SL 1K8IB 4I1NB 5BXFA 4YBQD 1Y0LA 2HTLD 5ICXA 1XCWA 4H8WC 3OKDA 4RDQG 3ZZLA 4NQCB 4L9LB 3LZPA 4DJMA 5DMJB 1J5OL 4PS4L 3IXAA 2Z4TA 1M57B 1A7PH 3UTPD 3VI4E 4U31A 1Q72L 3F83A 4G8FB 3MRNB 3D0AA 3NMEA 1ACYL 2KLSA 3E3QC 5FR3A 4WWNA 3WNOA 3IFNL 1KT2A 3AC0A 4FQPA 2F74A 1NCBH 3CPUA 4MLIA 4FFZH 4X4XB 2Y07H 4N6RB 2BNQE 2Y2WA 4UV7H 4UOZA 5I66B 3P3YA 4PQXA 3EW3B 1MQKL 4X4ME 2ZPKL 4X6EB 3MRGB 4KO9A 2FX8H 5I71C 2WQSA 3BFQG 3S4SG 1CDJA 1UACH 2CLRB 1NGZA 2V5MA 2F54E 2JVUA 2W60B 3L5HA 3OJMB 3BJLA 5CCKL 3MYJB 1XBRA 3BGFB 4X5WA 4A7TA 4RH4A 3T77A 4J3OF 5HYQA 1SEBB 3NABH 1ZGLM 3TT1H 4AYDC 1PY0A 3IPBA 4AYBA 3DETC 2FO4B 1ZWIB 3SYOA 4F8QA 2BSED 3CXDL 4YPJA 4P5SA 4Z78A 1ZLEA 4FA8A 1S7WB 4HZLB 5D2LF 4MA7H 4K7FA 5ILTL 2AK4D 4XVOA 4M3KB 1YY9C 3HNTH 4YAQA 5LKNA 5E4EC 1GPOL 3MUGA 3UPCA 5I15L 4GMSH 1FE8L 1YG9A 4LL9A 5CWSA 4N1HB 2YD8A 4MA1C 4YE4H 5IG7B 3ZXAC 4A67A 4NPYB 4QHMA 5F9OL 1KYFA 3AZUA 1J5IA 3QQ4A 2GJRA 1U8MA 4I3SH 4YS4A 5AYTA 5KN5B 3L8QA 3P2TA 2AMUA 4QIRA 1T0NA 4XMUA 2PYFA 4JFSA 5KOMC 4L8CB 1J5OH 1EDYA 3P9LB 4PS4H 3NACL 4WUUE 1T4KB 4D8OA 4YSCA 1H3TA 3GKWL 5LNDA 1LYQA 2KI6A 5DHXB 3ULVE 3BHBA 5DO8A 3QGVA 4CBZA 1ACYH 2ZCHH 3GTVA 5FWQA 4DO4A 1HXYA 4WJ5B 3AQXA 1UXLA 3IFNH 1PZAA 4AYGA 1UZ8A 2OTPA 3HJ0A 4J3SA 4KBPA 3WDJA 3H4FA 5T3ZE 1NOFA 2NUTB 5F88A 2CGYA 2A1WL 4IGBC 3TN0C 1JF1A 2WXIA 1MXGA 1MN4A 3V6ZB 4QRQB 1Z9MA 3P4NB 5KSBB 4ES8A 2ZPKH 4U3SB 4YDVB 4B7LA 5KWYC 1TZHA 2NZ1A 3WIFB 4JMNA 3QFDA 3QS3A 4IGBA 3TN0A 2R29H 4YO0A 3TX4A 3WAJA 2FATL 3QI9B 5IMOA 4B9GA 2RJMA 4XZUA 1KXQE 2LGNA 2YD9A 1IFRA 1JPST 3LDBC 4XCFL 5CP7B 2QDVA 1YZZA 3Q05A 1JZ6A 2CNYA 2IANB 3ZLQC 5JA8B 5PCYA 4UU9B 4IBQA 1AACA 1AQDB 3DX6A 1BQHB 2WTRA 1LP9B 1SXAA 3TOPA 1VADA 2LVCA 3WMSA 3VWJD 1OCRB 4S10A 3CXDH 3HG2A 3FKUS 3WTWA 1OCCB 2OI9C 2K1MA 1R5IB 2F7IA 5GRYA 1K5NB 2GB2A 4GP4B 4IU2B 4ZOAA 4CGTA 1SOXA 1Z9SA 2MOGA 3G5YA 2APWA 5ILTH 1WICA 3GMOB 1A1OB 2I5YL 1GPOH 4OZFA 1XAUA 3Q2NA 1S3RA 2P24B 4L3ED 1FE8H 2PCFB 4CSTA 4RMVA 2Q3XA 4M7LL 2X9WA 3B8SA 5CILL 4X5PA 1QOKA 3BP7A 3B7YA 3WIHA 4AV4A 2FJFB 3RWHA 2F5AH 2P5EB 2OL3B 1KYDA 5F9OH 2Q0ZX 2VC2L 5EN2B 5TDOB 5E6YA 5HDBF 1BW8A 1USZA 4PJ5D 5GGQL 5CGYD 3UPRB 1B9ZA 1BJ8A 2HT2D 4OJAA 3SPCA 5A2CA 5DRNA 1IBHA 4EN3B 1SXBA 3T0EE 3QNZA 2XN9D 5A7BA 3NACH 1N2RB 1DSWA 2X9ZA 2FYYA 3GKWH 3OHXB 1AS8A 5CZXD 1AR1B 4LVOC 3OMAB 1KNOA 3K2MC 3WTVA 3BZFB 3INOA 3Q43A 3PQYE 4G8FA 4C56D 4DN4L 1RQ5A 2A1WH 2XT1B 3FSZA 5FB8B 1J48A 5HYEA 4P2RE 1RZJL 4NO3B 4RMBA 4Q9BA 3FRPB 2P42B 4JRLA 3SE4C 4BUQA 2PABA 5MENE 3M88A 2DAVA 5AYQA 2VDLL 3P3UA 2DQJL 2Z35A 4AYFB 4LLMA 4HOZA 4XPHL 4ZUUB 5L8KB 1V7NL 3AXLA 4PTTB 2FATH 2A9AA 3TF7C 2H4EA 4XCFH 5IQMA 1A14H 4P04A 3QZPA 3KWTA 1R9FA 5FHBH 3SE4A 4H1LH 2C9UA 2TRHA 3IETB 3NTCL 4MAYB 5DRXA 2JI1A 1VSCA 3FXIC 3IB4A 1ZHNA 4KKPA 4MRBA 3FUNA 3T1FA 1YJDC 1SEBA 2G5BA 3NFNB 1L9NA 5SX4H 3NFSL 4KY1L 2A6JB 1DVUA 2LLNA 2WLLB 3ZL4L 1P5VB 4NRZB 2W9DL 1HJBC 2OSLB 2I5YH 3EJYC 4AQ1C 1HL5A 1CYWA 2HX9A 2YKKA 3FT3A 5CILH 5DD1L 5J56B 2BHYA 1X5IA 3U9UA 3OMNB 4M8QA 1JZ3A 1XB6A 3VA6A 3CFIC 4AQ1A 2DLEA 2VC2H 5KSAD 3IJ9A 1NC4B 3DX2A 3FQUB 4MTMA 4P9HC 1GXEA 4IU3A 2LOEA 5G4MA 1NGPL 4X6DA 4DFHA 4I2XE 3GSQA 3E2HB 1IGTB 5KS9A 3HN3A 4PRBA 4FJ6A 1ZVSA 1WH0A 1EEYB 2WXGA 1U8PA 1RZKL 4UOQA 2X44D 5MP6L 4YDZA 3LPGA 3RWDA 5HY9A 5E00A 1IM3D 2EDFA 3QUKA 1SYSB 4DN4H 4FLSA 3CVDA 3SY0A 4Z8FL 3EYOB 3KS0J 4XTRC 2OULB 2FEEL 1LK3H 1RZJH 2XN1A 4ODHL 3H4HA 3TBSA 2W95A 4ZUVB 5D7IF 3WCYA 3BAXA 1H6EA 3VSUA 1R3LB 5TGBA 5KZCD 2VDLH 2DQJH 4QRRA 1SDYA 3DROA 2ERJC 4XPHH 4F2EA 1CLZL 1V7NH 4PJ7E 5F71A 4F37F 4ABUA 4EXKA 2JCCF 4QRTA 3CZLA 2R69L 2XACC 3MLYL 2NSXA 5DC0A 3RTLA 2MJWA 3NTCH 3FT9A 2Z1KA 3LZQA 3MU3A 4JLRA 4M1CD 4JRXB 1XSKA 3D0LB 3V4UH 2SEBB 5I23A 4V2CB 4EDWL 3LKSA 3WJJC 4M02A 3GMRB 1RK1A 4MB3A 5FA3B 3BZ5A 3NFSH 4KY1H 2A6DB 4LB8A 1UYWH 1FV1B 2YQ2A 1BD2B 2IH1A 5AKTA 1V3JA 1YNTB 2DMBA 2K9FB 4J1UA 3ZDYF 2W9DH 5T8IA 1DDTA 3WJJA 1ZIAA 3G9VA 1HDMA 4ZQTA 4PRPA 2ZCLL 5DD1H 2EIEA 2NZ9C 3RAJL 4JN1H 2J25A 2PPDA 1BF5A 1M4KA 4JY4B 4NI6A 3KLSA 2YS4A 4XP6L 5F7LB 4WI7A 4YHIB 1UT9A 3DV4B 1CE6B 2DWSA 4BSVB 2UUDH 3QC6X 2FJFA 4IMLB 4GUCA 5F0JB 2ZYRA 2CRYA 1NGPH 1YN7B 4DCQA 2Q1EA 2NYYC 4YFEA 1BFOA 3ZW3A 1G6VK 4Q0XL 3US1A 2MQCA 3FPYA 1J18A 1JN6B 3C6EA 4B0MM 3QQNA 1RZKH 2Z92B 4J4PD 1JJUA 3DX8A 3TIEB 5MP6H 4XPTL 5I2IA 3T1WA 4V1DD 1BLNB 3B9KB 3KYMA 3MVSA 4HHAB 3WLBA 5CCGE 4GG6E 1EFXA 3H55A 1J5CA 4Z8FH 3HR5B 2YD3A 1NUFA 2XX1A 1J5DA 3Q9PA 3VRIB 1BFSA 1MI5A 4ODHH 5I24A 2HPOA 3GHPA 3D52A 2ZAGA 4P2OB 2X4UB 5EFIB 3QO0B 4WI3A 1NCOA 4M6AA 4ZS7L 3VI3E 5A3IC 4FNPA 5JHDE 1L6PA 5I1KL 3MX0A 4U6HA 5ANHA 3SDCD 2DI9A 3BRFA 4EI5C 5IFJB 3VG9C 1HNYA 2R69H 3L7FB 3O6LL 1SDAB 4EIBA 3TCLB 4M9OA 1I3GL 2NNCA 3FB5B 3MLYH 5I1IL 2ICEC 4XN1A 2WWNA 2FDBP 2H8PB 3H3PH 4ZT1A 2XZZA 4K7PL 1A22B 2UYLA 4EI5A 3WL9B 4PJEB 4MWFA 2GBTA 3HFFA 4EDWH 2MQ0A 1JV2B 1MLCB 4TVUA 5DD6B 1HN1A 3ZKMD 3PWPD 3ULUC 1FH5L 3OX8B 2ICEA 2RALA 4NQEA 4PGEB 2UVFA 4OZ4B 1Q4NX 4DO5A 3QFJA 4I4WA 5T1KD 3UTZA 3VWKC 2V5SA 3BQUD 3FHAA 5FDYA 3HCVA 3ABMB 1MDAA 4OVVA 1AKPA 2YEVB 1PEZA 3QPKA 4LQFL 1GS8A 4M6MH 3FT0A 2BS9A 2Q2LA 3HBQA 2ZCLH 4R2GD 4X7FC 3WS6C 7PCYA 4Q9RL 3O2DA 1Q94B 3RAJH 1VEPA 3KPRB 4B41A 5IW1A 3BEVA 3VWKA 1XF1A 4XP6H 1C7SA 4GG8B 2WP3T 4PS3A 2EACA 3I6GA 3O3AB 4G9FD 4YGVB 5ALCL 3ABLB 5E9DB 2CKBA 1JZ5A 2XQ0A 3LAFA 4BCXA 1RPUA 3G5XA 3Q01A 4EOWL 3FFOA 3UAFA 4LFHD 4ODSH 3IDUA 4HS3B 4F8OA 3T8MA 1KLFB 1IAIM 4JFPA 3W39A 1BVNT 4X4YA 4MXWL 4O51B 4Y4KB 2AXGB 2R2HA 3RL1A 3ZQWA 4ACTA 4NC0B 5EU6D 3H0TA 1TO4A 4NKMB 4G1MA 3OJVC 4XPTH 3VFTA 3CZEA 3MR9B 5EBLB 4MLSA 2DTML 4R4BB 5CNHA 1EK3A 4TXVB 4URTB 1NC2B 1ACCA 1HXKA 3TPUB 1YY8A 2VRKA 4L4VD 3S7GA 1AIZA 4MHHI 2AJYL 4C83B 1AD9A 5AOZA 3EFDL 1NDTA 3FQXB 3EYOA 3OB8A 1OANA 4RGND 4TUJB 5E7FA 5CCHE 5IIEA 4OAWB 3QR1A 4ZS7H 4E0RB 4ZFFA 4XO4A 3OJ2C 3ZIYA 5I1KH 1HHIB 5K39B 2K8QA 4LRNL 3OKOB 3IGUA 4ZOBA 2B1HL 5AVUB 3WDIA 3VTTA 3O6LH 2H26A 1FJ1B 2ZSWA 2HMIC 1I3GH 3APMA 5L0QB 1VEMA 4FCAA 4Y4HD 4D0BB 2B5IB 5EULV 2GAZB 4Y8DC 2VW7A 5BQ7A 3A6BL 5EBWA 2JCWA 1NPUA 4Z7WE 1FH5H 3S9DB 3VD2A 4JRXA 3PRZA 2SEBA 4KX7A 3RWGB 2BVOA 4MB1A 5BS0D 4O2EA 5E56A 5KSUA 2WZPD 3ZHFA 4AE1A 4A38A 2APVA 1JZGA 1WC7B 3ARGC 2H6UA 2KHAA 3IF1B 1NL0L 1F6AB 4K5LA 3LD8C 4MD5A 1U8NB 4Q9RH 1NDGB 2C1OA 1WGVA 3P4MB 2AC0A 1HSBB 1O9ZA 2OTUB 3E8UL 4I0PC 3SDYL 3ARGA 3V8OA 5ALCH 1X7QA 5IB5B 2CDFB 5C3TA 1DQLH 3FQ2A 1MJUL 1H3PL 4ZFOA 4EOWH 4I0PA 2ED7A 1GKEA 1EVTC 2XSKA 1TQCB 2OR8A 2VMEA 3P2BA 5EO0B 4MXWH 1DUZB 1QNIA 4MNGE 4ZAKD 1JHLL 4OF6A 4DGYL 3AITA 3UGUA 3W9DB 2GABA 5I1AB 4G7VH 1HESA 4ZTEA 3K71A 3FU5A 2DTMH 2Z92A 2OMXA 3D4ZA 2C4FU 3RGVD 3I6KA 4X6FB 1S9YA 4QOKB 1OD7A 4WTZG 3DOHA 3S4SB 5IOKA 2AJYH 1OT1A 2H41A 4KZCA 2BIQA 1H8OA 3ARBD 4PB9L 1QBML 4K23L 5B8CC 4UOW0 3KPNA 3FFCB 4OZIE 1D6VL 3A6OA 5EZLA 5H37G 1VB9A 5C7XL 1ILUA 1SLWA 5B8CA 3G08B 4R6UA 1U8OA 5CD3A 1CG9B 4P5RA 4O4YL 3MKGA 1GCFA 3HHRB 4KK9D 5BUGA 4PI2A 4LRNH 2ZNWA 2B1HH 3N3EA 5GZOD 2WO2B 4PRHE 3EUDA 1KXTA 3LJ3A 3SSGA 3S5ZA 3P4OA 5DD0L 4EIGB 1IZKA 5EF2A 5DJAB 3FB6B 1RUKH 4XWOC 1E3FA 4GYBA 5C07A 4HEME 3A6BH 3UTSB 4TM9A 3OZ9L 4TTGA 3MV9B 2PO6B 5FOBA 5T3ZL 1JOIA 2WXKA 4Z7UF 2QPEB 5I26A 4U3XA 1A64A 2ZF8A 3TJEL 4FDWA 1IVLA 2BXZA 1JV2A 2H3NA 2E7CA 1ZAGA 5D2LA 1MNNA 2QPFA 4KDVA 2CU9A 5DK2A 2FQEA 43C9A 1NFDE 1NL0H 1VFAB 1CFQB 2Y06L 3DO4A 2IXQA 3QJSB 2VH5H 2VITB 4N26A 1QSFB 4N9GA 3U0TB 3UTTB 4DIXA 5L2KA 2WHVA 3E8UH 3SDYH 3FQYA 3U0PB 4MZRA 4MAUL 3IAPA 2R1YB 4N20A 5JIQA 3S48A 3N1QC 4OIFA 4JQIL 5KSVA 1CLYH 2IPTH 1MJUH 1H3PH 2OMUA 5DFTA 1HYRC 4YGVA 4AT6B 1EHKB 2BSCA 3GM8A 3GUTB 4FJYA 5CGTA 5JNYB 4N2HA 3DSNB 1JHLH 3ZTNL 4DGYH 1VLXA 3DXAA 2IH9A 3AT8A 4GQZA 2VDLB 3IXTB 4YDLB 3QH3A 4O5LL 4A7VA 3VXMD 3MRFB 3KWVA 5DGRA 3PWUB 4JUTA 1AOHA 3RWEB 2Z8WC 4NKMA 3EFOA 4WTWA 2J56A 1RP9A 4KK6D 5IWLC 3BPNC 2WLZA 3ULVF 5DF0A 4FXGC 1F6LL 2FL5A 1FFOA 1PAZA 1QBMH 1UKSA 4K23H 4M3HA 4PB9H 3SO3B 4ZRGA 1CZ8H 2IH8A 3SYCA 1RIUL 5JO5A 1D6VH 1A4KB 2CLVB 3Q5TA 3QJZA 5C7XH 3HRPA 3VD0A 3HS0C 3TNNA 4KTEL 3TA3D 2NY3D 3MNVB 3TS8A 1KCVH 4FXGA 1JGUL 4HQQL 4O4YH 2DS4A 2GTZB 4FQLL 3QBTB 3CH1B 5DJ2B 5GIRB 4FG2A 3HS0A 3IDJB 1NINA 4IRJD 1YEHL 2GT9A 2FWOB 5DD0H 5EU4A 2NW3A 2MPVA 4RLDA 2YN3A 3IE9A 5F7YC 2DICA 2O6EA 3OZ9H 2VJ0A 5T3ZH 3EYUH 4D7BA 2D3NA 1XTMA 5I76A 2CDGA 3MCG1 4LEOB 1AD0B 3CSYA 4DZBA 3D2UA 4Q74A 4Q97A 4AIOA 2JJWA 3THML 4KOBA 4XBPA 3BH8A 4JVPA 5CBAB 2Y06H 1I7TA 3P3TA 1ADQH 1JGEA 1HU8A 3C6LB 1IBYA 4LOUC 4N1CA 4KKCD 1U8CA 3EBAA 2AJ3B 4MAUH 3ECUA 3L7EB 4WV1C 5GISL 3VVWA 4CL7A 5HHPA 3D39A 3SE8H 1HH9B 4MNQE 1XR9B 4K3JL 1UTDA 3QIUC 1Z5HA 3QJFA 1KCKA 1V27A 3UL4A 5FGSA 4DP7X 4WV1A 4QRFA 4I1PA 3ZTNH 4KKBC 3QIUA 1GTNA 4O5LH 3S8GB 4NQQA 3MBWB 3DYOA 2V7HB 3UZEA 3KPSD 4RMSA 4WFFD 4PJBA 3ZTJH 5DZAA 5I1AA 3DOIA 3C8HA 5KVGL 1SUHA 3ZZSA 1FZKA 4OM0L 5L88L 3T0VA 2CBQA 1FYTB 1M1XA 2VXVH 4QRUB 4KRPB 1MLBA 4XVTL 4D9RE 4H1LA 5ICZA 4KTGA 3L1EA 4Q2ZB 1RIUH 4NC1E 3AADB 3L9RA 3B2UC 2ICES 2ESVB 4HBQA 4UMGA 3OB0H 2BH0A 3PIQA 4HQQH 5J89A 1AI1L 5I5JA 4H8UA 2EDOA 5E8DL 2XNAB 4NB7A 4PJFF 2YEZA 4QXTB 3SDAB 4LSSL 3OXSB 4IJ3C 4MX7A 4LPXA 1TEYA 2Z4QA 3I3DA 1YEHH 4XI5C 3EF4A 2VR8A 5B38B 3AMLA 3W57A 2E9BA 1T1WA 1I8IB 2YFNA 5D6CB 2Y5EA 4FHKA 3CDYA 4P23B 4QJ3B 1BJ1J 3FAXA 5I1CL 2WLNA 1G6RL 4YUEL 5AAWC 2VL5A 1A4BA 1YUKB 2VN6A 2WQWA 3HG1A 3VXUE 4PV9B 1ZLUH 4KV5E 4BJLA 1KYOJ 3THMH 2AJXH 4JFFB 2H45A 1G5AA 3QEHA 5AAWA 3M17B 1UUSA 4KJYB 3ZDZB 4U49A 4ZNCD 3GZQA 2QHRL 3KCPB 4XNAA 3E38A 1BOGB 3C75A 1MCDA 1H0DB 1L3WA 1LEGB 2NW2B 5GISH 3UTTA 1T7VA 5IM7B 4L3FA 2VISA 3IT8D 3D69A 3K6OA 4MGXA 4K3JH 3D6GA 1RZJC 4N25A 3SE9L 4OF3A 2BNRA 2BIPA 4F9PC 4FP8L 5FLVA 2EDEA 4A68A 1ZS8B 1JUFA 1IZJA 2D73A 2XPGB 2R2EA 3BCDA 1J8RA 4LDOB 5ERWB 3MBEC 4IEFA 3MGTA 5DJXA 1U33A 3P9MA 3GUTA 1J0YA 2NPLX 2EKJA 4PRIB 3RIFF 2IBBA 2W80C 4JG5A 4JPIA 4F9PA 2IEPA 2DWYA 3BDYL 1OSZB 4UZSA 4LIQE 1XGUB 2F53E 2EDNA 3MBEA 3BN3B 2UWEE 4KGLA 3VFPB 2ZXQA 5KVGH 3LXBA 3QQ9D 1C5BL 3RLSA 4QLRA 4OM0H 3FT2B 3ILQD 5L88H 2E27L 1KTBA 1VRSA 1IJNA 1F13A 2ARJB 4XVTH 3VFSA 1JG9A 4NUQA 3HS9A 5J8OA 5GGUB 4G42B 4N2MA 5J6HB 4X2UA 3KPLA 4BH7B 1ZT7A 3BEWB 2VJXA 4PJ9D 1AI1H 5E8DH 4POYA 1EHAA 2Q5BA 5ITFA 4LSSH 1G9HA 2HFEA 2NY6C 1ZRUA 2XJKA 4RISL 4WNSA 2QL1A 2JSFA 3TBCA 3UH8A 5BZDB 3QZBA 5E4IA 4QGTA 3QWNA 1XF2A 4PY8J 4PJ7F 4UTAA 3ATFA 1A5FL 4L05A 4GMTH 3V0EA 2R7EB 4GKNB 1YUHA 3BSGA 3I74A 4G7QB 3RILA 5I1CH 2V9RA 1G6RH 4MMZB 1ZLDA 4JCLA 3WEOA 5E6ZA 3SQRA 4PJXB 3CSGA 5LCVL 4C56E 1R5WB 2NXYC 2ITCB 1AZNA 1I8UA 4JPSA 5F1NB 3SGKC 4XVUC 5BO0D 1F41A 2M1KA 3STBA 4AQAB 3HZMB 3OJDB 4YR6B 2NY0B 1BZ7B 1B4TA 1CC3A 2QHRH 5F97E 3SGKA 1JGDB 1F6FB 3FS9A 2W92A 3QIBC 4ZFZA 1VESA 1TJHL 3L7EA 1A9BB 4FP8H 4PREB 1TKWB 1YMMD 4HK3J 1S7QB 3QIBA 3MOAL 4X5QA 3RI5F 4EZMA 2V6HA 3PABB 3ZKQD 3QQXA 2D3VA 3AS1A 4EZKA 3BDYH 2BINA 4S0SD 1VDGA 2E8ZA 2OCFD 2DDQL 5CU5A 4KHTL 3RIKA 4B9PA 1MJJB 4PN6A 1C5BH 3VXSD 3M7OA 1TJXA 2HVJB 2E27H 2BSSB 4OGAD 4P4RA 4RAVA 1EGJL 1I1FB 2VLJB 4QDGA 2R69A 4NI3A 3R7QA 1U93B 4C4KO 4W70A 1RHFA 2VM4A 4BDVA 5DVPA 4F8TA 2D3JA 3O6KL 3EJUA 2YAHA 4RFOL 4YH6A 2J4WL 3LMJH 1NMBL 2PPAA 4R84A 1PZ5B 5K5YA 1V8HA 4DK3A 2DWTA 3U9PL 3W9EB 1LO5B 4YHYB 2VRQA 5HHOD 4Z7IA 5I17B 5AUMA 4ISVA 1T03L 4RISH 4ALAH 2IH3A 4NNXB 4DP8X 1IC5H 1D5XB 3A0OA 5EU7C 2D8KA 3V0VA 1E6OL 4HIJA 3MRHB 3OXSA 4HIPA 2PYED 1G0DA 1A5FH 1XF5B 5E9AA 4MJHA 1WISA 3QZNA 3TWYA 1PD6A 5B38A 4PJGF 4L4TA 1XFPA 1K4DA 4R90L 1QFWM 4I18B 4NQDB 4GW5B 4GO8A 1UWYA 4E9QA 2WIIB 1QUPA 3OB0K 4NQTA 4EPSA 5LCVH 1R3KA 2P80A 1MFMA 1U3ZA 2C5DC 3O4LA 4XX1E 3RKPA 5C0CB 1OB1A 1KB9J 1ETJA 3MRIB 2X12A 1OKEA 1NZRA 4Y1TA 1HI6A 5FM8A 5GJSL 2NTSP 4DP0X 2X4OA 3CDFA 2ORBL 1PQZA 4LDLB 2G3NA 2FQGA 1USQA 3AROA 4OBRA 3NSFA 1LO3L 3MMEB 4S1QL 5FKPB 5B21A 4Z77A 4PIBA 1BOGA 2G0KA 3M8OL 1TJHH 4U1LB 1LEGA 4Y9FA 3QJXA 4BBWA 3MROA 4R3SB 3MOAH 5KBDA 1JI1A 4XMZA 3LNHA 3TASA 3NAAH 4PRDA 2WNKA 1X5XA 2N0MA 4AENA 2RA1A 3PP3K 2DDQH 4DWHA 4FKEA 4KHTH 2ICWB 4KFMA 2JIXA 5C0BA 2YXWA 1FVDA 3VXTA 3CZNA 3V6FB 1EGJH 4L5FL 1RI8A 5LO7A 1OP9A 1YYLH 2XKUA 3EZJB 3MV7B 3BI9X 4K8RD 8PAZA 1LE5B 3O6KH 4DUWA 4LCYB 5EUOE 4GSDL 4RFOH 2J21A 3BFWA 2J4WH 3PJLA 2X5PA 2J57A 1NMBH 4KKNA 1QBBA 1VACA 4KI1A 3TO2A 4TTDD 3U9PH 2YJLA 3FOLB 4AQOA 1H6UA 4QHKI 5GGRB 4MDJA 2FZ3A 2R0KH 3ZE2F 2WD0A 2OMBA 2NY4D 4JM4L 1N26A 5EF0A 5FGCB 3VUAA 5E0QA 2AJUL 1E6OH 4WO4D 2UZYA 3RNKA 3B8YA 4ZDHB 1GYCA 4AZUA 1D5BB 4IOIA 4YLQT 1ZK9A 2ZICA 3MUUA 1SZNA 4Z1PA 1A8JH 2BP5M 3GLZA 1TTBA 4R90H 4GRWB 2PCYA 4KROB 2XYCA 4V1DE 4YHPA 1XD0A 5B1BB 1X5KA 3B2DC 4HCIA 2QMKA 3BPCB 3RZWA 1CT8B 2APTA 3P54A 5DVLA 1HEZB 1D5ZA 4HYTB 2DM3A 3AQZA 3RJOA 3V95A 1B0WA 3DHUA 3EOYG 5GJSH 4IRSB 1DJXA 3HZKA 4YC2C 1W15A 1S9VB 2QADB 2ORBH 4HKXB 1ZXQA 3V55A 2ZNXA 4HKBB 1DJZA 5FM5M 2WW8A 4Z76B 5F7WC 1YC8A 1YHPA 3M8OH 3QRGH 4MJIA 4E9XA 2YQGA 3CQFA 4U1HB 3RYMA 1FI8C 5GGTA 1KJ2L 4NYLB 1XGYL 2YARA 4DOHE 4AM0Q 1V5JA 1WFMA 2P5WB 1JCKA 3WUWG 2WXFA 2XV0A 2UXTA 3UJTL 3K72B 2E6PA 3CSPA 1WAEA 3LRKA 4UAOB 3TA4D 5SWSB 2HAZA 3A21A 4J3OG 5FHAL 5L2JA 2F5BL 5HVHC 3B7UX 2QLVB 3FCSA 3LZFL 1R34A 2QHLA 4L5FH 4AIEA 3IGKA 4FQJL 2IAMB 1H8SA 5HHMD 1RK0A 1SOKA 2PR4H 3VI4A 1HAWA 2OXHB 3Q8FA 1E5CA 1I1FA 3X11A 4KUZL 4GSDH 5FKAB 3LV3B 5AYUL 3RZCD 5D71L 3QAZB 3KXFB 4FQXC 5C0NC 1J9QA 1OSPL 4NUPA 3ZL2A 5J12B 3GRWH 1A3ZA 3JYCA 2BNQA 1D7DA 2ENPA 5ESVA 4HF5L 4XPGL 2XFXB 2O26U 3MYZA 4FMFA 4X4MA 1XZWA 4QXGL 4FQXA