4NLTA

Poliovirus polymerase - s291p loop mutant
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
461
structure length
457
Chain Sequence
GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGPGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
total genus 135
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nltA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nltA02
3MR5A 3MEGA 1TQLA 4DEZA 1RT2B 1C1BB 4ZVFA 3PR4A 1HYSA 2QE5A 1TKXB 3M9MB 1MMLA 2BANB 4LQ3A 4IRDA 4QPXA 3UQSA 1BQNA 2YNGB 3QO9A 4MK7A 3RAQA 4ZPCA 5KT3A 5C42A 2R8JA 3DRRA 5KT4A 4RNHA 2E9RX 3CWJA 3NAHA 3OHBA 1LWCB 3D5MA 3JYTB 5KFDA 2VA3A 4R8UB 1BQMB 4ECQA 1KHVA 3N6MA 4K4ZA 1TKTB 4RW9A 5KG1A 1RT3A 2XI3A 1GX5A 4O4GB 4J9MA 2XGPA 3T5JA 4PQUB 3H2LA 2HNZA 2D3UA 2E9TA 4ZVEA 1LWEB 4WXOA 2AGQA 2AX1A 3KLGB 3H40A 4DL5A 3QYYA 2C2EA 4RU9A 5F8HA 2HNYA 2VG7B 3JYTA 2UUTA 1RYSA 1LW2A 5F8LA 2ZE2B 1S1VB 2OPPB 3LP1A 1TKTA 4I7FA 4QWAA 5L1IA 2FJVA 2AWZA 2GIRA 2R8HA 2FVSA 3CJ2A 2IBKA 4FS2A 4ZPBA 3MTKA 4DL4A 2C2DA 4YR0A 3KK3B 1OS5A 2IC3A 2VG5B 5KFNA 3KLGA 4ZP6A 2BRKA 2R8IA 3CDEA 1R0AB 3LP2A 4IFYA 3OL6A 2JEFA 4Q0BB 4TYBA 4DL7A 3QZ7A 1HQUA 4IG3A 3PW7A 4M94A 3BGRA 3MR2A 1SH2A 4IR9A 1QAJA 4KE5A 1S9EA 3BSNA 1RT1A 1Z4UA 3PW0A 3ICLA 3DYAB 5C24B 2B6AB 2AGPA 1D0EA 3TVKA 5HLFB 4RW8B 4NYZA 4QWBA 4DG1B 4XPEA 1RT7B 5J2QA 4ZP9A 2CKWA 5KFYA 2E9ZA 2DPJA 3QZ8A 2YNIB 5KFQA 5J2PA 1JLGA 2ZKUA 3MEDA 4J9RA 4JUZA 3CJ4A 3FRZA 4ED7A 3C6UA 5KG7A 5DLFA 4KFBB 3GIMA 4GC6A 2J6TA 3DRSB 1FKOB 5C24A 5KFAA 3C6TB 4RZRA 2XC9A 4YR3A 4NLWA 4J9SA 5HP1B 4TXSA 4NLPA 2XCPA 2W9BB 2GIQA 3G6XA 3CO9A 1S1TA 3MECA 5DQHA 2OPQA 5KG5A 3V81A 3KK1A 2RF2A 2V0NA 3LP0A 1JLCA 2HAIA 4RW7B 3HVTB 5KFEA 1T05A 4KHRA 5L1KA 4JV1A 2IAJB 3QLHB 1GX6A 5KG3A 4KHMA 5KFTA 2BR0A 2J6UA 1VRUA 2WOMB 5F9LA 1QE1B 4I2PA 4LSLB 1XR6A 3DOKB 3DOLB 2GC8A 4U7CA 4B3OB 2ILZA 4J9PA 4RNMA 1FK9A 2ZD1A 1DLOB 5J2MB 1S0NA 4ICLA 3NKYA 4RW7A 5KFIA 3MR3A 1IKXB 4QWCA 3GQCA 4WXWA 4ZHRA 3QLHA 4H4OA 5HBMA 3DM2A 3N6NA 4IG0A 3TQ1A 5I3UA 4WFZA 1JX4A 2W9CB 3TAMB 3I5AA 4ZMMA 2DPIA 2IM0A 3EZUA 4O3RA 1KLMA 3LANA 4ZVHA 3MFHA 2JLEA 1HNIB 5J2MA 4ED2A 2ASJA 4ECXA 3V4IA 2IM3A 5KFZA 2FLPA 1S1WB 4K4SA 4RUCA 2VG6B 4URSA 3V6DA 4NLSA 3DLGA 2XI2A 3RB3A 1ZETA 2IJNA 5J2NB 4ED0A 1KHWA 2YKMA 3ITHB 3QIPB 3BSAA 5C5JA 3JSMB 3PW2A 4IFVA 4QWDA 3KLFA 1N6QA 4YMEA 1UWBB 3MEGB 3IN5A 1REVB 5KT5A 1LWFA 3PW4A 1S10A 3IS9A 3GIKA 1NNDA 3RB0A 5DG8A 3Q8QB 4Y2AA 4EBDA 1BQNB 1W25A 3QO9B 5KFOA 4K4YA 2D41A 3V6KA 1S1XA 5C42B 2V4QA 5CYQA 2XGQA 5KFRA 5J2NA 2ASDA 1N48A 1RTDA 3DRRB 4PWDA 1RA7A 5EUHA 5KFCA 3PZPA 1UWBA 1S97A 4K50A 1REVA 3SFGA 4LQ9A 3FDSA 3T19A 2HWHA 1I6JA 3KMSA 4RW9B 3H4DA 1RT3B 4QW8A 3CDWA 2HNZB 1HNVA 3CJ3A 1JLEA 3I5CA 1VRTA 3MEEA 2BE2A 3RBDA 3GILA 1J5OA 5KFVA 1S6PA 4G3IA 5KFKA 1SV5A 2BQUA 3M9OB 3MFIA 2V4RA 3RAXA 4K4UA 2IM1A 2HNYB 3I0SA 1D1UA 2IA6A 4O3SA 3T1AA 3KMQA 1SH3A 3NBPA 3RB6A 1LW2B 3LP1B 4ED8A 4I7FB 3NMAA 4NZ0A 5I42B 4TQRA 4ECVA 4H54A 3OSNA 4KO0B 2R2SA 2C22A 2AQ4A 4ECSA 4ECRA 4ECYA 4NLTA 4PUOA 4ED6A 2IC3B 4Q8FA 1WNEA 4IOBA 4Q45A 3V6JA 2YNHB 1RT6A 1FKPB 3LP2B 4IFYB 5KFHA 1N56A 4NLUA 1HQUB 4IG3B 3BGRB 1QUVA 5I42A 1S9EB 5K14A 4DL3A 1RT1B 3KK2A 1HARA 1N5YA 2C28A 3BQ0A 5EWEA 4KO0A 1TVRA 1JKHA 2YNFA 1JIHA 1SUQA 4ECWA 3UPFA 5JXSA 2CJQA 2W7OA 5J2QB 2YNHA 4KKOA 1FKPA 5KG6A 4NLDA 2W8KA 4NLVA 5J2PB 1JLGB 4I2QA 1IKVA 3MEDB 5KFBA 2OH2A 4ED1A 2WB4A 5KG0A 4ID5A 3C6UB 4TQSA 4IDKA 2ATLA 4WYWA 4IH7A 1S9FA 1JLAA 3PW5A 3DMJB 5DGAA 4RNOA 2BRLA 2RKIB 1MU2A 2JC0A 4RW6A 4TN2A 4YP3A 1HMVA 4ZP7A 1RTIA 3KLEA 1EP4A 1IKWA 1RTHA 1S1TB 2OPQB 3MECB 1RTJA 5FDLA 3FSIA 3KLIA 4WFYA 2RF2B 3LP0B 1JLCB 3KK1B 3V81B 5D3GB 2IMWP 1T05B 3T5LA 1JLQA 1VRUB 3GV8B 2ILYA 1S1UA 1S6QB 3DMJA 4I2PB 4KB7A 4MK8A 4K4WA 2RKIA 2WCXA 4EO8A 2D3ZA 3I0RA 2HWIA 4MIAA 4IQXA 1FK9B 2ZD1B 4MKBA 4K4TA 3PR5B 4ICLB 1DTTA 3M8PA 3HVWA 4ZHRB 3GIIA 4NLGA 4IKAA 3FFIA 3E51A 4H4OB 3BR9A 3DM2B 5HBMB 4XPCA 1TL3A 4IG0B 5I3UB 4NRTA 2W9AA 3KLVA 3DLKA 4O3NA 1RDRA 1LW0B 1NHVA 1S6QA 1TP7A 4HYKA 2WTFA 4K4XA 1KLMB 3SI8A 4KSEB 4F4XA 3IRXA 4WYLA 2RDJA 5F8NA 3E01B 4Q8EA 4WE1A 3M9NB 3EPGA 2OPSA 3Q8RB 2R2UA 1JLBA 3V4IB 4QW9A 1T03A 1RT4A 1YVFA 3V6DB 3DLGB 3KHGA 2HNDA 4XO0A 4EBEA 4NCGA 3Q8PB 4YR2A 4J9LA 2YKMB 4IH6A 1LW0A 1S49A 4RNNA 2XCAA 2ALZA 2WONA 4IFVB 3KLFB 1N6QB 4FS1A 4MIBA 3V6HA 4HKQA 1LWFB 2OPRA 4G1QA 4IRKA 3IS9B 4KV8A 5EWGA 3E01A 3ISND 2R2TA 4ZPAA 1C0TA 4MKAA 4EO6A 5KFXA 1IKYB 5CYMA 5KFSA 1HPZA 4R5PA 4WFXA 1S1XB 5CYQB 2WK4A 3H5SA 4F4WA 2RDIA 3OLBA 3GYNA 3OLAA 1RA6A 4TY9A 3N6LA 2UVVA 3OL9A 1TKZA 4Y3CA 3RB4A 4URQU 1XR5A 4JV2A 5C25B 1IKYA 3KJVA 2WRMA 5J1EA 1HNVB 4MFBA 1JLEB 3G86A 1VRTB 3MEEB 2BE2B 3HHKA 1J5OB 3QGGA 4Q44A 5L1LA 4OL8A 1S6PB 4LSNA 1T3NA 1S0OA 1SV5B 1EETA 5KFWA 4O44A 3MR6A 3DI6A 3I5BA 3I0SB 3NGDA 3VQSA 5JUMA 5F8IA 3NBPB 2I5JA 3OHAA 4F50A 3IGNA 2W7PA 3CVKA 5DQGA 1HQEB 5C25A 4YQWA 4IH5A 4FBUA 4IR1A 1C1CA 2D7SA 4F4YA 4FBTA 4PUOB 5L1JA 3DRPA 3IG1A 3QIDA 4H4MA 5KT2A 2VA2A 1TV6A 4RW4A 3KHHA 1RT6B 5DGBA 1QAIA 4TY8A 3H4BA 2UVRA 1C0UA 2R2RA 1HQEA 1NHUA 3PVXA 5K14B 4EYHB 2AGOA 4NLRA 5DQIA 3KK2B 1N5YB 3LALA 4PWDB 1TVRB 1JKHB 2YNFB 2HMIA 2BQRA 1SUQB 3DLEB 3D28A 3Q8SB 2ASLA 2B5JA 2YKNA 4Y2CA 5KFFA 4J9QA 3H59A 5L9XA 2JEGA 1S9GA 1JLFA 4X2BA 2B43A 4NLQA 4KKOB 4J9NA 2FVPA 5DG7A 4O4RA 2JEJA 3BJYA 2UVWA 3FQKA 4I2QB 3KLHA 1IKVB 4EEYA 3M8QA 3BQ1A 1S0MA 4ID5B 4IDKB 1CSJA 3HKWA 1RT2A 1JLAB 5F8JA 1C1BA 4O3QA 1TKXA 2BANA 1TL1B 4IRCA 1MU2B 3DLEA 3BSOA 3H5UA 4RW6B 1HMVB 1RTIB 2YNGA 3KLEB 1EP4B 1IKWB 3CDUA 1RTHB 5FDLB 2FVQA 3SFUA 1RTJB 3KLIB 2WHOA 2JEIA 3PJXA 5EDWA 2UVUA 4NRUA 4ZPDA 1LWCA 3CIZA 5DG9A 1RTDB 4EYIB 1JLQB 1JXLA 4R8UA 1S1UB 1BQMA 1TL1A 5D3GA 4EBCA 2W8LA 3GV7B 4O4GA 3BQ2A 3I0RB 4ZP8A 4PQUA 2FVCA 2IJFA 1LWEA 4Y34A 1DTTB 5KT6A 3M8PB 4U6PA 4K4VA 4QWEA 3CJ5A 3H98A 3MF5A 3FFIB 2VG7A 1TL3B 5KT7A 3DLKB 2R8KA 2ZE2A 1XR7A 1S1VA 2AX0A 2OPPA 1RAJA 3UR0A 3BSCA 1T94A 3IRXB 2C2RA 1N4LA 4WE1B 2OPSB 4NLOA 1JLBB 3KK3A 2VG5A 2FJWA 3HVAA 1T03B 1RT4B 3PJWA 5HROB 3GV5B 5T14A 1R0AA 2HNDB 4NCGB 3BREA 4Q0BA 4J9OA 3OSPA 3FQLA 3NL0A 2WONB 5DLGA 2JC1A 3GIJA 3T5KA 2FVRA 1RT5B 4ED3A 4G1QB 2OPRB 4URGA 4KV8B 3DYAA 2B6AA 1C0TB 5KFPA 4MK9A 5KFUA 4RW8A 5KG4A 5HLFA 2FLNA 5F9NA 1S48A 5F8GA 4WZQA 4DG1A 5CYMB 3H5YA 1RT7A 4RNFA 5HROA 1HPZB 4R5PB 5F8MA 4DL2A 3IGVA 3LAMA 3NAIA 4WZMA 2YNIA 4O3PA 4MH8A 2IM2A 1RT5A 2O5DA 4KFBA 1TKZB 3DRSA 1FKOA 4ZVGA 3C6TA 5HP1A 3G6YA 2FJXA 3UDLA 4ECUA 3KJVB 5KFGA 5KFLA 5J1EB 2W9BA 4MFBB 3T5HA 2FLLA 1U09A 1K1QA 2J6SA 4ECZA 4LSNB 3HVTA 4Q43A 1EETB 3KOAA 4O44B 4TYAA 3DI6B 1RYRA 1C2PA 3QGHA 2IAJA 3PHEA 1ZTTA 1ZTWA 2I5JB 2WOMA 3CJ0A 5KFJA 2V9WA 1QE1A 5KG2A 4LSLA 2F8EX 3DOKA 3DOLA 4TLRA 3LAKA 5EWFA 4F4ZA 4ECTA 4GC7A 3KHRA 4B3OA 2I1RA 1DLOA 1C1CB 3EPIA 3ISNC 3DRPB 1IKXA 3IG1B 3QGIA 4H4MB 1TV6B 2XWYA 4RW4B 1SH0A 4TY8B 4R0EA 4NLXA 3KNAA 1IM4A 3KHLA 4KBIA 1C0UB 1DTQB 2W9CA 4O3OA 4DL6A 2AU0A 3TAMA 3H5XA 3RBEA 4JV0A 4J9KA 2QV6A 1HYSB 1HNIA 2HMIB 3OL8A 1S1WA 2B5JB 2EC0A 3OL7A 2YKNB 5KFMA 4KAIA 4RUAA 2R8GA 2VG6A 1S9GB 1JLFB 4M95A 4NLYA 1S4FA 1DTQA 2UUWA 3G6VA 2BQ3A 3JSMA 3ITHA 3DDKA 3QIPA 3KLHB 3M8QB 1K1SA
chains in the Genus database with same CATH superfamily
1AYEA 4OZLA 4U67Q 1U1OA 1SC1B 1TQLA 1UEUA 3O44A 1HYSA 2OSRA 1JQGA 1SKWA 4IRDA 1CULA 2DY1A 1BY9A 3NAHA 1LWCB 4AT1B 4OLOA 1S76D 2AEJA 1TTHB 1RT3A 5BXIA 2KHDA 3M1VB 3CDBA 3T1YJ 2QG9B 4HTJA 3ZTSA 1RU1A 2DNQA 1S1VB 4KTQA 2MQOA 4AE5A 1OS5A 1WF1A 4B9UA 3KLGA 3DNCA 4OYMA 3AOCA 1RACB 4OZ3A 2O67A 1YQHA 2OO4A 2CQDA 3Q89A 3PDNA 2XZDB 5JVHQ 1Q7YT 2XB2D 4OX7A 4J9RA 1FFSB 4EWTA 3C6UA 4G1IA 1WC3A 4ZN1A 3CCZA 4NLWA 4DV7J 4L74A 4LF7J 1KFDA 2OPQA 4DFKA 3M8RA 3RRGA 3HJFA 4FYWB 1X0FA 3PFOA 1UVKA 1KD1T 3NCQA 3BB5A 4LRAA 5FLXU 1YSJA 3LANA 1SIWB 4ILRA 1WELA 3K58A 3EX7B 1S1WB 1Y11A 2A6MA 1ZETA 3GFXA 1KKHA 3MDFA 4RX6A 4QIGA 5HQMA 1REVB 2OFHX 1H7XA 3E2EA 1WHXA 5B08A 2DNLA 3Q8QB 4EBDA 1HNWJ 1RTDA 5EUHA 5KFCA 2CWKA 2QFIA 2HWHA 4LFBJ 2HNZB 5CCLA 1VRTA 5ETKA 2Y0SD 5KFKA 3I31A 1H72C 1H3DA 1X7VA 4ECVA 4OHVA 4ECRA 2IC3B 4DN9A 4DZDA 3OTCA 1GH8A 1S57A 1O6XA 3DU5A 4LMZA 2IHR1 2CJQA 2YNHA 1FKPA 5LJ5Y 4NLDA 2VQEJ 2VD3A 1RZMA 2QC3A 2RKIB 1RTIA 3V81B 1JLCB 4LF6F 3FBCA 4ID8A 1S1UA 1TFWA 3G6ES 1YJNS 2EFNA 1U6ZA 3HCXA 4XPCA 2E7VA 2XHWA 1UETA 2KH9A 4HEA9 4CLFA 1N33J 1DAXA 1WHWA 5A8RA 1QD1A 5ADZA 1R3NA 1ZH5A 2XMTA 3V6DB 3DLGB 2LCWA 4MT1A 4J9LA 2X7IA 2W2OP 3V6HA 1KVKA 1T9VA 3OLBA 3UR3C 5JJBA 2HPUA 2EW9A 4C3MA 5L1LA 3MR6A 2F4VF 2KRBA 4F7VA 2CQPA 4OMFG 2M9KA 1WG5A 1GNKA 3DRPA 1XMOF 2H4WB 1YJTA 3TO8A 4GKKJ 3H4BA 5H9EJ 3HM9A 3LALA 2ZH8A 1JKHB 5DM6Q 4J9QA 1VQSA 5CA5A 2H48B 3N0VA 2HVZA 2UVWA 2YX7A 4LBHA 3BSOA 3J80Y 4TLQA 1FD8A 3WBZA 5HSPA 5HMZA 3ENQA 2GJFA 4LFAF 1FJGJ 4FYVB 2NXCA 4DZ6A 4DV4F 2ACYA 1X60A 1N5SA 3P4UB 2V4JA 2J9DE 3NGSA 3J7Z5 1B99A 1XR7A 2AX0A 4LF4F 4QIWD 2FPHX 4FF3A 1Z2LA 4ATNA 3C14B 1RHMB 4DG1A 5G0RA 1RT7A 1HPZB 1F9FA 3LAMA 1NDLA 2DD8S 2NXUA 2V8VA 1L3UA 3H25A 3BKUA 3PY8A 5HQ8A 1IUJA 4TLRA 2FJAB 3R27A 4JOUA 3HFZB 3R7SB 2VC1A 4DL6A 2HIQA 4K2JA 2HMIB 3CCWA 1SL2A 2ZM6J 4RUAA 3CCTA 3G6VA 3HI9A 3JSMA 5AXKA 4GKJF 2VFUA 4EFAC 1GT8A 3RAQA 2V1SA 4GO5X 2AJ2A 4HH0A 4RNHA 2XS7A 2M2BA 3AD9C 2P8IA 3TZXA 2X3DA 2LVWA 3FRYA 2AGQA 4JYAJ 4OI1A 1NU4A 2HSEB 2VG7B 1SB6A 1UUJA 3HPOA 1N52B 5AT1B 4TKTA 2M88A 1F9EB 4JI8J 1H73A 2R7OA 2R7SA 2I38A 1W26A 3D6MB 4CH0S 1RT1A 1EARA 2Z56B 5AXNA 4NYZA 2BEFA 1CQMA 5J2PA 2DISA 5U47A 4DFJA 1B7YB 5HP1B 2KZMA 5E3AA 4TXSA 3W2VA 2HAIA 3BZQA 4P72A 4JV1A 1TELA 4USTA 5KFTA 4C48A 2FIUA 4LSLB 4QZVB 3T1HJ 2ILZA 2FC9A 3PKYA 1S0NA 1IR0A 4ICLA 2HLTA 3IWXA 5KFIA 4QWCA 5LM7E 3QJPA 2RQKA 2DPIA 4X4OA 3TZWA 3KDOA 4YOEA 2QX0A 3AJ1A 5DETA 3MCNA 5DZ7A 4ED0A 3CJSA 2ZH5A 1RTZA 1T3OA 2W4DA 5D0HA 1YRTA 3NS6A 3PIOQ 3UDEA 2CJYB 1UWBA 2LA4A 3D0HE 4X4RA 4FYXB 1RWUA 4QW8A 1R43A 2H4YB 3GILA 4DV7F 2V4RA 4B9SA 3NBPA 2A2DA 1F3FA 2G0IA 4AFFA 4UY8T 5K20B 3OSNA 3BN7A 3AT1B 3THVA 2C1EB 3LP2B 4IFYB 4HT7A 2BJEA 3TA2A 1G3OA 2V63A 1VHFA 2GQ2A 5JXSA 4IQMA 2ZEJA 5DZ6A 3A3NB 3K89A 3BGFA 3I82A 2FHMA 2OEKA 1IKVA 4IH7A 3EXCX 4Y2IA 3KK1B 2VBWA 2D9PA 5HK4A 2GW8A 1KBRA 1X9WA 4IQXA 4LJMA 1H2UX 1FRXA 1DY3A 1D8ZA 1Z2ZA 3DLLQ 3UNGC 3SI8A 2DNOA 3V4IB 3Q8YA 1T03A 1RT4A 1YVFA 2VBXA 4B3RF 3M30B 4DQSA 1C0TA 1K9MT 4Q7AA 1AA1B 4ZLLA 2LXUA 4YY3F 7FDRA 1RA6A 1MW7A 1X5TA 4O0IA 3L95X 5B0FA 1HHQA 2WRMA 1WJ9A 4P10A 3CO0P 3QGGA 3QATA 1RP5A 5KFWA 3ZZ0A 4F04B 3LW5C 2IPOB 1NZAA 1TV6A 1RBLA 4YB5A 5J1NA 4DI6A 1NHUA 4JI5J 2GAHC 2D69A 3FC9A 2QA2A 5DDPC 2YBVA 5K8MA 1GEHA 2B43A 4O4RA 2H1YA 4C8KA 1U45A 1IBCB 9ATCB 1VQ6S 1MU2B 3IBFB 1X4EA 2IVMA 2JOQA 2UVUA 1WC4A 2R42A 2RUSA 3W9IA 5D3GA 3GV7B 2CIMA 1AFIA 2N3OA 1DTTB 2V67A 4HI2A 4WWSA 5IT9Y 5E33A 1Q95G 2A10A 1SI9A 2K2PA 3UR0A 3IRXB 2DIVA 4CH1A 3B4DA 2VZ9A 3D7SB 3NL0A 2JC1A 3TUJC 3HMJG 2IJRA 2B6AA 4RW8A 3TUZC 3THTA 5F9NA 1T95A 3N28A 4CI0B 1JJ4A 2I0XA 5CHCB 2C3MA 2ZNZA 4MH8A 1M0SA 1SKUB 1YGYA 2B4OA 3R1HA 2B8QA 4X62J 4FF2A 2W7AA 3I9V9 3K7RA 3TYTA 3HHLC 5CZXA 3D6FB 4B02A 3LAKA 5K5MA 4NEYA 1FJGF 1VS3A 2UXDJ 4KGZB 3MZIA 2HBRB 2YWEA 3VAHA 2FUG9 3LWMA 4LRDA 2BE9B 3GB0A 4B08A 3VCDA 2RD5C 3MHYA 3UN5A 4KAIA 4LRCA 3SXLA 4WP9A 4UF4A 2VFVA 1NSPA 4C8ZA 1UVJA 4X4QA 3D1OA 2V34A 1R89A 2CXEA 4PPDA 4DFPA 1QAYA 1UMJA 3ZTRA 2AWZA 2AT1B 2DNGA 2R7QA 2JVOA 2XSFA 4P75A 4NXNJ 1KP6A 4E8UA 2O3DA 4IG3A 3G2XA 3E3XA 3G96A 1N34J 4OHZA 3MUVP 2R7XA 4OI2A 4BDPA 1SL1A 2ZVIA 1XNRJ 3SQGA 4JUZA 4USUA 1VQYA 1N5QA 3UVJA 5A6WA 1B70B 4U8YA 1OYDA 4J9SA 3OVBA 3CJ8A 4USHA 4NLPA 4W90B 2RF2A 3LP0A 5KFEA 3PEJA 4OHWA 3BYPA 2MZQA 1L3SA 1VRUA 1DURA 2GC8A 4WU3A 2QRRA 2GMHA 3MR3A 1IKXB 2ZBPA 1IBKJ 4H4OA 5SZTA 3I5AA 4KJIA 3EZUA 3IR5B 2B8PA 2DNMA 4NE9C 5J2MA 1DQ9A 1AFJA 3VF0B 2VG6B 3CPWR 4NLSA 3OXGA 4OI3A 2IJNA 2HGLA 3IAM9 3MEGB 1RAIB 1R6VA 1LWFA 1S10A 5DG8A 3D68A 1BQNB 4Z7YA 2HKEA 2RQCA 3AX5A 3NP5A 3QAUA 3SFGA 1P6TA 3FDSA 2XLIA 1UPMB 1I6JA 3H4DA 3OXLA 2U1AA 3OFHA 3RBDA 2OUGA 4DPTA 2QL9B 1GMUA 1NH8A 2GZOA 4AXJA 1D1UA 3KMQA 1LW2B 2HLUA 3VAGA 4RJVA 4LVNP 2BJ7A 2HVIA 5GMEA 1XEZA 3T1HF 3GFZA 5KFHA 4NLUA 4WIQA 2QLBB 4J90A 2YNFA 2W7OA 3DXBA 5KG6A 1WC1A 4NLVA 2NYIA 5MAOA 3DMJB 4NYPA 2BRLA 2V2QA 2AYMA 4YP3A 4C11A 1RTHA 2IMWP 1B0VA 1H38A 4EO8A 2D3ZA 4K0KF 4MIAA 1NJYA 3PR5B 4GVBB 4LBPA 2DRBA 4NZ7A 3HX9A 3CCJS 1LW0B 3FSXA 4B3MF 2R2UA 1RISA 3Q8PB 2COLA 2ALZA 3KLFB 4CIOA 3BN4A 2QA4S 2CPZA 3S6EA 4ZPAA 5KFXA 2WK4A 2RDIA 2EBEA 2IVYA 1VQKS 4BS2A 2LQ8A 2MQPA 1T3NA 3CULA 3DI6A 2ZH9A 2PMZD 3GR0A 4F50A 3EZ5A 4JP8A 4PABA 1RAGB 4M1KA 2GHVC 3JQKA 2VUGA 4TY8A 2UVRA 3C46A 1HHTP 3EE3A 5DQIA 3KK2B 2DNHA 4WIIA 1KVIA 1YJ9S 5T7LB 2DGQA 1V5VA 1VISA 4FKXA 3GJSB 5L9XA 3OW2R 2CQ4A 2MSTA 3Q2TC 4UOHA 5DG7A 4I2QB 4ID5B 1FI4A 4ZCKA 2A6OA 2X51A 1HWKA 1NDKA 2C3UA 3MAHA 1EAYC 3MMJA 1F5BA 3JS9A 3DN9A 1HI1A 3CIZA 2ERRA 2Y1IA 1CG2A 5A0YA 4R8UA 5GVQA 1BQMA 3KJFB 1R0CB 4EMDA 2R9LA 4JI0F 1AROP 3DLKB 4P52A 2UV8A 1RWKB 1RU2A 2R8KA 4B3SF 4OYOA 2CNOB 4YFUA 2F4FA 3EVMA 4LF8F 1JLBB 2NREA 2VG5A 4IO1A 3GFYA 2HNDB 3DFEA 3DGPA 4KGMA 1VC0A 4ED3A 1TKDA 5A76A 2MJNA 1X31C 3PO4A 3U1NA 5HROA 1M5PC 1BWEA 3AOAA 2YNIA 3DDNA 3MD1A 4KY3A 2LXIA 2Q66A 3VVUA 2VDHA 2R7TA 3DLJA 2LDIA 3T3FA 4V1Ak 2GGPB 1CQNA 4GC7A 3FSYA 4OYPA 3QGIA 1MN7A 4Z7CA 4NLXA 2NYHA 1QUPA 2V6AA 2NXNA 2V8HA 1NK0A 1YRXA 1ZS6A 4N76A 2QJ3A 2EC0A 2YKNB 2ABYA 2MZJA 5IS2A 4DV3J 2NZCA 1N88A 5E0OA 2GA7A 2RQMA 2W24A 2R8JA 4CP5A 4Y00A 2O66A 4ES1A 4WK1A 4JBCA 5KG1A 1FX2A 3KUGA 4WXOA 1OWXA 4OYWA 4OZ2A 5L1IA 1JXEA 4ZPBA 1OQ3A 4ZP6A 3VZHA 2LFVA 4LREA 4DU8A 3K17A 1U02A 2E5GA 8RUCA 4KC5A 2LXFA 1WOSA 3TW0A 1NXIA 3GU0A 3QZ8A 2XZ2A 2DK2A 3M32B 3FUYA 4PYAA 2XC9A 3J7A1 2IY5B 3SSRA 4DV5F 1FNMA 4LFCF 4ED5A 2VKZG 2J7KA 1RKIA 3DOKB 1H2VZ 4N41A 4AL5A 4DQRA 4U95A 3L3CA 4P2XA 3DM2A 4WFZA 2HK3A 1F5AA 4W92B 1P8GA 5HJYA 3MM9A 1U1LA 4ECXA 2DR6A 2XMJA 1IQZA 2XYPB 2YKMA 3A8JA 2HHHJ 4YMEA 1RCXB 2F8MA 3HF5A 3WX8A 1YKWA 4DR3J 1NNDA 5DM7Q 4UOFA 3ZTOA 3FZBA 3EM1A 2OSQA 5C42B 5K8NA 2ASDA 1RSCA 1S97A 3D1HA 4PQAA 3CC2S 2YXLA 4OZJA 3T19A 2W1BA 1TAQA 3M8YA 1XNRF 2KJVA 2F3JA 4C9DA 5LMNF 1NLKL 2BQUA 3D3BJ 4C8MA 2Y3YA 4CLWA 3LP1B 5I42B 4H54A 4QIFA 4ZS6A 2D9OA 3FGVA 2CQHA 3BS9A 2RIJA 3TZYA 3BGRB 1P9QC 2XYGB 1R8HA 2Q6CA 4DX8H 3G87A 4M63A 4NASA 1JIHA 3P5TL 3UPFA 3QAEA 3KWMA 1F2HA 4YDXA 1KSPA 2AV5A 4GRSA 4RWWA 3MECB 5B0CA 2HHWA 3CD5A 3W9JA 3MMBB 1Q5YA 1ZM4A 1YDLA 3GV8B 1MMDA 3GYGA 2ZD1B 2I6WA 2EVZA 1T11A 2CAJA 1NKEA 1CJTB 4Y28C 2DTJA 1T7PA 1UKUA 3M9NB 2MKIA 4IH6A 1CC8A 1S49A 3IFEA 3U02A 2GHPA 3J81U 2QMXA 5G4DA 3E01A 3MPUB 1Y10A 4EO6A 2BJDA 1S1XB 2CPHA 3J7AN 5C2CA 2DH8A 1SXLA 3LGHA 4MFBA 3MM7B 3TJAA 3QRQA 2CPYA 4OL8A 2PO4A 1HWJA 1HBNA 1PO6A 2ZC3A 2CJAA 2YVSA 4IH5A 1C1CA 1WACA 4FBTA 2HIYA 1J2VA 5AE1A 2HQDA 3TVYA 2F9JA 1K0VA 3JSBA 4KKOB 4CTAB 4X65F 1C4CA 3EZOA 2YX1A 3Q22A 2CPJA 3H5UA 4F67A 3N9UC 1REGX 3NNCA 2DCUB 4NA1A 4P2FA 3FBBA 3H20A 1SCJB 1F1BB 2AZ3A 4HACB 2RT3A 3M8SA 3OFFA 5SUHA 4P2SA 3ZC4A 1UA0A 3RBZA 2J5AA 1TL3B 1HKAA 1T94A 2P9CA 3UN2A 4CM0A 3KK3A 4Y2MA 4TU7A 4DV0F 4Q0BA 2RRBA 1R31A 1VQPS 1UAWA 2Y1LB 2WONB 1S7HA 3GIJA 1QLNA 2H54B 4G1QB 1AXQA 4X64J 2GNKA 3GYXB 3ULHA 2EFOA 4NA3A 4R5PB 4ELTA 3CJQA 3CIMA 2LYVA 4ZVQB 2FJXA 2B4VA 5HANA 1SL0A 4WP3A 5F41A 1EIYB 3H42A 1S6OA 2PA3A 4DOZA 1C2PA 3PHEA 2W2QP 3IBCB 2WOMA 3R9LA 1RABB 2E29A 2HFVA 3UO0A 3SEOA 2GVZA 1SH0A 4NXMF 2W9CA 2HZVA 1HBOB 1NMEB 1SJRA 3NG8A 4WTYA 2LQJA 4JV0A 3CNQP 4XK8C 4ZCMA 1HNIA 2M52A 4X66F 2ZWOA 3NCPA 1RBOB 1YBAA 3B6BA 3MR5A 4DEZA 3NNAA 2B7CB 1TKXB 1NK8A 4F4AA 3UQSA 3CB4A 3QO9A 3R7BB 1DJ0A 3JYTB 2HS0A 3H0PA 4FF1A 1QSYA 1QY7A 1X9SA 1PC5A 4YHHJ 1LWEB 2QL7B 1CJKB 4DPYA 3CCQS 1TAUA 2OPPB 3OTOF 2RHSB 4KGVB 2R7WA 4ZJOA 2A1BA 3VGVA 5IFMA 3JSYA 5CH7B 1HQUA 1SH2A 1D0EA 2LDYA 4QWBA 2QN6B 2I9SA 1FNOA 5KFQA 3C19A 3FRZA 1FVQA 4B9MA 3W63A 4RZRA 4USKA 2CDQA 3SIPB 1WHYA 3X1LB 3PYEA 1GMVA 4C0HA 2HFNA 1URRA 1T02A 2OAUA 1DLOB 3JAMY 3GQCA 3CC7S 3QBCA 2JH3A 5I3UA 2J0XA 1O0PA 1Y5IB 4ED2A 1RBAA 4PXEA 5C5JA 1N6QA 4HT5A 3IN5A 5KT5A 5HJXA 3C15B 2VH7A 4I67A 2BJ3A 3OR2A 5KFOA 2GAGC 4PG7A 2VA2A 3UCZP 3DDIA 3VR1A 4K50A 1REVA 3NGTA 2HZCA 4FXVA 2UUBJ 1HNVA 3TARA 1NSQA 4JB8B 4RBTA 2MKYA 3LUYA 4F0HA 4HLBA 2HVEA 1VBXA 2J0SD 2J9EA 4OYZA 1Y5LB 4ED6A 4OI4A 4Q45A 3ET6B 2BJ9A 1SIZA 1SQFA 2KN4A 3OFGA 2MKHA 4OYBA 4LIWA 1XTZA 4A8MP 1RWPB 1IBMF 3TANA 3JQJA 1FTCA 3FNNA 2ATLA 4MYUA 1JLAA 2KFYA 2YWHA 3WHIA 1V3RA 3AA9A 4DWIA 2LQBA 3PW5A 2UU9F 4WFYA 4DR3F 1SVDA 4LF5J 1TMMA 3D0GE 1S6QB 2YKQA 3Q2SC 2RKIA 2XWXA 3AODA 3K5MA 2HGNA 1YITS 1SKRA 1VR6A 3BBCA 1S4EA 1PYOB 1Q8IA 1HWUA 4UZBA 3RUBL 1LQ9A 3FMWA 3IC1A 4F4XA 4Q8EA 5F8NA 2GV1A 3EPGA 1NJZA 3MPWA 4OX8A 2LU1A 3QT8A 3G82B 3IS9B 2K06A 2D1CA 1ZM9A 3FEZA 1S5ZA 3N6LA 2UVVA 4M5IA 3CMQA 2RSQA 3F41A 4YB7A 2BE2B 1J5OB 5IT4A 2HVHA 4F8RA 4O44A 2W7PA 2OMOA 5CD4A 4PUOB 3HFKA 3P45B 4RW4A 1RT6B 4NYOA 1FEEA 1VMBA 5DJBA 3OUYA 2PIIA 4LT6A 5K14B 4KPYA 3PG9A 4I69A 4P71A 3DLEB 2ASLA 2VPWB 4Y2CA 2JEGA 4ETZA 3M2UA 4W98A 1IBLF 1CSJA 3HKWA 2DO0A 4NI2B 3SQOP 3VAMA 4RLEA 2YNGA 4F0MA 2K1RB 3NCRA 3PYFA 3OJSA 3UNYA 1IJEB 3W61A 4EBCA 4PKDB 3I0RB 1A9NB 2IJFA 2EI5A 1XK8A 4K4VA 2DJWA 1R8AA 4NLOA 1UL3A 3W2WA 4ZVPB 4A8QA 1PJ6A 4OJHA 5C2GA 4USMA 4FNHA 2BOAA 2VOOA 5KFUA 2FLNA 5D15A 1LFWA 5GADU 4IUFA 2PD1A 5IWAF 2PA8D 3V4MA 4ZVGA 1FKOA 2NUUG 4I6YA 4CYUB 3G6YA 1RI7A 2AD9A 1U0HB 4TNOA 5A8WB 3QGHA 2LQ9A 3HHDA 5KFJA 1RHRB 1TL7A 5LT5A 1FWLA 1IXKA 2KVIA 1C0UB 2B3TB 1TFYA 2H5EA 2HS4A 1F3VA 3H5XA 3N5FA 2BJ8A 2VICA 2CVEA 3D6TB 2GVDA 3VAJA 4DV6J 4LUBA 2KI2A 4LQ3A 4EK2A 3M2RA 2MGZA 2NS1B 4K5SA 4X64F 1YJWS 4WU2A 1Q82T 3MWBA 2OTJS 5LSLA 1GMWA 2PFDA 4ECQA 2E5JA 4K4ZA 2Z0GA 3H2LA 3IO1A 1UP1A 2KO1A 3H40A 4D3HA 5F8HA 2QO3A 4WFBQ 3R3TA 3Q23A 1KN6A 1GAOA 3M6XA 3MUMP 1XMQJ 4F25A 1KTQA 2FZGB 2VQFJ 1SJ1A 3UW1A 2V69A 4LR8A 2HVDA 4QJVA 5KG7A 3LF0A 3D6HB 2XMUA 1RHUB 4CO2A 3QRRA 2BOPA 1CS4A 4AQYF 1RQ0A 2BZ2A 3M7VA 2FJBB 4ZHRA 5HBMA 3F73A 4IG0A 1UVIA 3AY0A 1JXVA 4DDFA 5J2NB 4JI6F 3PW2A 4DMZA 1VK8A 2ZZTA 1AZSA 5LL6d 5D4NA 2F63A 1FDBA 4CT8A 1CULB 3ZZZA 2MYFA 2JNJA 2HHTA 1R7IA 2QLXA 3I96A 2V1TA 1RT3B 1F9HA 2UUCJ 1UVLA 4G65A 3J81j 1FJEB 3I0SA 1WEZA 3RB6A 3PX0A 2AQ4A 4P2MA 3D0IE 1I94J 1N5YA 1F2GA 2F5GA 4OI0A 1JWWA 3PEHA 5KFBA 3C6UB 4H4KC 1ELOA 4RW6A 2XO6A 1HIYA 4D3GA 1S72S 1VQ5S 3Q0AA 2OPQB 3HXMA 1D9AA 1FJCA 4L75A 2XS2A 3T5LA 2LMIA 3CCUS 2E1MC 2CZ9A 3PXGa 4W4MA 1CBKA 2RILA 3Q24A 4HH1A 2RDJA 4WE1A 2OPSA 1GXLA 1I3OB 3HT3A 2MLYA 3FMBA 4MIBA 2MQMA 1VLOA 1PAEX 4L73A 3NXZA 5LMUJ 2LKZA 2BM0A 3GYNA 2ZH2A 1UVNA 4Y3CA 4ILLA 1FXDA 1VRTB 4O0NA 3TX0A 1AW0A 3BPSP 3FBEA 3SZ2A 4MIWA 2ASYA 3KFWX 3R5CA 4OHYA 1YX2A 3W7BA 3L4BC 1HL6A 3M4XA 1VBKA 1FA0A 1ZYQA 3DOMA 3EWGA 1OY8A 1NK4A 3D28A 3UDCA 4J5OA 1QVGR 1Q8LA 1JNRB 2G13A 4JI7J 1C1BA 2QFJA 1LNQA 4DR1J 3NOGA 1RTIB 2R3VA 3RTVA 2FVQA 1HBUA 4AL7A 1JXLA 2AEMA 1S1UB 4OX9J 4QU6A 4PQUA 1RHJB 1NB2A 3MPVA 4X4TA 2X1GA 3CD6S 3I4PA 4ZVOB 2HK2A 4FPIA 5A8RB 4X4SA 2QMUB 3OXFA 3CXCR 5AE2A 3CJRA 1UEKA 1SJFA 4G6VB 4DR2J 3X3UA 5AJ3F 1R0AA 1E6YA 2MTLA 2ZWPA 4C98A 2OEJA 5F8GA 4WZQA 1B0TA 4F2RA 1MWYA 2UXBF 4WZMA 4G1PA 3MMCA 2Y0BB 3DRSA 2OP5A 1FF2A 2W9BA 4DPOA 1FNXH 1OPZA 1ZTWA 1QE1A 4UOGA 1VC6A 4QOTA 3DRPB 1G7CB 3GCXP 1NEEA 2M8DB 1PKUA 3KNAA 5HVFA 4EZ6A 1X4CA 4UQTA 4M5MA 2F1FA 2ZDOA 4F3OA 2DO4A 1XBWA 2UXCJ 3QIPA 2GMJA 4ZKAA 3IAS9 1K1SA 2DHAA 2QE5A 1RWVB 2XLJA 2HFOA 3CCSS 4ZPTR 4B3TJ 3DRXA 4ZPCA 3GG0A 2DEIA 2HZAA 2E9RX 4IOCQ 1NK5A 4JV5F 5KFDA 5HVHA 1W2BR 2XI3A 4DR7F 3HVRA 4ZVUB 3GIRA 2V4JB 2XG8A 2L3MA 4FVCA 5F8LA 4I7FA 1EX8A 3MTKA 3J80U 4MJKA 1UJ5A 2JEFA 4M94A 3BSNA 3H2VE 2AGPA 3HFVA 2ZC4A 1LK5A 4ITSA 4DG1B 5E2QA 5G0RB 1X5PA 1RT7B 5KFYA 2DPJA 1B0PA 2HHPA 3MEDA 4DX7A 1J5EJ 1GK8A 4OJ1A 4DBQA 1TUWA 3NLCA 3NS5A 1XC9A 3JTNA 3RAMA 4I2PA 1U4BA 2VKRA 1H7WA 2G1HA 4DR4F 3L9ZA 4KIAA 3ZXWA 4H4KA 2J0WA 1CJUB 5J1PA 5HO4A 4ZVHA 3MFHA 2JLEA 2ASJA 1YZ7A 4PG8A 4RUHA 3RZAA 2D68A 3RB3A 5L46A 5IT0A 3JSMB 4DU7A 4RKUC 2ZUGA 2VPYB 1RGVA 4RL1A 2MDAA 2EFQA 4KHPF 2L9WA 4OJ3A 2WB1D 2UUAF 2QSWA 3KMSA 2VFTA 4CO4A 3ADAC 1MN9A 2OI2A 1JLEA 1UW4A 1S77D 4QYZK 1HNZF 1BHNA 4NA2A 5A2QY 2OKQA 3GSDA 1KLNA 3MM6A 1VBYA 3R6LB 2R2SA 2Z2MA 4C8NA 2KG0A 3V6JA 1JJHA 2M5YA 3MM5A 1RT1B 4HHUA 4OYIA 1SUQA 4FXWA 2XY7A 3W3SA 4ZA1A 3UI3A 5J2PB 2PGCA 2Y8WA 2BMBA 2HHVA 4DXLA 1N8RT 2BKNA 3LO3A 4ZP7A 3KLEA 1IR2A 3EUNA 3KLIA 4PG6A 3AJDA 1NCLA 3DMJA 4ANEA 4CO5A 3NMRA 2DB1A 4ICLB 3M8PA 3GIIA 4F36A 1VJWA 4UUXA 3TP2A 2BABA 4ZJLA 1LW0A 3MURP 4DUYJ 5DS7A 2QA1A 4E98A 2F65A 4DR5F 4NZ6A 3PNIA 1VOMA 2KFNA 1CC7A 4M5DA 3VGTA 1TKZA 5E3RA 4ZDNA 4ZN3A 2QZ8A 5J1EA 3G86A 5CD4H 4LSNA 2ZFHA 5HMWA 4DV1F 2OELA 4U7UK 3OHAA 3NBPB 3IGNA 1HQEB 2K3KA 2DT9A 3C16A 3A8KA 4CWBA 5L1JA 2PN6A 4H4MA 2MY7A 1X5OA 1FRHA 1VFJA 2Q43A 1IKVB 4ZLJA 2VDIA 2RH3A 3CMAS 1U2RA 2BANA 1LEOA 2MPUA 2V8GA 2WHOA 1JNZB 2QA4G 3A8IA 1A6LA 2KFZA 2XBPA 4O4GA 3IR7B 3ZNUA 2R7VA 1TMJA 2AMCB 1RAJA 1X0PA 3BSCA 1PIEA 1TUVA 1T03B 1RT4B 5ETSA 2XULA 3BREA 1AUDA 3K57A 4DSJA 2CPDA 1C0TB 1RWOB 4PRFA 5ETRA 3H5YA 2KT5A 4J9UE 1HNXF 4M8LA 5BYQA 3M2VA 1RHQB 3S7RA 4KFBA 1FVSA 2ZOMA 4DR6J 3C6TA 2WW4A 1M5SA 2VL1A 1M5VC 2FLLA 3I55S 2IRYA 4CT9A 4JI3F 3HVTA 3AXMA 2IAJA 2F8EX 1CJVA 2KYXA 2KVQE 2BV3A 5FIIA 5IC4B 5JMNA 1M90T 3QRPA 1TV6B 4O23A 3ENWA 1H2TZ 1O51A 1OYEA 4LF9J 4Q5VA 4DR2F 5HATA 4ZVFA 4R25A 1OIAA 3PACA 3TUPA 2CPFA 3N79A 3OHBA 1VQ4S 4JI4J 1NKCA 3H2UB 1M5OC 5D3GB 3T5JA 3AX2A 4DLEA 3EGZA 1DFDA 1G4CA 5IOLA 2G2YA 1LXNA 2DGXA 3FEXB 2ZBQA 1RAAB 2XTDA 1ZA1B 2AJFE 3PO5A 2BRKA 4JI2F 2R8IA 2MXYA 5L38A 2Z30B 2Z2ZA 1BUXA 1S79A 1CLFA 1Z4UA 2XNRA 5C24B 2B6AB 4RW8B 1NK7A 4XPEA 5IT9U 1VQ9S 4USVA 3L7UA 1MNEA 2GIQA 3G6XA 4K5RA 5DQHA 1NJIT 3MAAA 4ENOA 1SPBP 3MCOA 3QLHB 2VONA 1VCTA 1FK9A 4WXWA 3NWRA 4QU7A 1ZAXA 4ETXA 4OV1A 2OD4A 4ZLPA 2BKPA 4OYXA 2YQ1A 3FCHA 4K4SA 4URSA 2PI4A 4MTPA 4QWDA 5GAGU 3UCGA 4IO9Q 2JSXA 1NH7A 2Y1JA 4K4YA 4F26A 5JVGQ 2HHUA 4CNYA 2H51B 4NWBA 2KU7A 3MEEA 4FVMA 4DUZF 1LV5A 3PM9A 1SV5A 3A12A 5E3QA 1XNQJ 1E6VA 4ED8A 3HHEA 3ETOA 3RW7A 2OIHA 3AXKA 3DXSX 2QEXS 3EDRB 3A3PB 1OSCA 4IG3B 5I42A 1ACMB 4GMKA 5DDQC 1TL5A 4MKYA 5DDRC 2MZTA 3SQGB 3D67A 2OTLS 3NGRA 4ZVRB 2HRYA 2NQPA 2IBOA 2U2FA 3GJRB 5FDLA 5CZVA 2RF2B 3LP0B 2YKAA 1VRUB 4K4WA 3OQ2A 2NCKL 5CABA 4H4OB 4ERDA 3J81Y 1NHVA 5BYRA 1H98A 2MQ8A 2ROEA 5T41A 4CO1A 4YR2A 3W66A 2FB0A 3BH7B 5BR8J 1FD2A 1LWFB 4WKRA 1RWNB 1FRJA 4A4JA 1VQMS 2X3GA 1B3TA 3OLAA 4LF1A 4GO7X 2W4CA 3MUTP 4TY9A 2XO7A 2A2CA 2V2VA 2M3DA 5C25B 2HQFA 2E5LF 2M7SA 1S0OA 1ZA2B 4KRWA 1LFPA 1NSKL 4JI1J 4F4YA 1WD6A 3KHHA 1N32J 4YUDA 1D9DA 2DGTA 4WJBA 3W62A 4PXDA 4Z2XA 4I68A 2YNFB 2KXHA 2OJ3A 2B51A 2IYIA 2KTQA 2RE1A 2YPZA 3BGUA 3BJYA 1ZPWX 3M8QA 3EMTA 3HD1A 3NOCA 3ILOA 2UP1A 4C11B 1RTHB 3GPAA 1NDPA 1I51B 3PJXA 3HP6A 3U7JA 2X1BA 2LEAA 2EKNA 1VLYA 2J8AA 2IDEA 3CJ5A 3ENAA 2FY8A 3NGUA 1VGYA 4U9RA 1ZZFA 2NXEA 3P96A 2IA0A 3POTA 1DARA 2CPEA 3SV4A 3GV5B 1PJ5A 1FWPA 3SDEB 3MTJA 4OV6A 1HR0F 1RT5B 3DYAA 3NAIA 4DV2J 5F3TA 3D4JA 4RPFA 4FNIA 2XTCA 3BR8A 3UDLA 3T5HA 2J6SA 3DI6B 3MM8A 3SSQA 3T1YF 3GWCA 4B3OA 2I1RA 1N36J 3ISNC 2A18A 2XWYA 4TY8B 3KHLA 2W4PA 2VJUA 2AU0A 1T8EA 2QV6A 1U1PA 3SYZA 5ITHA 2CZVC 5M2RA 1CEZA 2AJ4A 3HSZA 3ITHA 1KC8T 2APOA 5HN0A 4MK7A 4KH1B 1Q7LB 3DRRA 3CWJA 4LF7F 2DNKA 5A0YB 4R8UB 1BQMB 1KHVA 2BX6A 1TKTB 5D0EA 1SBRA 2ZITA 1TR0A 4UW2A 2HNYA 3JYTA 3CSKA 2UUTA 1Y4ZB 3ZZPA 4CDIA 2OFGX 3KYLA 2HHQA 1QAXA 1U2CA 2YY3A 3K5LA 4YR0A 1SC6A 2MEWA 4C8LA 2VG5B 2GQQA 1IVZA 4DQIA 3DGPB 2OD6A 1YRUA 4ZP9A 2QLFB 1VQNS 4LR7A 2YNIB 1JLGA 1S7IA 1PILA 2RHQB 3B4MA 1HNWF 4LF9F 4PWWA 3ILIA 3CO9A 1T05A 4LFBF 5L1KA 2WSEC 1XR6A 2WSCC 2MLXA 1NDCA 2YWGA 1TU0B 2G2OA 4N7TA 2H3EB 4X4PA 4L3NA 5KOXA 3OR1A 3K8WA 1K8AT 1CPZA 1VRQC 2CQIA 3BO2A 5EX0A 3L7PA 3BSAA 3HDSA 2VQEF 1W25A 2D41A 2XGQA 1UZDA 3K5OA 4USIA 3B54A 3JSRA 2MQQA 3BM7A 1B64A 1KWMA 3I5CA 4UOCA 5KFVA 3B8HA 3RAXA 2YQ3A 4K4UA 3K8VA 2EEYA 3BGOP 1HW8A 2JWNA 3H8YA 2XYHB 4LBIA 5B0BA 1UCNA 2C22A 2VFSA 2HAFA 3VGSA 1N33F 1T0TV 2UZAA 3M6VA 1D8YA 2C28A 5EWEA 2BJ1A 3HSJA 3PYGA 1K44A 2C3PA 4FYDA 3QSYB 2NPFA 1FESA 4IDKA 4WYWA 4P7VA 2MY8A 2CQ1A 3AAWB 4RNOA 2ZBRA 5GAHI 4FXDA 3NNHA 2OLWA 2V94A 3V2UC 4DLGA 5GADI 2DGVA 3CW2C 1WKJA 1U7LA 5CYJA 3FFIA 1SJ4P 3DM2B 1UFLA 1Q79A 1S6QA 4HYKA 4PXCA 4XAKA 3MM9B 4GKKF 1XNQF 3CUNA 3HHLD 2YKMB 3UD5A 4RNNA 2YKPA 5EWGA 2ZDPA 4C6AA 4DPWA 1RXOB 3VWSA 3BGLA 4RBVA 4WK3A 3N4WA 3R5AA 3W5XA 4LF6J 4PEOA 1C4AA 3BBFA 3HHKA 5A8KA 3MCSA 2YWKA 2I5JA 1EKSA 3CVKA 3PFEA 2DNRA 4FBUA 3KNGA 3AX3A 3IG1A 5KT2A 2KT3A 2ZJQQ 2V8PA 3S8SA 1VI7A 4OHXA 2GQCA 1N5TA 1S9GA 4J9NA 3M8ZA 2QT7A 2BW7A 1RT2A 2CNLB 3ISZA 3W64A 4IRCA 4TU9A 3DLEA 2EFPA 4NRUA 2HRTA 3W60A 2B56A 2F4VJ 1MROB 3SCLE 1WOOA 2K1RA 4Y2KA 1T9UA 1XMOJ 1H74A 1V3SA 3ZFVA 2ALYB 3W65A 3OSPA 2ZM6F 2CDRB 4URGA 4NMLA 5HLFA 1P1TA 1WKKA 4I56A 2KRRA 5ETNA 4LFAJ 3V5RA 2Z58B 5KFGA 4MFBB 4DV4J 3P6YC 3DRYA 3C8YA 1U24A 5M2PA 1HBNB 1WEYA 3HT0A 4CYUA 1WTBA 5GAEU 4JYAF 4F4ZA 1FX4A 1C1CB 2MKJA 4LF4J 2W2PP 4JI8F 5D4OA 2VF3A 1Q8BA 4F3MA 4M95A 4HDGA 5CAAA 3D54A 4OQJA 3PR4A 2JDJA 2EG1A 2OHDA 3M9MB 2BXJA 4I0WA 1VYAA 4CLUA 1NM2A 4PPZA 4EI2A 1MMNA 3D5MA 2RMLA 1MG7A 2ZVSA 4RW9A 4WBFA 4A8KA 1GX5A 4YS2A 5HL7Q 3JTOA 4L6V3 1Q86T 4HVZA 3QYYA 3OPKA 4RU9A 4YEAA 1ICEB 3TQEA 4OZ5A 4I1TA 2GIFA 3KK3B 1RWXB 4A8FA 2KHCA 1PYTA 4Q0BB 5AXLA 1BWVA 1N36F 2CRLA 2AP6A 1PJ7A 2O1PA 4DS4A 1EQMA 4GKJJ 2CKWA 2KB2A 1SC4B 2YWWA 2L41A 2DIUA 2R4FA 3RW6A 2BVZA 3A4TA 3SCKE 2Z2LA 3R5DA 2J7WA 1S1TA 2AJ0A 3MMAA 1RKJA 1JJ2R 4V19X 5LXYA 1PGZA 4KHMA 1EHWA 2WOMB 3AH6A 5F9LA 4ZJQA 4QBUA 1ZAWA 3LPEA 5D0RA 5LSRA 2GVZB 2BDPA 3TQ1A 3P8BB 2W9CB 2CVIA 1HNIB 3ZO7A 1QTMA 5KFZA 1Q53A 3IMQJ 1H0HB 3O1LA 2YTCA 4A8YA 4IFVA 1WDTA 4CLKA 2F8HA 2QSFA 3RB0A 3D66A 5ETTA 1U1RA 3QO9B 2PEHA 4WFNQ 4PXBA 5J2NA 5CYQA 1VJQA 1RWMB 2CWXA 5L39A 4G3IA 3K5NA 4QQBA 4BC9A 1FERA 1X4DA 1HWIA 4KO0B 5B0AA 3ZZRA 3UDVA 3H7HB 2HGMA 3A1YG 3HHLA 1HQUB 1NO8A 1QUVA 1WC6A 1FCAA 4MKVA 4ECWA 3CJKA 2VBZA 3RR7A 4TQSA 4DF4A 3GFHA 4J9VA 5I3QA 4CO0A 2JC0A 1IKWA 4DF8A 1N5VA 4X4NA 3SV3A 1JLQA 4MK8A 3IA0A 1T9WA 3VALA 1LK7A 2JL9A 7FD1A 5KTQA 4NLGA 3CD7A 5I3UB 4O3NA 5ETVA 2I8EA 2NXJA 3ZZTA 4K4XA 4P7TA 3N01A 3NEKA 1R8PA 1P9YA 4JI5F 1N6QB 4LRFA 1KOHA 2R2TA 4ZLNA 1IKYB 2XMVA 5CYMA 3OR2B 3JAMU 3QSIA 2G1DA 5LXRA 3G71S 3U1MA 2FC8A 2IRUA 3ENVA 1HNVB 4Q44A 1TL4A 4B9TA 4WPAA 3RG6A 2EKYA 3WIUA 2CUYA 4K59A 4XDDA 5DGBA 2EXUA 1LWXA 2ZH4A 4B3RJ 2B5JA 3KLHA 1V6HA 1IJFB 1JLAB 4QIVA 5F8JA 4YY3J 2NZ4A 2M70A 2KXFA 2B4PA 5EDWA 4EYIB 1BE4A 4X62F 2HBYB 5KT6A 1WHVA 2OMLA 3TA0A 3H98A 2UXDF 2ZE2A 1IWGA 5B7WA 1X4GA 2EFVA 1ZPVA 3A3OB 2CNKB 3T6JA 4QR1A 1VHIA 3W9HA 5T14A 2MKSA 2PDAA 1OM2A 3T5KA 2FVRA 5ETQA 2V2ZA 2JRSA 4ZK7M 2KM8B 4MK9A 3DLHA 2Z2YB 3DLBA 4RNFA 1SKSA 3GZ7A 2BA9A 2FHOB 2SXLA 2O5DA 4V19J 5KFLA 5D6GA 2CQGA 4Q43A 3EICA 1RYRA 3KOAA 4O44B 4WF9Q 1ZTTA 1NHKL 2V9WA 2W2NP 1F6TA 3DOLA 3GJQB 1YJVA 3BDPA 1X5SA 2DHXA 4RW4B 4UQGA 4R0EA 2DHGA 2DRDA 3OUYB 1FE0A 3TAMA 2NR0A 4NXNF 2MZRA 4J9KA 3ZTQA 4BCAA 5KFMA 4K2XA 2GX8A 3M2UB 1N34F 4QCLA 2YNGB 2Y8YA 3VZIA 3PCOB 1T9TA 5KT4A 1OMSA 2XSJA 1YI2S 1WWHA 1Q5VA 3J7ZT 4DL5A 5FD1A 3ETMA 4FKYA 3VHQA 4QWAA 2I2YA 2FZCB 2GIRA 1IBKF 4DL4A 3CT9A 3CCVS 4NPOA 4B17A 2EG2A 5KFNA 3W2WB 2DH7A 2W25A 4C3LA 1QAJA 4KE5A 1S9EA 5E3CA 2IIHA 3ICLA 3TVKA 2KG1A 3MPDA 3SBMA 1V9OA 5J2QA 1BC6A 1VIOA 1HBMA 4QYZJ 4ZCIA 2XZWA 1FKOB 3QFWA 4XDCA 2HQGA 4USWA 1FRLA 4KHRA 2ROGA 1BXNA 1DQ8A 2LEPA 5KG3A 1M1HA 3K59A 1QTNB 2RAQA 1EQ0A 2ZKTA 4GVLA 5BJRA 1TL7B 1MWZA 3QFHA 3AA8A 1FDNA 2PEBA 4M5JA 2IM0A 1KLMA 1ROFA 2HBQB 4E0DA 2CG8A 2J9CA 2GVDB 1ZZNA 1VQLS 2J8SA 4OLPA 4PWDB 4DHVA 3N5BA 3G8SA 1CJUA 3R97A 2AJ1A 2MKKA 1YJRA 3EVOA 2H5IB 3M2RB 2MGZB 4P74A 2KDOA 1NZ8A 5KFRA 5C7PA 3CDWA 2Q3PA 4QIEA 1LXJA 1S6PA 1NJWA 3EVWA 3M9OB 1BQXA 2IA6A 2Z8QA 3NMAA 4TQRA 3KDNA 2D3OR 2ROPA 1RWWB 1K73T 4NLTA 4Q8FA 1WNEA 4IOBA 3ZZUA 1H6KX 1TVRA 2W8KA 4ED1A 3IWNC 2ADCA 2RJZA 3IM9A 2B9YA 1HMVA 1T9YA 8ATCB 1EP4A 3W5YA 5IQQA 1RTJA 2LLZA 4KT0C 1CS4B 1Q4RA 4DCOB 5MLCV 4K4TA 4ZHRB 5HBMB 4IG0B 1RDRA 4PAAA 1WUUA 3FKBA 2C2MB 3C3LA 4DFMA 3QPIA 4NCGA 4F3QA 1FXLA 4Q2LA 1AZSB 3BH6B 2OPRA 4KV8A 1FXRA 1D9FA 2J9DA 1KEKA 4M5KA 1RB0A 1R8CA 2HEKA 1FRMA 1SQEA 1NUEA 1FFWB 4DQQA 2F9DA 2CPXA 5AE3A 3KJVA 5HMYA 3FK4A 6FDRA 3ELHA 3FJ2A 3OBIA 1VC5A 1EETA 4K0KJ 3I5BA 3AB2B 3I0SB 2HS3A 4OIXA 5F8IA 3SCJE 4C2MA 1URNA 1Y3KA 3O3LA 4IR1A 2ZHBA 1UA1A 4B3MJ 5IM0A 3QT6A 3QIDA 3M05A 3VAIA 1U47A 2ATCB 1HQEA 2MZ1A 1N5YB 3LGMA 5E3PA 3C2PA 1G2EA 1LKZA 1JLFA 1WF0A 2CQCA 2LQ5A 3EJMA 1HQ2A 1JK9B 1TL1B 4RW6B 3SFUA 2JEIA 2CG4A 3F0NA 1LWCA 3R5GA 1KVJA 1DQAA 2FVCA 3CCRS 3M1VA 1NJXA 4OFZA 1KRPA 4N8NA 1S1VA 2E1RA 1FRIA 2VB6A 3K5PA 2PMWA 4WE1B 2OPSB 2HFSA 3HLUA 2VPXB 3FQLA 4ZPWR 3GE9A 2CQ2A 1SC3B 1S6UA 2N82B 4DL2A 4DV3F 2JFKA 5FLXY 1GMWD 3JTPA 2HQCA 3MXHP 4C0BA 2L48A 5GAGI 4PYDA 4RU2A 4XIUA 1KDNA 1PAUB 3EGVA 5H9FK 1YIJS 4JI0J 2HBZB 5KG2A 4RO0A 5ETOA 1XIQA 4B3SJ 3BBBA 3W5ZA 4ILMA 4LF8J 3RU0A 1DTQB 2A0FB 3DOMB 3RBEA 3ILJA 1AB8A 1S1WA 1MSWD 1X4FA 1FJ7A 2E7XA 3HKZD 3EDQB 1ZBTA 2ZOGA 1C1BB 4PWUA 2VJVA 2E44A 2XTJP 4QPXA 4HTIA 1OY9A 1HBUB 2FJEB 2YQ0A 3GONA 1U1MA 2WAQD 2VA3A 1QSLA 3N6MA 5L9NA 2XGPA 4PQUB 2HNZA 2ACMA 1RLDA 3TX8A 2DXDA 3QJLA 1ZAVA 5IZHA 2DR9A 1WSVA 3OVSA 2IBKA 2Y9HA 2C2DA 2C3YA 2IC3A 2XHCA 3KUHA 1R0AB 2IYGA 3OL6A 3DCAA 3I9ZA 4E2FB 4DL7A 3QZ7A 1E6YB 4FYYB 2HHHF 3K0JA 2E9ZA 4WP8A 4CQ1A 3CJ4A 3MMCB 3DRSB 5C24A 3AD7C 2DXFA 2W9BB 3EYZA 1PSDA 3V81A 1JLCA 4RW7B 5EHHA 2Y1RI 1QE1B 1R27B 1L5UA 2CADA 1WI8A 2E66A 3HULA 2MHEA 4F0KA 2YKOA 3QLHA 3DKDA 1PG5B 2M4MA 2RRAA 2IM3A 2FLPA 3V6DA 3DLGA 1X4HA 4KH0B 1KHWA 3QIPB 2QYCA 1HD0A 3PW4A 3DU6A 4DUTA 2V4QA 1XN9A 2AEFA 4DV5J 2EK1A 4LFCJ 2MMYA 3O6QA 3CCES 1BGXT 4Y65A 5HMXA 3PIPQ 5LJ3Y 2WBMA 2N7YA 1SH3A 2DBBA 5EGYA 4I7FB 4NZ0A 1OJ4A 4ES2A 2P5VA 4TU8A 2FYXA 4ECYA 1DZ5A 4A48A 3TUIC 4IYQA 2CJ9A 3WZ0A 3I56S 1YJUA 4Q2MA 1JKHA 2DR5A 4BLGA 3PV8A 2K8GA 3MEDB 1RAEB 2GJ2A 5DGAA 2HHXA 3QT5A 2AYEA 2AKWB 2OGUA 5LMNJ 2K3IA 4I2PB 1OPIA 4DSIA 4OZ1A 2GS8A 3MD3A 1PBAA 1RAOA 1VQ8S 2CQ3A 4J7CA 4YN3B 2WTFA 1QDUB 4KSEB 4PR6A 5GAHU 4HL9A 4XO0A 4EBEA 3C14A 4IRKA 2MJUA 2ZBCA 5D77A 1HI8A 1HPZA 2DNZA 2C2OB 2IRXA 3OL9A 4LF2A 2OEMA 1XR5A 1JLEB 5JUMA 2C3OA 4P73A 5C25A 3MM6B 4YQWA 1VIXA 2RDDA 2FGOA 4AD6A 4MYTA 3MM5B 4NMXA 4F02A 3OTBA 3PVXA 1NPKA 5D8HB 2FD2A 2HMIA 1SUQB 3PTWA 3H59A 2P9GA 5A2QU 3FQKA 1WTFA 3CD0A 2WVEA 3J7YU 4ANCA 1RAFB 3KLEB 1YWXA 3KLIB 4UZCA 1X9MA 3VAFA 4L76A 3PX4A 1NB7A 1U48A 2W8LA 3BQ2A 4ZP8A 4CLYA 1FTRA 3M8PB 4QWEA 4OX6A 4N47A 2VG7A 3K2YA 3OFEA 4I6AA 5E41A 2BACA 1J27A 3KG4A 1N4LA 2VV5A 4FZVA 4QPTA 2M8HA 2KJWA 1TK0A 1RADB 4X65J 4IOAQ 2PE8A 2IVFB 3SDEA 2DITA 1TK5A 4N77A 3MR7A 4M5DB 1RT5A 1TKZB 5HP1A 3PKMA 5J1EB 3HZGA 1PC4A 3U1LA 2ADBA 4LSNB 5DDOC 4YHHF 3HHNB 4LSLA 2C2ZB 5EWFA 1B4SA 3C16B 1X4AA 4U7UD 4CLZA 2CJBA 1ITPA 4H4MB 2NPIA 2GHWA 4KBIA 4DS5A 3P49B 2HQIA 2XY5A 4DV0J 5DO2A 3WC0A 4ZIWA 1HYSB 6FD1A 2DXEA 1WG4A 1DRZA 1Q78A 3IBWA 2BANB 2XMAA 5KOWA 3VAKA 1N54B 5D4LA 2V2KA 3O8WA 3PW7A 4O4GB 4UT4A 3KLGB 3G8TA 1X8DA 4YB6A 2B9XA 3Q8UA 1TKTA 1PYSB 2FJVA 1F0XA 4NXMJ 3CJ2A 1DHMA 1HA1A 3A8EA 2E5HA 4C7QA 3CDEA 3LP2A 4IFYA 4X66J 3T41A 3KG1A 3T9NA 3PW0A 5ETPA 3HJVA 1HD1A 2VBYA 2ZJPQ 3BKFA 2B4UA 3LWLA 2POKA 3CDAA 4F4KA 3M2VB 4ED7A 5DLFA 4KFBB 4ZIVA 3C6TB 2B0GA 4WCEQ 3KXDA 4RWXA 5B0GA 5IV4A 3KK1A 2V0NA 1NKBA 3HVTB 2IAJB 2J0QD 2PC6A 2UUBF 1GX6A 3IP0A 3UD4P 2J6UA 5ETLA 3BKTA 4C0OC 1CJVB 3I6PA 4J9PA 4L72B 3OTOJ 5ETMA 4M5HA 3QNWB 3TJ8A 5EX3A 3B78A 4L3KA 2ZOFA 3BEGB 3V4IA 1OSDA 2FHJD 1RTDB 4USJC 3H90A 4MMOA 2HWTA 3MOZA 3M30A 3GIKA 1V3ZA 1KOOA 5GMKa 3V6KA 1RA7A 1WSRA 3MEKA 2N4CA 2NSBA 4LF5F 3WDOA 2B7BB 2R7UA 3R5BA 3MFIA 2MKCA 2XMKA 2KKHA 5E5NA 3CCMS 3MGJA 2YNHB 1FKPB 1N56A 3DC2A 1FRKA 4M5GA 3BO3A 1VQOS 2G0JA 2OH2A 4ELUA 5KG0A 1YLXA 5F0UA 2YH1A 1MU2A 4TN2A 2IDLA 3P3DA 3MAAB 4CM2A 4CLLA 1RCOB 2CQ0A 3UWTA 4LR9A 4KB7A 2WCXA 1UW9A 1FK9B 1FDAA 3QQCD 1DTTA 3QGPA 3QT7A 3HVWA 4HHHA 3TR5A 3QJJA 4NRTA 2FJDB 5H1SV 1NPRA 3IRXA 4C4WA 3NWGA 4C97A 5GAEI 2E7WA 1UJ4A 1IBMJ 2MB0B 2WSFC 2KL8A 1APSA 2HQ3A 2JLGA 2VIHA 1NAQA 4WFXA 3H5SA 3EGWB 2AW0A 2AHOB 2UU9J 1IN0A 2ZHAA 2RU9A 5HVGA 4C8OA 4JV2A 1SJ3P 3O5TB 3MEEB 1ZOTA 2MHNA 1SV5B 2RVJA 3NGDA 1E6VB 2CJKA 1ZM3A 5DQGA 4ZVSB 1YG0A 2D7SA 4WKYA 2LEBA 3LA0A 1HW9A 2AGOA 1KONA 2W2MP 1L3TA 5KFFA 1KQKA 2KT2A 4AUKA 1M1GA 1S0VA 1VDHA 3RRHA 1Q81T 1Y9OA 1U8WA 1FE4A 2FQQB 5CCMA 2BW2A 5FDLB 4DPUA 3TOQA 4ALZA 4ZPDA 5DG9A 2KZZA 3I32A 2E1AA 4PG4A 4Y34A 1BD6A 3MF5A 2DCLA 3HSDA 4A8SA 3EGNA 6AT1B 1NBEB 1BLUA 1MROA 2QL5B 2DH9A 3BYRA 2D3O1 3CGIA 3UCUP 2KXNB 4J9OA 2YPYA 3L09A 4LRBA 2PT0A 3FCVA 3PRDA 5H9EK 1IBLJ 3M6WA 3HD2A 3CJTA 1VQ7S 4DV6F 2LU2A 4O3PA 1Y00A 2IM2A 3I87A 4S0MA 2FY1A 3C66A 4ECUA 1U1KA 2MLZA 3GG1A 1HHSA 4ECTA 1UFKA 4OZ0A 4HHJA 3EPIA 2G4BA 4CZCA 1IKXA 2BKOA 1YHQS 2EFGA 5CQGA 2WVBA 3RGIA 1XMQF 2YX4A 4EUVA 4PG5A 3OL8A 4ZPVR 2VG6A 2VQFF 3M8QB 3MEGA 1CVJA 2P2CB 4CLSA 1BQNA 5IWAJ 2XLKA 1VK3A 2DNPA 1HI0P 2VASA 1EZZB 2RB7A 2D3UA 2E9TA 4DCJB 4EU0A 3VV2B 3QMQA 3I4HX 5K9FA 5IXUA 2DNYA 1LW2A 3THPA 1M1KT 4C3KA 3POTB 2EBGA 4FS2A 3TWZA 2KM8C 2C42A 2FHJA 4BWJA 3IXQA 4UUWA 2M0GB 4IR9A 2GO8A 1KQSR 3LGNA 1P1LA 3DYAB 2AF6A 2AZ1A 4B9LA 2XNQA 2ZHOA 1RAHB 3W2VB 4LIRA 2EPIA 2ZKUA 3G9CA 1IWAA 5KFAA 4YR3A 4PZVA 3L7OA 1FEHA 2ZZMA 5HQLA 3MM8B 1F60B 2UUCF 3R5JB 4B3OB 1Q16B 4Y6IA 1OO0B 4GVBA 8AT1B 2Z4PA 3AQOA 4KGKA 1I94F 4J37A 1WDDA 1F5CA 4RUCA 1O5JA 3Q86A 3ITHB 1IQTA 3KLFA 1UWBB 1FDDA 3GSIA 4Y2AA 3DRRB 1NK9A 4B9NA 4XTTA 4AQYJ 2VC0A 2IM1A 2HNYB 1UZHA 4QR0A 1A0OB 1FT8A 3EXYA 3LOUA 4LVOP 1U1QA 4ECSA 3T9ZA 3FBFA 1XJWB 4AL6A 1NRKA 4FP9A 4DL3A 3KK2A 4JI6J 1WG1A 2L9DA 4KO0A 5T7LA 2JVRA 2N3LA 4X84A 2C2KB 3TNVA 1JLGB 4I2QA 4CO3A 2F7VA 4ID5A 1WORA 1S9FA 5LMUF 2E1CA 3CC4S 2Q6BA 5B0EA 2ZH1A 3FSIA 4K8RA 1T05B 2CYYA 3TA1A 2A3JA 1UVMA 2ILYA 4MKBA 4A8WA 2HG4A 3OT9A 4IKAA 3BR9A 2CZ4A 3DLKA 4OJGA 2V5HG 1XMBA 2FZKB 3GLJA 3OR1B 4DL0C 3Q8RB 1JLBA 2NSCA 2ZH3A 2P9EA 2HNDA 3IRWP 5BYSA 4F2SA 1R6YA 3F56A 4CRJA 3IM8A 1NK6A 3QWPA 2P6SA 4JI7F 5IQ6A 3PRBA 4F4WA 3D2WA 4DR1F 2DGSA 4BBYA 2RUGA 3RB4A 1RLCL 1U49A 1IKYA 1UFWA 2J76E 1FHTA 4OX9F 1XERA 1OY6A 2GGPA 3CTRA 3UE2A 4M5LA 4Z37A 4KR0B 3GP9A 1O8BA 4A47A 1ZM2A 4NX9A 4I4BA 3Q8SB 2H9ZA 2YKNA 2N7CA 1Y0HA 3R8YA 1K0TA 2YWFA 1HWLA 3BQ1A 2DGOA 4IDKB 1N0UA 1KFSA 2WW8A 2BE7D 1JJCB 3IR6B 1EKRA 3R2DJ 4ES3A 4FN5A 3GR1A 4DQPA 1S59A 4KYZA 3AWRA 3JXOA 2GO9A 3TAPA 2AIRB 2G2ZA 1GXTA 5K8PA 3FFIB 2VODA 2EK6A 1VBZA 2C2RA 4DJBA 3NS7B 2FJWA 1U26A 3UN3A 2XY6A 3AHPA 2PI5A 4ER8A 2FHKA 1N0VC 2UXCF 5M2UA 2XEXA 1YK9A 3SMZA 5KG4A 1S48A 2NLWA 1U0SA 4BWMA 1SJQA 2V68A 5IV3A 3M32A 4B3TF 1GXUA 2DY9A 4FF4A 2IMOA 2LP4A 1K1QA 4CCHA 2JZ5A 5A8KB 4ECZA 2G0CA 1QM9A 2VFRA 3AOBA 2I5JB 3P5BP 3DOKA 3KHRA 3AB4B 4DSKA 4KQZA 3IG1B 3CMES 1KR4A 5GMDA 3LTOA 3AJ2A 5AJ3J 2ZBIA 1S9GB 1WC0A 2RS8A 2V8DA 2CFXA 2UUWA 3TRGA 1KQFB 1RT2B 2UXBJ 1MMLA 3PYDA 3A13A 5C42A 5KT3A 1J5EF 1P27B 1EJ7L 3VVTA 2XS5A 4J9MA 1RK8A 1RUSA 4ZVEA 2DGUA 2AX1A 2C2EA 1YTYA 2DKOB 3LP1A 3M6UA 2XMMA 2FVSA 2LA6A 4N56A 3Q8VA 4RR5A 1TK8A 3BGRA 1XQIA 3UVJB 3S01A 5I3PA 5HLFB 3KUEA 2XTEA 3DHXA 4OI6A 4FDFA 4M5NA 3GIMA 4GC6A 5EN1A 1I5OB 1QVFR 2DYAA 1PBUA 4JV5J 2XCPA 3MCMA 3MECA 1DBDA 3MMBA 4DR7J 3LQVA 2BR0A 1JB0C 2BBEA 2DHSA 4U7CA 1U8SA 2ZD1A 5J2MB 4I6WA 3LPYA 1YBUA 1UTAA 3N6NA 2XQCA 1JX4A 1CJTA 2ZH6A 1U25A 4OYAA 4O3RA 3FZ2A 2X1AA 2DR7A 3W1YC 3NGKA 4HDHA 1WOPA 5HAOA 1S12A 2XI2A 4N5SA 2HRUA 4A8OA 1EB0A 1U6BA 1IM6A 5K8OA 4C8YA 1S1XA 2FLOA 4PWDA 2RU3A 2E5IA 1N48A 1WEXA 3O2IA 3PZPA 2ZUAA 4LQ9A 2MQLA 4RW9B 1G6BA 3ZTPA 4DSEA 3MM7A 5L8RC 2CNNB 4O3SA 3BDEA 4DR4J 1I1GA 1KQGB 4A8XA 4UTGA 2DGWA 1UEVA 4LSZB 2H65B 1OQ6A 1KTVA 1QSSA 3JB9k 3G4SS 2QTWA 1HARA 2ZNYA 4DX6A 4HR2A 4KPCA 3BQ0A 2AJQA 1RJJA 4NOHA 2WVDA 2P6TA 4DUYF 3MPYA 4KKOA 2H5JB 4CTAA 2WB4A 4KHPJ 2R7RA 2UUAJ 2WVCA 1S1TB 3MMAB 2IFXA 2ZJRQ 3SCIE 2CA9A 1S99A 1HNZJ 3TAQA 3ILLA 2HWIA 4ANDA 4OZNA 3WX4A 4YB1P 4HACA 2ZZNA 2QGFB 3E51A 3VQTA 1TL3A 3W8PA 1TP7A 4AYBD 2HW3A 5AXMA 7AT1B 2JFDA 3ONQA 2O01C 3KHGA 5B0DA 2HFZA 2EWHA 4CLPA 2XCAA 2WONA 4IFVB 4HKQA 4ZITA 4G1QA 3RRKA 3ISND 2GCFA 4R5PA 2JX2A 4HI1A 4K7QA 4QYRA 5CYQB 5HI7A 3TEGA 4DSLA 1TUGB 2BUNA 2BYCA 4URQU 3R6GB 3MOJB 2QMWA 2JHEA 2B9WA 4FPRA 3GJTB 4BC7A 2AYGA 1WF2A 4N8OA 1QAIA 2D74B 2RS2A 3HHLB 4PCQA 1HBOA 4EYHB 4NLRA 2BQRA 3CJKB 2FVPA 1R8BA 4X2BA 4NLQA 2JEJA 1Z1ZA 1G1XA 1S0MA 2KYZA 4DR5J 4O3QA 4ZCLA 3F44A 1TKXA 2FTRA 5H9FJ 2PFFB 1FKAF 3R1LA 1IKWB 3CDUA 3FVYA 2XZTB 4U8VA 1TZ0A 4DR6F 3SSSA 1L3KA 1JLQB 3AQPA 2DNNA 4DV1J 1TL1A 1ULRA 4ZOSA 1LWEA 1MWQA 4U6PA 4UY85 3KJNB 3TZZA 1CJKA 5KT7A 1R0BG 4A46A 1U1NA 2OPPA 2CJXB 3PX6A 9RUBA 4RUBA 3PJWA 5HROB 2X1FA 2F40A 5KFPA 1W2IA 3TI0A 5CYMB 4ELVA 5F8MA 1D09B 3R7NB 3CE8A 4JI4F 4DCPB 3HO1A 3HSGA 1U2FA 2W01A 3CJ0A 3G8QA 2VHGA 3OTDA 2GJIA 1DLOA 1Q1KA 1HLWA 4DSFA 1X4BA 3GMGA 3FEYB 2VU5A 2BM1A 5KAKA 5DRKA 2WZ1A 3CCLS 4U96A 2B5JB 4NEZA 1DTQA 3HZEA 3KLHB 5IC6B 1HNXJ 2VPZB 2MZSA 5FJ4A 3C15A 1NSAA 4ED4A 2MSSA 3GCWP 4AXIA 1MLAA 4RBUA 4JI3J 1RE1B 3E8OA 4J91A 1W7WA 2XMWA 1BMQB 2J7UA 4QR2A 4DPXA 2PSZA 1RYSA 1FWKA 2ZE2B 3GTYX 2R8HA 1AUSL 3NY0A 3PJ9A 3MAQA 1NPPA 1IR1A 4BHQA 3OV7A 1JMTA 3NRBA 4TYBA 3ET6A 1KNZA 1GTEA 1FO1A 2Z57B 3MR2A 1UWAA 4B9VA 1AT1B 2HURA 3M8WA 2RQ4A 2NUHA 3T6BA 1FFGB 1HFEL 3MI7X 2J6TA 3OJUA 1A7GE 5KG5A 5RUBA 3DOLB 4CNZA 4RNMA 3RJMB 3NKYA 4RW7A 2K7JA 2MQNA 4MAKA 3LH2S 2Q79A 1QJHA 1K47A 3TAMB 4ZMMA 4JI2J 1M5KC 4KGXB 1LOUA 3OVAA 3G82A 4DN0A 3IS9A 3BPDA 2GMLA 3FCWA 5THWA 2XSJB 5I4MA 2L08A 2QLJB 1UPPA 3AD8C 3R2CJ 3CJ3A 3Q83A 2BE2A 1J5OA 1RHKB 2E1PA 3J7YI 1XWLA 4P9SA 3T1AA 2QYGA 4Y0FA 4PUOA 1WKLA 4EGLA 1Q8KA 1RT6A 4WTOB 1KS2A 3RBXA 1S9EB 5K14A 2CQBA 2AYBA 3UFCX 5J2QB 3JQMA 5BR8F 1HBMB 3TVZA 3BO4A 1UJ6A 1YZ6A 5D0GA 2WVFA 4NI2A 3TEHB 3TJ9A 2C2NA 3US5A 4DUZJ 3RR8A 5F0WA 3AFGA 3I0RA 2ZH7A 3WIVA 4EZ9A 4JI1F 5D4PA 2W9AA 3KLVA 4NL5A 2RNEA 3B82A 2PMHA 1KLMB 1Y7PA 1N32F 4WYLA 2DEJA 3E01B 3KTQA 4QW9A 2HHSA 2CPIA 5F3ZA 5D78A 4FS1A 1GTHA 2DRAA 4ZVTB 3D1QA 4MKAA 5CXTA 4DX5A 2EC2A 5KFSA 3VTIA 2VOPA 1L3VA 2L9NA 2G9OA 3DHWC 2QIFA 1U0HA 5A8WA 3KKFA 1S6PB 5LOQA 4X4VA 2HFUA 2JLFA 3VQSA 2Q1LA 4R0JA 4YDDB 5A6PA 1Y3JA 4I64A 2V9KA 3RYLA 1Y5NB 2DR8A 3W8GA 3PHTA 3KJQB 1C0UA 2R2RA 5LSOA 3S1TA 3PRVA 1TVRB 2YH0A 3CF5Q 4EEYA 3WC2A 2QLWA 1Q0NA 4X4UA 1SQGA 1HMVB 4DV2F 1EP4B 1RTJB 3D9BA 2GFFA 3ZZYA 4WFAQ 2E5LJ 1U6FA 3OD2A 3WQPA 3QWUA 4NCBA 1B7FA 3IWLA 5B09A 1V5IB 4P6QA 3OTEA 2RRNA 2LECA 3HVAA 2N4DA 4NCGB 2DHHA 5DLGA 3D3CJ 2OPRB 1D3WA 4KV8B 4NCAA 2JJ4D 1T9XA 4CH7A 1YBTA 3CEDA 3IGVA 2DVIA 1GQEA 1PCAA 1M5HA 2FDNA 4CLTA 3KJVB 1U09A 3U27A 3ZZOA 2UV8G 1EETB 1YJ7A 4TYAA 2FGCA 3VGUA 2WBRA 5E7OB 3UD3P 3KG0A 3ZNJ1 3BV8A 3BF4A 5IM0B 1IM4A 1WI6A 2V50A 4O3OA 3HK2A 3DGVA 2XM3A 2B9EA 1HR0J 3OL7A 2R8GA 1WC5A 1JLFB 2K7KA 4NLYA 1S4FA 2BQ3A 3DDKA 2HYIB 1GFWB 4TVAB
chains in the Genus database with same CATH topology
4OZLA 4U67Q 3MR5A 1U1OA 1TQLA 3IBWA 4DEZA 1UEUA 3O44A 3NNAA 1HYSA 2B7CB 1TKXB 2OSRA 2BANB 2APOA 1NK8A 1SKWA 5KOWA 4IRDA 5HN0A 3VAKA 3UQSA 3CB4A 3QO9A 4MK7A 1BY9A 1N54B 1Q7LB 3DRRA 3CWJA 3NAHA 1DJ0A 5D4LA 1LWCB 4LF7F 3JYTB 2HS0A 2DNKA 2V2KA 3O8WA 5A0YB 4R8UB 4FF1A 4OLOA 1BQMB 1QSYA 1S76D 1KHVA 3PW7A 1TKTB 1QY7A 1RT3A 1SBRA 1PC5A 4O4GB 1X9SA 1LWEB 2KHDA 3M1VB 3CDBA 2ZITA 1TR0A 3KLGB 4HTJA 4UW2A 2HNYA 3JYTA 3G8TA 3CSKA 1X8DA 2UUTA 4YB6A 3CCQS 1Y4ZB 1TAUA 2B9XA 2DNQA 1S1VB 2OPPB 3ZZPA 1TKTA 2FJVA 4KTQA 3OTOF 2MQOA 2OFGX 1F0XA 3KYLA 4AE5A 2HHQA 1QAXA 3CJ2A 2YY3A 3K5LA 1DHMA 4YR0A 1HA1A 1OS5A 1SC6A 1WF1A 3A8EA 2E5HA 2R7WA 2VG5B 4B9UA 4C8LA 2A1BA 3KLGA 4C7QA 3DNCA 3CDEA 2GQQA 3LP2A 4IFYA 4DQIA 5IFMA 3JSYA 5CH7B 1HQUA 2OD6A 1SH2A 3KG1A 3T9NA 2O67A 3PW0A 1YQHA 2OO4A 1D0EA 1YRUA 2CQDA 3PDNA 1HD1A 2VBYA 2ZJPQ 2LDYA 4QWBA 2B4UA 4ZP9A 3LWLA 5JVHQ 1Q7YT 2I9SA 2POKA 1FNOA 4OX7A 1VQNS 2XB2D 2YNIB 3CDAA 5KFQA 4F4KA 1JLGA 4J9RA 4EWTA 3M2VB 3FRZA 1PILA 3C6UA 4ED7A 1FVQA 5DLFA 4KFBB 4B9MA 3B4MA 4G1IA 3C6TB 4RZRA 3CCZA 4NLWA 1HNWF 4LF9F 2B0GA 1KFDA 2CDQA 4WCEQ 4RWXA 1WHYA 5B0GA 3CO9A 3X1LB 2OPQA 3KK1A 2V0NA 1NKBA 4DFKA 3HVTB 3M8RA 1T05A 4C0HA 3RRGA 5L1KA 4LFBF 2IAJB 2WSEC 2PC6A 2J0QD 1GX6A 2UUBF 2HFNA 3UD4P 3HJFA 2J6UA 1X0FA 4C0OC 1URRA 3PFOA 1XR6A 3I6PA 1T02A 4J9PA 4L72B 2OAUA 2WSCC 1DLOB 3JAMY 2YWGA 1UVKA 3GQCA 3CC7S 1KD1T 3NCQA 2JH3A 3BB5A 5I3UA 2J0XA 1O0PA 1Y5IB 5EX3A 3B78A 4X4PA 2ZOFA 4L3NA 3BEGB 1YSJA 5KOXA 3LANA 1SIWB 4ILRA 1WELA 3OR1A 4ED2A 3K8WA 3K58A 3V4IA 1K8AT 1CPZA 3EX7B 1S1WB 2CQIA 1OSDA 2FHJD 1ZETA 3GFXA 3MDFA 4RX6A 3BO2A 4QIGA 5EX0A 3L7PA 4PXEA 1RTDB 5C5JA 3BSAA 1N6QA 4HT5A 3IN5A 4USJC 1REVB 4MMOA 3HDSA 2OFHX 1H7XA 2HWTA 3MOZA 5KT5A 3M30A 3GIKA 3E2EA 1V3ZA 1WHXA 5B08A 2VQEF 2VH7A 2DNLA 3Q8QB 4EBDA 1KOOA 3OR2A 4I67A 1W25A 5KFOA 4PG7A 2D41A 5GMK