4NLTA

Poliovirus polymerase - s291p loop mutant
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGPGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
molecule keywords RNA-directed RNA polymerase 3D-POL
total genus 135
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nltA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nltA02
2IC3A 4ID5B 2FLNA 2AU0A 3KOAA 1C2PA 5DGBA 3DRPB 3RB4A 3MFIA 1NHUA 2JC1A 4IG0B 1S1TA 4G3IA 3DOLA 4QWDA 2VA3A 1SUQB 3N6MA 4LSLA 5KG6A 2XGQA 1VRUB 2O5DA 4K4YA 4TQRA 3TQ1A 5J1EA 3BSOA 2YNGA 4YMEA 4ECUA 2WONB 2IA6A 1KHVA 3EPIA 4ECZA 2HNZB 4I7FB 4XPEA 4YR2A 3KJVA 4ECWA 4PQUA 3CJ2A 4TQSA 5KG3A 4EYIB 4DL7A 3OL8A 3TVKA 3UDLA 5KT6A 5J2PA 4KE5A 1EETA 4EO6A 5EUHA 5I3UB 4ID5A 1S9EA 3RB0A 4MIAA 4O3NA 2ALZA 4ECSA 4NLWA 3BQ0A 2QE5A 5KFUA 3QGHA 2JC0A 5KFOA 5EWGA 3NKYA 3KK3B 2J6TA 4RNNA 2YNHB 5KFYA 5L1JA 1HPZB 4ECRA 3N6LA 2YNFA 2YKNA 4NCGA 4K4ZA 1JLGB 2I5JA 3V6KA 3DI6B 1JLFB 1HYSB 4U7CA 4IKAA 1LWEB 3MEEA 4KKOA 1RT6A 4Q0BA 2HWHA 2GC8A 5KT5A 1JXLA 3CDEA 3EZUA 2YNHA 3FRZA 3OHBA 3V6HA 5KFHA 3T5LA 3PW4A 3QGGA 3SFUA 1RTJB 3DYAA 2WK4A 3TAMA 1TVRB 4O3OA 1RYSA 5I3UA 3DRRB 1S9EB 1S6QA 4GC6A 2XGPA 4G1QA 2QV6A 3DLGA 3KLEB 4ZPAA 2HMIB 5KFSA 3M8QA 2E9ZA 2RF2A 3FFIA 5F8GA 3BGRB 4O4GA 4KO0A 3MEEB 1SH0A 1RTHB 4RW8A 4IRCA 3C6UA 5HP1A 1RTDA 4DG1A 2YKNB 3CVKA 2YNIA 3I0SB 3QZ7A 4HYKA 4F4WA 4NLGA 1HYSA 1HQEA 2BQUA 4ECYA 1C0UB 4O3RA 1S49A 3KLIB 1VRTB 1REVB 3M8PA 5KT2A 1QE1A 3IGVA 3MECA 3QIPB 4IH7A 4KFBA 3KLGB 2VG7A 2BE2A 3T1AA 5KG5A 4QPXA 5KFMA 3BJYA 4QWEA 3OHAA 4NRTA 3KLIA 4HKQA 3NL0A 4IFYB 4URGA 4ZVFA 1N5YB 4ZP8A 2HNZA 3QIPA 4I7FA 4KFBB 3KJVB 1R0AB 5HLFB 2YNGB 4RUAA 4FS2A 2FVQA 5JUMA 3ISND 5CYQB 2RKIA 3FFIB 4DG1B 4RW4B 3CJ5A 2IJNA 2W8KA 2IAJB 4WE1A 1YVFA 4J9MA 5KFZA 3M9MB 3KK3A 3CIZA 3JSMB 4F4XA 3PR5B 2AGOA 2AX1A 1RT3A 3IRXB 3MEGB 1XR7A 4TY8B 2FVPA 1S1VA 5EDWA 2XCPA 2JEFA 4H4MB 3OL7A 3BSNA 1JLQA 5EWFA 2BQ3A 3DOKA 3LP1B 4KV8A 5J2QB 4WXOA 4WXWA 5J2MB 3T5HA 4Q0BB 3IRXA 4WYLA 1W25A 1NHVA 1BQMA 4IDKB 5DG8A 2WB4A 1HMVA 4IFVB 3KHRA 4J9PA 3QO9A 4NLXA 1OS5A 2C2DA 1LWFB 3M9OB 2R8HA 2YNFB 3V6JA 5KG0A 4TLRA 5KT7A 2R2TA 3V6DB 5C5JA 2BR0A 4FBUA 1LWCB 5C25B 1ZTTA 4OL8A 4IH5A 4EEYA 3RB6A 4O4RA 3IS9A 4MK8A 4NLDA 2FVRA 2AQ4A 2ATLA 4ZPCA 2YKMB 5FDLA 3T5JA 3RBEA 1NNDA 1JLCB 4H54A 1VRUA 4QW8A 4M95A 5DQGA 1JLEA 4Q43A 2W9CA 3DOLB 1S1UB 5F8NA 2XWYA 2VG6B 4Y2AA 4PWDB 3M8QB 2B5JB 3FDSA 1JLAA 1MMLA 1IKXB 4IH6A 5KG2A 3DLKB 1IKVA 4IOBA 4NZ0A 5C42A 1QAIA 2UVWA 2ILYA 3G6VA 3T5KA 3BSCA 3V6DA 5L1KA 3UR0A 4URSA 3TAMB 1TVRA 5J2PB 4PUOA 3M8PB 1RDRA 3ISNC 3KK1B 4LQ9A 3HHKA 1HQEB 2HNDA 2WCXA 1C0UA 4WE1B 4ED0A 5DLFA 1LW0A 2D3UA 4R5PA 4XO0A 4J9NA 5I42A 3NMAA 1RTIB 1XR6A 1LWEA 5KFIA 1RT6B 1S1UA 4U6PA 3DM2B 1N6QA 3BGRA 3V81A 1MU2B 4NCGB 1FKOB 2I5JB 3H59A 4WZMA 3H98A 2I1RA 2R8JA 4IG0A 3Q8QB 3LP1A 2ILZA 4K4XA 2BANB 3JYTB 4Y34A 5HBMB 3UPFA 2AX0A 3SFGA 3H5YA 3DRRA 4XPCA 3LAKA 4Q45A 2BRLA 4I2QB 4NYZA 2OPPA 1IKVB 1JLBA 5HROB 4ECQA 3GIIA 1S0NA 1S1VB 3HVWA 4M94A 3EPGA 4KSEB 3JSMA 1TV6A 3KLFB 2W9BA 3NGDA 1RTHA 2AWZA 3LALA 2B6AB 2JEJA 1RA6A 4QWBA 2R2RA 1TP7A 1C0TA 1IKWB 4IQXA 3KHHA 2FVCA 2W7PA 3PJXA 2AGQA 2YKMA 1T94A 2ZKUA 2C2EA 1RT7A 3G6XA 4TYAA 2IMWP 1S1XA 4WFYA 1QE1B 3KLGA 4I2PB 1FKPA 4H4OB 3D5MA 3VQSA 3QIDA 1DTTA 2B5JA 4EO8A 3KHGA 1RT4B 4RNHA 3RAQA 4O3PA 1IKYA 3DLEB 1XR5A 4ZP9A 4RW4A 1C0TB 3Q8RB 1TL3A 1FK9A 4KHRA 1KHWA 2JEGA 3H40A 3KK1A 1RT1A 5KT3A 4JV2A 2DPIA 2R8KA 5L1LA 1LW2B 3C6TA 3DRSB 4EBDA 4ZVEA 5C24A 3DOKB 4KV8B 5J2QA 3ICLA 3NBPB 1S6QB 1IKXA 4LSNB 1HNIA 4ZVGA 3PW5A 5F9NA 3MFHA 3IG1A 1VRTA 1RYRA 4K4WA 3CO9A 4MKBA 4URQU 4ECVA 4X2BA 4IR9A 4WYWA 2DPJA 1TL1B 3OL6A 5KFXA 4MH8A 2JEIA 4R8UB 4ED3A 4ECXA 3H2LA 2HNDB 2XI2A 2CJQA 1T05B 2IM2A 1RT5B 5F8IA 3CDWA 1K1QA 1LW0B 3HVTB 3I0RB 4NLRA 4R5PB 1S9FA 4ZP6A 3OSNA 1JLBB 5HROA 2BQRA 4EYHB 4MFBB 2VG7B 5KG7A 5KFBA 2XC9A 2IM3A 1LW2A 1QUVA 4RW9A 4RW6B 1S6PB 5KFWA 3E01A 3M9NB 3HVTA 3MECB 2BANA 3MR2A 2W7OA 2ZE2A 3BSAA 4ED2A 4FBTA 2F8EX 4KBIA 4RNFA 5J2NB 4WZQA 3QZ8A 3KLHB 3PR4A 4IG3B 3FQKA 1I6JA 2V4RA 2OPSA 4J9KA 3CDUA 5KFTA 1JLCA 2CKWA 3KMSA 2VG6A 2XCAA 3RBDA 1S1TB 4F4YA 2FJXA 1RTIA 3KK2B 5KFDA 2ZE2B 3H4DA 3KLVA 4EBEA 1SUQA 4NLYA 1HARA 3H5UA 3RAXA 1DTTB 1Z4UA 4RW7B 4YP3A 4ZPBA 1J5OA 3DLGB 2ASJA 4I2PA 3MTKA 4H4OA 5K14A 5T14A 1DTQB 4ZHRB 1TQLA 4NLVA 4G1QB 5F9LA 1HNVB 5KFLA 2UVRA 3KLFA 3PJWA 5C42B 1TKZB 5F8MA 1LWFA 2EC0A 2IBKA 3PW7A 3LP0A 3I0SA 3NAHA 1TL3B 1QAJA 2HNYB 2UVUA 3I5CA 5KFCA 3DM2A 1BQMB 4IDKA 3Q8PB 5DLGA 3V81B 2FJVA 4ZVHA 3QYYA 5KFPA 3GIMA 4IG3A 1RT4A 2C22A 2OPRA 5F8HA 4RU9A 4LSNA 1N48A 2R8GA 4F50A 3BQ2A 3IG1B 3KLEA 1D1UA 3KNAA 1TKXA 4YR0A 1SH3A 3G6YA 1HNIB 4I2QA 1IM4A 4MK9A 2RDJA 1S0OA 3NAIA 1EETB 3IS9B 5KFFA 5K14B 3DYAB 1EP4B 3FSIA 2FVSA 1JLAB 2YNIB 1RT1B 4QWAA 4DL5A 4J9OA 5DQIA 2C28A 3HKWA 3I5AA 1JLGA 2GIQA 3DI6A 3H5SA 1DLOB 3IN5A 1HPZA 3GV7B 3OLAA 2WHOA 2FLPA 4Q44A 5KFJA 3V4IB 2UUWA 3DDKA 4K4TA 4YQWA 4RW9B 1S1XB 5DQHA 1S6PA 4ICLB 4RZRA 1C1BA 3GV5B 4DL3A 3DLKA 3G86A 5KFEA 4QW9A 1REVA 2C2RA 2OPQA 5KFGA 1RTJA 1N4LA 1S0MA 4NRUA 2D7SA 5F8LA 1ZETA 5DG9A 4O3SA 3I0RA 4NLQA 4ZPDA 2IAJA 1HMVB 4IFVA 2WTFA 4GC7A 3DMJB 2R2SA 1C1CA 1S9GB 5J2NA 5HLFA 4O4GB 2V9WA 1TKZA 4ZMMA 1SV5B 3MF5A 3OSPA 4ED6A 5J2MA 3H5XA 4NLPA 2R2UA 3RB3A 3JYTA 3PW2A 3NBPA 3BQ1A 4KAIA 1N56A 1BQNA 2VG5A 2BE2B 4MK7A 2E9RX 3QGIA 3T19A 4ICLA 3HVAA 4TY8A 3PW0A 4RNOA 4DEZA 4ED8A 2OH2A 1JKHB 4O44B 4WFXA 4PWDA 1GX6A 2WOMB 2FLLA 5L9XA 1KLMA 2BRKA 2OPRB 4RNMA 1S1WB 2ASDA 1TL1A 3LP0B 3KHLA 3MR5A 2W8LA 1RAJA 2B43A 1TV6B 2W9BB 3GQCA 2R8IA 4YR3A 4K4UA 4KHMA 2W9AA 4Y3CA 1EP4A 3BR9A 2J6SA 1K1SA 4PUOB 4H4MA 4J9QA 4IR1A 4Y2CA 3N6NA 4WFZA 3ITHB 4NLOA 2D3ZA 4K50A 4ZHRA 5KG4A 1RT7B 2V0NA 5D3GB 5EWEA 5DGAA 4ECTA 3FQLA 2FJWA 2D41A 4Q8FA 3CWJA 4NLSA 4LQ3A 1DLOA 3LAMA 1S1WA 1RTDB 1MU2A 4NLUA 1RA7A 1RT2A 4JUZA 3CJ3A 4DL2A 1ZTWA 1D0EA 3GIKA 1N5YA 2ZD1A 2OPQB 2IM0A 3SI8A 2OPPB 1LWCA 5C25A 1HNVA 3C6TB 3GILA 2GIRA 3V4IA 1JX4A 1S48A 2JLEA 1UWBA 4QWCA 4FS1A 1S97A 3CJ0A 3LP2A 5KFAA 1TKTA 1HQUA 3MEDB 2RKIB 2B6AA 5DG7A 5KFKA 3H4BA 3PZPA 5CYMB 1JLFA 1JLEB 2J6UA 4R0EA 2HNYA 2ASLA 4DL6A 3QLHA 3PHEA 3LP2B 1SH2A 4MIBA 4ED7A 1S4FA 1BQNB 4O44A 3DRPA 4B3OB 1JLQB 4TY9A 3MR3A 5F8JA 1CSJA 2UVVA 1SV5A 1T03A 1C1CB 1S9GA 4IRKA 3UQSA 1RT3B 3MEGA 5L1IA 1IKWA 2WONA 4O3QA 3C6UB 4KKOB 5HP1B 2XI3A 5CYMA 4ZP7A 1WNEA 3QO9B 5I42B 3CJ4A 1FK9B 3PVXA 1N6QB 1TKTB 2OPSB 1HQUB 3MEDA 4LSLB 3KLHA 4K4SA 3OL9A 2WOMA 3I5BA 1FKPB 4TN2A 1JKHA 3GYNA 4K4VA 3ITHA 4Q8EA 4F4ZA 2WRMA 2HWIA 5HBMA 4TXSA 4B3OA 3LANA 2AGPA 4RW7A 1J5OB 3BREA 2IM1A 4PQUB 1GX5A 2UUTA 1RT5A 1JIHA 4RW8B 1RT2B 3Q8SB 3GIJA 3OLBA 2W9CB 1S10A 4R8UA 3E51A 3DMJA 5CYQA 2V4QA 1KLMB 5KG1A 2HMIA 4EBCA 5FDLB 1UWBB 4DL4A 2RF2B 5D3GA 4RW6A 2VA2A 3E01B 2IC3B 4J9LA 4MFBA 2VG5B 3D28A 1R0AA 4J9RA 1TKXB 3GV8B 3KK2A 2HAIA 1T05A 3IGNA 4KB7A 5J1EB 2RDIA 5KFRA 1U09A 4JV1A 3QLHB 4NLTA 5KFVA 2E9TA 1FKOA 5KT4A 1IKYB 3DLEA 1T3NA 4KO0B 4RUCA 5KFQA 4JV0A 5KFNA 3KMQA 4TYBA 4IFYA 4J9SA 1DTQA 3MR6A 1T03B 4IRDA 2IJFA 4ED1A 5JXSA 3DRSA 2ZD1B 4MKAA 5C24B 1C1BB
chains in the Genus database with same CATH superfamily
2V8HA 2PE8A 2FLNA 1SQFA 1RI7A 3GLJA 2YKAA 5A8WB 5IXUA 1FJEB 2L48A 3NOCA 5BXIA 3EGWB 1VS3A 2FC9A 4WFAQ 1PJ6A 2KFYA 3RB4A 1VQ5S 4OX6A 2UU9J 4BS2A 4G3IA 3P6YC 3QFWA 4N56A 4QWDA 4C4WA 4B9UA 4I6WA 2NZCA 1NJZA 5HI7A 5ETTA 1VRUB 2XS7A 4K4YA 2V2VA 5DS7A 4TQRA 4FXDA 4QU7A 4JI4F 3W60A 4C8LA 4P7TA 1VC6A 4M5MA 4ECUA 4J9KA 4OYZA 1P8GA 3EPIA 4ECZA 2FD2A 3J81Y 1S5ZA 2JLGA 4ECWA 4PQUA 3CJ2A 2LXUA 4DL7A 2HVZA 3OL8A 3UDLA 1YTYA 1NPKA 3BDEA 2ZC4A 1RTZA 3ZZOA 5AXLA 4KE5A 1CQMA 4FF2A 2BKNA 1VHIA 1GMUA 1VCTA 4FDFA 4OFZA 3T6BA 1IM6A 3OTOF 2ALZA 1GH8A 2DEIA 3C14B 1F9FA 1RUSA 3BO3A 2CYYA 2A2DA 2HS4A 3AJDA 4P9SA 3UD3P 2V2KA 3JB9k 3V6KA 1F5CA 3Q8VA 4K4ZA 1U1KA 1JLFB 3LO3A 2F8MA 3MCSA 1JB0C 1LWEB 4Q0BA 1RT6A 1YZ7A 4KGZB 2MMYA 2RH3A 3ZTSA 5KT5A 4C98A 1JXLA 2LXFA 4A8OA 4PPZA 1RWVB 1FFGB 4LF6F 1EKSA 3DYAA 3IBFB 2FUG9 2JNJA 4C8ZA 4DUTA 1Q8BA 4ZVSB 1RYSA 2DO0A 2ZZTA 4P52A 4DV5F 3BZQA 1OPIA 1U1PA 5D78A 1LFWA 2UU9F 4ZPAA 3UD5A 4QIVA 4MYUA 3J80U 4CT8A 3DGPA 2E9ZA 4DCPB 4KIAA 2B8QA 1PG5B 1PBAA 2ZM6J 4EUVA 3MM5A 1CPZA 4RW8A 4WK1A 5HP1A 5CYJA 3KJQB 2YKNB 2DNPA 4LR9A 2ZBIA 3CO0P 9ATCB 1X4FA 4JI3F 3KLIB 3W62A 1REVB 1PSDA 1W26A 2VPZB 5KT2A 1QE1A 3IGVA 3DN9A 3MECA 4KFBA 4DZDA 4F2RA 2XTEA 2NXNA 2QLWA 2BE2A 2DGXA 5KG5A 3BJYA 4Y2KA 4LBHA 4NRTA 2R7WA 1GAOA 1HBNB 3KLIA 4IFYB 4QR0A 2FGOA 1FEEA 4ZVFA 3MPWA 2R7TA 4ZP8A 4KFBB 5CCMA 1UFKA 2YNGB 1RJJA 3QT7A 3D4JA 2PMZD 4NYPA 5JUMA 2JL9A 4AFFA 5A76A 1HR0F 5CYQB 2RKIA 4UY8T 2IDEA 4ZLJA 3Q22A 4RW4B 1ZPVA 5ETMA 2W8KA 2IAJB 4WE1A 1LEOA 2H51B 2Y0SD 4FVMA 2ZH6A 5KFZA 3CIZA 1FCAA 1DFDA 4D3GA 2AX1A 1XR7A 2JEFA 1A9NB 3LGNA 2Z2YB 2DITA 2P5VA 4I6AA 5EDWA 2FJBB 4Y2MA 1HWLA 3ZTRA 3U7JA 3LP1B 1IN0A 3R5BA 4WXWA 4YB7A 1F2GA 4PXDA 1KFDA 4JI0J 1NXIA 1P1LA 1XMBA 1S7IA 1WELA 1Y3KA 1AB8A 2K7JA 3BEGB 1CJUB 3IR7B 4UUWA 4JI2F 1M1KT 3HSJA 1D9FA 4QU6A 4USHA 4USVA 1HLWA 1VQ7S 1NK5A 2CPYA 5LMNF 3KHRA 4J9PA 1QD1A 3QO9A 2K1RA 2M4MA 3VALA 2RVJA 1RAFB 2UUBF 3VTIA 1F9HA 1U1RA 1FO1A 2Q43A 5AE2A 5KG0A 2CJKA 4FBUA 1X0FA 2F3JA 5C25B 1ZTTA 4KT0C 3FZBA 2MKHA 3TOQA 2JRSA 4B3RF 4NLDA 2Z0GA 4UOCA 3CB4A 3NY0A 1VQLS 2ATLA 3TP2A 3T5JA 4U7UD 4UOGA 1NNDA 3PO4A 2VFVA 2B7CB 1NHKL 4M95A 3HZGA 1FJGF 5HN0A 1VGYA 4KH0B 2XWYA 1RXOB 4CT9A 5C7PA 1DQ8A 4NWBA 3L3CA 2NZ4A 4A8XA 4QYZJ 1LXJA 1VJWA 1MMLA 1K9MT 5ETQA 2W4DA 4OYBA 2AYEA 1MW7A 2HG4A 4JBCA 3KKFA 4ZCIA 1IKVA 3SQGA 2UVWA 4CQ1A 3R2DJ 3T5KA 3BSCA 2XG8A 2QSWA 3TAMB 2QA4G 4PUOA 1RBOB 2XBPA 2J0WA 1WSVA 2H5IB 4DPOA 2WBRA 3A4TA 4LQ9A 1BHNA 1HQEB 1REGX 2GMJA 2ZWOA 1NK4A 1NDCA 4JI1F 2EKYA 3OR2B 5LM7E 5DLFA 1LW0A 2W4CA 5I42A 4DSEA 1KSPA 1UFLA 1NM2A 1HA1A 2CQ0A 1S1UA 3BGRA 3V81A 1MU2B 4L73A 1Q0NA 1URRA 2MKCA 2QG9B 4NCGB 4WZMA 2CJBA 4ZIVA 2R8JA 3LP1A 2ILZA 4HT5A 2VJUA 3JYTB 5HBMB 3JQJA 2XNQA 4XPCA 3LAKA 2BRLA 4I2QB 2XQCA 1Q7YT 1HNXF 2CQ2A 3MAHA 4ZIWA 2XTDA 1HI1A 1S1VB 3ONQA 2NPFA 4UZBA 2MTLA 2V8VA 3PRVA 3TZZA 3JSMA 3AB4B 2GZOA 4J5OA 1CC7A 2GV1A 4PEOA 5BYRA 4Y0FA 3NGDA 4CO4A 2JEJA 4F2SA 1OY8A 3NRBA 1UWAA 1WG1A 1YJRA 3W9HA 2DNMA 2CIMA 2XSJA 1OMSA 1U2RA 1Z2ZA 2FVCA 2IVMA 2RRNA 4LBPA 2W7PA 1XNRF 1T94A 3CJKB 2C2EA 4J37A 3G2XA 1U2CA 2KL8A 2IMWP 1S1XA 4M5DA 3VR1A 4WFYA 1QE1B 2RMLA 3F41A 5HMWA 2LDYA 2FJAB 2O01C 3PV8A 2R7OA 2M8DB 4UUXA 2IMOA 1RHJB 2B5JA 2QO3A 3CW2C 4A48A 1J5EF 4MYTA 4JV5J 3JAMU 4B3TF 1SL2A 2MKKA 4WK3A 1ZA1B 2B7BB 1HWIA 2CFXA 3DLEB 4C0OC 4ZP9A 3Q8RB 1RHRB 3TVZA 3B8HA 1HQ2A 3M6XA 3TJ8A 1FK9A 3QAEA 2NLWA 1RT1A 2JSXA 3MPUB 1ZZNA 3C6TA 3ILJA 2ZJQQ 3DOKB 3BPDA 2KYZA 4RKUC 1WC1A 2MLYA 3ICLA 3NBPB 5F0UA 3R5DA 3MMBB 5GAEI 3CD6S 2BE7D 5F9NA 1MMDA 1G7CB 2HK2A 1R6YA 3ENWA 4CLZA 2U2FA 3C15B 2DPJA 2ASYA 1PKUA 2KVIA 1W7WA 2B4OA 4LRDA 3K7RA 2VH7A 2EXUA 2V1SA 2JX2A 2QA2A 2LVWA 3A3OB 4B17A 2HNDB 2XI2A 4TU9A 3HHLC 4DQPA 1RT5B 1VQ8S 1LW0B 3CNQP 4JB8B 1S0VA 3NCQA 4GRSA 5IM0B 1S9FA 3MCOA 2P9GA 3MOJB 3H90A 3NS6A 3HF5A 2BQRA 3IM9A 1M5PC 1DRZA 1FDDA 1RHKB 4FYVB 1X5OA 3R5JB 5KG7A 2CJ9A 3HI9A 4HL9A 4RW9A 1S6PB 2XC9A 3M9NB 1U1OA 2M88A 3TO8A 4I0WA 3US5A 2F8EX 4RUBA 5J2NB 4UT4A 3PR4A 3K59A 1F60B 4IG3B 2AP6A 2VASA 3BYPA 5EHHA 4DR5F 1Q86T 2ZDOA 4U7UK 3TZXA 2HHTA 2YKPA 3GCWP 5KFDA 3KK2B 1VBZA 1Z2LA 3H20A 4X84A 1SUQA 2BXJA 3FSYA 4EBEA 1X4GA 1DTTB 1Z4UA 2GQQA 2YWWA 3PYEA 4ZPBA 2QA4S 3DLGB 4USIA 4K0KF 3V2UC 2VBZA 4DS4A 3I55S 5AT1B 1H2TZ 1U25A 2IYIA 5IT0A 2DBBA 3AJ1A 3PJWA 4ZVRB 1UCNA 2IDLA 4L3KA 1PGZA 3C46A 3UN3A 2RE1A 2IBKA 3LP0A 3PCOB 2AD9A 3Q2TC 3PX6A 4C8YA 1G4CA 1QAJA 3G96A 3TAPA 1C4CA 2UVUA 3I5CA 2PA3A 2WSEC 3DLJA 1BQMB 1HBOA 2LEPA 2V4JA 3KFWX 4IDKA 2RU3A 2FJVA 1HYSA 1UEKA 4H4KA 1RT4A 2FYXA 2OPRA 1A0OB 1RACB 1K0VA 1V5VA 4LSNA 1NK9A 3ILLA 2YXLA 4F50A 2VOPA 3BQ2A 4CLTA 3IG1B 1WF0A 3KLEA 1D1UA 1YKWA 3KNAA 1TKXA 3NGSA 2AEJA 4I1TA 4USUA 1LNQA 4EZ9A 5ITHA 5LJ5Y 2MHEA 2DCLA 3FBBA 5KAKA 1CJVA 3NAIA 2GO9A 2KFNA 1OSDA 3DYAB 1UEVA 4E98A 2BW7A 5LXRA 2F7VA 5K8NA 3H2VE 3FSIA 1OO0B 5IWAJ 3RBXA 1RAHB 2FVSA 4LF4J 3BGUA 3TNVA 2E5LJ 4DL5A 4LRBA 4J9OA 4P6QA 2HQFA 1U45A 3BR8A 1JLGA 4DQRA 4K7QA 4DR6F 4P75A 1DLOB 4QIFA 3IN5A 1BMQB 3GV7B 1QTNB 1GEHA 1RBLA 3I6PA 1HI8A 3V4IB 4HLBA 1R8HA 4YQWA 1M1GA 5DQHA 5LMNJ 3KJFB 4ICLB 1LV5A 2A10A 2UP1A 1YRUA 2COLA 3G86A 2FB0A 4WP9A 4AXJA 2RQCA 2OPQA 3CPWR 1RTJA 3CT9A 1N4LA 4GO7X 2BMBA 2H5JB 3BKFA 2VBXA 4QIEA 5F8LA 3NWGA 3OXGA 2L9WA 1ZETA 1Q81T 2DHAA 3I0RA 4NLQA 5SZTA 4HHUA 3D3BJ 4KTQA 2Z8QA 3NS5A 3BKUA 2KO1A 4OMFG 4PR6A 2R2SA 3DRXA 2DRAA 2F9DA 4PQAA 2RD5C 4GVBB 1XEZA 5J2NA 4ERDA 1TKZA 2MZRA 4WBFA 4A47A 4JI7J 5KOXA 2NQPA 3OSPA 3DDNA 3QT6A 4RWWA 3CCVS 4DV0J 1RP5A 3CJQA 3JYTA 2DR7A 4NXNJ 4QR2A 1G6BA 1WACA 1NK6A 4NZ6A 2VQEF 3AJ2A 3HVAA 2Y1JA 2AJ0A 2AJFE 2GHVC 1Y9OA 3M2UA 1X4BA 4PWDA 1VBKA 3QRPA 1T9XA 2ZHOA 2GGPA 2KJWA 3TZWA 1WKJA 4G6VB 4ZDNA 1WC5A 3OFGA 1S1WB 3PFOA 3NLCA 1RABB 4OQJA 3LP0B 4F4KA 1RAJA 4F0KA 4ZN1A 5D4PA 2E29A 2GJFA 1HNWF 3IR5B 3GQCA 2X1BA 2PFFB 1N0VC 2G0CA 4YR3A 2CJAA 2QMWA 4KHMA 2HQ3A 1WDTA 2YQ1A 3BR9A 5HMZA 4PUOB 3M8SA 4DN0A 3N6NA 4WFZA 1AXQA 4DX7A 2D3ZA 4K50A 1NZAA 3SXLA 3OTOJ 3IWNC 4HT7A 5EWEA 4HHHA 3GJRB 2XMAA 4LF2A 2D41A 3SMZA 5LT5A 1FNOA 4Q8FA 4LRCA 4QOTA 2ZZNA 2RDDA 4I6YA 4CYUA 1RA7A 4EK2A 3HZEA 3MM6A 1EX8A 4K0KJ 4B3MF 2C2MB 1I3OB 2ZD1A 2OPQB 3C19A 1FD8A 4NX9A 1LWCA 1BLUA 1YJWS 3C6TB 3AFGA 3MD3A 2JZ5A 3DOMA 3JTNA 3KG0A 3V4IA 1JX4A 3CGIA 4QWCA 3BV8A 4FS1A 1GQEA 1S97A 3I31A 1AT1B 4BCAA 3W64A 3VQTA 3MURP 2E1CA 4C8KA 4HH0A 2B6AA 2A0FB 1JLFA 3DNCA 5DRKA 4DPWA 1JLEB 4N8OA 4JI5J 3MMCB 2UXBF 3W3SA 2ASLA 1Q8IA 4DL6A 1VIXA 2KN4A 3QLHA 3PHEA 1NK8A 2UXCF 1XK8A 5HVHA 3K5NA 1S7HA 1O51A 3FBCA 1S12A 3L7UA 4B3OB 1JLQB 2MZJA 2RAQA 4MJKA 3R97A 2VIHA 4FN5A 1KKHA 3HKZD 2UVVA 1SV5A 1KTVA 2K3IA 2O66A 4I56A 5K8MA 1C1CB 1S9GA 2H1YA 2DXDA 2V5HG 3G6ES 3IC1A 3EX7B 4P10A 4LF8F 2CPIA 3IAM9 1KRPA 2FY8A 4KKOB 4ZKAA 4C8NA 2MQPA 3KDNA 4Y00A 4LMZA 1FD2A 3CJ4A 1X5SA 2GMLA 3MEDA 2G0JA 4OHWA 2HVHA 1MWYA 4FKXA 4LSLB 4OZNA 2DT9A 1SJ3P 2GCFA 3EWGA 1FE0A 3I5BA 4ETZA 2EPIA 2UUAF 3LGMA 4J9VA 3QRRA 2YVSA 4ELVA 2PD1A 2GS8A 4AD6A 2QMUB 1TL7A 3CCLS 3FNNA 4JI8J 5IQQA 1SJQA 3JSBA 4AYBD 1ZS6A 2KZMA 3SCIE 2F1FA 2K06A 3MM7B 1J5OB 1D9AA 3BREA 3ZTPA 3R5GA 1RE1B 2VFTA 3NGRA 1Q4RA 2JHEA 1RT2B 3AQOA 4WPAA 3Q8SB 3VAHA 3OV7A 4PYDA 3I96A 2KH9A 2HHHJ 2ZOMA 1Y00A 2ADBA 5KG1A 2FDNA 1IQTA 4PAAA 4EBCA 2J8SA 2VOOA 1YLXA 5FDLB 4DL4A 1B0VA 5FIIA 2MQMA 4KPYA 4RW6A 3AA9A 1D8ZA 1LFPA 2CWXA 2PO4A 3E01B 2DR8A 2P2CB 5B0DA 1D09B 2V6AA 2VG5B 2F4FA 3GMGA 3TWZA 2FC8A 3D28A 3FMWA 1P27B 4U8YA 2DHHA 2WSFC 3LGHA 3GV8B 4FXWA 4F02A 3AX2A 1T05A 3IGNA 3QJPA 5KFRA 1U09A 2MYFA 2AYMA 2QL9B 2BW2A 3B4MA 4NLTA 3QLHB 1XJWB 5KFVA 5GAHU 3BN7A 1WG4A 1SJ1A 3M8WA 3RRKA 1TU0B 2CWKA 3DGVA 4KO0B 4RUCA 2XTCA 4JV0A 3UCUP 5KFNA 4X4RA 5THWA 1GTHA 2P8IA 3I82A 1U6BA 1VQPS 3BO4A 3BKTA 4IRDA 4NPOA 5JXSA 3RRGA 3W63A 3DKDA 4ID5B 2GO8A 2BKPA 4LREA 4X4QA 2Y3YA 5GVQA 1FXLA 2ZH3A 2YWKA 4GVBA 1NHUA 2CQ3A 2G2OA 2JC1A 3DCAA 3HSGA 3MCNA 4ZVOB 3VAJA 3DOLA 2E1AA 3U1NA 2O5DA 3KJNB 1VQSA 3TJAA 3TQ1A 1ZH5A 2DGQA 2Q3PA 2Y1LB 3BSOA 2H4WB 2CJYB 5CQGA 5J1EA 3D2WA 2WONB 3VAGA 3D68A 3SSRA 2JFKA 1N54B 3K8WA 2J7KA 1PYSB 1I51B 3NOGA 3TVKA 3ZTQA 1JJ4A 2LQ8A 1V9OA 2UV8G 3ZZYA 2LQBA 3TZYA 2DNLA 4BWJA 4BC9A 1EETA 3PKMA 2CVIA 1JMTA 2LMIA 4LSZB 2ZH5A 4MIAA 3TUIC 3RB0A 4OI0A 2D68A 4NLWA 2WW8A 5KFUA 4DX6A 2JC0A 2DNHA 4C9DA 3NKYA 4LR8A 2VC0A 1Y11A 1Y10A 2HBYB 2I0XA 2YNHB 5KFYA 5L1JA 2JH3A 1XMOJ 3N6LA 2NREA 2YNFA 2YKNA 1YIJS 1JLGB 2I5JA 3EMTA 2LQ5A 1IR1A 2ZBRA 4P74A 4PABA 3MEEA 2Y1IA 2HK3A 2GC8A 6FD1A 2BJ9A 3SV3A 1LK7A 3CDEA 5HJYA 2R7SA 2LA6A 3FCHA 1N0UA 2KYXA 2NXUA 5KFHA 1NEEA 3SFUA 5CD4A 5AJ3F 3PW4A 4DSJA 4M5HA 2Z57B 4OV6A 2KXNB 1TVRB 3MPDA 5I3UA 2OI2A 3QAUA 2XGPA 1TL7B 4ED4A 2AT1B 4X4PA 3BPSP 3F44A 2KG0A 3DLGA 5M2UA 2J0QD 1FE4A 3A3PB 3A8JA 3J80Y 2HMIB 3Q23A 2POKA 3HP6A 3WIVA 1BXNA 5KFSA 4Q5VA 1P6TA 3M8QA 1AZSA 4HH1A 3VVUA 1CJTB 1N33F 3TAQA 3MEEB 1RTHB 4PZVA 1SXLA 2DGVA 3Q2SC 4UW2A 4OHXA 2O1PA 4Y2IA 4F4WA 4NLGA 1HQEA 4O3RA 1S49A 1QSSA 1VRTB 2MEWA 2RU9A 3LOUA 3MTJA 3KLGB 2C2ZB 1BD6A 2FGCA 1F3VA 3CCTA 3J81j 4DR1F 4PRFA 4RWXA 3T1AA 3BN4A 4DSKA 4QWEA 4OJ1A 4ZLLA 2V34A 3FEYB 3ET6A 4XAKA 3I9V9 4W4MA 4LIWA 5H9FJ 4URGA 1FWKA 3BQ1A 1G3OA 1R0AB 2K3KA 1TMJA 3HFZB 4CH0S 1UVNA 1WHVA 4RPFA 4RUAA 4FS2A 3QRQA 1JXEA 3UD4P 3EZOA 5DM7Q 2H4YB 5L38A 4DG1B 3THVA 3CJ5A 2KT3A 5F0WA 3EE3A 1NJIT 2M0GB 1R0AA 3M9MB 3JSMB 1X31C 1X9MA 3IRXB 1RT3A 3MEGB 4ATNA 2XCPA 3SDEB 1V3SA 1JLQA 3I4PA 3DOKA 3S7RA 2CPHA 2HEKA 4KV8A 3ZTOA 2BJEA 4DV3J 3A12A 3GZ7A 4KHPJ 1UW4A 2X3DA 1RADB 3AOAA 3T5HA 1YG0A 3GYXB 2KU7A 3D0IE 4P71A 3CJKA 4C0HA 1SJ4P 1S6OA 4WYLA 2G9OA 1SL0A 2YH1A 1X60A 4WU3A 4PCQA 3S1TA 1HMVA 2BOPA 1NK7A 2NPIA 3P96A 1UJ6A 1WOSA 2EI5A 3M1VA 5L39A 4CO3A 2EW9A 2R8HA 1CULB 3V6JA 4U9RA 4TLRA 1WHWA 3AHPA 4M5NA 5DO2A 1N5VA 4D3HA 5KT7A 5EX0A 3V6DB 2J9CA 1LWCB 4CLSA 1HBMA 3OTEA 1BWVA 2KI2A 2QGFB 3D66A 4EEYA 4HEA9 4CLFA 1OYEA 4MK8A 3OBIA 4W90B 3T3FA 4CO5A 2EEYA 1U0HA 5E7OB 2CZVC 3Q0AA 2W2MP 4CNYA 1FRMA 1CG2A 4ZPCA 3A8EA 3RUBL 1WEYA 1WG5A 1ZPWX 5FDLA 1X4EA 3RBEA 1X5PA 1JLCB 3EYZA 1U49A 1VRUA 2KZZA 3IM8A 1UVLA 2M7SA 4A8FA 4FF1A 4Q43A 5F8NA 5B0EA 3MGJA 4CLPA 4PWDB 2EFPA 3M8QB 4QQBA 2B5JB 1JLAA 1SQEA 3O1LA 2F65A 3T1HJ 1HHQA 1FXDA 3POTA 4DV3F 4F25A 4KHPF 4NZ0A 1H2VZ 2E44A 3D7SB 5D0RA 3WBZA 2HHVA 5D6GA 3PG9A 4DXLA 1T11A 3UR0A 4URSA 2CUYA 4AE5A 3QMQA 4OYIA 2GQ2A 4MKYA 1RHUB 1OY6A 3ADAC 3HHKA 4OI1A 3KUGA 3MMJA 2V2ZA 4A8MP 4ED0A 1R0CB 3GSIA 1SPBP 2C1EB 1WI8A 1XR6A 1OJ4A 2FQQB 1RT6B 2CADA 2AEMA 2PDAA 3DM2B 1CJTA 1NRKA 2G4BA 1FKOB 2DCUB 1GXUA 1L3TA 2JDJA 4C8MA 4IO1A 3P5BP 2PFDA 3CD5A 3A8IA 1VK3A 2CQHA 4K4XA 5E5NA 4OZLA 4Y34A 1D3WA 1AUSL 1R7IA 5E0OA 4DPUA 1HKAA 1MWQA 2OPPA 4FF3A 3TVYA 1N52B 1S57A 4L76A 5IT4A 4ECQA 1VJQA 2BR0A 2HBRB 2AYBA 2UUCF 2BM1A 3QNWB 4HACB 3MUMP 2V68A 2XO7A 1NJYA 5D0HA 2W9BA 1R43A 4WJBA 4OI3A 1GTEA 2HAFA 2LFVA 4CTAA 1H7XA 4ZN3A 2AWZA 4MT1A 2VV5A 1R8PA 2J76E 5LXYA 2R2RA 3AT1B 3RW6A 3HFVA 3PRBA 1R89A 1H74A 5DZ7A 3RG6A 3SV4A 3LUYA 2CZ9A 4A46A 3Q86A 1SC6A 4NEZA 1IQZA 3LWMA 2ZHBA 5I3PA 2DNZA 3OVSA 1QVGR 4OLOA 2AJ1A 2QTWA 2XMWA 2Z30B 2Z2LA 4H4OB 3CCSS 3VQSA 3J81U 4DN9A 2F40A 4UOHA 1DTTA 4DV6F 3M6VA 3M8RA 4X4SA 4S0MA 4RNHA 4PG8A 3JAMY 3KHGA 4JI6J 3K5OA 1KC8T 3VAKA 3UDVA 1HL6A 5H9FK 2MJUA 4P2FA 4RW4A 2X51A 4FXVA 1T9TA 2ACYA 2X1AA 4DL0C 1KHWA 5M2PA 4DUZF 2JEGA 4B9TA 2MGZB 2M2BA 3HJFA 2HHUA 3KK1A 3IXQA 1TKDA 2R8KA 3PDNA 5B08A 3ETMA 1T9VA 1TAUA 4EBDA 3W8PA 4GKJF 5C24A 5J2QA 3DHXA 4W98A 3WIUA 4K5RA 5IWAF 4EFAC 3M7VA 2HFZA 1VFJA 2R42A 4LSNB 1HNIA 4ZVUB 2GFFA 2CA9A 3MFHA 3NMRA 3ZNJ1 1VRTA 1SQGA 2FIUA 4URQU 5HO4A 3BGLA 5DDOC 2OD4A 2NYIA 2HRYA 4DR6J 2OFHX 3CMQA 2C3MA 2FY1A 5KFXA 1UUJA 4IYQA 4ECXA 3H2LA 4HHJA 2ZVSA 1Q53A 2ZBCA 1R8CA 5E41A 4FPIA 1T05B 1M5OC 1EIYB 1NKCA 4R5PB 1K1QA 3I0RB 2ZJRQ 3UWTA 3R3TA 2UXCJ 4NEYA 3PACA 1JLBB 1T0TV 1HIYA 1XMQF 2R7XA 1GFWB 4EYHB 4USMA 3J7YI 2HQIA 3GR1A 5FJ4A 1FJCA 5KFBA 4QZVB 2IM3A 1QUVA 4RW6B 2C42A 5KFWA 5LOQA 4X4TA 1RISA 2QYCA 1H2UX 2BANA 4ED2A 2ZE2A 3BSAA 4OJ3A 2N4CA 2BOAA 3MMAA 4Q2MA 4Q2LA 5A8KB 5A2QU 2Z4PA 4WZQA 1YRXA 3EGZA 3C16B 4IO9Q 4NL5A 1FRJA 4QYZK 3FQKA 4BBYA 2V4RA 3PYDA 4DZ6A 7FD1A 2XCAA 1JLCA 4HTIA 3KMSA 1ZBTA 3M2RB 3Q83A 1S1TB 3TEHB 1RTIA 4IOCQ 1T7PA 3GFYA 5AE1A 1PAEX 3NG8A 3O44A 4OZ0A 1F6TA 1HD0A 3BDPA 3MM7A 2YX1A 2EBGA 3T41A 3J7Z5 4H4OA 2PIIA 5K14A 1EKRA 4DF4A 1DTQB 4ZHRB 4G1QB 4NLVA 4NZ7A 5F9LA 2E7WA 1FF2A 5KFLA 5IC6B 3DU5A 3W65A 4B02A 1WD6A 4ENOA 5HAOA 5C42B 3KLFA 1TKZB 4DV5J 5F8MA 2QFJA 2BVZA 3EUNA 4TLQA 3NAHA 3QGPA 2ZNZA 2AIRB 3VAMA 2QT7A 3ZZ0A 1RQ0A 2HNYB 1VC5A 2CPFA 1XIQA 5KFCA 4B3SF 1RZMA 4V19X 3M2RA 5DLGA 3QYYA 4CTAB 3ULHA 3GCXP 1IWGA 5LJ3Y 3M6WA 2R8GA 3MMBA 4USWA 1K47A 1N48A 5I3UB 3BBBA 4EI2A 3HHNB 3UDEA 1MG7A 5D0EA 5BYQA 1FA0A 4WFBQ 4ELTA 3QT8A 4I2QA 4MK9A 5DJBA 1KOOA 4NMXA 1S0OA 2XHWA 1FVSA 1LWXA 4Y28C 2PI5A 1QVFR 4DUYF 1EP4B 2YH0A 4P2SA 3HK2A 4PWUA 2GIFA 3CCWA 1RHQB 5E3PA 2SXLA 2GMHA 3HMJG 3SCJE 2YNIB 3KWMA 4TNOA 4QWAA 3TUZC 2XLJA 3LA0A 1SC1B 4DSFA 2C28A 2HVIA 2DGTA 2MXYA 3HKWA 2GIQA 3DI6A 2ZBQA 5FLXU 1UPPA 4DFMA 2JFDA 4B3MJ 5B0GA 1L3VA 2HHHF 1HPZA 3M8ZA 1EZZB 2FLPA 1TMMA 4B9LA 2MQQA 1J2VA 3NNCA 2UXDJ 4CDIA 4Q44A 4DR7F 4KC5A 2UUWA 4K4TA 1WWHA 1NKBA 2HIYA 1S1XB 1KBRA 4M5DB 3G8QA 3M30B 1E6VA 2B9YA 1L3SA 3X1LB 3RYLA 8AT1B 1MMNA 1Y5IB 2X1GA 3DLKA 3OD2A 2M9KA 3W2VA 5HSPA 5KFEA 3MR7A 1SKRA 4WP3A 4ZLPA 3R7SB 4A8KA 5B0BA 2GVZB 4E8UA 4B3SJ 1NDKA 4FNIA 4O3SA 2ZNYA 4H4KC 1KTQA 2D3O1 2IAJA 2DH8A 4PG6A 4NYOA 1CBKA 2GAGC 3T6JA 1MWZA 2E1MC 1VQ9S 1UJ5A 3B4DA 1JJCB 2UXDF 2QLJB 3BB5A 2KG1A 2KHCA 4L75A 1M5SA 2HFOA 1GXLA 4OYAA 1AROP 5J2MA 4NA2A 5U47A 1D9DA 2MKIA 4NLPA 4EWTA 4F3MA 3RB3A 2AZ3A 2GW8A 1AA1B 1UW9A 3FK4A 3GWCA 3IBCB 2F63A 3NBPA 2BE2B 4CLWA 4I4BA 4DPYA 3T19A 4LF8J 4ICLA 4X4VA 4TY8A 3J7ZT 1FHTA 4DEZA 3VAIA 2OH2A 3C3LA 4OHYA 1T02A 4GKKF 2BE9B 1Y3JA 1KOHA 5LMUF 2WOMB 2JWNA 1KLMA 3HSZA 1LK5A 1UZDA 2DD8S 1ULRA 3M32A 5K5MA 5IQ6A 3OTCA 1FNMA 2ASDA 1TL1A 3ZZUA 1BQXA 3KHLA 4CI0B 4LFBF 2XMTA 1TV6B 5ETSA 4JI8F 2L9DA 5JJBA 4DR4F 2RQMA 5G0RA 4K4UA 4ZITA 2EFVA 4N47A 2AMCB 4M5IA 4PXBA 1RLDA 4CZCA 2W9AA 2DTJA 3O8WA 1EP4A 2J6SA 2NUUG 2VKZG 3EXYA 2CG4A 3K5MA 4GKKJ 4PXCA 2APOA 1YQHA 5G0RB 5KG4A 4ZHRA 2D3OR 2QIFA 4DV2J 2EC2A 2OEKA 2VZ9A 2FJWA 4NE9C 5B7WA 3PX4A 2DNNA 1TUGB 3CWJA 1PBUA 4DOZA 1XMOF 4DV4F 5JVGQ 1RTDB 2J9DA 2KTQA 3OFFA 5CA5A 3R27A 1T3OA 3TANA 2IRUA 3L4BC 4JUZA 3KG4A 1S6UA 1WTBA 1ZTWA 2H54B 4C7QA 3BYRA 1CJKA 3I4HX 2BJ3A 4N5SA 2IVYA 4WKYA 1KVIA 1VR6A 2IYGA 1EB0A 2OPPB 5C25A 1VI7A 2LEAA 2GIRA 4LRAA 4DV2F 4C6AA 1S48A 5CCLA 4JI2J 3FEZA 2DEJA 2EBEA 3CMAS 1IR2A 2CDRB 3BBCA 2B0GA 2VL1A 2J0XA 1TKTA 2OELA 2Z56B 4HVZA 4OX7A 2BUNA 2RKIB 2XNRA 1RU1A 1Q82T 4LFBJ 1SC3B 2H48B 2NUHA 4DR4J 4R0EA 2G1HA 2HNYA 5E3QA 2V50A 4LF7F 1NO8A 2EWHA 3LP2B 2ALYB 2NSCA 1SH2A 4MIBA 4YY3F 6FDRA 2ZH2A 1IBLF 1CC8A 3MI7X 1SKSA 2MKYA 2OMLA 4CM0A 5K9FA 1V3RA 2ZWPA 3L9ZA 3MM9A 3Q24A 5F8JA 2CNOB 4I67A 1CSJA 2ZOGA 4LF5F 1T03A 1HNZF 3POTB 4P72A 2WZ1A 3EVWA 2K2PA 3EXCX 4L6V3 3ZZZA 5L1IA 2CNKB 4MKVA 1W2BR 4LT6A 5HP1B 1J5EJ 4USKA 2IIHA 1HBUB 2XULA 2XI3A 2XYHB 4ZP7A 2V8PA 3A13A 4DU8A 5I42B 3PVXA 3K0JA 3CSKA 1HQUB 3W2WB 2MB0B 4BDPA 4LF6J 3FCWA 2JVRA 1IBLJ 1ELOA 1AFIA 2FHKA 1NSQA 2JOQA 1FKPB 1HD1A 2X3GA 3GYNA 1QSLA 4K4VA 1IJEB 1Q1KA 2HURA 1S99A 2WRMA 2YPYA 4F36A 5HBMA 1HHTP 2M3DA 4TXSA 1HNZJ 3G9CA 5HATA 2O67A 4J91A 3VHQA 2Z58B 1Q79A 4OI2A 2HZVA 4B3OA 2YWFA 2IM1A 4OX8A 3PTWA 2UUTA 1RT5A 1JIHA 4RW8B 2ZM6F 2H3EB 1ZA2B 3GFXA 4WWSA 3SBMA 2RJZA 4LF7J 3B54A 3M32B 4USJC 2DXEA 1UZHA 1BY9A 3GJSB 1IR0A 3MOZA 4ZPWR 2RQKA 3UN2A 1UL3A 1XN9A 1WDDA 2RF2B 2CPEA 3IFEA 4I64A 5D3GA 3N79A 3PM9A 3UR3C 2IC3B 2Z2MA 4CH7A 2DRBA 3EDQB 1OY9A 4BHQA 4J9LA 1NSAA 1KLNA 3RZAA 3J7AN 4X62J 5I4MA 4A4JA 3G87A 3PFEA 4DFJA 1QDUB 1Q5YA 1YJTA 4J9RA 1TKXB 4DLGA 5JMNA 2FJEB 3I32A 2HAIA 4WIIA 4YDXA 2CXEA 5J1EB 2RDIA 1X8DA 2K1RB 1H7WA 1BGXT 3SSSA 4JV1A 4YB1P 5AXNA 3UCZP 2F8HA 2DR5A 1UETA 4ZA1A 1IKYB 3V4MA 3ENAA 3K58A 5D4NA 5SUHA 1NKEA 1N5TA 1T9UA 5GMDA 2LA4A 2W4PA 3KMQA 5CH7B 4ANEA 3G82B 2AJQA 2EG2A 4J9SA 1DTQA 4WP8A 1KWMA 3MR6A 2LCWA 2YQ0A 4LRFA 1CJKB 5AXMA 1TL5A 2AU0A 1C2PA 3RBZA 3DRPB 5DGBA 2FZKB 2VBYA 4DFPA 3M2VB 4ZCMA 1K8AT 1TFYA 1DHMA 2CPZA 4DV1J 3T1YJ 2VA3A 3W2WA 3OTDA 1SUQB 3N6MA 2XGQA 1MROA 5CZXA 3AY0A 1PILA 2EFGA 1U8SA 2BJ8A 2A1BA 2YNGA 3PO5A 3CEDA 1PO6A 1SL1A 1KHVA 2IA6A 1TUWA 4YR2A 2YY3A 3O3LA 4OJHA 4EYIB 1MSWD 2C3UA 5KT6A 3QFHA 4ANDA 3RR8A 1NH7A 2MSTA 1Q8LA 3HLUA 4ECSA 3N9UC 3BQ0A 2WVFA 3GB0A 3QGHA 1H38A 5EWGA 2OJ3A 3TX8A 2N4DA 2J6TA 3FRYA 4IQMA 3UN5A 4DV6J 2HYIB 1FJGJ 3H0PA 4NCGA 3L7OA 3DI6B 1FX4A 2BJDA 4IKAA 2QFIA 3D1QA 2PN6A 4FNHA 4N41A 3JS9A 2R7UA 1QAYA 1SB6A 3EZUA 3JXOA 3OHBA 3NGUA 3H8YA 2V94A 1RTJB 2F4VF 1HW8A 5GAGI 4YB5A 1YZ6A 3TAMA 4A8YA 2M8HA 4U96A 2E5JA 3DRRB 1KQSR 2UV8A 3ZC4A 3RAMA 4A8WA 4DHVA 2JLFA 4DX5A 2V63A 1DURA 5DM6Q 2H9ZA 3FFIA 1GXTA 3HCXA 4DR2J 5F8GA 2XZDB 3BGRB 4O4GA 2KM8B 3ELHA 1SH0A 1TUVA 2MZ1A 2RSQA 2DISA 3C6UA 1FI4A 5E3AA 3CVKA 2YNIA 2C2NA 3I0SB 4HYKA 1FVQA 3PXGa 5D15A 1KD1T 4DUZJ 3OJUA 4NCBA 3QIPB 4IH7A 3OT9A 4ZCLA 2VICA 2MHNA 2W2OP 3UNGC 4KY3A 1VK8A 2VG7A 4DFKA 2X7IA 1DBDA 2BJ7A 4OYOA 4LFAJ 4QPXA 1NAQA 3OFHA 4FPRA 4NXNF 3QSIA 3HJVA 2Y1RI 4HKQA 4OHVA 1N88A 3THTA 3PX0A 3QIPA 2HNZA 4I7FA 3KJVB 1CLFA 3NEKA 2NS1B 1KQKA 2D69A 2PEHA 5HLFB 2FVQA 3HD1A 4YEAA 2XSJB 3ISND 1XNQJ 1FESA 2IJNA 4J7CA 3C2PA 1XNRJ 5HK4A 1YVFA 1H3DA 2GVDB 1UA1A 4F3QA 3CJ8A 3KK3A 2AGOA 1U4BA 4F4XA 2HHWA 1AYEA 4CO1A 3PR5B 1S1VA 4CLKA 4H4MB 3BSNA 1IBMJ 2KT2A 4OIXA 3HX9A 2BQ3A 1GMWA 5J2QB 1XMQJ 4LF4F 2HHXA 3T9ZA 5J2MB 4Q0BB 2XMMA 5BR8F 1TTHB 2W2QP 1PJ5A 3MM8B 2RRAA 2B4PA 1BQMA 1HBOB 2V4JB 1FTCA 4IDKB 4AXIA 1G2EA 3D1OA 5G4DA 2BZ2A 3NXZA 2N82B 5DG8A 3PJ9A 4IFVB 4NLXA 1OS5A 1WJ9A 2RHQB 2HQDA 3D1HA 5BJRA 3MM8A 1UKUA 2C2DA 5A6PA 1SKWA 1IBKF 3GONA 2V69A 2PMWA 3FMBA 2HIQA 3GFHA 5C5JA 1U8WA 2VC1A 4HI2A 5H1SV 4B9SA 4O4RA 2L9NA 3IS9A 4ELUA 2J9DE 3CJRA 5BR8J 3P8BB 2ZH8A 4EGLA 5AE3A 1H72C 1OYDA 2AQ4A 2YKMB 1U48A 2ZEJA 3RW7A 1JJ2R 1B64A 3TA0A 3AD8C 2OFGX 2XZWA 1RKJA 2I2YA 2QL5B 1S1UB 3VCDA 3ZO7A 3OUYB 1TK0A 1IBKJ 3K8VA 4N77A 4JI7F 3R7NB 2JVOA 3DFEA 4LFCF 3FDSA 3SCKE 5L9NA 4FYXB 1NH8A 3PNIA 4IOBA 1FRHA 4CM2A 3G6VA 3D0GE 3V6DA 4RUHA 5IZHA 4KGVB 1RAGB 2D9OA 2G13A 4K8RA 2VUGA 3KK1B 1KDNA 2HNDA 2WCXA 1C0UA 5ETLA 3OW2R 1VHFA 1SJFA 5HANA 2D3UA 3GFZA 4XO0A 5HVFA 3JSYA 1VQYA 1MNEA 4J9NA 2DGSA 3H2UB 3CCZA 5A2QY 1FX2A 4K5SA 4KR0B 4CYUB 2Q66A 3H59A 2XMVA 3H98A 1OPZA 3SZ2A 1VIOA 5DDQC 3PIOQ 4X4OA 1CQNA 3FJ2A 3NWRA 1DY3A 4JI3J 1B0PA 3F56A 3ZNUA 1L3KA 4C11A 2AX0A 4Q45A 4PXEA 2KM8C 3MXHP 1S59A 4B9NA 4NYZA 1TELA 2ABYA 4HI1A 2IPOB 5HROB 4RU2A 4ZS6A 2OKQA 2OEJA 2EKNA 3WC2A 1ZAVA 1N32F 3D54A 4F8RA 2ATCB 4OV1A 4ZPVR 2RHSB 5B0FA 1TV6A 5L46A 1RTHA 3CE8A 4CH1A 1ACMB 1JQGA 3NCPA 2B6AB 1MN7A 2G2YA 3CDBA 3FKBA 2HVEA 4QWBA 2ADCA 1TP7A 1IUJA 1C0TA 1IKWB 3PYFA 4OZ3A 1N8RT 5M2RA 4IQXA 2UZAA 3N4WA 3UCGA 3KHHA 3MMAB 3K57A 5A8KA 4ZJQA 2AGQA 4CO2A 2DIUA 3MDFA 3WX4A 1RT7A 4ZVTB 1CJVB 2OHDA 3EICA 1TFWA 1RWNB 4TYAA 2RT3A 2E5GA 4ZJOA 2EFOA 4I2PB 1FKPA 2VPYB 1HWKA 3CMES 3D5MA 1BWEA 3G8SA 4YOEA 1V3ZA 3VV2B 4EO8A 1RT4B 3RAQA 4IOAQ 3ENVA 4WTYA 4UY85 4JI5F 1QJHA 1L3UA 4O3PA 1IKYA 1NZ8A 4ZLNA 1C0TB 1NDLA 2VD3A 5IT9U 3TX0A 3ILOA 1JK9B 2IA0A 3E8OA 2DJWA 3IMQJ 1QSYA 4YN3B 3AOBA 1U6FA 2VONA 1QAXA 1U7LA 4DBQA 2DPIA 2LYVA 1NDPA 1HHSA 1LW2B 4X65J 3ILIA 4MMOA 3W5YA 4ZVEA 3CUNA 2P9EA 5L1LA 1RTDA 4KV8B 3VWSA 3U27A 1IWAA 4DJBA 1VQ6S 3TQEA 7FDRA 3PW5A 2WVEA 4NXMJ 2VB6A 2PSZA 3U1MA 4K4WA 2J8AA 4MKBA 5CZVA 4ECVA 4X2BA 2WBMA 4WYWA 2GAHC 2ACMA 3HSDA 3IWXA 5A0YA 3OL6A 1NBEB 1PCAA 2QRRA 4MH8A 1U24A 4DR7J 2IM2A 2XWXA 2I9SA 1A7GE 4DV0F 4ZP6A 2FPHX 3FBFA 1FEHA 5HROA 1Y5NB 3DU6A 3OFEA 3LH2S 2LU1A 2VG7B 3AB2B 4MFBB 3QATA 4OI6A 3V6HA 2OTJS 1TK8A 4PG5A 2W7OA 2C3PA 4FBTA 4C2MA 2LQ9A 2ROEA 5HVGA 5D8HB 1RKIA 1VQ4S 1I6JA 2ROGA 2ZDPA 2OPSA 2IRXA 2Z2ZA 3S6EA 2CKWA 2VG6A 3MPYA 4DLEA 2FJXA 3M2VA 4F4YA 4AL7A 2GJ2A 2BDPA 3MZIA 1M90T 3P4UB 3KLVA 2W25A 1HARA 3K5PA 1YDLA 2PGCA 3PRDA 2XYGB 4HACA 4RW7B 4L72B 5AJ3J 4I2PA 5T14A 3OJSA 3UFCX 1TQLA 1R27B 2L3MA 2UVRA 2FJDB 2NXJA 5L8RC 4LF5J 2VKRA 4FF4A 2XEXA 4OYWA 2NR0A 1UA0A 1UVMA 3DM2A 1IVZA 2DNGA 2XHCA 4ZVHA 4DDFA 5KFPA 3AX5A 2C22A 1FFSB 2YX7A 4JOUA 3N5BA 4ALZA 5KOWA 1HWJA 1Q8KA 2YKQA 3CJTA 3OR1A 4RBVA 3TR5A 3G6YA 1QTMA 4YR0A 4NOHA 3PY8A 2QZ8A 3UVJA 2BACA 5HQMA 3TI0A 3MM9B 1ZM3A 2FZCB 3KDOA 1EETB 3IS9B 1JWWA 5K14B 4P2MA 3DXBA 4X62F 2XLIA 1N5QA 5CHCB 5EN1A 3OR1B 3B82A 5MLCV 3LW5C 5BYSA 2GA7A 2OUGA 1WEXA 1Q95G 1RWPB 2P9CA 3EDRB 4RBTA 4NI2A 3U1LA 1I1GA 4YB6A 4B3TJ 2R7RA 3I5AA 3I56S 2YQ3A 1P9YA 2MLZA 2ZKTA 2DHGA 3H5SA 3VGTA 2F5GA 2J0SD 3C15A 3ZXWA 3AWRA 1LQ9A 5KFJA 2YWGA 3DDKA 2V2QA 2UUBJ 3F73A 1YHQS 2MZQA 4RW9B 2NSBA 1S6PA 4RZRA 3JSRA 1C1BA 1I5OB 4DL3A 1SC4B 2WW4A 1REVA 3BH7B 3JTOA 5KFGA 1SBRA 2B8PA 2C2RA 1WKLA 4EU0A 1PC4A 4RL1A 1RWUA 2D7SA 2G0IA 4CNZA 3O2IA 2VJVA 5DG9A 2IVFB 4B3RJ 3H42A 3HFKA 2CQBA 2HSEB 3VAFA 3M1VB 4ZPDA 5DETA 4AL6A 1YBTA 2HRUA 4IFVA 1GNKA 2WTFA 2W24A 2DKOB 3DMJB 2YBVA 4OI4A 2WB1D 3CCQS 2NXEA 2UUAJ 5HLFA 2C3YA 2AKWB 2D74B 4O4GB 3UNYA 4ZMMA 1SV5B 3WQPA 4C48A 2V9WA 4CCHA 4ED6A 3H5XA 2R2UA 1FDAA 2KVQE 1XTZA 4KAIA 4MK7A 2GHWA 3S01A 2E9RX 2CQPA 1ZOTA 3QGIA 1KQFB 3GJQB 2CQDA 1U47A 4DPTA 4RNOA 3EVOA 1JKHB 3R5AA 2QMXA 1QUPA 3FGVA 4C3MA 4WFXA 4Z37A 1GX6A 4XDDA 2XY6A 4MIWA 2VODA 4TKTA 1NCLA 2BRKA 1F5AA 2OPRB 1YSJA 4ITSA 2ZH4A 4JI1J 1VBXA 4UQGA 3MR5A 3A8KA 1CJUA 3MD1A 2W8LA 1Q78A 3GG0A 2W9BB 3CULA 1IBCB 3N01A 2KKHA 2F4VJ 1K1SA 1SIWB 1Y0HA 2AJ4A 3SDEA 4J9QA 1VBYA 5J1PA 4NLOA 2FHJD 2V0NA 2E5HA 5D3GB 1X4AA 1W2IA 3MM6B 5IC4B 3FQLA 3D6FB 4NA1A 1V6HA 1DLOA 2DGOA 3AXMA 3LAMA 1KQGB 1S1WA 3SCLE 3SEOA 2L41A 5H9EK 1MU2A 2E66A 1YJUA 1WC4A 4NLUA 2HGNA 1EAYC 2RILA 1RT2A 3CD0A 2ZH9A 4HDHA 1K0TA 3CJ3A 3EVMA 2MY7A 3A1YG 5LSRA 2GVZA 3GIKA 2DNQA 4ZOSA 2ZUGA 4N7TA 1WC3A 3EZ5A 3SI8A 3X3UA 1NUEA 1HNVA 3GILA 4ILLA 1RWXB 2BV3A 2W2PP 4FYDA 2DNOA 1FRLA 1UWBA 2B4UA 1YBAA 4QIGA 3NP5A 3ENQA 2R9LA 2M5YA 5KFAA 1N5SA 2Y8WA 1K44A 5FLXY 2I6WA 1PYTA 1Y4ZB 2KDOA 1HQUA 4RLEA 5DG7A 4WTOB 3S8SA 4QCLA 3IP0A 4WIQA 5CYMB 3H4BA 2EVZA 9RUBA 2A2CA 2VQFJ 4NI2B 3OTBA 1S76D 2HPUA 1XNQF 3OR2A 4C3LA 3M8YA 5GAHI 2XS5A 2RRBA 3KG1A 3CCJS 4O44A 1FNXH 1IJFB 4TY9A 3MUTP 3MR3A 2AW0A 3UI3A 1WI6A 1VYAA 1URNA 4IUFA 2IBOA 1EJ7L 1VDHA 2PI4A 2BYCA 2JJ4D 2RB7A 1RSCA 4DV1F 3T1YF 4ILMA 1B7YB 3G82A 4IRKA 1RT3B 2CPXA 2DNKA 2BM0A 2V9KA 2WONA 3M6UA 3MEGA 4FYWB 1OSCA 4O3QA 4JI6F 4QR1A 5CYMA 1K73T 1WNEA 4UOFA 3BF4A 1FK9B 1N6QB 4CRJA 1TKTB 2OPSB 5I3QA 2E1RA 2NYHA 5K20B 3KLHA 1U6ZA 3C16A 3PEHA 2JEIA 1PIEA 4DS5A 1QY7A 2E7VA 5K8PA 1AW0A 4OX9F 2VDHA 2N3LA 2MDAA 3RU0A 2CRLA 2QN6B 4XK8C 5JVHQ 2X1FA 2MLXA 1SVDA 3OPKA 1FERA 1DQAA 2GQCA 1BE4A 1T9YA 3FUYA 4DF8A 3R8YA 4PQUB 2CQGA 4PWWA 3PW2A 2WVDA 3VGVA 4LF9J 3TEGA 1FDBA 1H6KX 1T9WA 4V19J 3OLBA 2W9CB 3W5ZA 4GO5X 4J90A 3VZHA 5HQLA 5CYQA 2V4QA 4E0DA 4M5GA 2HBQB 4DR3J 1YRTA 1XC9A 3NS7B 2VFRA 3ZZTA 3H25A 3RR7A 3GP9A 3PIPQ 2DY9A 2VA2A 3J7A1 3W61A 2NXCA 1ZM9A 2ERRA 3PHTA 2AF6A 4MFBA 4PYAA 1NPPA 4OYMA 2OP5A 3RJMB 2HLUA 4LF9F 1H0HB 4NCAA 4JYAJ 4JV5F 2FLOA 4KB7A 2ZH7A 2MQNA 3KTQA 1TR0A 1EARA 1F5BA 1FKOA 1RHMB 3I87A 5KT4A 2E5IA 1ZYQA 3I9ZA 1NB2A 2IJRA 3KUEA 5KFQA 5HMYA 3DGPB 2RIJA 4TYBA 2BA9A 3TJ9A 3ET6B 4CO0A 3GE9A 3QBCA 1UAWA 2RUGA 1C4AA 4G1IA 4RX6A 4ED1A 3DRSA 2EFNA 2ZD1B 4MKAA 1C1BB 1B0TA 2IC3A 1F3FA 5C24B 2DVIA 2IY5B 4G1PA 5IM0A 4JYAF 2EK1A 3KOAA 1NLKL 2WVCA 3IBWA 3WHIA 3MFIA 4IG0B 2OTLS 1S1TA 3FVYA 3WC0A 8ATCB 5E3RA 2OO4A 3M05A 4AT1B 4LSLA 5KG6A 3D3CJ 1VC0A 5EGYA 1GK8A 1WTFA 1X9WA 1VLOA 1KP6A 3W1YC 2ZH1A 3HT0A 2XMJA 2DGWA 5ETVA 4YMEA 2DGUA 2HNZB 4I7FB 4XPEA 3KJVA 3AOCA 5J1NA 3R5CA 1VLYA 5KG3A 5KTQA 5LSLA 1ZM2A 2C3OA 2ZITA 4TQSA 1YJ9S 1HI0P 1RAAB 4UQTA 5J2PA 1EQ0A 4EO6A 5LL6d 2YX4A 1UP1A 2MZSA 1S9EA 4ID5A 5EUHA 4O3NA 3UDCA 3FEXB 2DHXA 4U95A 2H5EA 2QE5A 3OQ2A 5KFOA 2HFNA 4K2JA 3KK3B 2OLWA 1FJ7A 4RNNA 1HPZB 3GG1A 4ECRA 5CD4H 1IXKA 1CULA 2PT0A 3EJMA 4W92B 4HTJA 1KR4A 1HYSB 1S77D 2HQCA 4U7CA 1KNZA 3L7PA 4KKOA 3MUVP 2HWHA 1P9QC 2OSRA 4X64F 4DV7F 1N34F 3FRZA 2YNHA 2V8GA 3LPEA 3T1HF 2C2OB 1TZ0A 3T5LA 1WF2A 3QGGA 1U1QA 1U0SA 2LKZA 1JJHA 3LTOA 4DV4J 2WK4A 2CG8A 3C66A 1VQOS 3JQKA 4MAKA 4ZVQB 1HW9A 1MLAA 3R6LB 4O3OA 4M63A 4C11B 1S9EB 1S6QA 4GC6A 2N7CA 1VQKS 2BABA 1HWUA 1Q16B 2HHPA 2A18A 3PYGA 4G1QA 4UZCA 2QV6A 3H7HB 4OZ1A 2MGZA 3KLEB 3CIMA 2HGLA 2OGUA 5HJXA 1E6YB 6AT1B 1TK5A 1DQ9A 2CJXB 2RF2A 1XBWA 3RTVA 4KO0A 3PKYA 5ETRA 1JXVA 4DQQA 2A6OA 4IRCA 1R3NA 3HPOA 3WX8A 1FXRA 4NMLA 4DG1A 3QZ7A 2OMOA 1HFEL 1KVKA 3HO1A 2BQUA 1X0PA 4ECYA 1C0UB 1M0SA 3D9BA 3CC2S 3M8PA 1HNWJ 3DXSX 3FCVA 1RWOB 5KFIA 2WSCC 2DH9A 4QYRA 3L09A 3MAAA 4DSIA 2CPJA 2CAJA 5KFMA 2V1TA 3OHAA 1PC5A 1WKKA 2MQ8A 3KXDA 3NL0A 1N5YB 5HL7Q 3AD9C 3R9LA 1UVIA 4KPCA 2E5LF 1WC0A 4NXMF 4XIUA 3CC7S 4C8OA 2MQOA 3CF5Q 3NNAA 4Y65A 4O23A 5MAOA 3FFIB 1UPMB 2XB2D 4LUBA 4O0NA 1SCJB 1OIAA 3GU0A 4FZVA 4OZJA 2H65B 4J9MA 2D1CA 2LP4A 1YK9A 1KVJA 3V5RA 2MJNA 4TY8B 2FVPA 1QLNA 3MWBA 1FTRA 3OL7A 1OM2A 1O0PA 2QL7B 4DMZA 5EWFA 5IS2A 2HBZB 2HLTA 3OVAA 1N32J 2DB1A 2KFZA 4WXOA 1NSKL 1XWLA 4WU2A 1GMVA 1WOPA 2K8GA 3IRXA 2KRBA 1PJ7A 1RWKB 1W25A 4DI6A 1NHVA 4OJGA 5A8RA 1S4EA 3CD7A 3RRHA 4J9UE 2VPWB 5RUBA 1R8AA 3N0VA 1VQMS 2ZOFA 3ZFVA 1CVJA 2WB4A 1ZM4A 1OWXA 4C3KA 1LKZA 1LWFB 2O3DA 2CDQA 4LR7A 3M9OB 2YNFB 3KYLA 1B3TA 2UXBJ 3IWLA 4DX8H 2U1AA 4QIWD 2R2TA 4OL8A 2HKEA 1B70B 4IH5A 1NB7A 3RB6A 3IR6B 2VFSA 2ZHAA 3DOMB 4WF9Q 4X4NA 3ZZRA 3O6QA 3MAQA 2FVRA 1WOOA 4KYZA 5GAGU 3HT3A 3R2CJ 2DH7A 2XZTB 3D6TB 3R7BB 5LSOA 4H54A 4OZ5A 2QLFB 2E1PA 1DAXA 4QW8A 5DQGA 1JLEA 2W9CA 3DOLB 4NASA 3DLBA 3ISZA 3P3DA 2VG6B 4Y2AA 1WUUA 2XYPB 4A8SA 2EG1A 3RGIA 1B7FA 1IKXB 2CQ1A 4IH6A 5KG2A 3QSYB 4WKRA 2DHSA 3DLKB 3W2VB 5C42A 1F0XA 1QAIA 1EQMA 2ILYA 5FD1A 5B0CA 5L1KA 5H9EJ 3FBEA 4F3OA 4DCOB 1TVRA 3QPIA 5J2PB 3KUHA 3M8PB 2DO4A 1RDRA 3ISNC 1UJ4A 3CCUS 3TA2A 4WE1B 3K5LA 1D8YA 2VF3A 2CQCA 2VPXB 1SJRA 3OXFA 3THPA 2W7AA 2IRYA 4R5PA 2XY5A 3P49B 3NMAA 1RTIB 1LWEA 2Q6CA 5EX3A 4U6PA 1N6QA 2J9EA 2BBEA 4BWMA 4CIOA 5CXTA 2B4VA 1J27A 2I5JB 3CCMS 1X5TA 4CLYA 2ZZMA 1LOUA 2MSSA 1NK0A 2I1RA 1PAUB 4DCJB 2FHOB 2XS2A 1B99A 4IG0A 2HVDA 4Z7CA 3Q8QB 2HS3A 2BANB 4DR2F 1S72S 3M2UB 4U67Q 1GT8A 3UPFA 2B3TB 3SFGA 3H5YA 3DRRA 1SI9A 2B9EA 3UVJB 2NCKL 1KONA 5GMEA 3T9NA 1R8BA 1IKVB 1JLBA 2YTCA 2MKJA 4OHZA 3SQGB 3GIIA 1F2HA 8RUCA 1U1NA 1S0NA 4KQZA 3HVWA 3OVBA 3TYTA 2AJ2A 4WCEQ 3N5FA 4M94A 2N3OA 4KSEB 3EPGA 2RUSA 4YUDA 4DWIA 3MM5B 2R4FA 1CEZA 2Q79A 3LALA 3ZZPA 3SIPB 1RA6A 1H73A 1M5HA 2IFXA 3K89A 3PEJA 4ED5A 2OEMA 1NPRA 1ICEB 1WF1A 3TW0A 2RNEA 3PJXA 3CCES 3AH6A 2YKMA 3DC2A 3OXLA 2DY1A 1R6VA 2ZKUA 4YHHJ 3HHLA 1SIZA 1BUXA 1NMEB 3LPYA 1U0HB 2MQLA 3G6XA 3SYZA 2R7QA 4AL5A 3KLGA 2HHSA 1YJVA 2AYGA 4HR2A 3QIDA 3L95X 3QQCD 4I69A 4R0JA 2ZBPA 1RLCL 3BS9A 3CTRA 4RO0A 2A3JA 3QJLA 2MZTA 4FYYB 4PPDA 4QJVA 1WORA 1XR5A 1Z1ZA 2B9XA 1TL3A 4KHRA 1YGYA 4RJVA 4EZ6A 2DRDA 2F9JA 4L3NA 3AXKA 1RK8A 3H40A 3VGSA 1YITS 1N36F 4KGKA 3N28A 1UVJA 1S79A 5E33A 5ETPA 4FP9A 1E6YA 3UO0A 5KT3A 2VHGA 1KFSA 4JV2A 4PG4A 3W7BA 2BX6A 3DRSB 3SSQA 2PEBA 3MPVA 4ETXA 4LF1A 4YS2A 3P45B 3R1LA 4G65A 1HBMB 1S6QB 2VFUA 1IKXA 4ZVGA 5B09A 2XMUA 4KJIA 4YFUA 3MMCA 3IG1A 5C2CA 1G1XA 1RYRA 3CO9A 3D6HB 1X4CA 5D4LA 2CQIA 3F0NA 4IR9A 1TL1B 2LQJA 4F4AA 2OIHA 2ZVIA 4R8UB 4ED3A 1N36J 5ETOA 3HHDA 2CJQA 4ES3A 4QPTA 4ZK7M 4YHHF 1WHXA 5F8IA 1VISA 2XSFA 4CLLA 4F7VA 3CDWA 2VQFF 3DLHA 3HVTB 4NLRA 2R3VA 5A8WA 3AA8A 3QWUA 3TRGA 3HDSA 1Q5VA 3OSNA 2LU2A 4X4UA 3QT5A 4OLPA 4CP5A 4M5KA 5ADZA 1B4SA 1LW2A 3LWLA 1DZ5A 4JI0F 3E01A 3HVTA 3MECB 1NSPA 4PG7A 3MR2A 5LMUJ 4KBIA 3W9JA 4RNFA 1RAEB 1KS2A 3QZ8A 3KLHB 1HR0J 2R7VA 3DDIA 5D77A 2CVEA 4GVLA 5T41A 3CCRS 2LEBA 3CDUA 2Y0BB 5T7LB 2I38A 5AXKA 5KFTA 4M1KA 5A0YB 2B51A 4DQSA 4XTTA 1WEZA 4K2XA 1N33J 2ZE2B 3GPAA 5CAAA 2FZGB 3H4DA 4NLYA 3H5UA 3RAXA 2Y9HA 2HWTA 3NCRA 4YP3A 4ILRA 2ZC3A 4R25A 1MN9A 2ASJA 1J5OA 3MTKA 2HFUA 4Q7AA 2DIVA 1M5VC 1FFWB 1RU2A 1HNVB 1YX2A 1A6LA 3NGKA 3GJTB 1V5IB 1RCXB 2XY7A 1LWFA 2KB2A 2EC0A 5CABA 2A6MA 4LIRA 5IV3A 3PW7A 4KGXB 2M70A 3I0SA 2VU5A 3BGOP 4F0HA 1TL3B 2DNRA 3AQPA 4WFNQ 5F41A 3IAS9 1VMBA 4Y6IA 3Q8PB 2PMHA 4ANCA 3AX3A 4N8NA 3V81B 3G8TA 1X9SA 1MROB 3A3NB 3TA1A 3GIMA 1TAQA 4IG3A 2KJVA 5F8HA 4Z2XA 4K59A 4RU9A 3NNHA 1UTAA 2W1BA 3TUJC 1FWPA 1TL4A 2PC6A 3HM9A 3RBDA 1FT8A 1SH3A 3MAAB 1HNIB 2V67A 1IM4A 3GTYX 1F1BB 3M30A 4M8LA 3Q8UA 2RDJA 2QX0A 5K8OA 5KFFA 2AV5A 4M5JA 3AAWB 3CXCR 3HVRA 1Q7LB 1KN6A 3U02A 2CQ4A 5IFMA 1JLAB 2FTRA 1UMJA 1RT1B 2HFVA 3GSDA 5IV4A 2I8EA 5DQIA 1RWWB 1T95A 4C97A 4F26A 4BLGA 4AQYF 1CS4A 4GMKA 3BM7A 4YY3J 3OLAA 2WHOA 1X7VA 2DNYA 2QLBB 4FKYA 4DR3F 1JNRB 1UFWA 3Q89A 3D6MB 3WDOA 3IA0A 3ETOA 1U1LA 1I94J 3W9IA 3GV5B 1FKAF 4JP8A 4TU8A 1HNXJ 2AHOB 4QW9A 4QBUA 1S0MA 4NRUA 1RWMB 1APSA 2W01A 2YKOA 4DSLA 3DHWC 2QLXA 2OSQA 7AT1B 1N56A 1FRKA 2HQGA 4ZPTR 1HMVB 2W2NP 4GC7A 4RBUA 1CS4B 1X4DA 1WC6A 1RAIB 1YWXA 3QWPA 3CC4S 1C1CA 1S9GB 2DK2A 1OQ6A 2BKOA 3GR0A 4ZJLA 2M52A 3MF5A 4DR1J 3CJSA 3HHLD 3HD2A 3O5TB 3W8GA 4E2FB 4I68A 3G4SS 3BH6B 2MPUA 4DPXA 1BQNA 2KXFA 2EK6A 2VG5A 4KGMA 4F67A 1JNZB 3DLLQ 4ZVPB 4EMDA 3GYGA 3PW0A 1U1MA 4LVOP 2ZUAA 4ED8A 4B9MA 1ITPA 2ROPA 2HRTA 1DARA 1U02A 2J7WA 2FHMA 4O44B 2BEFA 4FVCA 3BO2A 2YWEA 4AQYJ 5L9XA 5F3ZA 5DDPC 2FLLA 2KXHA 4X66F 1FRXA 1RBAA 2KRRA 1FDNA 2Q1LA 4OYPA 4RNMA 4XDCA 2Q6BA 4F0MA 2HW3A 1HBUA 5A8RB 1DJ0A 2B43A 1WSRA 3C14A 3MCMA 4OX9J 3JTPA 5A6WA 1VQNS 1I94F 3TUPA 2D9PA 5ETNA 2R8IA 1ZAXA 4P2XA 2WVBA 3B78A 1U26A 4OZ2A 4Y3CA 1H98A 3KNGA 3LF0A 2GJIA 2LLZA 4H4MA 4DU7A 4IR1A 4Y2CA 1RAOA 2HGMA 3CDAA 3UW1A 3ITHB 4A8QA 4YDDB 2RS2A 1RT7B 2V8DA 2BJ1A 2G1DA 2E7XA 2IHR1 4PKDB 4ES2A 4ECTA 3VVTA 3OUYA 5DGAA 1O6XA 2UUCJ 3E2EA 1FRIA 2LXIA 2YPZA 4NLSA 4LQ3A 1BC6A 3FSXA 1ZZFA 2GGPB 2B56A 2J5AA 1U2FA 5C2GA 1YI2S 1ZAWA 4LVNP 3D67A 1RGVA 4DL2A 4ID8A 3Q8YA 1M5KC 1D0EA 3B6BA 2P6TA 2YWHA 5D4OA 1N5YA 5B0AA 3GIRA 2IM0A 3AD7C 2DR6A 2KT5A 5IT9Y 3SQOP 1QM9A 1L5UA 2C2KB 4O0IA 1EHWA 2JLEA 4DR5J 1YJNS 3EGNA 4DUYJ 2J7UA 1OQ3A 3CJ0A 3R1HA 4ES1A 4X66J 3LP2A 2QEXS 2HS0A 1O8BA 3MEDB 3VF0B 4P73A 5KFKA 1RCOB 2EFQA 3PZPA 2CPDA 1R31A 5GADI 1R0BG 2J6UA 1Y7PA 2K7KA 3NGTA 2AEFA 3VZIA 4C0BA 2QSFA 5HMXA 3HXMA 3TARA 5E3CA 1T8EA 4ED7A 1S4FA 2HHQA 1WHYA 1BQNB 2HZCA 4UF4A 3DRPA 3AODA 2AZ1A 2XZ2A 4RR5A 4V1Ak 2GHPA 5ETKA 3J7YU 2HFSA 1F9EB 1Y5LB 2VDIA 3UE2A 2XM3A 4USTA 4L74A 1PYOB 2GNKA 2GVDA 2XMKA 3EM1A 4DQIA 3UQSA 2VQEJ 3HULA 1IKWA 5F3TA 2CNLB 1NJXA 4F04B 3C6UB 2MY8A 3DRYA 2N7YA 3W66A 4P7VA 4HDGA 3E3XA 4Z7YA 3QO9B 4AUKA 4TU7A 4LFCJ 5GMKa 4N76A 3IO1A 3MHYA 2ZJPQ 4KRWA 4K4SA 3C8YA 3EGVA 3OL9A 1LXNA 1NU4A 1RB0A 1VOMA 2QJ3A 2WOMA 4MTPA 3W5XA 4TN2A 1P1TA 1JKHA 2KHDA 3LQVA 1AUDA 2PA8D 1AFJA 3ITHA 4Q8EA 4F4ZA 1HBNA 2HWIA 2Y8YA 4LBIA 4X65F 2RS8A 3M4XA 4M5LA 3LANA 4ZCKA 2CZ4A 4CWBA 1ROFA 2AGPA 4RW7A 2CNNB 5GADU 1UEUA 4LJMA 1NJWA 2FHJA 5E2QA 4NA3A 4B08A 1GX5A 1VRQC 2QC3A 2RQ4A 3FC9A 5D0GA 5DDRC 3GIJA 1S10A 4R8UA 4DV7J 4X64J 3E51A 3DMJA 1O5JA 1N34J 1FWLA 5DZ6A 1KLMB 2MKSA 3HHEA 2HMIA 5GAEU 4UTGA 4TVAB 2G2ZA 2QYGA 1UWBB 1YJ7A 4JI4J 1AZSB 3P5TL 3QJJA 2XLKA 1YBUA 5HQ8A 1XQIA 2P6SA 1XERA 4LFAF 2LECA 3D0HE 3JQMA 3MEKA 1SKUB 2LDIA 3K17A 2XO6A 4ER8A 3FZ2A 4OYXA 2DR9A 2B9WA 1M1HA 1X4HA 2OAUA 3BGFA 3HHLB 4CLUA 1KEKA 2WAQD 2L08A 2XTJP 3KK2A 3VGUA 5T7LA 2DYAA 3BBFA 2E9TA 2HZAA 5IOLA 2DXFA 4B9VA 3DLEA 1GMWD 1T3NA 4BC7A 3G71S 3WZ0A 4U8VA 3R6GB 3IRWP 4IFYA 1UVKA 2GX8A 4GKJJ 3K2YA 1IBMF 1T03B 2VBWA 2IJFA 2ZFHA 2QA1A 3KLFB 2OD6A 1E6VB 4KH1B
chains in the Genus database with same CATH topology
2V8HA 2PE8A 2FLNA 5A8WB 1RI7A 5IXUA 2YKAA 1FJEB 2L48A 3RB4A 3EGWB 1VS3A 2FC9A 4WFAQ 2KFYA 1VQ5S 4BS2A 4OX6A 3P6YC 4G3IA 4N56A 4QWDA 4C4WA 4B9UA 4I6WA 2XS7A 1NJZA 5HI7A 1VRUB 4K4YA 5DS7A 4TQRA 4FXDA 4QU7A 4JI4F 4C8LA 4P7TA 1VC6A 4ECUA 1P8GA 3EPIA 4ECZA 2FD2A 3J81Y 2JLGA 4ECWA 4PQUA 3CJ2A 2LXUA 4DL7A 2HVZA 3OL8A 3UDLA 1YTYA 3BDEA 2ZC4A 3ZZOA 5AXLA 4KE5A 1CQMA 2ALZA 3T6BA 4OFZA 3OTOF 1GH8A 1F9FA 3BO3A 2CYYA 2A2DA 2HS4A 3UD3P 3JB9k 2V2KA 3V6KA 1F5CA 4K4ZA 1U1KA 1JLFB 3LO3A 2F8MA 3MCSA 1JB0C 1LWEB 4Q0BA 1RT6A 2MMYA 2RH3A 5KT5A 1JXLA 4C98A 2LXFA 4A8OA 4PPZA 4LF6F 3DYAA 2FUG9 4C8ZA 1Q8BA 1RYSA 2DO0A 4DV5F 3BZQA 1OPIA 1U1PA 5D78A 1LFWA 2UU9F 4ZPAA 4QIVA 4MYUA 4CT8A 3DGPA 2E9ZA 4KIAA 4EUVA 3MM5A 1CPZA 4RW8A 4WK1A 5HP1A 5CYJA 2YKNB 2DNPA 2ZBIA 1X4FA 4JI3F 3KLIB 1REVB 1PSDA 2VPZB 5KT2A 1QE1A 3IGVA 3DN9A 3MECA 4KFBA 4F2RA 2XTEA 2QLWA 2BE2A 2DGXA 5KG5A 3BJYA 4Y2KA 4NRTA 2R7WA 1GAOA 1HBNB 3KLIA 4IFYB 4QR0A 2FGOA 1FEEA 4ZVFA 3MPWA 2R7TA 4ZP8A 4KFBB 5CCMA 2YNGB 1RJJA 2PMZD 4NYPA 5JUMA 2JL9A 4AFFA 1HR0F 5CYQB 2RKIA 4UY8T 3Q22A 4RW4B 1ZPVA 2W8KA 2IAJB 4WE1A 2Y0SD 4FVMA 2ZH6A 5KFZA 3CIZA 1FCAA 1DFDA 4D3GA 2AX1A 1XR7A 2JEFA 1A9NB 3LGNA 4I6AA 2DITA 2P5VA 5EDWA 2FJBB 4Y2MA 1HWLA 3U7JA 3LP1B 1IN0A 3R5BA 4WXWA 4YB7A 1F2GA 4PXDA 1KFDA 1P1LA 1Y3KA 1XMBA 2K7JA 1WELA 3BEGB 3IR7B 4UUWA 4JI2F 1D9FA 4QU6A 4USHA 1VQ7S 1NK5A 2CPYA 3KHRA 4J9PA 3QO9A 2K1RA 2M4MA 3VALA 2RVJA 2UUBF 3VTIA 1U1RA 1FO1A 2Q43A 5AE2A 5KG0A 2CJKA 4FBUA 1X0FA 2F3JA 5C25B 1ZTTA 4KT0C 3FZBA 2MKHA 3TOQA 2JRSA 4B3RF 4NLDA 2Z0GA 4UOCA 3CB4A 1VQLS 2ATLA 3TP2A 3T5JA 1NNDA 3PO4A 2VFVA 2B7CB 4M95A 3HZGA 1FJGF 5HN0A 1VGYA 2XWYA 4CT9A 1DQ8A 4NWBA 3L3CA 2NZ4A 4A8XA 4QYZJ 1LXJA 1VJWA 1MMLA 1K9MT 2W4DA 2AYEA 1MW7A 2HG4A 4JBCA 3KKFA 4ZCIA 1IKVA 3SQGA 2UVWA 4CQ1A 3T5KA 3BSCA 2XG8A 2QSWA 3TAMB 2QA4G 4PUOA 2XBPA 2J0WA