4NLRA

Poliovirus polymerase - c290s loop mutant
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
461
structure length
458
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGSSGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
molecule keywords RNA-directed RNA polymerase 3D-POL
total genus 142
structure length 458
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nlrA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nlrA02
3QLHA 1S97A 1T3NA 4ZHRA 1DTQA 4J9MA 1TL3B 4IH5A 4MFBA 1YVFA 2ZKUA 3KK1B 2B5JB 1J5OB 3KLGB 2R8GA 3DLEA 4LSNA 2AWZA 2AQ4A 2WB4A 3QYYA 4QWBA 3T5HA 2JEGA 3KK2A 3KLHA 5KFOA 3BQ1A 2ILZA 5KFQA 1XR5A 5DQIA 1D1UA 1JLEB 2B6AA 5HBMA 3CDUA 4K4UA 2XI3A 5KG1A 3IRXB 4DEZA 4MIAA 5KG2A 5KFCA 4TQSA 2JEJA 3H5XA 3DMJA 3DOLB 2GIQA 2HNDA 1QE1A 5C25B 3OL9A 2ASLA 3JYTB 4ECXA 2IBKA 1RT5A 3MECB 3LP0B 4Y3CA 3DMJB 3QGGA 3I0SA 1C1CA 1HYSB 3QO9B 3N6LA 1C1BB 1NHVA 3OSPA 4I2PA 2OPPB 3FDSA 1JKHB 1JLAA 4ED6A 2ASDA 3QGIA 4ZVEA 3OL7A 4IOBA 1QAJA 2J6SA 3SI8A 5I3UB 3I5BA 3QLHB 5DG8A 3RAXA 2IA6A 4LQ3A 4WZMA 5FDLA 4R5PA 3G6YA 2W8LA 2W9BB 5DLFA 1N5YB 4O3RA 2C2DA 3EPIA 3NGDA 4Q45A 4HKQA 4J9QA 1TKZB 3H5SA 5KG7A 1HQEB 2ZD1A 2YKNA 1HMVA 5HP1B 4Q8FA 2O5DA 4YR0A 3GIMA 1IKYB 2XWYA 3SFGA 4DL7A 1RYSA 4ZP8A 4I2QA 1JLGA 1HNIB 4URSA 3TAMB 4GC6A 3BR9A 1SV5A 4EBEA 3ISND 2FVRA 3KLGA 4K4VA 4J9PA 3FQLA 3GYNA 3PJXA 2HAIA 2OPSA 2HNDB 3BSOA 1TVRA 4IFYB 4KHMA 3PHEA 1QAIA 4PQUB 3I0SB 3I0RA 1S6QB 2WONB 3V81B 4IH7A 1K1QA 3DOKA 5EDWA 1LWFB 4LSLA 4QW9A 3V6DA 2W7PA 5KFGA 5T14A 2UVWA 3OHBA 4MIBA 3V4IA 4IG0A 5KFMA 1R0AA 3H5UA 3Q8SB 1GX6A 4ECYA 5F8IA 1C0TA 4O44B 3Q8PB 2R2TA 2UVRA 2IM1A 5J2MA 4KFBB 3T5JA 3PR5B 2IC3A 1RT4B 4IG3B 1SUQB 2BQ3A 5J2MB 1S1VA 2D41A 2C2EA 4Y34A 2JLEA 3KK1A 1RTJA 2XC9A 4RU9A 5J2QB 3PR4A 2JEFA 2AX0A 5CYQA 4NYZA 3IGNA 3N6NA 3N6MA 2YKMB 4DL4A 2YNGB 4Q44A 4ZP6A 4NLGA 5KFIA 1MU2B 4R8UA 3DLEB 4TY8A 1JLBB 2BQRA 3BGRB 3FRZA 2RDJA 2IM0A 3C6UB 4Q0BA 2XI2A 1IM4A 3GIJA 3MR6A 1JLBA 2D3ZA 4R0EA 2BQUA 4KKOB 3DOKB 1IKXB 3IGVA 4IFVA 1MMLA 2UUTA 4RUCA 4NRTA 1C0TB 2JEIA 4PQUA 2E9ZA 2R2RA 5L1JA 1S0MA 4TYAA 3FSIA 4H4OA 3T5LA 4QWDA 3EZUA 2V4RA 5KFZA 3LALA 5DG9A 3IG1B 1SUQA 3FQKA 2UVUA 2WCXA 1DLOA 1RTIB 3CJ0A 4NZ0A 2ASJA 3C6TA 3MEDA 4K4TA 2WRMA 1RT1B 3HVTB 3MEGB 3DI6B 4KFBA 3NL0A 4RW7A 5K14B 2QE5A 5KFTA 4Q43A 1GX5A 3KLVA 4ECQA 2BE2B 3PZPA 3M9MB 1S1XA 2WK4A 3M9NB 1SV5B 3V6HA 3DYAA 2B6AB 3GV8B 4ED7A 2AU0A 4QW8A 2FVSA 5C25A 4RNMA 5KFNA 3HVWA 1RYRA 2R8KA 5KFBA 1T05A 1LW2B 3BSCA 3OL6A 1UWBA 4LSNB 3RAQA 4NLSA 4DG1B 5KFHA 4RW9A 1RT7A 2CKWA 4IRCA 1N4LA 2FLPA 3LP2B 1HPZB 3RBDA 1RA6A 1FK9B 5DG7A 3I5AA 2XCAA 2IM3A 4IR9A 5EUHA 1LWFA 2ZE2A 3V6DB 4IR1A 1JLAB 4R5PB 3MR3A 4J9RA 2V9WA 3I0RB 3DM2B 1RT2B 2R8JA 1N6QA 4Y2AA 3I5CA 3GILA 4HYKA 1HQEA 4NLOA 4NCGA 3BQ0A 3TVKA 1HNVA 3CWJA 3EPGA 1S9FA 4X2BA 1ZETA 1RT1A 3MEGA 4ZP9A 4YMEA 2EC0A 3UR0A 4YR2A 4J9NA 2FJXA 1HNIA 3KNAA 3FFIA 3KK3B 1JXLA 5KG3A 4K4XA 4RUAA 4YQWA 3DYAB 2UUWA 1HMVB 4QWAA 2YKMA 3JSMB 3C6TB 3MEDB 3HVAA 4RNFA 4EEYA 3UDLA 5J2QA 1S6PB 3E01A 5HBMB 4PUOA 2WOMA 2VG5B 3DRSA 3H40A 1JLQB 3OL8A 4DL2A 3DRPB 3BSNA 4WXOA 4WFYA 2IAJA 1RT6B 4IDKB 3OLBA 3KHRA 2UVVA 2W9AA 4Q8EA 1JLFB 1REVB 1TL1A 3KJVA 2VA2A 4TY8B 4J9LA 1S0NA 4FBTA 5J1EB 5KT3A 1HYSA 1KHWA 1HARA 3V4IB 5C24A 4KV8A 4MK9A 5KT6A 4RW4B 5KG4A 1JLCA 1BQMA 1RTDB 2WONA 3V81A 4TQRA 3MEEB 5CYQB 4ZHRB 4ECZA 1S49A 1EP4B 1BQMB 1D0EA 1RTDA 1S4FA 2AGPA 3DI6A 1TKXA 1ZTTA 2BRKA 4IG3A 3RBEA 1DLOB 1RTIA 4G3IA 4RNHA 1NHUA 5C42B 5C5JA 3OLAA 4RW6A 5KFPA 5KFXA 2R2SA 3CVKA 3HVTA 4DL5A 1S1UB 2W8KA 3UPFA 5KG5A 4NLRA 3DRPA 5F8MA 1JLGB 2CJQA 3TAMA 4ICLA 4NLXA 3KHHA 2IMWP 1TL1B 1TV6A 3KJVB 2YNIA 3MFIA 1S1WA 1C2PA 4WFXA 2VG6B 3T1AA 4ECTA 5L9XA 3ICLA 2OH2A 1HQUA 5CYMA 3KOAA 1FK9A 4FS1A 1JKHA 2YNIB 4LSLB 4O44A 4DL3A 5DQHA 5KT5A 2YNFA 4RW4A 4DG1A 4KKOA 4IG0B 2RKIB 3LP1A 3M8PB 3D28A 4KV8B 2I1RA 2IC3B 4O3SA 4TYBA 1FKPA 3H2LA 5KG0A 1K1SA 4ZP7A 1C0UB 2RDIA 3Q8RB 4KHRA 3BREA 3M8QA 5I42A 1T03A 3G6VA 3H5YA 1LW0B 3DM2A 1IKWA 3CJ3A 2OPQB 3KLFA 4PWDA 2GC8A 4RW7B 1IKYA 4IH6A 2HNZA 4H4MB 5FDLB 4O3OA 3V6JA 5J2NB 4M95A 3CDEA 1HNVB 3GIKA 3KLHB 1EP4A 1EETB 1IKWB 3T19A 4EO6A 1S1TB 3GIIA 5KFRA 5KFWA 4U7CA 3IRXA 5KT4A 2DPJA 4Y2CA 4TY9A 3DRRB 5KFDA 1TKTB 5K14A 4G1QA 1S1TA 3MTKA 1JX4A 4IRDA 4IKAA 1S9EB 3MR2A 2YNHA 5F9NA 4ZPBA 3QIPA 3PVXA 3H59A 3PJWA 5F8GA 2ALZA 3QGHA 1HPZA 2HMIB 2RF2B 1S6PA 1IKVA 1KLMA 2IJNA 4EBDA 4JV2A 3GV5B 1R0AB 4ECSA 3MF5A 4O4GA 3KHLA 5DLGA 1S1WB 3NMAA 2I5JA 1KLMB 3DLKA 3KHGA 5EWFA 4RW9B 3BJYA 3PW5A 1RDRA 4MK8A 1SH2A 3LP0A 4O3QA 1OS5A 2YNFB 3DLGA 4NRUA 2ATLA 2AGQA 5KFSA 2HWIA 5KFVA 4H4OB 4NLUA 1WNEA 2ZD1B 4URGA 5KT2A 5F8JA 1KHVA 4RNOA 3FFIB 5KT7A 3KK3A 5C42A 1RT2A 4MK7A 4B3OB 4I7FA 3LAMA 4IRKA 1FKOA 5J2NA 4NLQA 2DPIA 4QWCA 1N48A 1TL3A 4MFBB 5DGBA 4F4YA 1QUVA 4IQXA 2OPQA 3KLFB 4J9OA 4PWDB 3CJ2A 2IJFA 5KFEA 4RW8A 3CJ5A 1S48A 3C6UA 4QWEA 2XGPA 4ED3A 1J5OA 1JLFA 1REVA 3PW7A 2HMIA 1Z4UA 1JLEA 4RW6B 4FS2A 4K4SA 1UWBB 2HNYA 2C22A 2V0NA 1U09A 1XR6A 3KK2B 5C24B 3H4BA 4KB7A 3Q8QB 3JYTA 1TV6B 1I6JA 4G1QB 4JV0A 5D3GA 5JXSA 4K4WA 4MH8A 1RT7B 1C1BA 4KO0B 5KFYA 2E9RX 5J2PA 3TQ1A 2VG7A 2VG6A 4K4YA 1SH3A 2W9CB 4K50A 2C28A 1C0UA 1S10A 4WYLA 4ED8A 3BQ2A 3M9OB 3DDKA 4EBCA 4IFVB 4LQ9A 4JUZA 3PW4A 5KFAA 5J2PB 1BQNB 4J9KA 2FJVA 4KE5A 1LW0A 5J1EA 1NNDA 4U6PA 1RTJB 5F8LA 4XO0A 3MFHA 4TLRA 4YP3A 4NLWA 3NAHA 3ISNC 2YKNB 3DLGB 4F50A 3IG1A 4J9SA 1ZTWA 1SH0A 4ZPAA 2WOMB 5KFJA 3KLEA 1LWEB 1RT3A 3LANA 4F4ZA 2QV6A 5KFLA 1VRUB 3ITHA 2FVQA 4RNNA 1S9EA 2IAJB 2HNYB 2AGOA 2IM2A 3G86A 4WZQA 3LP2A 4WE1B 5HROA 2BANA 5KFKA 5D3GB 2VA3A 3E01B 4PUOB 1S6QA 4XPCA 3RB4A 1RAJA 2JC1A 4R8UB 2OPRA 1JLQA 1S1UA 3T5KA 4ID5A 4EYIB 2W9CA 2OPSB 4JV1A 1DTTA 3QZ8A 1T94A 3MEEA 4KAIA 2FLNA 4FBUA 3SFUA 1C1CB 1IKVB 3OHAA 1RA7A 1DTTB 1JLCB 2XCPA 3IS9A 3MR5A 4ECUA 3QIDA 1TKXB 2ZE2B 2HNZB 4H4MA 1S0OA 4ZVGA 4TN2A 4RZRA 4ECVA 2VG7B 1VRTA 3KLIA 4ZVHA 3IN5A 4B3OA 2HWHA 4O3NA 4YR3A 3M8QB 5I42B 2OPPA 2BE2A 3BSAA 4F4WA 5KG6A 1DTQB 1S1VB 1RTHB 1S9GA 4URQU 4WXWA 2WTFA 5HP1A 3RB0A 3NBPA 2BR0A 4NLVA 1TKZA 3ITHB 2YNHB 4ED0A 3CJ4A 4I2QB 5DGAA 3DRSB 1RTHA 1S9GB 2W9BA 1N56A 4ZPDA 3GQCA 2B5JA 3HKWA 4WE1A 1XR7A 4I7FB 5DQGA 5HROB 2R8HA 2WHOA 1RT6A 4IDKA 4XPEA 1HQUB 5CYMB 3JSMA 5JUMA 1TVRB 1EETA 1TKTA 4IFYA 3PW2A 3NKYA 4ID5B 2RF2A 4O3PA 3NAIA 5F9LA 5HLFA 3H98A 4ICLB 4ZVFA 2V4QA 4OL8A 3E51A 2JC0A 1T05B 3OSNA 4NLTA 1RT5B 2BANB 2D7SA 2FVPA 2W7OA 3DLKB 1QE1B 3IS9B 4O4RA 2XGQA 4O4GB 4I2PB 2FJWA 1TP7A 4NLDA 3UQSA 3QO9A 3CO9A 4TXSA 4DL6A 2B43A 1VRTB 3KLIB 4NLPA 3QZ7A 5L1IA 1FKPB 2I5JB 4NLYA 2YNGA 5I3UA 4MKBA 3NBPB 4EO8A 4F4XA 5F8NA 3KMSA 1T03B 5L1LA 4WFZA 2E9TA 4ZMMA 1N5YA 1LWEA 2ILYA 1RT3B 3VQSA 3G6XA 4EYHB 1RT4A 2FVCA 2D3UA 3D5MA 3QIPB 5L1KA 1MU2A 3H4DA 2AX1A 3DRRA 3RB3A 3GV7B 4GC7A 3DOLA 2R8IA 4RW8B 1JIHA 2R2UA 2GIRA 1S1XB 3V6KA 2C2RA 5KFUA 5EWEA 1LW2A 3PW0A 3MECA 4MKAA 1VRUA 2J6TA 4ED1A 3CIZA 3BGRA 4Q0BB 4WYWA 2VG5A 4ECWA 1CSJA 2OPRB 1IKXA 4ECRA 2BRLA 5EWGA 1TQLA 4KO0A 1BQNA 4M94A 2FLLA 1LWCB 5HLFB 2F8EX 3KMQA 5F8HA 4NCGB 2J6UA 3HHKA 1LWCA 4QPXA 4H54A 1N6QB 3LAKA 4ED2A 2RKIA 4ZPCA 4K4ZA 1W25A 3LP1B 3M8PA 4KBIA 4KSEB 3RB6A 1FKOB 5KFFA 3KLEB 3CDWA
chains in the Genus database with same CATH superfamily
3QLHA 3MDFA 1KN6A 2IBOA 4W4MA 5GMEA 2KYXA 1FRIA 2HQDA 4OLOA 2IVMA 4MFBA 4ES2A 2ZKUA 1B0PA 2DCUB 1PAEX 3ET6A 3DLEA 3JTOA 2WVFA 3P3DA 4C0HA 3T1HJ 2FZGB 2AQ4A 4JI5J 2YX1A 1VJWA 1KQFB 3KK2A 3BQ1A 1XTZA 2ILZA 2F4FA 2PT0A 2YKAA 3ADAC 2ZBQA 3HDSA 5DQIA 2DGVA 1X4GA 1YZ7A 5HBMA 2XI3A 5KG1A 3NY0A 2HVDA 2KYZA 3BPSP 1U02A 2V94A 1YQHA 3SV4A 4C9DA 4LFBF 2JEJA 4KGVB 3DOLB 4WTYA 4Y2KA 4DPWA 2FJVA 2AYEA 2V63A 2AJFE 4OX8A 4C6AA 2KRBA 3PV8A 3MECB 3LP0B 4USMA 1F60B 1C1CA 1HYSB 2DNMA 3EYZA 1K0TA 1NHVA 2MKIA 4I2PA 4YS2A 3MAQA 1IXKA 1JLAA 4M5MA 4Q2LA 3J7YU 2KDOA 3QGIA 4NMLA 1VQ8S 3OBIA 4C3MA 5I3UB 2PIIA 2UXBF 3I5BA 4DR1J 5ETQA 3PO4A 4DI6A 4WZMA 3GJQB 2MMYA 3OR1A 4R5PA 3BKTA 4UZCA 3G6YA 5DLFA 4O3RA 4C98A 2HHWA 1ZBTA 5GMKa 3NGDA 1SIWB 3EPIA 2AT1B 2C2DA 2UP1A 2DTJA 2L9WA 2B56A 1OMSA 1Y11A 2VPWB 1VLOA 2F8MA 2O1PA 2ZOFA 3H0PA 1HMVA 1O5JA 2I9SA 3OQ2A 3M2UB 5D0HA 3RG6A 4C11B 4X4TA 4Q8FA 2QA2A 3W1YC 1RHMB 2UV8G 2ZHAA 5IQ6A 4F4AA 3D7SB 1WDDA 3ET6B 4K4VA 4CLSA 4I64A 2D3O1 5DRKA 4PABA 3SQGA 1WKJA 2NXUA 2XEXA 3G8SA 4JI4F 4LFCF 1TVRA 2HHVA 1Q79A 1SB6A 2XTDA 3KUHA 2HVZA 3BGFA 1J5EF 1UVIA 2XM3A 1HBMB 1K1QA 1WELA 1VC6A 2J0QD 4QW9A 3M8SA 1VQPS 2RQMA 3NOCA 4ILRA 5DS7A 4X84A 3IR5B 2HFSA 5KFGA 2DNZA 4DV6F 1H6KX 3TVZA 3AQPA 4IOCQ 2FZKB 2Y0SD 5E3QA 2DH7A 3ILIA 3ZTPA 1RB0A 3Q8PB 2KG0A 2ALYB 3AXMA 4KFBB 5HANA 2NUHA 4FXDA 3TA0A 3PR5B 3BO3A 4DSEA 5LMNF 2BKPA 2CPZA 1TK0A 1G3OA 2UU9F 2KI2A 4OLPA 3MMBA 4LRFA 4ZLPA 1Z2ZA 2OHDA 2XLIA 3KK1A 1ULRA 5J2QB 4RU9A 1YJWS 1Q7YT 5HVFA 1UETA 1QTMA 2XYPB 1F1BB 3N6NA 1VS3A 2YKMB 2UZAA 4UTGA 4Q44A 1HWKA 2M70A 3HHLD 2GO9A 3I9V9 3EXCX 3AAWB 3BM7A 1AYEA 4NX9A 1RHKB 3PX6A 1YLXA 4OYXA 1YRUA 1SI9A 2F40A 5DO2A 1LK7A 4NCBA 2DEJA 3NCPA 1HHQA 1I1GA 4DPYA 1U1OA 2KXHA 2BOAA 2DVIA 2LXUA 2IM0A 3C6UB 2HYIB 4O23A 1FTCA 2UU9J 3DDIA 2D3ZA 4XTTA 1VQ7S 3AY0A 5D78A 1AB8A 1BXNA 1IKXB 1KVKA 2HRYA 2D9PA 2LP4A 4KKOB 1NSQA 1I94J 1MMLA 4X4QA 3M05A 2ZM6J 3HSZA 3TEGA 2HHPA 2GX8A 2OP5A 1CJKA 2R2RA 2HRUA 5L1JA 2R7VA 2RUSA 3DKDA 5AXNA 2RQKA 3POTB 2G2ZA 3ZTRA 3T5LA 2QGFB 1L3TA 5A0YB 3VALA 3DGPA 4DR6J 2P8IA 2CWKA 1W2IA 2MEWA 3HF5A 1Q4RA 3EZOA 4J91A 3TWZA 3FQKA 5BXIA 2UVUA 1DLOA 3CXCR 3C6TA 1Q95G 2WRMA 3MEGB 2G0IA 1HFEL 3OXLA 1EKSA 3NL0A 4KFBA 3VTIA 4CNZA 3AD9C 4USIA 4Q43A 1IBLF 1B0VA 1KR4A 2B4UA 3M9MB 2YWHA 2WK4A 2QC3A 1SV5B 3D54A 2WW8A 2ZKTA 3OTBA 3T1HF 1BC6A 3MGJA 4B3RJ 4ZVUB 2H51B 2RQCA 1JMTA 4QW8A 4USKA 1K73T 4B9NA 2RU9A 1T02A 1TL4A 5C2GA 2Y1JA 1ZH5A 2ZEJA 3BSCA 4AYBD 3W8PA 2XNRA 4JI7J 4J5OA 4DG1B 4RW9A 4IRCA 1HBOB 4EZ9A 4I69A 2CJXB 1U0HA 3LP2B 5IS2A 4LF6J 3AJ1A 5DG7A 3DGVA 2QYGA 2XCAA 2BKNA 4IR9A 1VK3A 2YVSA 3GYGA 1PYTA 2ZE2A 3D0HE 4HR2A 1JLAB 1VYAA 3MR3A 3I0RB 1U6BA 1RT2B 1ROFA 4OYAA 5CABA 1N6QA 4Y2AA 1PJ6A 1UPMB 2K06A 3ZC4A 3GILA 3BQ0A 2CVEA 2NS1B 5HAOA 1RWNB 2GHVC 4DR1F 4QOTA 3K5MA 4P7VA 2XO6A 1S9FA 1QUPA 2W01A 5G0RB 3UR0A 2A6OA 3OVBA 4DZDA 4FKXA 1HNIA 1Y0HA 3KNAA 1YZ6A 2HQIA 4WPAA 3TYTA 3VZHA 4OHYA 3VV2B 1M1HA 5HO4A 2FPHX 4RUAA 4YQWA 2UUWA 1S99A 1SQGA 3ILJA 3BKFA 1U6FA 2LLZA 3CD5A 3C6TB 1YI2S 4CYUB 2V2KA 4CI0B 4F02A 1RAEB 1VCTA 2MKSA 3E01A 4YB7A 3RW6A 3NS5A 1UVNA 3RBXA 2ERRA 4JP8A 3TARA 3CDBA 2C3PA 2IAJA 2V8DA 4FYVB 2HS0A 3THTA 4ZK7M 2UVVA 3LPYA 1AFIA 4BC9A 2UV8A 5FLXU 1T9WA 2OMLA 5KT3A 3NMRA 3AX2A 1TTHB 4FXWA 1KOOA 2QL5B 2GMLA 1NK8A 2MQMA 2FJBB 3MM6A 4RW4B 5KG4A 1JLCA 3V81A 2F4VJ 1L3KA 3NG8A 4QIWD 4TQRA 3EGNA 2ZZNA 4R0JA 2DY9A 1IR2A 4B9LA 2QLBB 2Z0GA 1MG7A 1S59A 2E29A 1EP4B 2G2OA 4MMOA 2Z56B 3DI6A 3UNGC 2AJ1A 1X9MA 4IG3A 4GO7X 1DJ0A 1DLOB 3FZ2A 4RNHA 4A8MP 5C42B 1F9EB 2FVQA 3MMAB 4ER8A 4OYMA 3VAJA 1FA0A 1RKIA 4FVCA 4KH1B 5KFXA 2R2SA 3CVKA 3HVTA 4DL5A 3QWPA 2HS3A 2PGCA 2JSXA 2ZJPQ 5F8MA 2OD4A 2QSFA 2F4VF 4WCEQ 1V5VA 4C8KA 1O0PA 2CQ1A 2X7IA 4OZNA 2YNIA 3NXZA 3MFIA 1S1WA 4WFXA 1EZZB 2E1AA 2VG6B 3MUTP 1NKEA 2CADA 1JJ2R 2K8GA 2W2NP 3KOAA 1I3OB 3A1YG 4CLPA 1JKHA 2XZDB 1SJRA 4Y65A 4RW4A 1P8GA 4DX6A 4CIOA 1HW8A 2RKIB 4RU2A 3CCES 1X9SA 1FWPA 3SCJE 3G82A 2AP6A 1FESA 1K1SA 4ZP7A 2RDIA 4WP8A 3UI3A 1M1GA 2RQ4A 3C8YA 3HSDA 1NU4A 4DCPB 4CDIA 4ZKAA 4X66F 2ZH2A 4IQMA 2Y9HA 3M8QA 2V1SA 5I42A 3CD6S 4OZ0A 3MM8A 1WHYA 2KXNB 2QMXA 1IKWA 2Y8WA 2CQHA 4P71A 3LUYA 4RW7B 1IKYA 3V6JA 4H4MB 1PO6A 2GMJA 5FDLB 4CRJA 2E7VA 4JI1F 2LDIA 4OZ3A 1EP4A 1F2HA 2V50A 3K17A 3HHDA 4PYAA 3U1LA 3QMQA 2DKOB 2C42A 4RJVA 3ZZUA 5THWA 3CJ8A 4J9VA 1X5TA 4OI3A 5KFWA 1UA0A 1VQ4S 5I3QA 1FJCA 4CO3A 5KT4A 2DPJA 3AD8C 3ZXWA 3CCQS 4Y2CA 1YGYA 4DLEA 1VBYA 1D9FA 4IRDA 2XS7A 3CULA 3BKUA 3MR2A 2XZWA 5EX0A 4WJBA 4P2FA 3H59A 4F26A 3VVTA 2OD6A 4A8YA 3NRBA 2IJNA 5AXLA 1KLMA 3UDCA 1XMQF 1N54B 4B3MF 4JV2A 2PMWA 2W4DA 2V68A 3GV5B 3RRHA 1R0AB 3FBCA 3G8QA 1SL1A 2PC6A 2P6TA 3I55S 1Y3KA 2LCWA 3KHGA 4ERDA 4RW9B 2RD5C 2VASA 1LKZA 1RADB 3UN5A 1U0SA 3CD0A 1UPPA 1Y00A 2XYGB 3LP0A 4O3QA 2XBPA 3CMQA 3V4MA 1X4EA 4DFPA 1WKLA 2ATLA 3UDEA 1WG5A 4OI6A 4NLUA 1J27A 1AA1B 1R8CA 1FDBA 3DOMB 4AL6A 3PCOB 4USHA 3C66A 3M30A 4I7FA 1GMVA 2ZC4A 5LSRA 2Z30B 2HSEB 3R1LA 5B0AA 5H9FK 2DPIA 3AB4B 4QIGA 4MFBB 4KT0C 2Y1IA 2AF6A 2UUAJ 4CNYA 4FZVA 4J9OA 3FBBA 3R7NB 2IJFA 2I38A 2IPOB 3ZO7A 2EC2A 1K9MT 1DBDA 4LSZB 4RW8A 4C3KA 2XGPA 4XIUA 3C14B 1CJUA 1GXTA 1N88A 1REVA 2EEYA 3B6BA 3HHLB 5HVGA 4RW6B 4WK3A 5ETRA 4PG8A 5IT0A 3OTOJ 3K5LA 2HMIA 1N32J 2BACA 2HNYA 2J9CA 5E5NA 2R7SA 4QJVA 2YH0A 2VDIA 4OZLA 4KB7A 4JV0A 2ZH7A 3X3UA 1EB0A 4MH8A 2ZJQQ 1K8AT 2DB1A 2E5IA 3DFEA 1S79A 3GSIA 3N28A 3CUNA 4LRBA 6FDRA 4KO0B 3V2UC 3PRBA 2M8DB 2HBZB 3S6EA 5J2PA 3HK2A 1ITPA 2W9CB 4YB5A 2CQ0A 4EBCA 3DDKA 3Q86A 2IFXA 5LJ3Y 1QVGR 5KFAA 4AUKA 3PFOA 2BM0A 1NNDA 1WI8A 2VD3A 5F8LA 3M1VA 1VDHA 3PRVA 3G2XA 3JSRA 2GMHA 4C48A 2Z2YB 1VBKA 3OXGA 2EFNA 3ISNC 4RUHA 2R42A 3HT3A 4DR3J 3IWLA 2EI5A 5H9EK 4KYZA 1CULB 2RUGA 2NUUG 5LXYA 4ZCLA 3KWMA 1TZ0A 4I56A 1SH0A 4ZPAA 1CJTA 1CJUB 2XMAA 1H0HB 4L76A 1YITS 3TNVA 2CDRB 2M0GB 4YDDB 1NPRA 1D9DA 4GKJF 2HNYB 2ZWPA 3G86A 1TFYA 1A9NB 1PGZA 3H42A 1X4DA 1YJNS 1U48A 2R7TA 4GVLA 1MWZA 4MTPA 3HSGA 3KG0A 5KFKA 5D3GB 1H74A 4YDXA 5A6PA 2R3VA 5F3ZA 3GB0A 4XPCA 1T05A 1RAJA 2UUBJ 2DIUA 4UQGA 2VQEF 1S1UA 1ZM2A 3QSIA 4USUA 4LFCJ 4RR5A 2RT3A 3OUYB 3OJSA 2ZH3A 2W9CA 5D6GA 3QQCD 1T11A 3RGIA 2XTEA 2EFGA 2SXLA 1RXOB 4FYDA 2FLNA 4H4KA 4DBQA 1KFSA 3UD4P 1DQ9A 2LXFA 4U9RA 2HVHA 2E1CA 3NNHA 4OI0A 1V6HA 1MNEA 1YKWA 4ZVGA 4M5HA 2VG7B 4C8NA 2AYBA 1RLDA 2K1RB 2LU2A 4B3OA 2RHQB 1WF2A 2FYXA 2NSBA 2DGWA 3C16B 3D1HA 2F63A 4MIWA 3THPA 3VF0B 4ZLNA 5DM7Q 2XZ2A 4F4WA 1HNZJ 5KG6A 1DTQB 3MMBB 4WXWA 2IRUA 2BVZA 3QNWB 1TKZA 4C8MA 2FC9A 3LTOA 3I9ZA 3ISZA 4NWBA 1S9GB 2NLWA 4OZ1A 4TLQA 1X4HA 5D0RA 2DRBA 3C3LA 3HKWA 1XR7A 1FD2A 1T9TA 5F41A 2R8HA 1FEHA 1RT6A 2WHOA 4IDKA 4XPEA 2CJAA 1XC9A 3M4XA 3O3LA 3PYDA 2AEJA 5JUMA 3NKYA 3U7JA 1JNZB 2RF2A 1HKAA 2CQGA 4C7QA 4OL8A 5AE3A 4PKDB 2KFNA 4C8ZA 2EXUA 1IN0A 1JXEA 3OSNA 2L08A 1MLAA 2J9DA 1ZA2B 1KKHA 4C0BA 4O4GB 2F7VA 4A8KA 4LIRA 5T41A 5I4MA 4DV0J 3UQSA 3H4BA 1UEVA 3W61A 4TXSA 3CO9A 4IO1A 4CO5A 2VUGA 3QZ7A 2AJ2A 2Y0BB 1FDDA 2OAUA 3ZTSA 4WFNQ 3MXHP 1CQMA 1D09B 3W66A 1RAHB 3N5FA 3M2UA 3R27A 2DGSA 2OTLS 4MKBA 1HBUA 3X1LB 1VQSA 1M5OC 1XIQA 1Q82T 3R5CA 2AV5A 3EZ5A 3S1TA 1T03B 1O8BA 2XHWA 3TR5A 4ZMMA 1RT3B 2ILYA 3DXSX 3FKBA 2QFJA 5BYRA 1NJWA 1Q8BA 2D3UA 2FVCA 1MROB 2BE9B 3TRGA 2MY7A 3R5DA 2AX1A 3BH6B 3HVRA 3MCNA 4CLKA 1KVJA 1G7CB 3MM9B 1PSDA 2ZWOA 4QU7A 2LDYA 3CEDA 5EWEA 1LW2A 2QT7A 2DO0A 3PW0A 2B9WA 5E3RA 3CIZA 4UW2A 2M7SA 2MHEA 3A3PB 4CP5A 3TZXA 1IKXA 3HI9A 3NEKA 9ATCB 1TQLA 4M94A 1NBEB 5GAHU 2EPIA 1NK9A 4J7CA 4WFAQ 2KVIA 4DSLA 3RR8A 2D9OA 3D66A 2F8EX 4NCGB 5CH7B 5L9NA 3R5AA 1FFWB 1QD1A 1LWCA 3EICA 2QFIA 3MM5B 4OYBA 3MURP 2J6UA 4NYOA 1X5SA 2CPEA 4UOHA 4WIQA 4KSEB 3MEKA 1R31A 3Q8YA 3JQMA 3TVYA 5JMNA 2ZDOA 4YOEA 1EIYB 4ITSA 1UTAA 1R27B 5FIIA 2IDEA 3ZZPA 1FDNA 1FI4A 4DMZA 4LVOP 1S97A 2U1AA 3NGUA 2C2OB 2G13A 2W2QP 2XMVA 4DR5F 1DTQA 2E44A 4LREA 1XMOJ 2VB6A 3HHLA 3KK1B 2VL1A 3KLGB 4DU8A 2ZVIA 1UKUA 2AWZA 2NYHA 2WB4A 2VFSA 4QWBA 2KM8C 3MD1A 2JEGA 1HBNB 1TELA 2KT5A 3IP0A 2J5AA 3TX0A 2QO3A 1FRJA 3MTJA 3OT9A 2N7CA 3GYXB 4KC5A 5CZVA 1D1UA 1JLEB 4F3OA 3B78A 2KTQA 4DEZA 4K4UA 4BC7A 2XSFA 3CE8A 3UVJB 2OEMA 5ETLA 4PPZA 3W8GA 5KFCA 2BW7A 2DNGA 4UUXA 4QQBA 4JI6F 3H5XA 4K2JA 2AJ0A 4ES1A 2M3DA 3TJ8A 4MKYA 3OL9A 1G2EA 3JYTB 2FDNA 5IC6B 2HQ3A 2HRTA 5B0BA 4Y3CA 3DMJB 3I0SA 2NXCA 5H9FJ 4RLEA 2L9NA 2P2CB 3US5A 4W92B 1NB2A 3H20A 4CO1A 3E2EA 2GCFA 3Q89A 1IJFB 4IOBA 1ZPWX 2EFPA 4XK8C 3GFZA 4PCQA 4YN3B 4F0MA 5KOXA 5DG8A 3AOCA 3SI8A 2D3OR 4DXLA 1U49A 4BDPA 5F0WA 5FDLA 1Q1KA 3WQPA 2W9BB 2W8LA 4E0DA 2ABYA 3M32A 4HKQA 1VHFA 5K9FA 2KO1A 3G4SS 3EM1A 3SEOA 4AXIA 4KPYA 3UW1A 3GIMA 2M4MA 4PG6A 3D4JA 3D68A 3L9ZA 1KOHA 1RYSA 3FMBA 2KHCA 1HNIB 1KP6A 4URSA 3BR9A 1SV5A 2BJDA 2ZFHA 4EBEA 2RHSB 2VZ9A 3EGZA 2V2VA 1X4BA 3FQLA 2B4OA 4QZVB 1C4CA 3PJXA 4LR7A 5ETKA 4ZJLA 3VWSA 1CC8A 2HZAA 2OPSA 3LGMA 4NA1A 3W2VA 5GADU 4IFYB 2H4WB 4F7VA 1V3SA 2P9GA 4KHMA 4NXNJ 5GVQA 1D8ZA 1Q5YA 3DU6A 3SMZA 4PQUB 3B4MA 3I0RA 1E6VB 2WONB 4LT6A 2N82B 2HHQA 3K2YA 4YP3A 2ZBPA 3V6DA 1KQSR 2W7PA 3NOGA 2XY5A 4FYYB 4MIBA 5HMYA 3W3SA 1VR6A 1R0AA 4NCAA 3HFKA 3CGIA 1NK7A 2XULA 4ECYA 5F8IA 1C0TA 2GHWA 3POTA 2IM1A 2CQCA 4DHVA 1SVDA 3UO0A 4IG3B 5D4OA 1H3DA 1WC1A 3PG9A 1T8EA 5B09A 2IDLA 2LQ8A 3B82A 2C2EA 1RCOB 2VV5A 2A2CA 2JEFA 1YJTA 5LMUF 1VGYA 1M5PC 4YUDA 4E2FB 4FYWB 2E5GA 4RWXA 2HHUA 1NKBA 3JXOA 2MJUA 1GAOA 2BMBA 3MPUB 5KFIA 2LQ9A 1Q8LA 2CQBA 4R8UA 3AODA 3AB2B 1MWQA 2HBYB 3K8VA 4DV4F 2AYGA 1HL6A 1JLBB 2CJKA 4QIEA 5KAKA 4A8QA 1KD1T 2RDJA 2Z4PA 4NZ7A 2XI2A 2IIHA 1F9FA 2DJWA 1M0SA 3L7UA 3GONA 1CC7A 1Y5LB 2Z2MA 3DOKB 1PC4A 4YB6A 4Y00A 6AT1B 4DFMA 3SCKE 2UUTA 1B0TA 2AJ4A 2JOQA 4UOGA 4G1PA 2PI4A 3R7BB 1JJHA 1S0MA 2K2PA 3FSIA 5HSPA 1XNQJ 3W64A 2K3KA 2F5GA 2M5YA 2MYFA 3EZUA 4C0OC 2RMLA 3P45B 4JOUA 3MPWA 4RBVA 2LA6A 5KFZA 2PI5A 5EN1A 3WHIA 2C3YA 1SUQA 2GQQA 2CQ2A 1RTIB 4U8VA 2ASJA 5T7LB 2XZTB 3HVTB 3V5RA 4JI1J 4X66J 2QTWA 2WW4A 4M8LA 4LUBA 3VR1A 3PZPA 1RWPB 1M5VC 3MUVP 4B3MJ 3VGTA 5SUHA 1NCLA 3CC4S 2BE7D 2P5VA 1R8PA 3AA8A 4ZPTR 3BGUA 2POKA 5AXKA 1FXLA 3GV8B 2BJ9A 3S8SA 2XMWA 2DGXA 3FSYA 1EQMA 5B0DA 2VODA 2Y8YA 3HVWA 4C11A 2R8KA 5KFBA 4LF5F 3W63A 2YY3A 3O1LA 1UWBA 4OV1A 3ENVA 4ELTA 4NLSA 3N5BA 3HSJA 3HJVA 2W25A 4OYWA 1N4LA 1Q5VA 1HPZB 1T95A 1FK9B 3RBDA 2MKYA 1H7WA 4DU7A 1UWAA 2KXFA 2IM3A 3CSKA 3I5AA 1TAQA 4NA3A 5EUHA 3WZ0A 5ETSA 4HHUA 1BHNA 3D1OA 2QX0A 2NSCA 4R5PB 1YBTA 1ZM4A 1IBKJ 2OTJS 2XNQA 1ZM9A 1U1QA 1XJWB 1HQEA 2FY8A 2V5HG 4FP9A 4S0MA 4A47A 7FD1A 1HNVA 1RGVA 1CS4A 4YY3F 4OHXA 1N34F 1HNXF 4ZP9A 3BS9A 1XNQF 4YR2A 1QAXA 4USJC 3F73A 3C19A 3FCWA 2H1YA 2V2ZA 2FJXA 3FEYB 3UR3C 3PNIA 3H2UB 1CQNA 4K4XA 2RJZA 4KIAA 5KG3A 4CH1A 1KVIA 2JJ4D 5ITHA 2ATCB 3A3OB 1HMVB 4WIIA 4DX7A 1M5SA 1GMUA 2BM1A 3PEJA 4RNFA 4EEYA 1S0VA 1NEEA 1S6PB 4PUOA 3GCWP 5HBMB 2VG5B 3NGTA 5GAGI 1RUSA 3FJ2A 2LEAA 1ZAWA 3BN4A 4CLZA 1FNXH 1JLQB 4DL2A 1U2RA 3BSNA 4WXOA 4WFYA 4NI2A 3R2DJ 3I32A 5HMWA 3OLBA 4LF5J 3UDVA 3LGNA 4Q8EA 1REVB 3KJVA 2AEMA 1RACB 5J1EB 2ZH6A 5A76A 1HYSA 1RU1A 1KHWA 1HARA 2Q6CA 3TUZC 5HK4A 1R8AA 5KT6A 2OGUA 4C8YA 1E6VA 2C2MB 2EFOA 2WONA 1RHUB 5HQLA 2R7WA 4KTQA 2CPHA 2ROPA 3JQJA 3MEEB 4ZHRB 4KJIA 2VONA 5E7OB 1SKWA 1S4FA 3EWGA 4KGMA 3OPKA 2V6AA 1IBMJ 5CZXA 4MYTA 5LT5A 4P7TA 2UUCF 1NHUA 3LGHA 3UWTA 1U2CA 3AT1B 5C5JA 1MN7A 2DNNA 2RVJA 1XMBA 1VQMS 1X5PA 3T1YF 3NNCA 3TJ9A 3QBCA 2B7BB 3UPFA 4NLRA 4NXNF 1XWLA 2CJQA 2A6MA 1URRA 4YHHF 2BW2A 3QRQA 2ZH4A 3KJVB 3Q83A 3D6HB 3AJ2A 3T1AA 2AZ3A 5L9XA 2MZQA 3ICLA 3UNYA 4WTOB 1BWEA 1WEXA 1FK9A 1HHSA 2YNIB 4LSLB 3DRXA 5KT5A 4DG1A 1P1TA 4HI2A 4KKOA 2R7UA 1S76D 4UOCA 4FF1A 1AXQA 1U25A 2I1RA 4Q2MA 5DM6Q 3QGPA 1FD8A 2DHAA 3HLUA 8AT1B 1KEKA 3SZ2A 1S12A 2ZH1A 3IO1A 1AFJA 3Q8RB 4KHRA 5E3PA 3C16A 2BKOA 2GAHC 4N8OA 4ZCKA 4F0KA 4ZJQA 4A8XA 3OTCA 1X4AA 3VGSA 4DWIA 3CJ3A 2OPQB 3K89A 3KLFA 2DNRA 4Z7CA 2GC8A 2BJEA 1WF0A 3L7OA 4IH6A 4N41A 4K5RA 1X4FA 3G87A 1RWUA 4LR8A 3FVYA 5J2NB 1HNXJ 1IKWB 2CQDA 2BYCA 1ZAXA 3GU0A 2BXJA 3AD7C 3GIIA 2WSCC 3HHEA 5G4DA 4B9VA 1FFSB 1DAXA 3RJMB 1F5BA 4F04B 1HBOA 2JL9A 2PD1A 4OX7A 5M2RA 2KVQE 5K14A 2XHCA 1S1TA 2P9CA 4G1QA 4I67A 3VAIA 1S9EB 2VH7A 2YNHA 4AE5A 5F9NA 4ZPBA 2H5EA 2HBRB 2RS2A 3BDPA 1IBCB 4W98A 1OQ6A 1HPZA 1X0PA 3FBFA 3KUEA 4ZVTB 1IKVA 4GRSA 4UUWA 2W1BA 4NPOA 5A8KA 2FHKA 2GA7A 3FCVA 2GVDB 4ECSA 4LRDA 3NWGA 7AT1B 3THVA 2OKQA 2GQ2A 3NMAA 1A0OB 2I5JA 3OR2B 3ZNUA 4I68A 2VQFJ 2PFFB 3PW5A 4J37A 1OYDA 5D4NA 1SH2A 5A8RB 1KSPA 2MLXA 4P9SA 2YNFB 2KJWA 4NRUA 3F41A 3KG1A 2AGQA 3P4UB 2ZUAA 5KFSA 2HWIA 5IFMA 1FJEB 5IC4B 1GFWB 3IMQJ 2ZD1B 1TMJA 4KGKA 3MM7B 1KHVA 1YJUA 3FFIB 2B4PA 5KT7A 1FEEA 3CJTA 3GJSB 5C42A 3PYFA 3CMAS 4UY8T 2HS4A 4IRKA 1ZA1B 1FKOA 3EXYA 4NLQA 4N7TA 3VGVA 3L95X 2V4JB 1TL3A 3PTWA 5DGBA 2MSSA 1QUVA 4CCHA 1IWGA 4M5KA 2R9LA 4PWDB 1Z1ZA 2J8AA 1RISA 2VBYA 1VMBA 2QLWA 3CJ2A 5J1NA 3VAFA 1T7PA 3M6UA 2ZOMA 3C6UA 2DR5A 2OI2A 4ED3A 1N33J 3PW7A 1NZAA 4QR1A 2HW3A 2CNLB 1JLEA 1NSPA 1S4EA 1KQKA 3GTYX 1I5OB 1KWMA 1LXNA 1DFDA 1HD1A 2V0NA 1QVFR 2E1RA 4FF2A 1OSCA 3KYLA 4G1QB 2ZJRQ 4OI2A 4DPTA 4F3MA 5JXSA 2PE8A 4K4WA 2CVIA 3BH7B 3J7ZT 2ZH5A 2HZVA 2CXEA 8ATCB 1VQOS 5EGYA 1FRKA 1R6VA 5KFYA 4DR7J 4DUZJ 1QDUB 3KXDA 2C28A 4K4YA 4K0KF 2PN6A 2LKZA 1GT8A 2MTLA 4ED8A 3CC2S 4DQRA 2J7UA 2MQ8A 1WKKA 1BQNB 2Q1LA 1WOPA 4J9KA 1TR0A 1LW0A 3MAAA 4CO0A 4CT8A 3QPIA 3TEHB 4U6PA 3QJJA 4KHPJ 1SJ1A 4XO0A 1CJVB 2VPXB 4TLRA 2HVIA 4NLWA 2PMHA 3T9NA 2VFRA 3OV7A 4QIFA 3OXFA 2MZRA 2XMKA 4JB8B 1NK6A 1SQFA 3MOZA 2HHHF 1F2GA 1ZTWA 3CO0P 3JQKA 4ZLLA 3PRDA 3GG1A 1LWEB 2HURA 4UY85 2A2DA 4PAAA 5GAHI 2C3MA 1V5IB 3ITHA 4JI3F 3EJMA 4I4BA 4NI2B 2AGOA 1S72S 2UXBJ 3GIRA 2VF3A 2VJVA 4QU6A 2CUYA 3LP2A 5A6WA 4A46A 4CQ1A 1GTEA 2B9EA 4DSJA 3ZFVA 1QSSA 4FKYA 1N5SA 2B4VA 4PUOB 1QM9A 1S6QA 2E7WA 2O66A 2MZTA 2RH3A 4IYQA 1H2UX 1WWHA 4R8UB 1JLQA 3GR0A 1X4CA 2D68A 4ID5A 2XWXA 2MKJA 5BYQA 1XBWA 4EYIB 2KZMA 4EU0A 3F44A 3OTDA 4JBCA 3C15A 4FXVA 2NPFA 1T94A 3QZ8A 3MEEA 4FDFA 3QT7A 2HQFA 2XO7A 4FBUA 1MW7A 1R89A 1Q0NA 1WACA 3EVWA 3IM8A 4P2SA 1JLCB 4CM2A 5FLXY 3OHAA 3G96A 4AL7A 1NSAA 1LK5A 2CIMA 4K0KJ 4H4MA 1S0OA 4ZCMA 3BO4A 3B4DA 3KLIA 2KRRA 2RDDA 1KQGB 4O3NA 3R1HA 1QSLA 3M8QB 1SC4B 2QLFB 5I42B 2DHGA 4XAKA 3GR1A 4HACB 1RTHB 5HP1A 2VQEJ 3OFFA 3RB0A 4DUZF 3NBPA 2QL7B 1YWXA 2G0CA 2YQ1A 3MCOA 3NCRA 1WC0A 3ITHB 4PWUA 4DV3F 4DR2F 2CQPA 3ENWA 4DV0F 5RUBA 4I2QB 3TANA 5DJBA 5K8NA 5HROB 5HQMA 3MMCB 3HX9A 3BBFA 5HATA 5HVHA 4C8LA 3TZZA 5E2QA 2E5LF 1HQUB 5CYMB 4AXJA 4UT4A 3PM9A 4IFYA 3UD3P 4OYZA 3M6XA 4DN9A 1N34J 2DNHA 3KDNA 1U1KA 4AL5A 4DX8H 2V4QA 1U8WA 4HDGA 3T3FA 3CJRA 3C46A 2JC0A 3D6FB 1YRXA 1J2VA 4NLTA 1RT5B 2F1FA 2BANB 2GIFA 2D7SA 4JI0F 1Y4ZB 3AXKA 3U27A 3RUBL 4Z37A 1QE1B 2FVPA 4JI4J 1VQ5S 2XMUA 3IS9B 4YB1P 2HHSA 4J90A 2EBEA 2HFVA 4I2PB 3LW5C 4NL5A 1NK4A 2FJWA 2J0WA 1QSYA 3QO9A 4DL6A 3KLIB 3BPDA 3H7HB 3SYZA 3PO5A 4P6QA 1FNOA 2J7KA 3JSYA 4FF3A 3BEGB 4WFBQ 2DK2A 4OX9F 1FKPB 2YKOA 2DD8S 2I5JB 3OR2A 2RAQA 4K8RA 5IXUA 4Y0FA 4DLGA 4UQTA 1UEUA 4GKKF 2KHDA 3NBPB 1RWKB 2HWTA 2VPZB 4EO8A 3QRRA 2VHGA 2DHSA 1GMWA 4B9MA 2E9TA 1RAIB 1N5YA 3EE3A 1QLNA 4QYZJ 5L46A 4PZVA 1OYEA 3T6JA 3UCUP 5I3PA 1NDLA 3TP2A 3RTVA 1S57A 1P9YA 1ZAVA 3DU5A 3H4DA 3KJFB 4N5SA 1HD0A 1T9XA 3RB3A 3WX8A 3ZNJ1 4D3GA 5IT9U 5AJ3F 2DR6A 1U8SA 1S5ZA 2OEJA 4FPRA 1JIHA 5K20B 4ZA1A 4ILLA 3FK4A 3V6KA 3G8TA 1WORA 2HLUA 2C2RA 4LF7F 1DY3A 3LF0A 3MECA 4C97A 4DV7J 2J6TA 2UXDJ 1H2VZ 4WYWA 1QAYA 4RX6A 4DCOB 2DR8A 1HBMA 2Q43A 1NSKL 2NXJA 1OY9A 5ETMA 5EWGA 4B9UA 3RRKA 4WP9A 2I8EA 3Q8VA 5HLFB 3DGPB 2F3JA 2FLLA 4CLFA 2M2BA 5HJYA 4ALZA 4DPOA 3EMTA 1UFLA 1RHJB 1XK8A 4TKTA 4BLGA 3HHKA 3SCIE 5CA5A 3ELHA 3HP6A 1YHQS 1LEOA 2RKIA 4KBIA 4K4ZA 1KDNA 2JRSA 5HJXA 1H73A 3KLEB 4P10A 3CDWA 2R4FA 3CDEA 3GP9A 2YWGA 2H54B 5ETNA 3FEXB 4ZHRA 2CQIA 2DHXA 4FVMA 2GJFA 4DR3F 5H9EJ 4J9UE 4IH5A 4DSFA 2NXEA 2B5JB 1SKSA 2R8GA 2IA0A 4LSNA 2DNLA 2CAJA 1CG2A 5KFQA 1IUJA 1XR5A 2MDAA 4EMDA 2B6AA 1W7WA 2PA8D 1R7IA 3CDUA 2V8GA 3HULA 4NYPA 3IRXB 5DDQC 4X65F 3EX7B 4CYUA 4ZPVR 2JNJA 4PPDA 2XB2D 3RAMA 3DMJA 4P75A 2AD9A 3CJKB 2L3MA 4DL0C 1U24A 2CNOB 2CPYA 5C25B 2ASLA 4M5LA 1UCNA 2VBWA 1BGXT 1RT5A 3FNNA 3A8EA 2IYGA 3QGGA 2MB0B 3T9ZA 3RU0A 2MGZA 1H72C 3ETMA 4DV2J 4K5SA 1C1BB 2IRXA 1IBKF 4U7UD 1FDAA 3R6GB 5LJ5Y 2OPPB 2K7JA 5H1SV 2ASDA 4ZVEA 4HHHA 3UE2A 1LFPA 3DRYA 4ZIWA 1X0FA 3QLHB 2VIHA 4ELVA 3BN7A 3CD7A 3RAXA 1TL7B 1VBZA 2IA6A 4LQ3A 2W2PP 2DGUA 2P9EA 3I87A 4HACA 1SBRA 1JXVA 1WC5A 2B9YA 1HNZF 1B4SA 1RE1B 2A3JA 3BO2A 2F8HA 2HFNA 3H5SA 4LF8F 1HQEB 1UP1A 4TU8A 3KJQB 2YKNA 4YEAA 2EKYA 2O5DA 2Z2LA 4L72B 3PJ9A 1LNQA 3SQOP 1YG0A 3SIPB 4YR0A 3UN3A 2GO8A 4DL7A 1UFKA 4ZP8A 4GC6A 1JLGA 1S7IA 3TAMB 4DV4J 4QYZK 1APSA 1TL5A 4QCLA 4J9PA 3GYNA 3H8YA 4KGZB 3IWXA 4M5DA 2M9KA 4FYXB 4HVZA 1URNA 3ILOA 1PBAA 1P1LA 1TMMA 1L3SA 4WF9Q 2H5IB 3PHEA 1SJQA 1BQXA 2AZ1A 2FY1A 1NJXA 1S6QB 4B17A 1A6LA 3OFEA 3V81B 1RWXB 1Y7PA 1YBUA 2CDQA 2JFKA 2OSRA 3ZZRA 3DOKA 2G4BA 5EDWA 1LWFB 1Z2LA 4LSLA 4OZ5A 5B7WA 2OELA 2C1EB 5A2QY 4IG0A 2WSEC 1FX2A 5KFMA 1Q16B 2CNKB 4DR6F 2DHHA 3O8WA 1GX6A 2VC1A 2FGCA 4ZDNA 4O44B 3Q8SB 3P6YC 2FLPA 2R2TA 3PYEA 5D0EA 5J2MA 4F2RA 3HHNB 1YJVA 4H4KC 4CLUA 1SUQB 4L3NA 1WUUA 2BQ3A 1S1VA 1RAFB 1O51A 1WG1A 2D41A 4Y34A 3M6WA 3LWLA 4DR2J 3M1VB 3LPEA 3A8JA 5CYQA 4NYZA 1RHRB 3JAMY 4V19J 3J7AN 4WWSA 3N6MA 2MXYA 1YSJA 2BABA 4CO2A 4CLWA 4ZP6A 3TZYA 4DL4A 1HR0J 4NLGA 4E8UA 4DR5J 1MU2B 2NPIA 1X5OA 2BV3A 4RO0A 1OPZA 5JVHQ 4DV1F 3MM9A 2BQRA 3BGLA 2CJYB 3FRZA 3BYPA 5BYSA 4Q0BA 2HIQA 2CQ4A 1RK8A 2W2MP 2HQCA 3WIUA 1JK9B 4HH1A 4DQSA 3GE9A 4RUBA 1JLBA 3MUMP 4R0EA 3QSYB 2N7YA 4GO5X 5F3TA 2AMCB 4L74A 2BQUA 5C2CA 4IFVA 2VC0A 2X1BA 2ZOGA 2LQJA 1KS2A 2HHXA 2YPZA 2CZ9A 3J80Y 1H38A 2FHMA 2QRRA 1SKUB 3H25A 4TYAA 4X4OA 4H4OA 3CC7S 4LBIA 1CJVA 4EWTA 2DBBA 3S7RA 5DDPC 1WG4A 4YFUA 1BLUA 2QSWA 3VAGA 3FBEA 3J7Z5 5BJRA 1U1MA 3LALA 2WAQD 1SPBP 1MMNA 3IG1B 2CQ3A 4OHVA 2HFOA 3CJ0A 3MM7A 4NZ0A 1A7GE 3MEDA 1DZ5A 4K4TA 2Y1RI 5KFTA 1K47A 4RW7A 1DQ8A 1DQAA 2QE5A 3A8KA 3KLVA 4ECQA 2RRBA 1CBKA 3G6ES 1TFWA 3AX5A 1S1XA 1PYOB 1BD6A 2E5HA 3KKFA 4NEYA 1WHVA 2W24A 4JI2F 2C3OA 1RLCL 4G65A 3DYAA 2B6AB 2WB1D 4ED7A 2FVSA 2PA3A 1XNRJ 3R2CJ 4RNMA 1N5TA 1RSCA 5KFNA 2HFUA 4HDHA 1LW2B 4AFFA 2ZZMA 4LSNB 4EK2A 3RAQA 4USVA 4CTAB 5LMUJ 2ADBA 1UA1A 3K7RA 1RT7A 2CKWA 2N4CA 2ZC3A 3C14A 1VJQA 1XN9A 1HWLA 4EGLA 1YK9A 2R7OA 1RA6A 5A8WA 4X4RA 2JVOA 1KNZA 3MM6B 4DUYJ 3A13A 4X4VA 3ENAA 1N5QA 1CJKB 1KBRA 3A3NB 1ZYQA 1RZMA 3PEHA 1LWFA 2J76E 2X1FA 1FJ7A 1NDCA 3LQVA 4J9RA 2B51A 1NDPA 1WC6A 2BJ7A 2FJEB 2Q3PA 4CT9A 1RI7A 4F36A 3MHYA 2W2OP 2R8JA 3CW2C 3R5GA 2QLJB 1X7VA 3BR8A 4RL1A 5D4PA 1FCAA 3M8ZA 4HYKA 3LOUA 2IHR1 2R7QA 4X2BA 2IYIA 3MEGA 4YMEA 2CZ4A 2EC0A 1HA1A 3FMWA 4LF9J 4J9NA 2F65A 2KT2A 2YKQA 2IMOA 2KB2A 2MKHA 2YBVA 3KK3B 1JXLA 1OY8A 2K7KA 3PXGa 2KKHA 1HLWA 1M5HA 3E8OA 3DYAB 4QWAA 1BE4A 2EK1A 2YKMA 2Z8QA 2LA4A 3BDEA 3HVAA 2JVRA 3MEDB 4OYOA 1HNWF 4PWWA 4LRCA 3UDLA 2NZ4A 1VQ6S 5HQ8A 3AOBA 3A8IA 2WOMA 2FHOB 3GSDA 3DRSA 4PQAA 5E33A 3W9JA 3NGKA 1WTFA 1W26A 1PC5A 1QY7A 2DT9A 2ACMA 3DRPB 3JS9A 3W9HA 4ETXA 3HM9A 2J0SD 4MKVA 2KFZA 4RKUC 2J9DE 3KHRA 1F5CA 4A8WA 3DN9A 3L4BC 3FUYA 1M5KC 1Y10A 1JLFB 2V8VA 2MJNA 4Q7AA 1CVJA 3PIPQ 4LF6F 4TY8B 3MI7X 5K8OA 1S0NA 3MPYA 2DGQA 4HL9A 3ZZTA 1EJ7L 5C24A 4A8FA 1AZSA 4WU3A 4B9TA 1QTNB 3AFGA 4QYRA 2OUGA 2KH9A 3HD2A 3P96A 2V67A 4FPIA 3U02A 3J7YI 1K44A 4ECZA 2G9OA 3W7BA 1JWWA 2ZNYA 2GV1A 1BQMB 1GMWD 3A12A 4A4JA 4ZN3A 5J1PA 1D0EA 1RTDA 2AJQA 1F5AA 5K8MA 2Y3YA 4G3IA 2JZ5A 3WC2A 2WSFC 2Q79A 3Q8UA 3D3CJ 5G0RA 1F0XA 2ZBRA 2NCKL 2CRLA 1NHKL 4U8YA 1RBOB 1H98A 2DRDA 2HVEA 2UXDF 1XERA 3HPOA 3PYGA 3G9CA 1S1UB 3VHQA 5HL7Q 3D6TB 5KG5A 1JB0C 3DRPA 5HMXA 2W8KA 1H2TZ 2ROGA 1RABB 4NOHA 1JLGB 3TAMA 2ZDPA 1R0CB 4ICLA 4NLXA 5K8PA 1U45A 2UVWA 2IMWP 2NQPA 3DDNA 2GHPA 5CCMA 4ECTA 4AQYJ 2FLOA 2OH2A 2EFVA 2PEHA 2XMMA 1FT8A 2B9XA 3M8YA 4TNOA 4D3HA 4DL3A 4O44A 5DQHA 1IR0A 1U47A 1NH8A 2DY1A 1B7FA 3EVMA 3M8PB 3PKMA 4KV8B 3D28A 2FIUA 4O3SA 1BWVA 1R8BA 5LXRA 3DOMA 3C2PA 1GXUA 2FD2A 2CPDA 1O6XA 3H2LA 1C0UB 3TA1A 5KG0A 3CCVS 1VIOA 4JV5J 4RBTA 5ETVA 4M5GA 3BREA 1FNMA 3CCLS 1BMQB 1T03A 1QJHA 3H5YA 1LW0B 2NR0A 3IR7B 2ZVSA 3DM2A 2QA4S 3CCUS 2JLFA 3QWUA 4DQIA 1RHQB 4B3SJ 1OIAA 1EAYC 1RAGB 4DR4J 1HNVB 1EETB 3T19A 2J0XA 1S1TB 3KUGA 4L73A 1IBMF 1NO8A 3CJSA 2MQQA 2Y1LB 3IRXA 4LVNP 3T6BA 2ZH9A 1UVMA 3DRRB 1R0BG 2X3DA 1FXDA 1T0TV 2C2ZB 3MTKA 3D2WA 2FHJA 4N77A 4KH0B 4DV3J 4I1TA 4DV6J 1VFJA 3PVXA 4X62F 3PJWA 1HIYA 5F8GA 4X64F 1IR1A 3QGHA 2HMIB 3TW0A 3W2WA 2QA4G 2RF2B 1S6PA 2CPXA 4ZN1A 4KHPF 3FCHA 2YQ0A 1EHWA 5SZTA 1SL0A 2MQLA 2DGOA 3KTQA 5B0EA 3HO1A 5DLGA 1S1WB 4MAKA 1TK8A 1Q81T 3RW7A 3DLKA 2Q66A 1SC6A 3KG4A 2BA9A 1RDRA 3IC1A 4MJKA 1OQ3A 2MKCA 4MK8A 4ZOSA 5B0CA 2HPUA 2I2YA 4ILMA 3HFVA 3DLGA 1YJ9S 2LVWA 4LFAF 2YWWA 1XNRF 2HIYA 3OD2A 3NGSA 4H4OB 1L3VA 3H90A 1AW0A 1WNEA 2ZNZA 3M6VA 4ZLJA 5CD4A 1X60A 1NK5A 1REGX 3DHWC 4OI1A 3KK3A 3NS6A 1OO0B 1RT2A 1KC8T 3D3BJ 3LAMA 5DETA 4JI8F 5J2NA 3K5NA 4I6AA 2AKWB 3VZIA 4DDFA 2MQOA 4IQXA 1CULA 2LQBA 2MZJA 4CLTA 2HHTA 2HBQB 5KFEA 5GAEI 4CLLA 1NJIT 3CJ5A 1S48A 4QWEA 1HW9A 2EK6A 2VU5A 1J5OA 4LJMA 1Z4UA 2MHNA 2MLZA 2L9DA 5CAAA 4K4SA 1UWBB 4QR2A 4TVAB 4ZVOB 4R25A 1U09A 3OUYA 1XR6A 2E66A 1HBNA 1LQ9A 2OSQA 5DZ7A 1I6JA 3Q8QB 3JYTA 1DURA 3ETOA 5D3GA 5CXTA 2EW9A 4HT7A 4HHJA 1RT7B 2DH8A 3OFHA 1WD6A 2RE1A 1CEZA 3DHXA 1HQ2A 1RP5A 1LXJA 3IXQA 3CCZA 2E9RX 1OSDA 1ZOTA 2VG7A 3OFGA 2QJ3A 4PR6A 3TQ1A 1R3NA 3NS7B 4WYLA 1YRTA 8RUCA 3BQ2A 2FJAB 1G1XA 3TO8A 2AW0A 3K58A 3GCXP 3CCSS 1UZDA 2LYVA 4LR9A 5IQQA 3WBZA 4DQPA 1RWMB 2H65B 3TX8A 1UVKA 5L38A 3D1QA 3I82A 4AT1B 1RJJA 3AJDA 3ZZYA 3NAHA 3MCSA 2J8SA 1ZPVA 2K3IA 3DLGB 4OZ2A 4ETZA 1PILA 3AA9A 5ADZA 1S6OA 2ZBIA 2VICA 3KLEA 2WOMB 4NMXA 2WVDA 3GG0A 5CYJA 5KFLA 2BJ1A 3M30B 4X4SA 1VRUB 4I6WA 4UF4A 2KM8B 1UFWA 1JJCB 1S9EA 1YJ7A 1UJ6A 2IAJB 4U96A 1I51B 5CD4H 4RNNA 2DGTA 2DR7A 2H3EB 2B0GA 3DLBA 4LRAA 4OJGA 4F2SA 2CG8A 1NDKA 3MWBA 2WBMA 1AT1B 2YTCA 4WE1B 2KN4A 1N33F 3E01B 1H7XA 3QAUA 1Q8IA 4UOFA 1FWLA 1VQKS 3RB4A 4JYAF 2FHJD 2JC1A 2GGPA 3I96A 5CQGA 2B8PA 2GFFA 5GAGU 1NH7A 3GJTB 2OPSB 3LO3A 5L39A 2B7CB 1NB7A 1WJ9A 4JV1A 2BOPA 4FF4A 4NXMJ 4ECUA 5A8RA 3IRWP 1X9WA 3EDRB 1IKVB 2HLTA 3DLJA 1RA7A 5ETTA 4PG4A 1DTTB 3UCZP 3MR5A 3K5PA 3RR7A 2V1TA 4PXDA 3EVOA 2HNZB 1R6YA 1TL7A 3DC2A 3HCXA 1OM2A 3EDQB 2LECA 3QJPA 2EKNA 1NLKL 3PX4A 1FKAF 4KPCA 1NJYA 2G0JA 4OYIA 4YR3A 2OPPA 4V1Ak 3BSAA 1F6TA 5CCLA 1T9YA 4YHHJ 2ZITA 4RBUA 1S1VB 1VLYA 2WTFA 3ZZ0A 3CIMA 4OZJA 1VISA 1P9QC 2BDPA 2YNHB 4GMKA 3K5OA 1BY9A 4ED0A 4QIVA 1X8DA 1RTHA 2FC8A 4GVBA 1N56A 4ZPDA 2B5JA 4WE1A 3K57A 1LFWA 1C4AA 1SCJB 2VBXA 3JSMA 1MWYA 1X31C 4ZIVA 1TVRB 1EETA 1TKTA 1FTRA 2NZCA 3ZZZA 4DUTA 5BR8J 3PW2A 2MKKA 2UUAF 1G4CA 2HZCA 4O3PA 3NAIA 2QZ8A 2YQ3A 4USTA 5KTQA 5F9LA 4DV2F 3H98A 4ICLB 4ZVFA 2DRAA 5U47A 3CJQA 4WKYA 2JX2A 1NPPA 1SXLA 7FDRA 4ATNA 1VBXA 2CYYA 2KU7A 1UVLA 4M1KA 3DLKB 2W7OA 4N47A 5GAEU 4O4RA 6FD1A 2XS5A 4OYPA 3GFHA 1B3TA 5DDRC 1FJGF 3IBFB 2MGZB 2B43A 2K1RA 3ILLA 4NLPA 4PXCA 4JI5F 1SJ3P 4U95A 2DO4A 2VFTA 1NKCA 4NE9C 4OJHA 3BV8A 2YNGA 5I3UA 3I31A 4F4XA 3KMSA 1AUSL 4DSIA 2H48B 5L1LA 2WZ1A 4P73A 1LWEA 2HEKA 1NAQA 4HLBA 4V19X 2RSQA 1UVJA 3D5MA 1FF2A 2LEPA 1MU2A 3Q2TC 5FD1A 1IBLJ 1BUXA 4IO9Q 4NZ6A 2DXDA 2HFZA 2JFDA 4TU9A 2A18A 1U1LA 2O67A 2R2UA 4ZVPB 3IAS9 3LWMA 5KFUA 3JTNA 4G1IA 4MKAA 2N3OA 3BGRA 5D4LA 4ECWA 1FVQA 3D67A 5D0GA 4ECRA 2H9ZA 2X51A 1BQNA 4KO0A 4ANEA 1OWXA 2YWKA 2KT3A 1FO1A 2ASYA 2RILA 2KG1A 1I94F 2B8QA 4DV7F 4WP3A 3N79A 4CLYA 5F8HA 2PMZD 5BR8F 5M2PA 2XTCA 2DISA 5GADI 4H54A 3B8HA 3LAKA 1N6QB 3K0JA 3LP1B 1W25A 5AJ3J 4P2MA 3GZ7A 5KFFA 2YWFA 2AEFA 1NXIA 4KQZA 1RU2A 2M8HA 2BRLA 1T3NA 5IT9Y 2XSJA 2ZH8A 2DNYA 4J9MA 1TL3B 3IR6B 1RWVB 1YVFA 4OJ3A 4A48A 2BX6A 1N36F 1J5OB 4O0NA 3IBCB 1GEHA 2VOPA 2HK2A 3QYYA 4ZPWR 1LOUA 3T5HA 4MT1A 3KLHA 3SDEA 3GFYA 3MR7A 4Y6IA 1AROP 4DCJB 5IM0B 5KFOA 4DFJA 1MMDA 2YKPA 3OVAA 3BZQA 4CWBA 3CJKA 5DDOC 4DSKA 1GQEA 3HD1A 4MIAA 3I6PA 5KG2A 2Z57B 2A1BA 1D9AA 4TQSA 4NXMF 3MMCA 4FN5A 4ZVSB 2CJ9A 3AH6A 1MN9A 2YXLA 2GIQA 2HNDA 1WEZA 1QE1A 3U1NA 2VBZA 4ECXA 5FJ4A 4UZBA 2IBKA 3QJLA 2DEIA 3GLJA 3TQEA 1GXLA 1KTQA 3QO9B 2QLXA 2ADCA 3N6LA 3C15B 3OSPA 2VFVA 2BZ2A 4JI8J 2HKEA 1JKHB 3FDSA 3FGVA 3SBMA 2YH1A 4ED6A 3OR1B 3FEZA 4HI1A 3OVSA 3OL7A 3FSXA 1QAJA 2JH3A 4I6YA 4YY3J 2J6SA 3HT0A 1HWUA 1UJ5A 2WVBA 3QFHA 1VC5A 3MMJA 1NUEA 1N5YB 2V34A 1VC0A 4Q45A 3S01A 4J9QA 4Y2IA 4EFAC 1TKZB 2QMUB 3GPAA 2ZD1A 2O3DA 3HKZD 5HP1B 4N76A 2GAGC 5E41A 3BBCA 1TUVA 2Z58B 1IKYB 2XWYA 4K7QA 4ZJOA 3SFGA 3UFCX 1CJTB 3H2VE 4WK1A 4I2QA 1XMOF 1N36J 1NRKA 2FGOA 9RUBA 3ISND 2M52A 4LIWA 5E3AA 2FVRA 3KLGA 2E1MC 2HAIA 2HNDB 1FXRA 1FHTA 4F0HA 3BSOA 1R8HA 3HZGA 1PYSB 5IM0A 4LF4J 4DZ6A 1SC3B 4DX5A 2RU3A 4F67A 1QAIA 1RAAB 3I0SB 3TOQA 2GQCA 3VVUA 3MPVA 2P6SA 4IH7A 3K59A 2X1GA 3BF4A 3DCAA 3IFEA 2QMWA 3EUNA 4PG5A 3MOJB 2EG1A 3W9IA 1ZM3A 4ZS6A 1FX4A 5T14A 4BWMA 2J9EA 2V8PA 3OHBA 2ZUGA 2FTRA 3CF5Q 2E5JA 3V4IA 1GH8A 3H5UA 3HFZB 4KR0B 3TUJC 5HN0A 2X3GA 2MZ1A 4X4UA 5HMZA 3J80U 2BBEA 3CTRA 4DS4A 2UVRA 2EBGA 3W60A 5M2UA 3T5JA 3M2RA 1AZSB 2IC3A 1HI1A 1RT4B 2HG4A 4WU2A 4JV5F 5J2MB 4OX6A 1HI8A 2JLEA 4CM0A 1RTJA 2XC9A 2FB0A 5LOQA 5L8RC 3PR4A 2AX0A 2CPIA 5IWAF 4CH0S 2LEBA 3IGNA 1Y5NB 2B3TB 2D74B 2YNGB 1FRHA 2H5JB 3I4PA 3CT9A 4E98A 2HGMA 4C2MA 1IWAA 3CPWR 4ENOA 2QA1A 3TJAA 3SDEB 5D77A 4JI7F 3I4HX 4P52A 2E7XA 2GVZA 4Y28C 1HWJA 3DLEB 4TY8A 2DH9A 4F25A 3R9LA 1D3WA 3BGRB 3GWCA 1W2BR 4BBYA 4ZCIA 3A4TA 4U7UK 4DOZA 4JI0J 2EFQA 1IM4A 1GTHA 4X62J 2CG4A 3MR6A 4L75A 3GIJA 1SQEA 4N56A 3M7VA 3EGWB 5LM7E 1FJGJ 3D0GE 3O6QA 4LF1A 3VGUA 3SV3A 3PHTA 3IGVA 2CWXA 1UUJA 2DNQA 4RUCA 4NRTA 1C0TB 2ZHBA 2JEIA 4PQUA 1EQ0A 1CS4B 2E9ZA 3I56S 1JJ4A 2UUBF 3PIOQ 2GVDA 1WHWA 5B0GA 4LMZA 3VCDA 1NZ8A 1UW9A 4QWDA 3NCQA 2G2YA 1RWOB 2HAFA 3CDAA 2V4RA 3WX4A 1EKRA 1J5EJ 2LFVA 5DG9A 2GJIA 2XMJA 4GKJJ 4JI3J 2WCXA 1SIZA 3FC9A 2GNKA 2QL9B 1PG5B 2XMTA 1RT1B 5K14B 3DI6B 4DR4F 3RYLA 1GX5A 2BE2B 3CCMS 1XQIA 3BBBA 3M9NB 3HMJG 2GZOA 4K59A 3V6HA 1PIEA 2AU0A 1IQTA 4M5DB 1ACMB 5C25A 1RYRA 4Z7YA 2GGPB 4EUVA 3R7SB 1YDLA 4OIXA 3R5BA 2DXEA 3ZZOA 2MQPA 3OL6A 3P5TL 3T41A 4B02A 2KFYA 1AUDA 2OIHA 5KFHA 2AIRB 3LA0A 3NNAA 3N4WA 1FWKA 4OX9J 1JQGA 2RNEA 3G82B 4F8RA 1IQZA 3QAEA 2MZSA 1U6ZA 4KY3A 2V8HA 3LH2S 2RB7A 3V6DB 1Q86T 4IR1A 4RPFA 1R43A 2DYAA 1WF1A 2V9WA 1RAOA 2MLYA 1UEKA 3DM2B 3CCWA 3SXLA 3I5CA 5AE1A 4DF4A 2L41A 3VAMA 3JTPA 4OHWA 4NLOA 1T9VA 2E1PA 2PSZA 2DNKA 4NCGA 3CWJA 3TVKA 1TUGB 4ANDA 2DXFA 3RZAA 4DPXA 3EPGA 1RT1A 3KDOA 3M32B 5JJBA 3HXMA 1ZETA 1U1RA 1E6YB 1PCAA 1S77D 2KZZA 2EWHA 1ZZNA 2V2QA 4LFBJ 4HEA9 4NASA 4JI6J 3FFIA 2E5LJ 1Y9OA 4LF7J 3R6LB 1RCXB 1WSRA 4DS5A 2L48A 3ZTQA 1VK8A 2CZVC 1B7YB 1UAWA 1UW4A 3JSMB 4OHZA 5C7PA 3KNGA 4A8OA 1N52B 1D8YA 5J2QA 2APOA 4OV6A 3W5YA 4MYUA 2ZHOA 3HZEA 4GVBB 1U1NA 4ED5A 3E3XA 3H40A 2QYCA 3FZBA 3OL8A 5ETOA 2IVYA 1RQ0A 3WDOA 2OMOA 1WDTA 1RT6B 4IDKB 2XLKA 2PEBA 2W9AA 2PO4A 1U0HB 2Q6BA 1TL1A 2EG2A 3W2WB 2VA2A 4J9LA 3BGOP 4FBTA 4JI2J 3MAAB 3R3TA 3V4IB 1FE4A 5JVGQ 3T1YJ 1KLNA 4KV8A 4MK9A 3O2IA 2X1AA 4KRWA 4EI2A 4N8NA 1BQMA 1PJ7A 5GMDA 5A0YA 1RTDB 1Q78A 1VOMA 3DLHA 1FFGB 3QRPA 1Y3JA 2I6WA 1FRLA 5CYQB 3BB5A 2A0FB 2MPUA 2OLWA 3M2VB 1S49A 3UN2A 1V3RA 5LMNJ 1VQ9S 4WKRA 2AYMA 3AOAA 2AGPA 1TKXA 2RS8A 1PJ5A 2COLA 2G1HA 1NMEB 2BRKA 3MMAA 1RTIA 4FNIA 3RBZA 3RBEA 1ZTTA 1KRPA 2R7RA 2DCLA 3IAM9 3O5TB 1SKRA 1FE0A 2CPFA 3OLAA 3IA0A 4RW6A 5KFPA 1VRQC 3G71S 4DV5J 5IV3A 3D9BA 5A2QU 3TUPA 3W2VB 2W4PA 2CNNB 1UMJA 1SJFA 4LF4F 3ULHA 2FUG9 3KHHA 3WIVA 1TK5A 4CZCA 1TL1B 1TV6A 1LV5A 1C2PA 1SL2A 3GMGA 4DQQA 1PAUB 1HQUA 5CYMA 1NK0A 4FS1A 3W5XA 1FVSA 3DXBA 1N0VC 2YNFA 3N0VA 4CTAA 4ANCA 1F3VA 4TU7A 4IG0B 3LP1A 4M5NA 2XLJA 1YJRA 4OMFG 2IC3B 5EX3A 4K2XA 1PBUA 4PG7A 3MPDA 4TYBA 5LL6d 2BJ3A 1FKPA 1V9OA 2O01C 3R97A 1RBLA 3GFXA 5EHHA 3TAPA 2YWEA 4X64J 3R8YA 3G6VA 2OO4A 3CMES 4QBUA 2OFHX 4P72A 3CCJS 2I0XA 3RRGA 1HBUB 3AHPA 5IWAJ 1RBAA 4PWDA 5E0OA 2HNZA 4O3OA 1G6BA 4M95A 3GIKA 3KLHB 4EO6A 1KTVA 1WTBA 2EVZA 4Z2XA 4LBPA 2JDJA 5KFRA 1OPIA 1WC3A 4U7CA 2UUCJ 1N32F 3UVJA 3OTOF 1N5VA 3AX3A 4TY9A 2ZM6F 5KFDA 1TKTB 1JX4A 3R5JB 4F4KA 3DNCA 2VDHA 4IKAA 1OY6A 4CH7A 1WOOA 2VKZG 3NLCA 2AHOB 3PACA 3QIPA 3PX0A 3IBWA 4IUFA 2ALZA 2M88A 3D6MB 1FRMA 4EBDA 3Q22A 1TUWA 1WHXA 1YIJS 3MF5A 4O4GA 1NPKA 3KHLA 2HK3A 2OJ3A 4P2XA 1KLMB 4U67Q 5EWFA 5LSOA 3BJYA 1U7LA 4OQJA 2XS2A 3QT5A 5AE2A 4LF8J 3L3CA 5KG7A 4O0IA 1OS5A 3MM5A 4NEZA 2N4DA 1GK8A 5KFVA 2HGLA 3WC0A 2XY6A 2N3LA 1P27B 2OEKA 3B54A 2NXNA 3BYRA 4URGA 5IZHA 5F8JA 5KT2A 4RNOA 4B3TF 4B3OB 2KL8A 4MK7A 2VJUA 4LF9F 4L6V3 4OJ1A 3TZWA 3Q0AA 4EZ6A 1YTYA 1IJEB 1FERA 4QWCA 1N48A 5T7LA 2CPJA 4F4YA 1MSWD 1B64A 2OPQA 1VI7A 1YBAA 2NYIA 3KLFB 3F0NA 5AXMA 1KFDA 3SSQA 2GS8A 4X4PA 1L3UA 2JLGA 2QEXS 1VQNS 2WBRA 1KONA 2G1DA 1TU0B 1JLFA 2V69A 1CPZA 2LMIA 4FS2A 3O44A 4C8OA 2C22A 2UXCJ 1MROA 5J2PB 3SCLE 3KK2B 1T9UA 1EARA 2JWNA 3UCGA 5C24B 2QN6B 4X65J 1NM2A 1TV6B 3VQTA 3W62A 4DPUA 3NWRA 4DUYF 2QG9B 2MSTA 4BWJA 2OFGX 3MAHA 1C1BA 2C3UA 3CCTA 3FRYA 3VAHA 2XYHB 3CB4A 4XDDA 3ZTOA 2R7XA 1B70B 2J7WA 2WVCA 3L7PA 2U2FA 5MLCV 3M8RA 4DV5F 1GNKA 2VG6A 1SH3A 1S10A 4K50A 1WOSA 1C0UA 1ICEB 2GJ2A 4I0WA 3TA2A 4PEOA 3M9OB 1WSVA 4LQ9A 4IFVB 4JUZA 1OJ4A 2XG8A 1FRXA 2DIVA 2RIJA 3ENQA 1VQYA 3M2VA 2ACYA 1U2FA 1P6TA 3MM8B 4KE5A 4BHQA 5J1EA 4DV1J 4Q5VA 1HI0P 1RTJB 3OJUA 1B99A 2YPYA 3J81j 1WEYA 5AT1B 3QATA 3MFHA 2YKNB 2PDAA 2A10A 5E3CA 4DF8A 1ZS6A 4ZVRB 4F50A 3P5BP 4OI4A 3M2RB 4DJBA 3IG1A 4J9SA 1HNWJ 1UL3A 1F9HA 4QR0A 1U26A 5K5MA 2HGNA 1RT3A 4C3LA 3LANA 5KFJA 4F4ZA 2QV6A 4LF2A 1M1KT 1F3FA 2D69A 3JB9k 5IT4A 2XSJB 1LWXA 1DARA 2IM2A 3JSBA 4ID8A 4WZQA 4ED4A 4LBHA 5A8WB 4BCAA 5HROA 1CLFA 3W65A 1TAUA 2BANA 2VA3A 4PYDA 4Y2MA 4HT5A 5IV4A 1T3OA 3PDNA 2OPRA 1Q8KA 3TUIC 3T5KA 3W5ZA 3QFWA 1WC4A 2VKRA 3VAKA 3SQGB 1DTTA 2BEFA 3MD3A 2VQFF 2HHHJ 1XMQJ 3IWNC 2YX7A 4KAIA 3KFWX 2IJRA 3SFUA 1C1CB 2CFXA 2Z2ZA 3D0IE 3Q24A 2WVEA 1RTZA 2NREA 4OFZA 4HTIA 2XCPA 3IS9A 2C2NA 2FZCB 3QIDA 4BS2A 1TKXB 2ZE2B 3MZIA 5ETPA 5D15A 4RZRA 4TN2A 1UJ4A 2H4YB 4ECVA 4GKKJ 1U4BA 4M5IA 1VRTA 4ZVHA 3IN5A 1ZZFA 3PKYA 3GJRB 2HWHA 2KJVA 3N01A 3SSRA 2BE2A 1XEZA 1IM6A 4DR7F 2XTJP 3AWRA 2BR0A 1S9GA 1S6UA 4URQU 5KOWA 1SJ4P 3TAQA 2FJDB 1U1PA 4A8SA 3ONQA 4M5JA 3NP5A 1DRZA 4NLVA 1YX2A 4ZITA 2C2KB 2F9DA 2V4JA 3CJ4A 2LXIA 4KGXB 3DRSB 5DGAA 2W9BA 2F9JA 4DFKA 3DLLQ 3GQCA 4I7FB 2ROEA 1N0UA 5DQGA 3CNQP 1Q7LB 2RRNA 3L09A 4F3QA 1JNRB 2DITA 3AQOA 4CO4A 3PY8A 4XDCA 1N8RT 5IOLA 4ID5B 1S7HA 1VQLS 1VHIA 5HLFA 2MY8A 2YX4A 4HH0A 3J81U 3E51A 4FNHA 1T05B 1V3ZA 3N9UC 1RWWB 1HHTP 4G6VB 2PFDA 4X4NA 5B0FA 2DNOA 1ELOA 5DZ6A 2XGQA 4RWWA 4WBFA 2BJ8A 1TP7A 3CCRS 4NLDA 5HI7A 3MCMA 1M90T 3KJNB 5A8KB 1VRTB 4PRFA 2GW8A 3J7A1 1RKJA 1DHMA 3HHLC 1E6YA 4M63A 5L1IA 1WI6A 4PXBA 1HWIA 2IY5B 4NLYA 3U1MA 2V9KA 3M8WA 4ES3A 2FQQB 2CJBA 5F0UA 5F8NA 1UZHA 2D1CA 3PW4A 4B3SF 1IVZA 4WFZA 3NGRA 3VQSA 4EYHB 3G6XA 4IOAQ 4QPTA 5CHCB 3F56A 4AQYF 1EX8A 1RT4A 3QIPB 1HR0F 5L1KA 2DR9A 2RRAA 2QIFA 4B9SA 2XY7A 2BUNA 2DNPA 3DRRA 4P74A 3SSSA 3OTEA 3GV7B 4GC7A 1L5UA 4PXEA 3DOLA 1NJZA 2ZBCA 4AD6A 2R8IA 4RW8B 2ZZTA 3Q23A 2GIRA 4B3RF 1S1XB 3PFEA 2IVFB 2W4CA 3QT6A 3UD5A 3J81Y 3OW2R 1VRUA 4ELUA 5B08A 4ED1A 4ZVQB 2UXCF 5D8HB 2IRYA 4Q0BB 2LQ5A 4B08A 4C4WA 2VG5A 1CSJA 3QT8A 2OPRB 1Y5IB 3TI0A 3IM9A 4USWA 2GVZB 1SC1B 4NA2A 3EGVA 1LWCB 1PKUA 4L3KA 4JYAJ 3JAMU 2JHEA 4LFAJ 4DN0A 3KMQA 3K8WA 2CA9A 3P8BB 3Q2SC 1Q53A 5LSLA 2VFUA 4QPXA 4HTJA 5MAOA 3P49B 4ED2A 3M8PA 4ZPCA 4B3TJ 2VPYB 2LU1A 2W7AA 1FKOB 3RB6A 1VIXA 1TKDA 3HJFA 2VOOA 2HQGA 4W90B 2XQCA 2MQNA 1K0VA
chains in the Genus database with same CATH topology
3QLHA 3MDFA 1KN6A 2IBOA 2KYXA 1FRIA 4OLOA 2IVMA 4MFBA 4ES2A 2ZKUA 1B0PA 2DCUB 3DLEA 3JTOA 3P3DA 4C0HA 2AQ4A 2YX1A 1VJWA 1KQFB 3KK2A 3BQ1A 1XTZA 2ILZA 2PT0A 2YKAA 3HDSA 5DQIA 2DGVA 1X4GA 5HBMA 2XI3A 5KG1A 2KYZA 2V94A 1YQHA 3SV4A 4C9DA 4LFBF 2JEJA 3DOLB 4WTYA 4Y2KA 2FJVA 2AYEA 2AJFE 4OX8A 3PV8A 2KRBA 3MECB 3LP0B 1F60B 1C1CA 1HYSB 2DNMA 3EYZA 1K0TA 1NHVA 2MKIA 4I2PA 3MAQA 1IXKA 1JLAA 4Q2LA 3J7YU 2KDOA 3QGIA 4NMLA 1VQ8S 3OBIA 4C3MA 5I3UB 2PIIA 2UXBF 3I5BA 3PO4A 4WZMA 2MMYA 3OR1A 4R5PA 3G6YA 4O3RA 5DLFA 4C98A 1ZBTA 5GMKa 3NGDA 1SIWB 3EPIA 2C2DA 2UP1A 2DTJA 2L9WA 2B56A 2VPWB 5KG7A 2F8MA 2O1PA 2ZOFA 3OQ2A 1CLFA 1HMVA 1O5JA 2I9SA 4X4TA 3M2UB 4C11B 4Q8FA 2QA2A 2UV8G 2ZHAA 5IQ6A 4K4VA 4I64A 5DRKA 3SQGA 2HHVA 2NXUA 2XEXA 3G8SA 4JI4F 4LFCF 1TVRA 1Q79A 1SB6A 2XTDA 1J5EF 2HVZA 3BGFA 1UVIA 1VC6A 1HBMB 1K1QA 1WELA 2J0QD 4QW9A 3M8SA 1VQPS 2RQMA 4ILRA 5DS7A 4X84A 3IR5B 5KFGA 2DNZA 4DV6F 1H6KX 3TVZA 3AQPA 4IOCQ 2Y0SD 5E3QA 2DH7A 3Q8PB 2KG0A 4KFBB 2NUHA 4FXDA 3TA0A 3PR5B 3BO3A 4DSEA 5LMNF 1TK0A 2CPZA 1G3OA 2UU9F 2KI2A 4OLPA 3MMBA 4ZLPA 1Z2ZA 2XLIA 3KK1A 1ULRA 5J2QB 4RU9A 1YJWS 1Q7YT 1UETA 1QTMA 3N6NA 1VS3A 2YKMB 2UZAA 4Q44A 1HWKA 2M70A 3HHLD 2GO9A 3I9V9 3EXCX 3AAWB 3BM7A 4NX9A 3PX6A 1YRUA 1SI9A 2F40A 5DO2A 1LK7A 4NCBA 3NCPA 1U1OA 1I1GA 2DVIA 2HYIB 2KXHA 2LXUA 2IM0A 3C6UB 4O23A 1FTCA 2D3ZA 1VQ7S 3AY0A 5D78A 4KKOB 2HRYA 1IKXB 2D9PA 1MMLA 4X4QA 3M05A 2HHPA 2GX8A 2OP5A 2R2RA 2HRUA 5L1JA 2R7VA 5AXNA 2RQKA 3POTB 3T5LA 1L3TA 5A0YB 3VALA 3DGPA 1W2IA 3HF5A 1Q4RA 3FQKA 1DLOA 3CXCR 3C6TA 2WRMA 2UVUA 3MEGB 4KFBA 1HFEL 3OXLA 4Q43A 3NL0A 3VTIA 4CNZA 1IBLF 4USIA 1B0VA 1KR4A 2B4UA 3M9MB 2YWHA 2WK4A 1SV5B 3D54A 2WW8A 2ZKTA 3OTBA 3T1HF 1BC6A 3MGJA 2RQCA 1JMTA 4QW8A 4B9NA 2RU9A 1T02A 1TL4A 2Y1JA 1ZH5A 2XNRA 3BSCA 4AYBD 4J5OA 4DG1B 4RW9A 4IRCA 1HBOB 4EZ9A 4I69A 3LP2B 5IS2A 3AJ1A 5DG7A 2XCAA 4IR9A 1VK3A 2YVSA 2ZE2A 3D0HE 1JLAB 3MR3A 3I0RB 1U6BA 1RT2B 1ROFA