4NLIA

Crystal structure of sheep beta-lactoglobulin (space group p3121)
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
162
structure length
162
Chain Sequence
b'IIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGNLEILLQKWENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLACQCLVRTPEVDNEALEKFDKALKALPMHIRLAFNPTQLEGQCHV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactoglobulin-1/B
publication title Structure of two crystal forms of sheep beta-lactoglobulin with EF-loop in closed conformation
pubmed doi rcsb
molecule tags Transport protein
total genus 42
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4nliA00
2BLGA 2YG2A 3TZSA 4IB9A 1BEBA 2OZQA 5D48A 4AZMA 3QKGA 2FS6A 2EU7X 3FELA 2R73A 4HPDA 5D8JA 1PM1X 3D95A 5BVQA 3FMZA 2XKLA 3FEKA 2L9CA 1HBPA 5HZ5A 1S2PA 2W2FA 3CR6A 1IIUA 3KQ0A 4ORYA 3GAQA 5EEEA 1OEEA 3EM0A 1X8PA 3JSQA 4OS0A 3NR3A 5LKFA 3BS2A 4NYRA 1T68X 3B2IA 1R0UA 2XSTA 3P6EA 1OBUA 1A57A 4ZCBA 2RA6A 3NQ3A 1HBQA 3KFFA 1EALA 1HQPA 3EBKA 3VG6A 3BX8A 2RQ0A 2NNEA 2AMMX 5EEDA 1JZUA 4ZFXA 4YGGA 1JV4A 4YH0A 1CBQA 5D47A 4YCHA 4LZUA 1YUPA 1GM6A 1LIDA 1GGLA 1DZKA 2ACPX 4UU3A 4ARHA 4NNTA 3RSWA 1QY1A 4ORRA 5B29A 5H9AA 1KQXA 1DZMA 1KT4A 3O19A 4ZH6A 3P6FA 2CBSA 4ALBA 2QM9A 5HZQA 1O1UA 4QGWA 2RCTA 3PEDA 4AZRA 1ML7A 4QGXA 4TKBA 2G7BA 1LNMA 2RCQA 4ZJ0A 1I04A 3BSZE 2WQ9A 1GX8A 1KGLA 4LZVA 4K19A 1ZNDA 3MBTA 1EIIA 1SY0A 1QFVA 3APUA 1LIBA 3FR5A 5D4AA 5HTDA 1X71A 2WEWA 3F8AA 4ZHCA 4NNSA 1BBPA 3STMX 2L5PA 5HWZA 2MO5A 1TW4A 3HK1A 3HWDA 4IB6A 1G85A 1A2DA 5FAZA 1X8NA 1MVGA 4CK4A 1Z24A 2FWVA 5K06A 3FLLA 3VG7A 3STNA 4ALOA 5H8TA 2CZTA 2HZRA 3DSZA 4IB7A 5LKEA 3FW5A 4OMXA 5F6BA 3UEWA 4XMCA 1G74A 4AZNA 1P6PA 4TJZA 5HCDC 1DV9A 4ZHGA 2MM3A 1GT3A 1O8VA 1FE3A 3D96A 1I4UA 4NYQA 3NPOA 3RZYA 1AQBA 4DQ3A 2POAA 1LICA 1A3YA 3WJFA 1IFBA 1ALBA 2FLJA 1MUPA 5F58A 2CZUA 3KFIA 4YBPA 2N93A 3WXQA 3C76X 2X46A 2WEXA 4YDBA 3KZAA 3BRNA 1QABE 1RLBE 2FS7A 1DZPA 3D97A 1KT6A 4KIIA 3UEUA 5HA0A 2L68A 5L8OA 3B2HA 1SY2A 2Q2PA 1BM5A 1I06A 4UU2A 1EQDA 4TNNA 3OJYC 1OPAA 2LBVA 4HFOA 2Q9SA 3PH6A 3AKNA 1BJ7A 2WR6A 4TKJA 2A3FX 4RUUA 1NP1A 1KT3A 1YWAA 3FR4A 1KZWA 4MVIA 1QFTA 1YP7A 3WJCA 2G79A 1EUOA 1ERBA 1ZRYA 5BVTA 3CQNA 4OS3A 5HZ6A 2Q39A 3I0AA 1IFCA 2WSJA 3WBGA 2E4JA 4A8ZA 2OVEA 1SA8A 2JU8A 2WUTA 4OMWA 3EYCA 5DG4A 5LJCA 4I3BA 1PMPA 5LJKA 4M7MA 1SXWA 2AH7X 1E02A 1TXLA 3PP6A 2CM9A 2RD7C 1U0XA 4XMDA 1AELA 5LJEA 5IO6A 4IB8A 1JJJA 4BOEA 2HZQA 4YFRA 3CBSA 1PBOA 3VG5A 1ADLA 1VPRA 3STKA 5HCCC 4QZTA 1SXYA 1T8VA 5EPQA 2FR2A 4N7DA 3P6GA 1YWCA 2G78A 1KOIA 3B2LA 3AKMA 4ZHFA 1ZNHA 2F73A 1GKAB 3C78X 2CM4A 2CBRA 1UZ2X 2JU3A 4ORUA 4GNYA 1OBQA 1XKIA 2A13A 2ALLX 2X45A 2OFMX 1NGLA 1S7DA 2DM5A 1OEKA 4MVLA 1LF7A 4ZHDA 4AYHA 2MJIA 5KIDA 3BLGA 1LKEA 1TOUA 3HWFA 2Q4NA 3FEPA 5HTEA 3ZQ3A 4AZOA 1E5PA 2WQAE 1B56A 1ZNEA 4I9RA 1BRPA 4LKTA 4GH7A 1BWYA 5FENA 4EFGA 1JYJA 4NLIA 1FENA 1CBIA 2OFRX 2AT0X 1CRBA 3O22A 5H9KA 1KQWA 1NP4A 2JOZA 3WJGA 2OVAA 2QO6A 1DFVA 5IO5A 5KICA 2QO4A 1QQSA 4HPAA 2K23A 5IO7A 1QY2A 3CMPA 2NNQA 5D45A 2GTFX 4OS8A 1ICMA 1OPBA 4QAEA 5F6ZA 5LJHA 2R74A 1X8QA 1AVGI 1GKAA 3B2KA 3P6CA 4BVMA 1YIVA 1ZNKA 2QOSC 4YGZA 3CWKA 5HCEC 4WFUA 1OBPA 3ELZA 1LPJA 1ERXA 4XMFA 4ZGUA 3DTQA 2WWPA 5LJDA 3WJBA 1OEJA 4IAXA 3HWGA 2NNDA 3S26A 2ANSA 2FT9A 2AT8X 4GETA 1A18A 1YWBA 3BX7A 1XCAA 4GRJA 4TQ2A 3PECA 1HMRA 5HZ9A 4YMYA 1GXAA 2FRSA 1B4MA 2JU7A 1IKEA 1L6MA 4WFVA 2LBAA 3O2YA 5LJGA 5LJBA 1MX8A 5EDBA 5EZ2A 4IMNA 5BVSA 4ZR2A 1X89A 3UEXA 2NP1A 3JS1A 2HYSA 4ODDA 1ACDA 1HMSA 1VYGA 1MX7A 1O1VA 3TGAA 4AZQA 4YKOA 4ORWA 2FTBA 3NQ9A 4TLJA 1G5WA 3ZUOA 3WJDA 4XMEA 1BSYA 2FR3A 1ZNGA 3F9DA 3FA7A 4PSQA 3NX1A 5F1EA 2JN3A 1TOWA 4O9SA 5CE4A 4YKMA 2GC9A 1TVQA 3P6HA 1E06A 5DPQA 1B8EA 3NP1A 3I17A 4GKCA 1CJ5A 2Q2MA 1BSOA 3ELXA 2A2UA 4EXZA 1U17A 4Y0PA 1ICNA 4NLJA 1E00A 1BSQA 3B2JA 4YBUA 5B27A 4ZHHA 1KXOA 2O62A 3PH5A 4YFQA 3TGCA 2IFBA 1QG5A 5L8NA 1HMTA 3FENA 4ORXA 2GJ5A 2L67A 1LIFA 1GX9A 4A1HA 4WBKA 4AZPA 1EXSA 1KZXA 2W2AA 4YCEA 3KFGA 4NP1A 1EW3A 3IFBA 3CBCA 4HPCA 1CBRA 3MVFA 4BQUA 4I3DA 3U9PC 3BU1A 2HNXA 3BU9A 1HN2A 3WVMA 3UEVA 2ACOA 4I3CA 4I9SA 1DZJA 1LIEA 1GT4A 1G7NA 4IAWA 4HPBA 1GT5A 2HMBA 3FA9A 1VYFA 3VG3A 3FR2A 2P8GA 4ES7A 1KT7A 4GNWA 1SXUA 2PY1A 4RUNA 4XMHA 1UREA 4QZUA 1I05A 3C77X 4A60A 1QWDA 1LFOA 1QY0A 5HA1A 1PEEA 3EMMA 5H9NA 2A2GA 2LFOA 2AT3X 3P6DA 3FA8A 3VG4A 1JYDA 2K62A 3VG2A 4D6AA 3L4RA 2AT6X 4Y0SA 1IW2A 4M6SA 5EDCA 4QGVA 1S44A 4A1YA 2AKQA 1BLRA 4IBAA 1MDCA 4LKPA 1KT5A 5JR8A 1JJXA 1EPBA 2LKKA 2W2BA 4EEJA 3ZUIA 4YDAA 3TGBA 3APXA 4GE1A 5FFHA 5H9LA 1DF3A 3T1DA 1SY3A 4MVKA 4QYNA 2A0AA 1FEMA 5AQ6A 1D2UA 4TKHA 2AL0X 5F7GA 4QYPA 3Q6LA 5KHPA 3EBWA 3APWA 2ASNX 3FIQA 2QO5A 3G7XA 1DC9A 4N7CA 5HZ8A 4Y0QA 5L8IA 1X8OA 1CBSA 1YWDA 1IKJA 1SY1A 3IA8A 3APVA 4AW8A 3CQRA 1SXXA 3U03A 3HWEA 2AT5X 3K3LA 4D6BA 2OVDA 3NX2A 3FA6A 4XMGA 3WJEA 4ZH9A 1JBHA 4ORSA 1AB0A 3KFHA 1BRQA 1U18A 2KT4B 3BY0A 1T0VA 2HLVA 5HBSA 1EIOA 1EPAA 3U0DA 3BDRA 4Y0RA 1GT1A 5HAEA 4DQ4A 1FDQA 1ZNLA 2R56A 3NADA 1RBPA 3SAOA 5C0NA 1FTPA 4YFPA 4IMOA 1D3SA 3PPTA 3TF6A 4EDEA 1B0OA 1H91A 3FW4A 1N0SA 2LB6A 1FELA 2KTDA 4YGHA 1X8UA 1YP6A 4R0BA
chains in the Genus database with same CATH superfamily
1SLGB 4Z27A 2BLGA 2YG2A 4I6SA 1NBXA 1BEBA 1N9MA 2OZQA 2RTNB 4IB9A 5D48A 4AZMA 4BX6B 3QKGA 2FS6A 2EU7X 3P24A 2RTDB 5B2AO 1SWOA 2R73A 2X8SA 3FELA 4HPDA 5D8JA 1PM1X 3D95A 2AF5A 5AJBA 5BVQA 3FMZA 2XKLA 3FEKA 1SWDA 2RTFB 2L9CA 1HBPA 5HZ5A 1S2PA 2W2FA 3CR6A 4KCAA 1IIUA 3KQ0A 2RTJA 3KVNA 3GAQA 4ORYA 5EEEA 1OEEA 3EM0A 1X8PA 2OY8A 3JSQA 1NQNA 1UYOX 3HOEA 2AVIA 3NR3A 4OS0A 5LKFA 3BS2A 4NYRA 1T68X 3B2IA 1R0UA 2XSTA 3P6EA 3ZZVA 1KL5A 3SLOA 3F6ZB 1OBUA 4Z2PA 2IZIA 3P02A 3WYQA 1A57A 4ZCBA 2RA6A 3NQ3A 3VU1A 1HBQA 3KFFA 1EALA 2KTSA 1HQPA 3EBKA 1SWJA 3VG6A 4BCSA 3BX8A 2RQ0A 2NNEA 1MM9A 2AMMX 5EEDA 2HKDA 4O4UA 1RSUB 4Z2VA 4YGGA 4ZFXA 1JZUA 1JV4A 4YH0A 1CBQA 5D47A 4Z28A 4YCHA 4LZUA 1YUPA 1GM6A 3OD9A 1LIDA 2DJFA 1GGLA 1DZKA 1STSB 2ACPX 4UU3A 4ARHA 1Y9TA 4NNTA 3RSWA 3PDFA 1VWHB 4CPHA 1QY1A 4ORRA 2RTAA 5B29A 5H9AA 4OELA 1KQXA 1DZMA 1KT4A 2IZAA 3O19A 4CPFA 4ZH6A 3P6FA 2CBSA 4CPIA 4ALBA 2QM9A 5HZQA 1O1UA 5K67A 4QGWA 3VHMA 2RCTA 1UYNX 4O3XB 3CKFA 3PEDA 2KD2A 4AZRA 1ML7A 4Z2OA 2FKJA 4ON1A 1SWHA 3GE2A 4QGXA 1SRHA 4BX7A 4TKBA 2G7BA 1LNMA 2RCQA 4ZJ0A 1I04A 3BSZE 2WQ9A 1GX8A 1KGLA 4LZVA 4K19A 1I78A 1ZNDA 3MBTA 1EIIA 2GTLN 1SY0A 2OF9A 1QFVA 3APUA 1LIBA 3FR5A 5D4AA 5HTDA 4U9CA 1X71A 2WEWA 3F8AA 4ZHCA 4NNSA 1BBPA 1K3BA 3STMX 4CDCA 2FKGA 2L5PA 2RTKA 2X32A 5HWZA 2MO5A 1TW4A 3HK1A 3HWDA 1LCZA 4MISA 1VWCB 1G85A 4IB6A 2VFCA 4GGTA 1A2DA 5FAZA 1SWLA 1X8NA 1MVGA 4CK4A 1Z24A 2IZDB 2UZ2A 3D4RA 2FWVA 5K06A 4QNIA 3FLLA 3QQ2A 3VG7A 3STNA 4ALOA 5H8TA 3ZW1A 2CZTA 1Y9LA 2HZRA 2GTLM 3DSZA 2IZGB 4IB7A 5LKEA 4Y5DA 1NQMA 3FW5A 4OMXA 5F6BA 1STPA 3UEWA 5AEOA 4XMCA 3RDMA 1G74A 2MF6A 2JMBA 4AZNA 1P6PA 4TJZA 5HCDC 1W5RA 5B11O 2C1SA 1DV9A 1VWQB 4ZHGA 5F2BA 2MM3A 1GT3A 1VWIB 1O8VA 1FE3A 3D96A 1I4UA 4NYQA 2CAMA 1VWMB 5K68A 3NPOA 4BX5B 4ZGFA 5IRUA 3RZYA 3MM0A 1AQBA 4DQ3A 3S5XA 2POAA 1LICA 1A3YA 3WJFA 4DNEA 1IFBA 1ALBA 1SWSA 2X56A 2FLJA 3AUMO 1MUPA 5F58A 4I60A 2CZUA 1STRB 2Z4IA 3KFIA 2N93A 4YBPA 1OSPO 2RTCB 3WXQA 2MWHA 2X46A 1SWFA 2WEXA 3C76X 3BRNA 3KZAA 4YDBA 1QABE 3MG5A 1RLBE 2FS7A 1DZPA 1JJUA 3D97A 1KT6A 4KIIA 4FBRA 2Y32A 5HA0A 3UEUA 2L68A 5L8OA 1HXLA 3B2HA 1SY2A 2Q2PA 1BM5A 1I06A 4UU2A 1EQDA 3FYFA 4O3ZA 5L3YA 4GGRA 4TNNA 3OJYC 1OPAA 2LBVA 4U8UO 4HFOA 2RTIB 3RDXA 2Q9SA 3PH6A 3AKNA 1BJ7A 2WR6A 4TKJA 2A3FX 1I9HA 1NP1A 1KT3A 1YWAA 2OVSA 3D9WA 1SWKA 3FR4A 4MVIA 1EI5A 1QFTA 4NV8A 1KZWA 3T6FA 1YP7A 3WJCA 2G79A 1EUOA 3MX7A 1ERBA 1ZRYA 4I95A 5BVTA 3CQNA 4OS3A 1SWQA 5HZ6A 2Q39A 1NDJA 3I0AA 1IFCA 1VWNB 4OKAA 4EQAC 1AVEA 2WSJA 3WBGA 2E4JA 4A8ZA 2OVEA 1SA8A 2JU8A 2WUTA 4OMWA 1VWFB 5IRAA 3EYCA 4BBOA 2RTLA 5DG4A 5LJCA 4I3BA 1PMPA 1VWLB 4PJ2A 4BGFA 5LJKA 1VWDB 4M7MA 1SXWA 2VFBA 2AH7X 1E02A 2WPUA 4O49A 4FBVA 4MVEA 2OYBO 1SRFA 1IJ8A 1TXLA 3ZW2A 3PP6A 2CM9A 2RD7C 1U0XA 4XMDA 1AELA 3RY2A 5LJEA 3RDSA 4YVBA 5IO6A 4IB8A 1JJJA 4BOEA 2HZQA 4YFRA 1JIWI 2G5LA 1SLEB 4KT5A 3CBSA 1PBOA 3VG5A 1ADLA 1VPRA 3STKA 5HCCC 4QZTA 1SXYA 1T8VA 5EPQA 2FR2A 4N7DA 1SREA 1SWEA 4QRLA 2FHLA 3P6GA 5B3MO 1YWCA 3VHIA 1LCVA 2G78A 1KOIA 3B2LA 3AKMA 4ZHFA 4EKVA 1ZNHA 2F73A 1GKAB 3C78X 2CM4A 2CBRA 1UZ2X 2JU3A 4ORUA 1N7YA 4GNYA 1OBQA 1XKIA 2A13A 2ALLX 3SZJA 2RTPB 2X45A 2OFMX 4FQBB 1NGLA 1KL4A 1S7DA 2DM5A 2A5BA 2G8CO 1WBIA 2MHDA 1OEKA 4MVLA 1KL3A 1LF7A 2FHNX 3NQKA 4INNA 4AYHA 2MJIA 4BX6A 4MIRA 3ZW0B 4ZHDA 5KIDA 5JD2A 1SRGA 4RUUA 2OF8A 3BLGA 3LTWA 4CDFA 1LKEA 1TOUA 3HWFA 2Q4NA 3FEPA 5HTEA 3ZQ3A 4AZOA 1E5PA 2WQAE 1B56A 4WHIA 2RTQB 4CDEA 3S5VA 1RXJA 1DF8A 1ZNEA 4I9RA 1BRPA 4LKTA 2X4MA 4GH7A 1BWYA 3FDCA 5FENA 4EFGA 1JYJA 4IABA 4NLIA 1FENA 3SLJA 1Y0GA 1LDQA 5IRWA 1SWNA 1CBIA 1LCWA 2OFRX 3SOTA 3VHHA 3Q34A 1LELA 1SWAA 3WOVA 2AT0X 1CRBA 3O22A 1Y52X 5H9KA 1KQWA 1NP4A 4JHQA 3WZPA 2JOZA 5B5GA 3WJGA 2QMIA 2OVAA 2QO6A 1DFVA 4U46A 1PBYA 2QO4A 3EW2A 1QQSA 5IO5A 2QOMA 2K23A 4HPAA 1QY2A 5IO7A 3CMPA 5CSEA 2NNQA 5D45A 3PQUA 4GGZA 2RTBB 2GTFX 1FJ1E 4OS8A 1ICMA 1OPBA 4QAEA 5F6ZA 3VGWA 5LJHA 2R74A 1X8QA 1AVGI 1GKAA 3B2KA 3P6CA 4BVMA 1VWRB 1YIVA 1ZNKA 2QOSC 4YGZA 1SWCA 3CWKA 1W6FA 4OEMA 5HCEC 4WFUA 1OBPA 2A8GA 3RKGA 3ELZA 3SZIA 4QQ1A 2OL6O 2I5ZO 4GUZA 1LPJA 1ERXA 4XMFA 4ZGUA 3TZSA 3N91A 2BS5A 2KW1A 3DTQA 3HPEA 2OFAA 2IZCB 2WWPA 2F09A 5LJDA 3WJBA 1OEJA 4B55A 4IAXA 3HWGA 3PQSA 2NNDA 5FQ7E 3S60A 3S26A 2ANSA 2FT9A 2AT8X 4GETA 1A18A 1VYOA 3ZWEA 3RWXA 1VWOB 1YWBA 2F01A 1XCAA 3BX7A 4GRJA 4ML7B 4O4XA 3PECA 4TQ2A 1HMRA 5HZ9A 4C5PA 1PTSA 4YMYA 1GXAA 2FRSA 1B4MA 2JU7A 1IKEA 1L6MA 2Z4HA 4WFVA 2LBAA 1AVDA 3O2YA 5LJGA 5LJBA 1SWTA 1MX8A 2RTEB 5EDBA 4LQZA 2VDFA 5EZ2A 1JMXA 4IMNA 5BVSA 4ZR2A 1X89A 5CYBA 4GDZA 3UEXA 2NP1A 2JW1A 3VE1A 3JS1A 1VWPB 2HYSA 4ODDA 3T2WA 1ACDA 1HMSA 1VYGA 1MX7A 1RAVA 3FIDA 1O1VA 2RTMA 4GJVA 2IZKA 3TGAA 3LHNA 4AZQA 4YKOA 4ORWA 5B10O 2OY5O 2Y3EA 4ID2A 2FTBA 3NQ9A 4TLJA 1G5WA 4O4OA 3ZUOA 2BSZA 2OY7A 1VWGB 1VWKB 1RSTB 1BSYA 2FR3A 1ZNGA 3F9DA 3FA7A 4PSQA 4XMEA 3RBYA 3NX1A 5F1EA 2JN3A 1TOWA 4BX5A 2IZHB 1SWBA 4O9SA 5CE4A 4YKMA 1SMPI 2GC9A 1TVQA 3P6HA 1E06A 1Y53X 2RTGB 4DCBA 4CPHB 2JGSA 3VPJE 3T6LA 2C1QA 5DPQA 1B8EA 1JMZA 2BS6A 3NP1A 3I17A 4GKCA 1CJ5A 4FBOA 1SRJA 2Q2MA 1BSOA 2RN4A 2RTRB 3ELXA 4U8UN 1VWEB 1HY2A 2A2UA 4BX7B 1WUBA 4EXZA 5KICA 4JGLA 1U17A 2IZLB 4GJSA 1JQPA 4Y0PA 3SLTA 1E2TA 1ICNA 4NLJA 1E00A 1BSQA 3B2JA 4YBUA 5B27A 4Z6JA 4ZHHA 1KXOA 2O62A 3PH5A 4YFQA 3TGCA 2IFBA 1QG5A 5L8NA 5BYPA 3H3IA 1HMTA 1HQQA 1LUQA 3FENA 4GD9A 4ORXA 2GJ5A 2GTLO 3NBXX 2IZFB 1LIFA 2L67A 1GX9A 4A1HA 1RXKA 4WBKA 4AZPA 4GZVA 1EXSA 4U8UM 1GX3A 2I5VO 2W2AA 4IRWA 4YCEA 4CDDA 3E3CA 5FQ6E 1KZXA 3KFGA 1MOYA 4NP1A 5CHKA 1EW3A 3IFBA 4BJ8A 3CBCA 3WZOA 1K24A 3JQOA 1VWBB 2LA7A 4HPCA 2C4IA 1CBRA 3ZW1B 3MVFA 4BQUA 4I3DA 3U9PC 3BU1A 2HNXA 3BU9A 3WYPA 1HN2A 3WVMA 3UEVA 2X34A 2ACOA 4I3CA 4I9SA 1LDOA 1DZJA 1LIEA 2OL7A 1GT4A 1G7NA 3VE2A 3WZQA 4IAWA 4HPBA 1VWAB 1GT5A 2HMBA 3FA9A 4O3YA 4NV7A 1VYFA 3VG3A 3FR2A 2P8GA 2RTHB 4ES7A 4MEEA 1KT7A 1MEPA 4GK9A 4GNWA 4L1NA 1SXUA 2PY1A 4RUNA 4XMHA 1UREA 4QZUA 4JO6A 1I05A 3C77X 4A60A 1QWDA 4L3RA 3EW1A 4Y59A 1LFOA 3LV4A 1QY0A 2BHVA 5HA1A 3X00A 3HTYA 1SWRA 3EMMA 5H9NA 1PEEA 2A2GA 2YMSA 2GH7A 2OL8O 2LFOA 5AJCA 2AT3X 3ZI8A 2IZJA 3P6DA 3FA8A 3VG4A 2BC3A 4COTA 1JYDA 2K62A 2RTOB 4GDAA 3VG2A 3L4RA 4D6AA 1W4TA 2AT6X 4Y0SA 1NC9A 1IW2A 3SZHA 4M6SA 5EDCA 4KH8A 4QGVA 3RE6A 4CSBA 1S44A 1N9YA 4A1YA 2AKQA 1BLRA 4O4SA 2OFBA 5IXGA 4JNJA 1Y55X 1MDCA 4IBAA 1KT5A 4LKPA 3RY1A 5JR8A 4CV7A 1JJXA 1KFFA 4FGIB 1EPBA 3ZW0A 2LKKA 2W2BA 3OE3A 4EEJA 3ZUIA 4YDAA 3TGBA 3APXA 4GE1A 5FFHA 5H9LA 2QCBA 1DF3A 1MK5A 3T1DA 1SY3A 4MVKA 4QYNA 3WZNA 2A0AA 2X8FA 1FEMA 4KC8A 2PI3O 1SWPA 4NW4A 5AQ6A 3PK2A 1D2UA 4TKHA 1SLFB 2AL0X 2OY1O 4QYPA 3Q6LA 5F7GA 1SWUA 5KHPA 2BT9A 3EBWA 1VWJB 3APWA 3V8UA 2ASNX 3FIQA 2QO5A 3G7XA 1DC9A 4N7CA 5HZ8A 4KC7A 2ZSCA 4Y0QA 1X8OA 1CBSA 1YWDA 1IKJA 1SWGA 5L8IA 5FQ8E 3RDOA 1SY1A 2IZBA 3IA8A 3APVA 4AW8A 1SLDB 2Y3FA 3CQRA 1SXXA 2X8TA 2DJGA 3U03A 3CKGA 3HWEA 2AT5X 1N43A 3K3LA 4D6BA 2OVDA 3NX2A 3FA6A 1SRIA 4GU8A 4XMGA 2ZAIA 3WJEA 1N4JA 3AEHA 4ZH9A 3WJDA 1JBHA 2IZEB 4ORSA 1AB0A 4HWMA 3T2XA 3KFHA 1BRQA 1U18A 3EC5A 2KT4B 2FGSA 1T0VA 2HLVA 3BY0A 5HBSA 2M4LA 1EIOA 1EPAA 3U0DA 3BDRA 4Y0RA 4O3WA 5B5FA 3RDQA 1GT1A 3HOLA 5HAEA 4DQ4A 2A5CA 1FDQA 1ZNLA 2R56A 3NADA 1RBPA 3SAOA 4CPEA 5C0NA 2X55A 1FTPA 4YFPA 2UYWA 4IMOA 2ZAGA 1D3SA 3UAQA 3OBLA 3PPTA 3TF6A 1RXHA 4EDEA 1B0OA 1H91A 3FW4A 1N0SA 4U3QA 2LB6A 3RDUA 3RE5A 1HXZA 1FELA 2KTDA 4YGHA 1X8UA 1YP6A 4R0BA
chains in the Genus database with same CATH topology
2BLGA 2YG2A 4I6SA 4IB9A 1BEBA 2OZQA 5D48A 4AZMA 3TZSA 3QKGA 2FS6A 2EU7X 3P24A 2X8SA 2R73A 3FELA 4HPDA 5D8JA 1PM1X 3D95A 5AJBA 5BVQA 3FMZA 2XKLA 3FEKA 2L9CA 1HBPA 5HZ5A 1S2PA 2W2FA 3CR6A 4KCAA 1IIUA 3KQ0A 4ORYA 3GAQA 5EEEA 1OEEA 3EM0A 1X8PA 3JSQA 3HOEA 3NR3A 4OS0A 5LKFA 3BS2A 4NYRA 1T68X 3B2IA 1R0UA 2XSTA 3P6EA 3ZZVA 3F6ZB 1OBUA 3P02A 1A57A 4ZCBA 2RA6A 3NQ3A 3VU1A 1HBQA 3KFFA 1EALA 2KTSA 1HQPA 3EBKA 3VG6A 3BX8A 2RQ0A 2NNEA 2AMMX 5EEDA 4O4UA 1JZUA 4ZFXA 4YGGA 1JV4A 4YH0A 1CBQA 5D47A 4YCHA 4LZUA 1YUPA 1GM6A 3OD9A 1LIDA 1GGLA 1DZKA 2ACPX 4UU3A 4ARHA 1Y9TA 4NNTA 3RSWA 1QY1A 4ORRA 5B29A 5H9AA 1KQXA 1DZMA 1KT4A 3O19A 4ZH6A 3P6FA 2CBSA 4ALBA 2QM9A 5HZQA 1O1UA 4QGWA 2RCTA 4O3XB 3PEDA 4AZRA 2KD2A 1ML7A 4ON1A 3GE2A 4QGXA 4TKBA 2G7BA 1LNMA 2RCQA 4ZJ0A 1I04A 3BSZE 2WQ9A 1GX8A 1KGLA 4LZVA 4K19A 1ZNDA 3MBTA 1EIIA 2GTLN 1SY0A 1QFVA 3APUA 1LIBA 3FR5A 5D4AA 5HTDA 4U9CA 1X71A 2WEWA 3F8AA 4ZHCA 4NNSA 1BBPA 3STMX 2L5PA 5HWZA 2MO5A 1TW4A 3HK1A 3HWDA 4MISA 4IB6A 1G85A 1A2DA 5FAZA 1X8NA 1MVGA 4CK4A 1Z24A 3D4RA 2FWVA 5K06A 4QNIA 3FLLA 3VG7A 3STNA 4ALOA 5H8TA 3ZW1A 2CZTA 1Y9LA 2HZRA 2GTLM 3DSZA 4IB7A 5LKEA 3FW5A 4OMXA 5F6BA 3UEWA 5AEOA 4XMCA 1G74A 2JMBA 4AZNA 1P6PA 4TJZA 5HCDC 1DV9A 4ZHGA 2MM3A 1GT3A 1O8VA 1FE3A 3D96A 1I4UA 4NYQA 4ZGFA 3NPOA 3RZYA 1AQBA 4DQ3A 3S5XA 2POAA 1LICA 1A3YA 3WJFA 1IFBA 1ALBA 2FLJA 1MUPA 5F58A 2CZUA 2Z4IA 3KFIA 4YBPA 2N93A 3WXQA 2MWHA 2X46A 2WEXA 3C76X 3KZAA 3BRNA 4YDBA 1QABE 1RLBE 2FS7A 1DZPA 3D97A 1KT6A 4KIIA 4FBRA 3UEUA 5HA0A 2L68A 5L8OA 3B2HA 1SY2A 2Q2PA 1BM5A 1I06A 4UU2A 1EQDA 3FYFA 4O3ZA 4TNNA 3OJYC 1OPAA 2LBVA 4U8UO 4HFOA 2Q9SA 3PH6A 3AKNA 1BJ7A 2WR6A 4TKJA 2A3FX 2OVSA 1NP1A 1KT3A 1YWAA 3FR4A 4RUUA 1KZWA 4MVIA 1EI5A 1QFTA 1YP7A 3WJCA 2G79A 1EUOA 3MX7A 1ERBA 1ZRYA 4I95A 5BVTA 3CQNA 4OS3A 5HZ6A 2Q39A 3I0AA 1IFCA 4EQAC 2WSJA 3WBGA 2E4JA 4A8ZA 2OVEA 1SA8A 2JU8A 2WUTA 4OMWA 3EYCA 5DG4A 5LJCA 4I3BA 1PMPA 4PJ2A 5LJKA 4M7MA 1SXWA 2AH7X 1E02A 4O49A 4FBVA 4MVEA 1TXLA 3ZW2A 3PP6A 2CM9A 2RD7C 1U0XA 4XMDA 1AELA 5LJEA 5IO6A 4IB8A 1JJJA 4BOEA 2HZQA 4YFRA 1JIWI 4KT5A 3CBSA 1PBOA 3VG5A 1ADLA 1VPRA 3STKA 5HCCC 4QZTA 1SXYA 1T8VA 5EPQA 2FR2A 4N7DA 4QRLA 3P6GA 1YWCA 2G78A 1KOIA 3B2LA 3AKMA 4ZHFA 1ZNHA 2F73A 1GKAB 3C78X 2CM4A 2CBRA 1UZ2X 2JU3A 4ORUA 4GNYA 1OBQA 1XKIA 2A13A 2ALLX 2X45A 2OFMX 4FQBB 1NGLA 1S7DA 2DM5A 2MHDA 1OEKA 4MVLA 1LF7A 4INNA 3NQKA 4AYHA 4ZHDA 2MJIA 4MIRA 3ZW0B 5KIDA 3BLGA 1LKEA 1TOUA 3HWFA 2Q4NA 3FEPA 5HTEA 3ZQ3A 4AZOA 1E5PA 2WQAE 1B56A 4WHIA 3S5VA 1ZNEA 4I9RA 1BRPA 4LKTA 4GH7A 1BWYA 5FENA 4EFGA 1JYJA 4IABA 4NLIA 1FENA 1CBIA 2OFRX 3SOTA 3WOVA 2AT0X 1CRBA 3O22A 5H9KA 1KQWA 1NP4A 2JOZA 3WJGA 2QMIA 2OVAA 2QO6A 1DFVA 5IO5A 5KICA 2QO4A 1QQSA 4HPAA 2K23A 5IO7A 1QY2A 3CMPA 2NNQA 5D45A 3PQUA 2GTFX 4OS8A 1ICMA 1OPBA 4QAEA 5F6ZA 5LJHA 2R74A 1X8QA 1AVGI 1GKAA 3B2KA 3P6CA 4BVMA 1YIVA 1ZNKA 2QOSC 4YGZA 3CWKA 5HCEC 3RKGA 4WFUA 1OBPA 3ELZA 4QQ1A 1LPJA 1ERXA 4XMFA 4ZGUA 3N91A 2BS5A 2KW1A 3DTQA 2WWPA 5LJDA 2F09A 3WJBA 1OEJA 4IAXA 3HWGA 3PQSA 2NNDA 5FQ7E 3S60A 3S26A 2ANSA 2FT9A 2AT8X 4GETA 1A18A 3ZWEA 3RWXA 1YWBA 3BX7A 1XCAA 4GRJA 4ML7B 4O4XA 4TQ2A 3PECA 1HMRA 5HZ9A 4YMYA 1GXAA 2FRSA 1B4MA 2JU7A 1IKEA 1L6MA 2Z4HA 4WFVA 2LBAA 3O2YA 5LJGA 5LJBA 1MX8A 5EDBA 4LQZA 5EZ2A 4IMNA 5BVSA 4ZR2A 1X89A 5CYBA 4GDZA 3UEXA 2NP1A 2JW1A 3VE1A 3JS1A 2HYSA 4ODDA 1ACDA 1HMSA 1VYGA 1MX7A 1O1VA 3TGAA 3LHNA 4AZQA 4YKOA 4ORWA 4ID2A 2FTBA 3NQ9A 4TLJA 1G5WA 4O4OA 3ZUOA 3WJDA 4XMEA 1BSYA 2FR3A 1ZNGA 3F9DA 3FA7A 4PSQA 3RBYA 3NX1A 5F1EA 2JN3A 1TOWA 4O9SA 5CE4A 4YKMA 1SMPI 2GC9A 1TVQA 3P6HA 1E06A 3VPJE 5DPQA 1B8EA 2BS6A 3NP1A 3I17A 4GKCA 1CJ5A 4FBOA 2Q2MA 1BSOA 2RN4A 3ELXA 4U8UN 2A2UA 4EXZA 4JGLA 1U17A 4Y0PA 1ICNA 4NLJA 1E00A 1BSQA 3B2JA 4YBUA 5B27A 4ZHHA 1KXOA 2O62A 3PH5A 4YFQA 3TGCA 2IFBA 1QG5A 5L8NA 5BYPA 3H3IA 1HMTA 3FENA 4ORXA 2GJ5A 2GTLO 3NBXX 2L67A 1LIFA 1GX9A 4A1HA 4WBKA 4AZPA 4GZVA 1EXSA 4U8UM 1KZXA 2W2AA 4YCEA 3E3CA 5FQ6E 3KFGA 4NP1A 1EW3A 3IFBA 3CBCA 3JQOA 2LA7A 4HPCA 1CBRA 3ZW1B 3MVFA 4BQUA 4I3DA 3U9PC 3BU1A 2HNXA 3BU9A 1HN2A 3WVMA 3UEVA 2ACOA 4I3CA 4I9SA 1DZJA 1LIEA 3VE2A 1GT4A 1G7NA 4IAWA 4HPBA 1GT5A 2HMBA 3FA9A 4O3YA 1VYFA 3VG3A 3FR2A 2P8GA 4ES7A 1KT7A 4GK9A 4GNWA 4L1NA 2PY1A 1SXUA 4RUNA 4XMHA 1UREA 4QZUA 1I05A 3C77X 4A60A 1QWDA 4L3RA 1LFOA 3LV4A 1QY0A 2BHVA 5HA1A 3HTYA 1PEEA 3EMMA 5H9NA 2A2GA 2YMSA 2LFOA 5AJCA 2AT3X 3ZI8A 3P6DA 3FA8A 3VG4A 4COTA 1JYDA 2K62A 3VG2A 4D6AA 3L4RA 2AT6X 4Y0SA 1IW2A 4M6SA 5EDCA 4KH8A 4QGVA 4CSBA 1S44A 4A1YA 2AKQA 1BLRA 4O4SA 4IBAA 1MDCA 4LKPA 1KT5A 5JR8A 4CV7A 1JJXA 4FGIB 1EPBA 3ZW0A 2LKKA 2W2BA 3OE3A 4EEJA 3ZUIA 4YDAA 3TGBA 3APXA 4GE1A 5FFHA 5H9LA 1DF3A 3T1DA 1SY3A 4MVKA 4QYNA 2A0AA 2X8FA 1FEMA 4KC8A 4NW4A 5AQ6A 1D2UA 4TKHA 2AL0X 5F7GA 4QYPA 3Q6LA 5KHPA 2BT9A 3EBWA 3APWA 3V8UA 2ASNX 3FIQA 2QO5A 3G7XA 1DC9A 4N7CA 5HZ8A 4KC7A 4Y0QA 5L8IA 1X8OA 1CBSA 1YWDA 1IKJA 5FQ8E 1SY1A 3IA8A 3APVA 4AW8A 3CQRA 1SXXA 2X8TA 3U03A 3HWEA 2AT5X 3K3LA 4D6BA 2OVDA 3NX2A 3FA6A 4GU8A 4XMGA 2ZAIA 3WJEA 4ZH9A 1JBHA 4ORSA 1AB0A 4HWMA 3KFHA 1BRQA 1U18A 2KT4B 3BY0A 1T0VA 2HLVA 5HBSA 1EIOA 2M4LA 1EPAA 3U0DA 3BDRA 4Y0RA 4O3WA 1GT1A 3HOLA 5HAEA 4DQ4A 1FDQA 1ZNLA 2R56A 3NADA 1RBPA 3SAOA 5C0NA 1FTPA 4YFPA 4IMOA 2ZAGA 1D3SA 3UAQA 3OBLA 3PPTA 3TF6A 4EDEA 1B0OA 1H91A 3FW4A 1N0SA 4U3QA 2LB6A 1FELA 2KTDA 4YGHA 1X8UA 1YP6A 4R0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BLG A;  2YG2 A;  3TZS A;  4IB9 A;  1BEB A;  2OZQ A;  5D48 A;  4AZM A;  3QKG A;  2FS6 A;  2EU7 X;  3FEL A;  2R73 A;  4HPD A;  5D8J A;  1PM1 X;  3D95 A;  5BVQ A;  3FMZ A;  2XKL A;  3FEK A;  2L9C A;  1HBP A;  5HZ5 A;  1S2P A;  2W2F A;  3CR6 A;  1IIU A;  3KQ0 A;  4ORY A;  3GAQ A;  5EEE A;  1OEE A;  3EM0 A;  1X8P A;  3JSQ A;  4OS0 A;  3NR3 A;  5LKF A;  3BS2 A;  4NYR A;  1T68 X;  3B2I A;  1R0U A;  2XST A;  3P6E A;  1OBU A;  1A57 A;  4ZCB A;  2RA6 A;  3NQ3 A;  1HBQ A;  3KFF A;  1EAL A;  1HQP A;  3EBK A;  3VG6 A;  3BX8 A;  2RQ0 A;  2NNE A;  2AMM X;  5EED A;  1JZU A;  4ZFX A;  4YGG A;  1JV4 A;  4YH0 A;  1CBQ A;  5D47 A;  4YCH A;  4LZU A;  1YUP A;  1GM6 A;  1LID A;  1GGL A;  1DZK A;  2ACP X;  4UU3 A;  4ARH A;  4NNT A;  3RSW A;  1QY1 A;  4ORR A;  5B29 A;  5H9A A;  1KQX A;  1DZM A;  1KT4 A;  3O19 A;  4ZH6 A;  3P6F A;  2CBS A;  4ALB A;  2QM9 A;  5HZQ A;  1O1U A;  4QGW A;  2RCT A;  3PED A;  4AZR A;  1ML7 A;  4QGX A;  4TKB A;  2G7B A;  1LNM A;  2RCQ A;  4ZJ0 A;  1I04 A;  3BSZ E;  2WQ9 A;  1GX8 A;  1KGL A;  4LZV A;  4K19 A;  1ZND A;  3MBT A;  1EII A;  1SY0 A;  1QFV A;  3APU A;  1LIB A;  3FR5 A;  5D4A A;  5HTD A;  1X71 A;  2WEW A;  3F8A A;  4ZHC A;  4NNS A;  1BBP A;  3STM X;  2L5P A;  5HWZ A;  2MO5 A;  1TW4 A;  3HK1 A;  3HWD A;  4IB6 A;  1G85 A;  1A2D A;  5FAZ A;  1X8N A;  1MVG A;  4CK4 A;  1Z24 A;  2FWV A;  5K06 A;  3FLL A;  3VG7 A;  3STN A;  4ALO A;  5H8T A;  2CZT A;  2HZR A;  3DSZ A;  4IB7 A;  5LKE A;  3FW5 A;  4OMX A;  5F6B A;  3UEW A;  4XMC A;  1G74 A;  4AZN A;  1P6P A;  4TJZ A;  5HCD C;  1DV9 A;  4ZHG A;  2MM3 A;  1GT3 A;  1O8V A;  1FE3 A;  3D96 A;  1I4U A;  4NYQ A;  3NPO A;  3RZY A;  1AQB A;  4DQ3 A;  2POA A;  1LIC A;  1A3Y A;  3WJF A;  1IFB A;  1ALB A;  2FLJ A;  1MUP A;  5F58 A;  2CZU A;  3KFI A;  4YBP A;  2N93 A;  3WXQ A;  3C76 X;  2X46 A;  2WEX A;  4YDB A;  3KZA A;  3BRN A;  1QAB E;  1RLB E;  2FS7 A;  1DZP A;  3D97 A;  1KT6 A;  4KII A;  3UEU A;  5HA0 A;  2L68 A;  5L8O A;  3B2H A;  1SY2 A;  2Q2P A;  1BM5 A;  1I06 A;  4UU2 A;  1EQD A;  4TNN A;  3OJY C;  1OPA A;  2LBV A;  4HFO A;  2Q9S A;  3PH6 A;  3AKN A;  1BJ7 A;  2WR6 A;  4TKJ A;  2A3F X;  4RUU A;  1NP1 A;  1KT3 A;  1YWA A;  3FR4 A;  1KZW A;  4MVI A;  1QFT A;  1YP7 A;  3WJC A;  2G79 A;  1EUO A;  1ERB A;  1ZRY A;  5BVT A;  3CQN A;  4OS3 A;  5HZ6 A;  2Q39 A;  3I0A A;  1IFC A;  2WSJ A;  3WBG A;  2E4J A;  4A8Z A;  2OVE A;  1SA8 A;  2JU8 A;  2WUT A;  4OMW A;  3EYC A;  5DG4 A;  5LJC A;  4I3B A;  1PMP A;  5LJK A;  4M7M A;  1SXW A;  2AH7 X;  1E02 A;  1TXL A;  3PP6 A;  2CM9 A;  2RD7 C;  1U0X A;  4XMD A;  1AEL A;  5LJE A;  5IO6 A;  4IB8 A;  1JJJ A;  4BOE A;  2HZQ A;  4YFR A;  3CBS A;  1PBO A;  3VG5 A;  1ADL A;  1VPR A;  3STK A;  5HCC C;  4QZT A;  1SXY A;  1T8V A;  5EPQ A;  2FR2 A;  4N7D A;  3P6G A;  1YWC A;  2G78 A;  1KOI A;  3B2L A;  3AKM A;  4ZHF A;  1ZNH A;  2F73 A;  1GKA B;  3C78 X;  2CM4 A;  2CBR A;  1UZ2 X;  2JU3 A;  4ORU A;  4GNY A;  1OBQ A;  1XKI A;  2A13 A;  2ALL X;  2X45 A;  2OFM X;  1NGL A;  1S7D A;  2DM5 A;  1OEK A;  4MVL A;  1LF7 A;  4ZHD A;  4AYH A;  2MJI A;  5KID A;  3BLG A;  1LKE A;  1TOU A;  3HWF A;  2Q4N A;  3FEP A;  5HTE A;  3ZQ3 A;  4AZO A;  1E5P A;  2WQA E;  1B56 A;  1ZNE A;  4I9R A;  1BRP A;  4LKT A;  4GH7 A;  1BWY A;  5FEN A;  4EFG A;  1JYJ A;  4NLI A;  1FEN A;  1CBI A;  2OFR X;  2AT0 X;  1CRB A;  3O22 A;  5H9K A;  1KQW A;  1NP4 A;  2JOZ A;  3WJG A;  2OVA A;  2QO6 A;  1DFV A;  5IO5 A;  5KIC A;  2QO4 A;  1QQS A;  4HPA A;  2K23 A;  5IO7 A;  1QY2 A;  3CMP A;  2NNQ A;  5D45 A;  2GTF X;  4OS8 A;  1ICM A;  1OPB A;  4QAE A;  5F6Z A;  5LJH A;  2R74 A;  1X8Q A;  1AVG I;  1GKA A;  3B2K A;  3P6C A;  4BVM A;  1YIV A;  1ZNK A;  2QOS C;  4YGZ A;  3CWK A;  5HCE C;  4WFU A;  1OBP A;  3ELZ A;  1LPJ A;  1ERX A;  4XMF A;  4ZGU A;  3DTQ A;  2WWP A;  5LJD A;  3WJB A;  1OEJ A;  4IAX A;  3HWG A;  2NND A;  3S26 A;  2ANS A;  2FT9 A;  2AT8 X;  4GET A;  1A18 A;  1YWB A;  3BX7 A;  1XCA A;  4GRJ A;  4TQ2 A;  3PEC A;  1HMR A;  5HZ9 A;  4YMY A;  1GXA A;  2FRS A;  1B4M A;  2JU7 A;  1IKE A;  1L6M A;  4WFV A;  2LBA A;  3O2Y A;  5LJG A;  5LJB A;  1MX8 A;  5EDB A;  5EZ2 A;  4IMN A;  5BVS A;  4ZR2 A;  1X89 A;  3UEX A;  2NP1 A;  3JS1 A;  2HYS A;  4ODD A;  1ACD A;  1HMS A;  1VYG A;  1MX7 A;  1O1V A;  3TGA A;  4AZQ A;  4YKO A;  4ORW A;  2FTB A;  3NQ9 A;  4TLJ A;  1G5W A;  3ZUO A;  3WJD A;  4XME A;  1BSY A;  2FR3 A;  1ZNG A;  3F9D A;  3FA7 A;  4PSQ A;  3NX1 A;  5F1E A;  2JN3 A;  1TOW A;  4O9S A;  5CE4 A;  4YKM A;  2GC9 A;  1TVQ A;  3P6H A;  1E06 A;  5DPQ A;  1B8E A;  3NP1 A;  3I17 A;  4GKC A;  1CJ5 A;  2Q2M A;  1BSO A;  3ELX A;  2A2U A;  4EXZ A;  1U17 A;  4Y0P A;  1ICN A;  4NLJ A;  1E00 A;  1BSQ A;  3B2J A;  4YBU A;  5B27 A;  4ZHH A;  1KXO A;  2O62 A;  3PH5 A;  4YFQ A;  3TGC A;  2IFB A;  1QG5 A;  5L8N A;  1HMT A;  3FEN A;  4ORX A;  2GJ5 A;  2L67 A;  1LIF A;  1GX9 A;  4A1H A;  4WBK A;  4AZP A;  1EXS A;  1KZX A;  2W2A A;  4YCE A;  3KFG A;  4NP1 A;  1EW3 A;  3IFB A;  3CBC A;  4HPC A;  1CBR A;  3MVF A;  4BQU A;  4I3D A;  3U9P C;  3BU1 A;  2HNX A;  3BU9 A;  1HN2 A;  3WVM A;  3UEV A;  2ACO A;  4I3C A;  4I9S A;  1DZJ A;  1LIE A;  1GT4 A;  1G7N A;  4IAW A;  4HPB A;  1GT5 A;  2HMB A;  3FA9 A;  1VYF A;  3VG3 A;  3FR2 A;  2P8G A;  4ES7 A;  1KT7 A;  4GNW A;  1SXU A;  2PY1 A;  4RUN A;  4XMH A;  1URE A;  4QZU A;  1I05 A;  3C77 X;  4A60 A;  1QWD A;  1LFO A;  1QY0 A;  5HA1 A;  1PEE A;  3EMM A;  5H9N A;  2A2G A;  2LFO A;  2AT3 X;  3P6D A;  3FA8 A;  3VG4 A;  1JYD A;  2K62 A;  3VG2 A;  4D6A A;  3L4R A;  2AT6 X;  4Y0S A;  1IW2 A;  4M6S A;  5EDC A;  4QGV A;  1S44 A;  4A1Y A;  2AKQ A;  1BLR A;  4IBA A;  1MDC A;  4LKP A;  1KT5 A;  5JR8 A;  1JJX A;  1EPB A;  2LKK A;  2W2B A;  4EEJ A;  3ZUI A;  4YDA A;  3TGB A;  3APX A;  4GE1 A;  5FFH A;  5H9L A;  1DF3 A;  3T1D A;  1SY3 A;  4MVK A;  4QYN A;  2A0A A;  1FEM A;  5AQ6 A;  1D2U A;  4TKH A;  2AL0 X;  5F7G A;  4QYP A;  3Q6L A;  5KHP A;  3EBW A;  3APW A;  2ASN X;  3FIQ A;  2QO5 A;  3G7X A;  1DC9 A;  4N7C A;  5HZ8 A;  4Y0Q A;  5L8I A;  1X8O A;  1CBS A;  1YWD A;  1IKJ A;  1SY1 A;  3IA8 A;  3APV A;  4AW8 A;  3CQR A;  1SXX A;  3U03 A;  3HWE A;  2AT5 X;  3K3L A;  4D6B A;  2OVD A;  3NX2 A;  3FA6 A;  4XMG A;  3WJE A;  4ZH9 A;  1JBH A;  4ORS A;  1AB0 A;  3KFH A;  1BRQ A;  1U18 A;  2KT4 B;  3BY0 A;  1T0V A;  2HLV A;  5HBS A;  1EIO A;  1EPA A;  3U0D A;  3BDR A;  4Y0R A;  1GT1 A;  5HAE A;  4DQ4 A;  1FDQ A;  1ZNL A;  2R56 A;  3NAD A;  1RBP A;  3SAO A;  5C0N A;  1FTP A;  4YFP A;  4IMO A;  1D3S A;  3PPT A;  3TF6 A;  4EDE A;  1B0O A;  1H91 A;  3FW4 A;  1N0S A;  2LB6 A;  1FEL A;  2KTD A;  4YGH A;  1X8U A;  1YP6 A;  4R0B A; 
#chains in the Genus database with same CATH topology
 1SLG B;  4Z27 A;  2BLG A;  2YG2 A;  4I6S A;  1NBX A;  1BEB A;  1N9M A;  2OZQ A;  2RTN B;  4IB9 A;  5D48 A;  4AZM A;  4BX6 B;  3QKG A;  2FS6 A;  2EU7 X;  3P24 A;  2RTD B;  5B2A O;  1SWO A;  2R73 A;  2X8S A;  3FEL A;  4HPD A;  5D8J A;  1PM1 X;  3D95 A;  2AF5 A;  5AJB A;  5BVQ A;  3FMZ A;  2XKL A;  3FEK A;  1SWD A;  2RTF B;  2L9C A;  1HBP A;  5HZ5 A;  1S2P A;  2W2F A;  3CR6 A;  4KCA A;  1IIU A;  3KQ0 A;  2RTJ A;  3KVN A;  3GAQ A;  4ORY A;  5EEE A;  1OEE A;  3EM0 A;  1X8P A;  2OY8 A;  3JSQ A;  1NQN A;  1UYO X;  3HOE A;  2AVI A;  3NR3 A;  4OS0 A;  5LKF A;  3BS2 A;  4NYR A;  1T68 X;  3B2I A;  1R0U A;  2XST A;  3P6E A;  3ZZV A;  1KL5 A;  3SLO A;  3F6Z B;  1OBU A;  4Z2P A;  2IZI A;  3P02 A;  3WYQ A;  1A57 A;  4ZCB A;  2RA6 A;  3NQ3 A;  3VU1 A;  1HBQ A;  3KFF A;  1EAL A;  2KTS A;  1HQP A;  3EBK A;  1SWJ A;  3VG6 A;  4BCS A;  3BX8 A;  2RQ0 A;  2NNE A;  1MM9 A;  2AMM X;  5EED A;  2HKD A;  4O4U A;  1RSU B;  4Z2V A;  4YGG A;  4ZFX A;  1JZU A;  1JV4 A;  4YH0 A;  1CBQ A;  5D47 A;  4Z28 A;  4YCH A;  4LZU A;  1YUP A;  1GM6 A;  3OD9 A;  1LID A;  2DJF A;  1GGL A;  1DZK A;  1STS B;  2ACP X;  4UU3 A;  4ARH A;  1Y9T A;  4NNT A;  3RSW A;  3PDF A;  1VWH B;  4CPH A;  1QY1 A;  4ORR A;  2RTA A;  5B29 A;  5H9A A;  4OEL A;  1KQX A;  1DZM A;  1KT4 A;  2IZA A;  3O19 A;  4CPF A;  4ZH6 A;  3P6F A;  2CBS A;  4CPI A;  4ALB A;  2QM9 A;  5HZQ A;  1O1U A;  5K67 A;  4QGW A;  3VHM A;  2RCT A;  1UYN X;  4O3X B;  3CKF A;  3PED A;  2KD2 A;  4AZR A;  1ML7 A;  4Z2O A;  2FKJ A;  4ON1 A;  1SWH A;  3GE2 A;  4QGX A;  1SRH A;  4BX7 A;  4TKB A;  2G7B A;  1LNM A;  2RCQ A;  4ZJ0 A;  1I04 A;  3BSZ E;  2WQ9 A;  1GX8 A;  1KGL A;  4LZV A;  4K19 A;  1I78 A;  1ZND A;  3MBT A;  1EII A;  2GTL N;  1SY0 A;  2OF9 A;  1QFV A;  3APU A;  1LIB A;  3FR5 A;  5D4A A;  5HTD A;  4U9C A;  1X71 A;  2WEW A;  3F8A A;  4ZHC A;  4NNS A;  1BBP A;  1K3B A;  3STM X;  4CDC A;  2FKG A;  2L5P A;  2RTK A;  2X32 A;  5HWZ A;  2MO5 A;  1TW4 A;  3HK1 A;  3HWD A;  1LCZ A;  4MIS A;  1VWC B;  1G85 A;  4IB6 A;  2VFC A;  4GGT A;  1A2D A;  5FAZ A;  1SWL A;  1X8N A;  1MVG A;  4CK4 A;  1Z24 A;  2IZD B;  2UZ2 A;  3D4R A;  2FWV A;  5K06 A;  4QNI A;  3FLL A;  3QQ2 A;  3VG7 A;  3STN A;  4ALO A;  5H8T A;  3ZW1 A;  2CZT A;  1Y9L A;  2HZR A;  2GTL M;  3DSZ A;  2IZG B;  4IB7 A;  5LKE A;  4Y5D A;  1NQM A;  3FW5 A;  4OMX A;  5F6B A;  1STP A;  3UEW A;  5AEO A;  4XMC A;  3RDM A;  1G74 A;  2MF6 A;  2JMB A;  4AZN A;  1P6P A;  4TJZ A;  5HCD C;  1W5R A;  5B11 O;  2C1S A;  1DV9 A;  1VWQ B;  4ZHG A;  5F2B A;  2MM3 A;  1GT3 A;  1VWI B;  1O8V A;  1FE3 A;  3D96 A;  1I4U A;  4NYQ A;  2CAM A;  1VWM B;  5K68 A;  3NPO A;  4BX5 B;  4ZGF A;  5IRU A;  3RZY A;  3MM0 A;  1AQB A;  4DQ3 A;  3S5X A;  2POA A;  1LIC A;  1A3Y A;  3WJF A;  4DNE A;  1IFB A;  1ALB A;  1SWS A;  2X56 A;  2FLJ A;  3AUM O;  1MUP A;  5F58 A;  4I60 A;  2CZU A;  1STR B;  2Z4I A;  3KFI A;  2N93 A;  4YBP A;  1OSP O;  2RTC B;  3WXQ A;  2MWH A;  2X46 A;  1SWF A;  2WEX A;  3C76 X;  3BRN A;  3KZA A;  4YDB A;  1QAB E;  3MG5 A;  1RLB E;  2FS7 A;  1DZP A;  1JJU A;  3D97 A;  1KT6 A;  4KII A;  4FBR A;  2Y32 A;  5HA0 A;  3UEU A;  2L68 A;  5L8O A;  1HXL A;  3B2H A;  1SY2 A;  2Q2P A;  1BM5 A;  1I06 A;  4UU2 A;  1EQD A;  3FYF A;  4O3Z A;  5L3Y A;  4GGR A;  4TNN A;  3OJY C;  1OPA A;  2LBV A;  4U8U O;  4HFO A;  2RTI B;  3RDX A;  2Q9S A;  3PH6 A;  3AKN A;  1BJ7 A;  2WR6 A;  4TKJ A;  2A3F X;  1I9H A;  1NP1 A;  1KT3 A;  1YWA A;  2OVS A;  3D9W A;  1SWK A;  3FR4 A;  4MVI A;  1EI5 A;  1QFT A;  4NV8 A;  1KZW A;  3T6F A;  1YP7 A;  3WJC A;  2G79 A;  1EUO A;  3MX7 A;  1ERB A;  1ZRY A;  4I95 A;  5BVT A;  3CQN A;  4OS3 A;  1SWQ A;  5HZ6 A;  2Q39 A;  1NDJ A;  3I0A A;  1IFC A;  1VWN B;  4OKA A;  4EQA C;  1AVE A;  2WSJ A;  3WBG A;  2E4J A;  4A8Z A;  2OVE A;  1SA8 A;  2JU8 A;  2WUT A;  4OMW A;  1VWF B;  5IRA A;  3EYC A;  4BBO A;  2RTL A;  5DG4 A;  5LJC A;  4I3B A;  1PMP A;  1VWL B;  4PJ2 A;  4BGF A;  5LJK A;  1VWD B;  4M7M A;  1SXW A;  2VFB A;  2AH7 X;  1E02 A;  2WPU A;  4O49 A;  4FBV A;  4MVE A;  2OYB O;  1SRF A;  1IJ8 A;  1TXL A;  3ZW2 A;  3PP6 A;  2CM9 A;  2RD7 C;  1U0X A;  4XMD A;  1AEL A;  3RY2 A;  5LJE A;  3RDS A;  4YVB A;  5IO6 A;  4IB8 A;  1JJJ A;  4BOE A;  2HZQ A;  4YFR A;  1JIW I;  2G5L A;  1SLE B;  4KT5 A;  3CBS A;  1PBO A;  3VG5 A;  1ADL A;  1VPR A;  3STK A;  5HCC C;  4QZT A;  1SXY A;  1T8V A;  5EPQ A;  2FR2 A;  4N7D A;  1SRE A;  1SWE A;  4QRL A;  2FHL A;  3P6G A;  5B3M O;  1YWC A;  3VHI A;  1LCV A;  2G78 A;  1KOI A;  3B2L A;  3AKM A;  4ZHF A;  4EKV A;  1ZNH A;  2F73 A;  1GKA B;  3C78 X;  2CM4 A;  2CBR A;  1UZ2 X;  2JU3 A;  4ORU A;  1N7Y A;  4GNY A;  1OBQ A;  1XKI A;  2A13 A;  2ALL X;  3SZJ A;  2RTP B;  2X45 A;  2OFM X;  4FQB B;  1NGL A;  1KL4 A;  1S7D A;  2DM5 A;  2A5B A;  2G8C O;  1WBI A;  2MHD A;  1OEK A;  4MVL A;  1KL3 A;  1LF7 A;  2FHN X;  3NQK A;  4INN A;  4AYH A;  2MJI A;  4BX6 A;  4MIR A;  3ZW0 B;  4ZHD A;  5KID A;  5JD2 A;  1SRG A;  4RUU A;  2OF8 A;  3BLG A;  3LTW A;  4CDF A;  1LKE A;  1TOU A;  3HWF A;  2Q4N A;  3FEP A;  5HTE A;  3ZQ3 A;  4AZO A;  1E5P A;  2WQA E;  1B56 A;  4WHI A;  2RTQ B;  4CDE A;  3S5V A;  1RXJ A;  1DF8 A;  1ZNE A;  4I9R A;  1BRP A;  4LKT A;  2X4M A;  4GH7 A;  1BWY A;  3FDC A;  5FEN A;  4EFG A;  1JYJ A;  4IAB A;  4NLI A;  1FEN A;  3SLJ A;  1Y0G A;  1LDQ A;  5IRW A;  1SWN A;  1CBI A;  1LCW A;  2OFR X;  3SOT A;  3VHH A;  3Q34 A;  1LEL A;  1SWA A;  3WOV A;  2AT0 X;  1CRB A;  3O22 A;  1Y52 X;  5H9K A;  1KQW A;  1NP4 A;  4JHQ A;  3WZP A;  2JOZ A;  5B5G A;  3WJG A;  2QMI A;  2OVA A;  2QO6 A;  1DFV A;  4U46 A;  1PBY A;  2QO4 A;  3EW2 A;  1QQS A;  5IO5 A;  2QOM A;  2K23 A;  4HPA A;  1QY2 A;  5IO7 A;  3CMP A;  5CSE A;  2NNQ A;  5D45 A;  3PQU A;  4GGZ A;  2RTB B;  2GTF X;  1FJ1 E;  4OS8 A;  1ICM A;  1OPB A;  4QAE A;  5F6Z A;  3VGW A;  5LJH A;  2R74 A;  1X8Q A;  1AVG I;  1GKA A;  3B2K A;  3P6C A;  4BVM A;  1VWR B;  1YIV A;  1ZNK A;  2QOS C;  4YGZ A;  1SWC A;  3CWK A;  1W6F A;  4OEM A;  5HCE C;  4WFU A;  1OBP A;  2A8G A;  3RKG A;  3ELZ A;  3SZI A;  4QQ1 A;  2OL6 O;  2I5Z O;  4GUZ A;  1LPJ A;  1ERX A;  4XMF A;  4ZGU A;  3TZS A;  3N91 A;  2BS5 A;  2KW1 A;  3DTQ A;  3HPE A;  2OFA A;  2IZC B;  2WWP A;  2F09 A;  5LJD A;  3WJB A;  1OEJ A;  4B55 A;  4IAX A;  3HWG A;  3PQS A;  2NND A;  5FQ7 E;  3S60 A;  3S26 A;  2ANS A;  2FT9 A;  2AT8 X;  4GET A;  1A18 A;  1VYO A;  3ZWE A;  3RWX A;  1VWO B;  1YWB A;  2F01 A;  1XCA A;  3BX7 A;  4GRJ A;  4ML7 B;  4O4X A;  3PEC A;  4TQ2 A;  1HMR A;  5HZ9 A;  4C5P A;  1PTS A;  4YMY A;  1GXA A;  2FRS A;  1B4M A;  2JU7 A;  1IKE A;  1L6M A;  2Z4H A;  4WFV A;  2LBA A;  1AVD A;  3O2Y A;  5LJG A;  5LJB A;  1SWT A;  1MX8 A;  2RTE B;  5EDB A;  4LQZ A;  2VDF A;  5EZ2 A;  1JMX A;  4IMN A;  5BVS A;  4ZR2 A;  1X89 A;  5CYB A;  4GDZ A;  3UEX A;  2NP1 A;  2JW1 A;  3VE1 A;  3JS1 A;  1VWP B;  2HYS A;  4ODD A;  3T2W A;  1ACD A;  1HMS A;  1VYG A;  1MX7 A;  1RAV A;  3FID A;  1O1V A;  2RTM A;  4GJV A;  2IZK A;  3TGA A;  3LHN A;  4AZQ A;  4YKO A;  4ORW A;  5B10 O;  2OY5 O;  2Y3E A;  4ID2 A;  2FTB A;  3NQ9 A;  4TLJ A;  1G5W A;  4O4O A;  3ZUO A;  2BSZ A;  2OY7 A;  1VWG B;  1VWK B;  1RST B;  1BSY A;  2FR3 A;  1ZNG A;  3F9D A;  3FA7 A;  4PSQ A;  4XME A;  3RBY A;  3NX1 A;  5F1E A;  2JN3 A;  1TOW A;  4BX5 A;  2IZH B;  1SWB A;  4O9S A;  5CE4 A;  4YKM A;  1SMP I;  2GC9 A;  1TVQ A;  3P6H A;  1E06 A;  1Y53 X;  2RTG B;  4DCB A;  4CPH B;  2JGS A;  3VPJ E;  3T6L A;  2C1Q A;  5DPQ A;  1B8E A;  1JMZ A;  2BS6 A;  3NP1 A;  3I17 A;  4GKC A;  1CJ5 A;  4FBO A;  1SRJ A;  2Q2M A;  1BSO A;  2RN4 A;  2RTR B;  3ELX A;  4U8U N;  1VWE B;  1HY2 A;  2A2U A;  4BX7 B;  1WUB A;  4EXZ A;  5KIC A;  4JGL A;  1U17 A;  2IZL B;  4GJS A;  1JQP A;  4Y0P A;  3SLT A;  1E2T A;  1ICN A;  4NLJ A;  1E00 A;  1BSQ A;  3B2J A;  4YBU A;  5B27 A;  4Z6J A;  4ZHH A;  1KXO A;  2O62 A;  3PH5 A;  4YFQ A;  3TGC A;  2IFB A;  1QG5 A;  5L8N A;  5BYP A;  3H3I A;  1HMT A;  1HQQ A;  1LUQ A;  3FEN A;  4GD9 A;  4ORX A;  2GJ5 A;  2GTL O;  3NBX X;  2IZF B;  1LIF A;  2L67 A;  1GX9 A;  4A1H A;  1RXK A;  4WBK A;  4AZP A;  4GZV A;  1EXS A;  4U8U M;  1GX3 A;  2I5V O;  2W2A A;  4IRW A;  4YCE A;  4CDD A;  3E3C A;  5FQ6 E;  1KZX A;  3KFG A;  1MOY A;  4NP1 A;  5CHK A;  1EW3 A;  3IFB A;  4BJ8 A;  3CBC A;  3WZO A;  1K24 A;  3JQO A;  1VWB B;  2LA7 A;  4HPC A;  2C4I A;  1CBR A;  3ZW1 B;  3MVF A;  4BQU A;  4I3D A;  3U9P C;  3BU1 A;  2HNX A;  3BU9 A;  3WYP A;  1HN2 A;  3WVM A;  3UEV A;  2X34 A;  2ACO A;  4I3C A;  4I9S A;  1LDO A;  1DZJ A;  1LIE A;  2OL7 A;  1GT4 A;  1G7N A;  3VE2 A;  3WZQ A;  4IAW A;  4HPB A;  1VWA B;  1GT5 A;  2HMB A;  3FA9 A;  4O3Y A;  4NV7 A;  1VYF A;  3VG3 A;  3FR2 A;  2P8G A;  2RTH B;  4ES7 A;  4MEE A;  1KT7 A;  1MEP A;  4GK9 A;  4GNW A;  4L1N A;  1SXU A;  2PY1 A;  4RUN A;  4XMH A;  1URE A;  4QZU A;  4JO6 A;  1I05 A;  3C77 X;  4A60 A;  1QWD A;  4L3R A;  3EW1 A;  4Y59 A;  1LFO A;  3LV4 A;  1QY0 A;  2BHV A;  5HA1 A;  3X00 A;  3HTY A;  1SWR A;  3EMM A;  5H9N A;  1PEE A;  2A2G A;  2YMS A;  2GH7 A;  2OL8 O;  2LFO A;  5AJC A;  2AT3 X;  3ZI8 A;  2IZJ A;  3P6D A;  3FA8 A;  3VG4 A;  2BC3 A;  4COT A;  1JYD A;  2K62 A;  2RTO B;  4GDA A;  3VG2 A;  3L4R A;  4D6A A;  1W4T A;  2AT6 X;  4Y0S A;  1NC9 A;  1IW2 A;  3SZH A;  4M6S A;  5EDC A;  4KH8 A;  4QGV A;  3RE6 A;  4CSB A;  1S44 A;  1N9Y A;  4A1Y A;  2AKQ A;  1BLR A;  4O4S A;  2OFB A;  5IXG A;  4JNJ A;  1Y55 X;  1MDC A;  4IBA A;  1KT5 A;  4LKP A;  3RY1 A;  5JR8 A;  4CV7 A;  1JJX A;  1KFF A;  4FGI B;  1EPB A;  3ZW0 A;  2LKK A;  2W2B A;  3OE3 A;  4EEJ A;  3ZUI A;  4YDA A;  3TGB A;  3APX A;  4GE1 A;  5FFH A;  5H9L A;  2QCB A;  1DF3 A;  1MK5 A;  3T1D A;  1SY3 A;  4MVK A;  4QYN A;  3WZN A;  2A0A A;  2X8F A;  1FEM A;  4KC8 A;  2PI3 O;  1SWP A;  4NW4 A;  5AQ6 A;  3PK2 A;  1D2U A;  4TKH A;  1SLF B;  2AL0 X;  2OY1 O;  4QYP A;  3Q6L A;  5F7G A;  1SWU A;  5KHP A;  2BT9 A;  3EBW A;  1VWJ B;  3APW A;  3V8U A;  2ASN X;  3FIQ A;  2QO5 A;  3G7X A;  1DC9 A;  4N7C A;  5HZ8 A;  4KC7 A;  2ZSC A;  4Y0Q A;  1X8O A;  1CBS A;  1YWD A;  1IKJ A;  1SWG A;  5L8I A;  5FQ8 E;  3RDO A;  1SY1 A;  2IZB A;  3IA8 A;  3APV A;  4AW8 A;  1SLD B;  2Y3F A;  3CQR A;  1SXX A;  2X8T A;  2DJG A;  3U03 A;  3CKG A;  3HWE A;  2AT5 X;  1N43 A;  3K3L A;  4D6B A;  2OVD A;  3NX2 A;  3FA6 A;  1SRI A;  4GU8 A;  4XMG A;  2ZAI A;  3WJE A;  1N4J A;  3AEH A;  4ZH9 A;  3WJD A;  1JBH A;  2IZE B;  4ORS A;  1AB0 A;  4HWM A;  3T2X A;  3KFH A;  1BRQ A;  1U18 A;  3EC5 A;  2KT4 B;  2FGS A;  1T0V A;  2HLV A;  3BY0 A;  5HBS A;  2M4L A;  1EIO A;  1EPA A;  3U0D A;  3BDR A;  4Y0R A;  4O3W A;  5B5F A;  3RDQ A;  1GT1 A;  3HOL A;  5HAE A;  4DQ4 A;  2A5C A;  1FDQ A;  1ZNL A;  2R56 A;  3NAD A;  1RBP A;  3SAO A;  4CPE A;  5C0N A;  2X55 A;  1FTP A;  4YFP A;  2UYW A;  4IMO A;  2ZAG A;  1D3S A;  3UAQ A;  3OBL A;  3PPT A;  3TF6 A;  1RXH A;  4EDE A;  1B0O A;  1H91 A;  3FW4 A;  1N0S A;  4U3Q A;  2LB6 A;  3RDU A;  3RE5 A;  1HXZ A;  1FEL A;  2KTD A;  4YGH A;  1X8U A;  1YP6 A;  4R0B A; 
#chains in the Genus database with same CATH homology
 2BLG A;  2YG2 A;  4I6S A;  4IB9 A;  1BEB A;  2OZQ A;  5D48 A;  4AZM A;  3TZS A;  3QKG A;  2FS6 A;  2EU7 X;  3P24 A;  2X8S A;  2R73 A;  3FEL A;  4HPD A;  5D8J A;  1PM1 X;  3D95 A;  5AJB A;  5BVQ A;  3FMZ A;  2XKL A;  3FEK A;  2L9C A;  1HBP A;  5HZ5 A;  1S2P A;  2W2F A;  3CR6 A;  4KCA A;  1IIU A;  3KQ0 A;  4ORY A;  3GAQ A;  5EEE A;  1OEE A;  3EM0 A;  1X8P A;  3JSQ A;  3HOE A;  3NR3 A;  4OS0 A;  5LKF A;  3BS2 A;  4NYR A;  1T68 X;  3B2I A;  1R0U A;  2XST A;  3P6E A;  3ZZV A;  3F6Z B;  1OBU A;  3P02 A;  1A57 A;  4ZCB A;  2RA6 A;  3NQ3 A;  3VU1 A;  1HBQ A;  3KFF A;  1EAL A;  2KTS A;  1HQP A;  3EBK A;  3VG6 A;  3BX8 A;  2RQ0 A;  2NNE A;  2AMM X;  5EED A;  4O4U A;  1JZU A;  4ZFX A;  4YGG A;  1JV4 A;  4YH0 A;  1CBQ A;  5D47 A;  4YCH A;  4LZU A;  1YUP A;  1GM6 A;  3OD9 A;  1LID A;  1GGL A;  1DZK A;  2ACP X;  4UU3 A;  4ARH A;  1Y9T A;  4NNT A;  3RSW A;  1QY1 A;  4ORR A;  5B29 A;  5H9A A;  1KQX A;  1DZM A;  1KT4 A;  3O19 A;  4ZH6 A;  3P6F A;  2CBS A;  4ALB A;  2QM9 A;  5HZQ A;  1O1U A;  4QGW A;  2RCT A;  4O3X B;  3PED A;  4AZR A;  2KD2 A;  1ML7 A;  4ON1 A;  3GE2 A;  4QGX A;  4TKB A;  2G7B A;  1LNM A;  2RCQ A;  4ZJ0 A;  1I04 A;  3BSZ E;  2WQ9 A;  1GX8 A;  1KGL A;  4LZV A;  4K19 A;  1ZND A;  3MBT A;  1EII A;  2GTL N;  1SY0 A;  1QFV A;  3APU A;  1LIB A;  3FR5 A;  5D4A A;  5HTD A;  4U9C A;  1X71 A;  2WEW A;  3F8A A;  4ZHC A;  4NNS A;  1BBP A;  3STM X;  2L5P A;  5HWZ A;  2MO5 A;  1TW4 A;  3HK1 A;  3HWD A;  4MIS A;  4IB6 A;  1G85 A;  1A2D A;  5FAZ A;  1X8N A;  1MVG A;  4CK4 A;  1Z24 A;  3D4R A;  2FWV A;  5K06 A;  4QNI A;  3FLL A;  3VG7 A;  3STN A;  4ALO A;  5H8T A;  3ZW1 A;  2CZT A;  1Y9L A;  2HZR A;  2GTL M;  3DSZ A;  4IB7 A;  5LKE A;  3FW5 A;  4OMX A;  5F6B A;  3UEW A;  5AEO A;  4XMC A;  1G74 A;  2JMB A;  4AZN A;  1P6P A;  4TJZ A;  5HCD C;  1DV9 A;  4ZHG A;  2MM3 A;  1GT3 A;  1O8V A;  1FE3 A;  3D96 A;  1I4U A;  4NYQ A;  4ZGF A;  3NPO A;  3RZY A;  1AQB A;  4DQ3 A;  3S5X A;  2POA A;  1LIC A;  1A3Y A;  3WJF A;  1IFB A;  1ALB A;  2FLJ A;  1MUP A;  5F58 A;  2CZU A;  2Z4I A;  3KFI A;  4YBP A;  2N93 A;  3WXQ A;  2MWH A;  2X46 A;  2WEX A;  3C76 X;  3KZA A;  3BRN A;  4YDB A;  1QAB E;  1RLB E;  2FS7 A;  1DZP A;  3D97 A;  1KT6 A;  4KII A;  4FBR A;  3UEU A;  5HA0 A;  2L68 A;  5L8O A;  3B2H A;  1SY2 A;  2Q2P A;  1BM5 A;  1I06 A;  4UU2 A;  1EQD A;  3FYF A;  4O3Z A;  4TNN A;  3OJY C;  1OPA A;  2LBV A;  4U8U O;  4HFO A;  2Q9S A;  3PH6 A;  3AKN A;  1BJ7 A;  2WR6 A;  4TKJ A;  2A3F X;  2OVS A;  1NP1 A;  1KT3 A;  1YWA A;  3FR4 A;  4RUU A;  1KZW A;  4MVI A;  1EI5 A;  1QFT A;  1YP7 A;  3WJC A;  2G79 A;  1EUO A;  3MX7 A;  1ERB A;  1ZRY A;  4I95 A;  5BVT A;  3CQN A;  4OS3 A;  5HZ6 A;  2Q39 A;  3I0A A;  1IFC A;  4EQA C;  2WSJ A;  3WBG A;  2E4J A;  4A8Z A;  2OVE A;  1SA8 A;  2JU8 A;  2WUT A;  4OMW A;  3EYC A;  5DG4 A;  5LJC A;  4I3B A;  1PMP A;  4PJ2 A;  5LJK A;  4M7M A;  1SXW A;  2AH7 X;  1E02 A;  4O49 A;  4FBV A;  4MVE A;  1TXL A;  3ZW2 A;  3PP6 A;  2CM9 A;  2RD7 C;  1U0X A;  4XMD A;  1AEL A;  5LJE A;  5IO6 A;  4IB8 A;  1JJJ A;  4BOE A;  2HZQ A;  4YFR A;  1JIW I;  4KT5 A;  3CBS A;  1PBO A;  3VG5 A;  1ADL A;  1VPR A;  3STK A;  5HCC C;  4QZT A;  1SXY A;  1T8V A;  5EPQ A;  2FR2 A;  4N7D A;  4QRL A;  3P6G A;  1YWC A;  2G78 A;  1KOI A;  3B2L A;  3AKM A;  4ZHF A;  1ZNH A;  2F73 A;  1GKA B;  3C78 X;  2CM4 A;  2CBR A;  1UZ2 X;  2JU3 A;  4ORU A;  4GNY A;  1OBQ A;  1XKI A;  2A13 A;  2ALL X;  2X45 A;  2OFM X;  4FQB B;  1NGL A;  1S7D A;  2DM5 A;  2MHD A;  1OEK A;  4MVL A;  1LF7 A;  4INN A;  3NQK A;  4AYH A;  4ZHD A;  2MJI A;  4MIR A;  3ZW0 B;  5KID A;  3BLG A;  1LKE A;  1TOU A;  3HWF A;  2Q4N A;  3FEP A;  5HTE A;  3ZQ3 A;  4AZO A;  1E5P A;  2WQA E;  1B56 A;  4WHI A;  3S5V A;  1ZNE A;  4I9R A;  1BRP A;  4LKT A;  4GH7 A;  1BWY A;  5FEN A;  4EFG A;  1JYJ A;  4IAB A;  4NLI A;  1FEN A;  1CBI A;  2OFR X;  3SOT A;  3WOV A;  2AT0 X;  1CRB A;  3O22 A;  5H9K A;  1KQW A;  1NP4 A;  2JOZ A;  3WJG A;  2QMI A;  2OVA A;  2QO6 A;  1DFV A;  5IO5 A;  5KIC A;  2QO4 A;  1QQS A;  4HPA A;  2K23 A;  5IO7 A;  1QY2 A;  3CMP A;  2NNQ A;  5D45 A;  3PQU A;  2GTF X;  4OS8 A;  1ICM A;  1OPB A;  4QAE A;  5F6Z A;  5LJH A;  2R74 A;  1X8Q A;  1AVG I;  1GKA A;  3B2K A;  3P6C A;  4BVM A;  1YIV A;  1ZNK A;  2QOS C;  4YGZ A;  3CWK A;  5HCE C;  3RKG A;  4WFU A;  1OBP A;  3ELZ A;  4QQ1 A;  1LPJ A;  1ERX A;  4XMF A;  4ZGU A;  3N91 A;  2BS5 A;  2KW1 A;  3DTQ A;  2WWP A;  5LJD A;  2F09 A;  3WJB A;  1OEJ A;  4IAX A;  3HWG A;  3PQS A;  2NND A;  5FQ7 E;  3S60 A;  3S26 A;  2ANS A;  2FT9 A;  2AT8 X;  4GET A;  1A18 A;  3ZWE A;  3RWX A;  1YWB A;  3BX7 A;  1XCA A;  4GRJ A;  4ML7 B;  4O4X A;  4TQ2 A;  3PEC A;  1HMR A;  5HZ9 A;  4YMY A;  1GXA A;  2FRS A;  1B4M A;  2JU7 A;  1IKE A;  1L6M A;  2Z4H A;  4WFV A;  2LBA A;  3O2Y A;  5LJG A;  5LJB A;  1MX8 A;  5EDB A;  4LQZ A;  5EZ2 A;  4IMN A;  5BVS A;  4ZR2 A;  1X89 A;  5CYB A;  4GDZ A;  3UEX A;  2NP1 A;  2JW1 A;  3VE1 A;  3JS1 A;  2HYS A;  4ODD A;  1ACD A;  1HMS A;  1VYG A;  1MX7 A;  1O1V A;  3TGA A;  3LHN A;  4AZQ A;  4YKO A;  4ORW A;  4ID2 A;  2FTB A;  3NQ9 A;  4TLJ A;  1G5W A;  4O4O A;  3ZUO A;  3WJD A;  4XME A;  1BSY A;  2FR3 A;  1ZNG A;  3F9D A;  3FA7 A;  4PSQ A;  3RBY A;  3NX1 A;  5F1E A;  2JN3 A;  1TOW A;  4O9S A;  5CE4 A;  4YKM A;  1SMP I;  2GC9 A;  1TVQ A;  3P6H A;  1E06 A;  3VPJ E;  5DPQ A;  1B8E A;  2BS6 A;  3NP1 A;  3I17 A;  4GKC A;  1CJ5 A;  4FBO A;  2Q2M A;  1BSO A;  2RN4 A;  3ELX A;  4U8U N;  2A2U A;  4EXZ A;  4JGL A;  1U17 A;  4Y0P A;  1ICN A;  4NLJ A;  1E00 A;  1BSQ A;  3B2J A;  4YBU A;  5B27 A;  4ZHH A;  1KXO A;  2O62 A;  3PH5 A;  4YFQ A;  3TGC A;  2IFB A;  1QG5 A;  5L8N A;  5BYP A;  3H3I A;  1HMT A;  3FEN A;  4ORX A;  2GJ5 A;  2GTL O;  3NBX X;  2L67 A;  1LIF A;  1GX9 A;  4A1H A;  4WBK A;  4AZP A;  4GZV A;  1EXS A;  4U8U M;  1KZX A;  2W2A A;  4YCE A;  3E3C A;  5FQ6 E;  3KFG A;  4NP1 A;  1EW3 A;  3IFB A;  3CBC A;  3JQO A;  2LA7 A;  4HPC A;  1CBR A;  3ZW1 B;  3MVF A;  4BQU A;  4I3D A;  3U9P C;  3BU1 A;  2HNX A;  3BU9 A;  1HN2 A;  3WVM A;  3UEV A;  2ACO A;  4I3C A;  4I9S A;  1DZJ A;  1LIE A;  3VE2 A;  1GT4 A;  1G7N A;  4IAW A;  4HPB A;  1GT5 A;  2HMB A;  3FA9 A;  4O3Y A;  1VYF A;  3VG3 A;  3FR2 A;  2P8G A;  4ES7 A;  1KT7 A;  4GK9 A;  4GNW A;  4L1N A;  2PY1 A;  1SXU A;  4RUN A;  4XMH A;  1URE A;  4QZU A;  1I05 A;  3C77 X;  4A60 A;  1QWD A;  4L3R A;  1LFO A;  3LV4 A;  1QY0 A;  2BHV A;  5HA1 A;  3HTY A;  1PEE A;  3EMM A;  5H9N A;  2A2G A;  2YMS A;  2LFO A;  5AJC A;  2AT3 X;  3ZI8 A;  3P6D A;  3FA8 A;  3VG4 A;  4COT A;  1JYD A;  2K62 A;  3VG2 A;  4D6A A;  3L4R A;  2AT6 X;  4Y0S A;  1IW2 A;  4M6S A;  5EDC A;  4KH8 A;  4QGV A;  4CSB A;  1S44 A;  4A1Y A;  2AKQ A;  1BLR A;  4O4S A;  4IBA A;  1MDC A;  4LKP A;  1KT5 A;  5JR8 A;  4CV7 A;  1JJX A;  4FGI B;  1EPB A;  3ZW0 A;  2LKK A;  2W2B A;  3OE3 A;  4EEJ A;  3ZUI A;  4YDA A;  3TGB A;  3APX A;  4GE1 A;  5FFH A;  5H9L A;  1DF3 A;  3T1D A;  1SY3 A;  4MVK A;  4QYN A;  2A0A A;  2X8F A;  1FEM A;  4KC8 A;  4NW4 A;  5AQ6 A;  1D2U A;  4TKH A;  2AL0 X;  5F7G A;  4QYP A;  3Q6L A;  5KHP A;  2BT9 A;  3EBW A;  3APW A;  3V8U A;  2ASN X;  3FIQ A;  2QO5 A;  3G7X A;  1DC9 A;  4N7C A;  5HZ8 A;  4KC7 A;  4Y0Q A;  5L8I A;  1X8O A;  1CBS A;  1YWD A;  1IKJ A;  5FQ8 E;  1SY1 A;  3IA8 A;  3APV A;  4AW8 A;  3CQR A;  1SXX A;  2X8T A;  3U03 A;  3HWE A;  2AT5 X;  3K3L A;  4D6B A;  2OVD A;  3NX2 A;  3FA6 A;  4GU8 A;  4XMG A;  2ZAI A;  3WJE A;  4ZH9 A;  1JBH A;  4ORS A;  1AB0 A;  4HWM A;  3KFH A;  1BRQ A;  1U18 A;  2KT4 B;  3BY0 A;  1T0V A;  2HLV A;  5HBS A;  1EIO A;  2M4L A;  1EPA A;  3U0D A;  3BDR A;  4Y0R A;  4O3W A;  1GT1 A;  3HOL A;  5HAE A;  4DQ4 A;  1FDQ A;  1ZNL A;  2R56 A;  3NAD A;  1RBP A;  3SAO A;  5C0N A;  1FTP A;  4YFP A;  4IMO A;  2ZAG A;  1D3S A;  3UAQ A;  3OBL A;  3PPT A;  3TF6 A;  4EDE A;  1B0O A;  1H91 A;  3FW4 A;  1N0S A;  4U3Q A;  2LB6 A;  1FEL A;  2KTD A;  4YGH A;  1X8U A;  1YP6 A;  4R0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...