4NLTA

Poliovirus polymerase - s291p loop mutant
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
461
structure length
457
Chain Sequence
b'GEIQWMRPSKEVGYPIINAPSKTKLEPSAFHYVFEGVKEPAVLTKNDPRLKTDFEEAIFSKYVGNKITEVDEYMKEAVDHYAGQLMSLDINTEQMLEDAMYGTDGLEALDLSTSAGYPYVAMGKKKRDILNKQTRDTKEMQKLLDTYGINLPLVTYVKDELRSKTKVEQGKSRLIEASSLNDSVAMRMAFGNLYAAFHKNPGVITGSAVGDPDLFWSKIPVLMEEKLFAFDYTGYDASLSPAWFEALKMVLEKIGFGDRVDYIDYLNHSHHLYKNKTYVKGGMPSGPGTSIFNSMINNLIIRTLLLKTYKGIDLDHLKMIAYGDDVIASYPHEVDASLLAQSGKDYGLTMTPADKSATFETVTWENVTFLKRFFRADEKYPFLIHPVMPMKEIHESIRWTKDPRNTQDHVRSLCLLAWHNGEEEYNKFLAKIRSVPIGRALDLPEYSTLYDRWLDSF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-directed RNA polymerase 3D-POL
publication title Distinct conformations of a putative translocation element in poliovirus polymerase.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein, hydrolase
total genus 135
structure length 457
sequence length 461
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nltA03
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nltA02
4RW8A 2HNDA 3N6MA 3UQSA 2IJNA 3NAIA 4O3PA 1RTDA 4WZMA 4F4YA 5KFEA 5EWGA 3V6DA 1KHVA 1DLOA 1OS5A 1TQLA 1RT4A 4NLXA 4DL7A 3RBDA 1J5OA 2J6SA 4Q0BB 3LP1A 3Q8SB 4RNMA 4IFYA 5KG3A 4F50A 1JLBA 2HWIA 5DG8A 4ECWA 1RTHB 1TKXB 5KT4A 4RW9A 1NHVA 2YNGA 4RW8B 2HNDB 4G3IA 2AGPA 3PJWA 3QGGA 3PW5A 4HKQA 4IKAA 4ZPBA 4KB7A 1RTDB 2VA2A 5EUHA 4J9RA 3M8PA 2YNHA 3RB3A 4ED1A 1T94A 1DLOB 5DGAA 4TYAA 4IFVB 1HPZA 3OSNA 2XI3A 3DRPB 1JLFA 4NZ0A 5HBMB 3LP1B 2V0NA 1TV6A 3CJ3A 3MTKA 3KLEA 3KMSA 4I7FA 1RA7A 4IQXA 1JLBB 4RW6A 3KLHA 2B5JA 5L1KA 4J9QA 4Q8FA 4RW9B 3D28A 5CYQA 3GV7B 1JLAA 3HHKA 4O3SA 5KFWA 1IKXA 1IM4A 5F8GA 3NMAA 2RKIA 2FLLA 1C0UA 4KHMA 2B43A 4G1QB 4O3OA 1JLGB 4DL3A 2YNHB 3BR9A 4PUOA 3CJ5A 3E01A 4KFBB 4FBUA 1SH0A 4KSEB 4ECZA 4ZPDA 1XR6A 1HPZB 5KG5A 1S4FA 3ICLA 1JLFB 1LWFB 1FKOA 1TV6B 3PHEA 2HNYA 4YMEA 3KLEB 1EETA 2DPIA 2ASJA 3GQCA 4JUZA 4RW6B 3KLHB 2B5JB 2W7PA 2R2SA 2BQ3A 1RAJA 3CIZA 2C2RA 1S9FA 3GV5B 3BSNA 1JLAB 1RT3B 3TAMA 3KLVA 2RKIB 2YKMB 1C0UB 1D0EA 2WTFA 1C1BA 4IG0A 2FJXA 4K4TA 5KFYA 3JYTA 5CYMB 2VG6B 4NLTA 3GIKA 3FQKA 3BSAA 2WHOA 1SUQB 4NCGA 1VRTA 1FKOB 3DLKA 5KG7A 4ZVEA 3BQ0A 4ZVHA 4K4XA 3PW2A 3CJ4A 3FFIA 3M8QA 1N48A 3NBPA 3PW0A 4F4XA 1IKYB 5F9LA 5I42A 3H98A 4ZMMA 1LWEA 1N6QA 2BE2A 2GIRA 3UPFA 1S9EA 1TL3B 4EO8A 2WRMA 1HNVA 1W25A 1WNEA 3DMJB 4KKOA 5KFMA 4U6PA 3JYTB 4QW8A 2IM3A 2RDJA 2IAJA 3KLIB 3PW4A 3EPIA 1U09A 1HNIB 3KLFB 4NLYA 1NNDA 2OPQB 4ZVFA 5KFQA 3DLKB 2IM0A 1TL1A 3CO9A 4YR0A 3H40A 1EP4B 4IRDA 4TY8A 3FFIB 3GV8B 1N5YA 4WYLA 4EBDA 3MEDB 4R0EA 3DRRA 3GILA 1K1QA 4IDKB 2W8LA 1R0AA 2D7SA 1LWEB 2GC8A 5DQGA 2JC1A 4K4ZA 2BE2B 2YNFA 4GC6A 2W9BA 3DRSB 2AGOA 1N6QB 4M95A 3Q8PB 1HNVB 3UR0A 4KKOB 5KT7A 2B6AA 5I3UB 2HMIA 4WYWA 3M9NB 2UVWA 1RT5B 4MFBA 1TKZA 3KK3A 2V4QA 2ALZA 1S0OA 4DEZA 2C2EA 5KT6A 1TL1B 2WB4A 2HAIA 4Q45A 3ITHA 4MIAA 3KHHA 4WFZA 3GIMA 4TY8B 4O3NA 4YP3A 4J9LA 2VA3A 5F8NA 1S1UB 1N5YB 1S6QB 4QWEA 3I0RB 1TKXA 1R0AB 3DI6A 4DG1B 3DLEA 4RU9A 1S0MA 4F4ZA 5F8MA 2I5JB 2W9BB 4ECUA 1ZTWA 1IKVB 2JEIA 3NAHA 2IM1A 3H4BA 2HMIB 2B6AB 2F8EX 2FVSA 1VRUA 3SFGA 4MFBB 1S0NA 3DM2A 1TKZB 4XPCA 3KK3B 1S9GA 5JUMA 2WOMB 3DOLB 2IC3B 3FQLA 1S49A 3RB6A 2C2DA 4KO0B 2HWHA 5KG1A 3V6HA 3IGVA 4IFVA 3BGRA 3E51A 4DL2A 4K4UA 3ITHB 3DRPA 4WE1B 5HBMA 5DGBA 2BANB 1REVA 3CJ0A 2E9TA 5J2QB 4NLQA 4H4MB 3V4IA 5KT3A 3DI6B 5C5JA 3DLEB 3Q8RB 3N6NA 3NL0A 3IGNA 3OL7A 4ZHRB 1D1UA 4KE5A 1RT1A 1RDRA 3MR2A 1VRUB 2FLPA 4G1QA 3DM2B 1JLGA 5DG9A 3RB4A 1S9GB 3QIPA 3I5BA 4J9KA 4TY9A 4KFBA 2JLEA 4IOBA 4ECXA 4PWDA 3KHLA 3CDEA 4J9MA 3BGRB 4NRUA 3Q8QB 3ISND 4WFXA 1LWFA 1NHUA 1RTJA 3PJXA 2AWZA 2OPPB 4TYBA 1SH2A 1REVB 4QPXA 1S97A 5D3GA 5KG2A 4IG3B 2ZE2B 3V4IB 1FK9B 1TKTB 4ECQA 1RTIA 5L1IA 3LP2B 1QAIA 5KFPA 2R8IA 4NLOA 1RT1B 1RT3A 5KFXA 3PR5B 2WCXA 2UVUA 3TQ1A 2ASDA 2YKMA 3MECA 4ZP7A 2YNIB 1XR5A 3QIPB 5KFKA 5CYMA 2ILYA 2VG6A 2R8JA 4R8UA 3C6TA 4PWDB 5J2PB 4WXWA 1S1WA 5KFSA 4ECYA 3V6JA 2UVRA 1SUQA 1KLMA 4K4YA 4WXOA 2XGPA 3BQ2A 4U7CA 1RTJB 5KFIA 3EPGA 2FJWA 3GIJA 2WONB 5KFFA 3D5MA 4ECSA 5D3GB 5F8LA 2RDIA 1RT7A 3G6YA 3TVKA 1RTIB 1JX4A 1HQUA 1RYRA 1IKYA 3DLGA 5KFDA 4JV2A 4JV0A 4X2BA 5T14A 1RT2B 1SV5A 2XCAA 4ZP6A 3MECB 1TL3A 2JEFA 3DYAB 2W8KA 3RAXA 4XPEA 3H59A 3DMJA 3LP0B 5KFUA 4FS2A 3RBEA 5HLFB 2BR0A 1T03B 4ZPAA 4R8UB 3C6TB 1LWCB 3CVKA 3KLIA 3KLGB 4ED2A 4RNFA 3N6LA 1S1WB 4RUAA 1HNIA 1S6PA 5HROB 3KLFA 1KLMB 2OPQA 4DL6A 1GX5A 2AU0A 2VG5A 2AX0A 3C6UA 4NLDA 1S10A 1EP4A 5KFVA 4LQ9A 1SH3A 1UWBB 1RT7B 1DTTA 4ZP9A 3LANA 3MEDA 1HQUB 5F8JA 1CSJA 4ZP8A 1IKWB 3DLGB 4EBCA 4IDKA 5KFAA 2V4RA 3OL6A 2R2UA 1SV5B 3QLHB 4I2PA 5DQIA 5C24A 3RAQA 2ATLA 3DRSA 3KHRA 3PR4A 4RNNA 1MU2A 3OHAA 2QE5A 3QGIA 4WFYA 4QWCA 5I3UA 1JXLA 4O4RA 4NLSA 5F8IA 1RT5A 4RNHA 5KT2A 4ED7A 5EWEA 5DLFA 5KG4A 2BRKA 4GC7A 4B3OA 1C1CB 1S6PB 4IRCA 3KOAA 2CJQA 2VG5B 2VG7A 3C6UB 4IR1A 4ZVGA 1HYSB 2UUTA 3G86A 1S1UA 1DTTB 2D3ZA 4ZPCA 3GYNA 1S6QA 3QIDA 5J1EA 3I0RA 2XWYA 3OHBA 4DG1A 2OPRB 4RUCA 4I2PB 4LSNB 5C24B 2I5JA 2RF2A 1IKVA 1MU2B 5KFBA 4NLWA 1S1TB 1ZTTA 5KFJA 1HQEA 4TLRA 3MR5A 3MF5A 3T5LA 5J2NB 2WOMA 2JC0A 1TVRB 4B3OB 3DOLA 2IC3A 4KO0A 4NLVA 2VG7B 3MEGB 1FKPA 1QE1B 4LSLA 2XI2A 2R8KA 4MKBA 1YVFA 4WE1A 3H5YA 2QV6A 4Y2CA 2BANA 2FJVA 1GX6A 5J2QA 4H4MA 5J1EB 5KT5A 3PZPA 3IRXB 2UVVA 3FSIA 3CDUA 3T19A 2RF2B 4ZHRA 4PQUB 5HP1B 5C42A 4ECRA 4TQSA 3BJYA 1HQEB 2XCPA 2R8GA 4MK9A 4QWBA 3T1AA 3H2LA 4MK8A 3JSMA 4Q44A 4ED6A 2J6TA 2IJFA 5K14B 1S1XA 4Q8EA 4K4SA 4ECVA 1KHWA 4LSLB 1Z4UA 4K4VA 1FKPB 4EO6A 1N56A 1JLEA 1RT6B 1S1VA 4IRKA 1C0TB 2YKNA 2AQ4A 2OPPA 4FS1A 2ZD1A 1JIHA 5FDLB 4F4WA 4WZQA 3ISNC 4MK7A 2HNZB 5DG7A 4IG3A 5J2MA 2ZE2A 4MIBA 2IBKA 1JKHA 1FK9A 1TKTA 1HMVA 4Y2AA 3LP2A 2D41A 4MH8A 4RZRA 4O4GA 2AX1A 3QZ7A 3MR6A 5C42B 5C25A 4HYKA 4O44A 4J9NA 3LAKA 5F9NA 3V6KA 4K4WA 3BREA 4O3RA 4QWAA 2JEJA 3IN5A 1N4LA 2YNIA 1DTQA 3I0SB 4RW4A 3SFUA 3JSMB 1RYSA 3KNAA 1LW0B 3QYYA 1S1XB 2IM2A 3MFHA 4ECTA 4IR9A 1TP7A 5J2PA 4XO0A 4IH6A 4URSA 1JLEB 4R5PA 1S1VB 2GIQA 3OSPA 1ZETA 2YKNB 3DOKB 4H4OA 1C2PA 2ZD1B 4TN2A 2W9CB 2BRLA 2WONA 4KAIA 5J2MB 2ILZA 2UUWA 4EBEA 3KJVA 1JKHB 3QO9B 1HMVB 4Q43A 5KFLA 4O4GB 3GIIA 3MEEA 5C25B 3UDLA 2R8HA 4O44B 1RT2A 2WK4A 3HVTA 4YR3A 3DYAA 4EEYA 2FVCA 4ED8A 5KFCA 3LP0A 1DTQB 4RW4B 5L9XA 2I1RA 2W9AA 5HLFA 3V6DB 4NLUA 1T03A 4MKAA 5KG0A 3IS9A 1LWCA 5KFHA 3KLGA 2E9ZA 2FVQA 4ED3A 1RT4B 3HKWA 3PVXA 5HROA 4TXSA 4R5PB 1J5OB 5F8HA 4RW7A 2OPSA 4H4OB 2BQUA 3H5SA 4IFYB 3KHGA 1UWBA 3KJVB 5KFRA 2YNGB 2C28A 3T5HA 1IKWA 1BQNA 3MEEB 3H4DA 3QLHA 3HVTB 4JV1A 3H5XA 4I2QA 3RB0A 4ED0A 3M8PB 2XGQA 4K50A 3NGDA 3IS9B 1C1CA 3HVAA 1BQMA 4J9OA 4QWDA 3QZ8A 3M9OB 4RW7B 2OPSB 4IH5A 4I7FB 3MR3A 2W7OA 1HYSA 2XC9A 1JLQA 4LQ3A 5DQHA 3SI8A 4Y34A 4DL4A 2IMWP 2CKWA 5CYQB 5JXSA 1BQNB 3FRZA 4YQWA 2OPRA 1RA6A 1IKXB 4NLRA 4LSNA 5KFGA 3MFIA 2FVPA 1I6JA 3LALA 3T5KA 4I2QB 2FLNA 1S1TA 3M9MB 3VQSA 3OL8A 3KK1A 4URQU 2R2TA 4PUOB 3E01B 4KV8A 5J2NA 1TVRA 4ICLA 1BQMB 4NLGA 4EYHB 2C22A 1HARA 5KFTA 3HVWA 3MEGA 2E9RX 1QE1A 2ZKUA 3G6XA 3NKYA 1LW2A 2HNYB 1EETB 2FVRA 3BQ1A 5EDWA 2J6UA 1JLQB 3KK2A 4M94A 4J9SA 4NYZA 4ID5A 2V9WA 3IRXA 4KBIA 4OL8A 3V81A 3TAMB 4RNOA 3T5JA 5EWFA 2OH2A 4PQUA 3IG1A 5HP1A 2BQRA 3CDWA 1C1BB 4IG0B 3I5AA 4J9PA 3KK1B 2R2RA 3PW7A 4KV8B 4NLPA 5KFZA 2ASLA 4ICLB 5K14A 3BSOA 4NCGB 2O5DA 1VRTB 2IA6A 1LW2B 2D3UA 1XR7A 1RT6A 4QW9A 3QGHA 3OLBA 5DLGA 1T3NA 1C0TA 3OLAA 4NRTA 3M8QB 4H54A 5FDLA 3NBPB 5KFNA 1MMLA 3KK2B 2DPJA 1JLCA 5KFOA 2HNZA 4ID5B 4EYIB 4FBTA 1T05A 5I42B 3LAMA 1K1SA 4TQRA 3V81B 1QAJA 3BSCA 4DL5A 3DDKA 3OL9A 3IG1B 1S9EB 5L1LA 3CJ2A 2EC0A 3EZUA 3G6VA 3I0SA 2IAJB 1QUVA 1LW0A 3CWJA 3H5UA 4IH7A 4YR2A 4Y3CA 3FDSA 2JEGA 4Q0BA 5KG6A 3DOKA 4URGA 4KHRA 4O3QA 2W9CA 1JLCB 2AGQA 5L1JA 3DRRB 3I5CA 3QO9A 1RTHA 1T05B 1S48A 3KMQA 2YNFB
chains in the Genus database with same CATH superfamily
1IXKA 3T1HF 3W64A 4LF6F 1UAWA 2HW3A 2NXEA 4RNMA 2XZ2A 4CM2A 3SQGA 1TKXB 4WK3A 1UVJA 2GHWA 1CS4A 2A0FB 3M8PA 1WJ9A 2QA2A 4WKYA 3LPYA 3ISZA 2BV3A 5M2PA 4ES1A 2AD9A 1NDCA 2DTJA 1FE4A 3GV7B 3IR6B 4P73A 1IKXA 3NMAA 2B43A 2FJAB 3DU5A 4J91A 3L4BC 1RLCL 4B17A 3M8WA 3I9ZA 2V69A 4DPTA 2HNYA 4JI0F 5D8HB 2QLXA 3GV5B 3R2DJ 2MJUA 2MHEA 3EGWB 4RUHA 4OX7A 4DV1J 4DUZF 2XO7A 4HDGA 3PW0A 1LWEA 2BM1A 2HEKA 1IVZA 4FPRA 4C3LA 1NZAA 1WC4A 2IM3A 2RDJA 5BXIA 2OPQB 3LWMA 1C4CA 2QLBB 4K5RA 3IR5B 2DHAA 4NASA 4GC6A 3B82A 4LRFA 2HMIA 5B09A 4I6YA 5FD1A 3HSGA 4EFAC 3ENVA 1TAUA 1U0HA 4J9LA 3ZXWA 4JI5F 1TUWA 3PHTA 1N5YB 1KBRA 3NAHA 5AXLA 2EG2A 4DLEA 2C2DA 3IGVA 1KD1T 1SJFA 5IQ6A 4CM0A 4DHVA 3UDEA 2EPIA 2HQDA 3AOBA 4ZLLA 2UZAA 3CCLS 4ZVTB 4J7CA 4AL6A 4DR3J 4CLZA 2VKZG 1LKZA 2U2FA 2GS8A 5L1IA 4YY3F 1NDPA 1GXTA 2R8JA 2PA3A 2HZVA 3G8TA 5SZTA 4A8FA 3KNGA 1NO8A 3BQ2A 5IV4A 2RDIA 3NGUA 4LRBA 3DLGA 5LXYA 1WF2A 3BBFA 1GQEA 4N56A 2NSBA 5LSLA 3GSIA 3CCES 3G82B 1WHYA 4CO3A 4DR1J 4JB8B 1T11A 4ZJLA 4RNFA 1FDNA 1KLMB 2C3UA 2MZSA 2Y1LB 2M7SA 4AQYF 4CTAB 3GG1A 1WG1A 1CJVA 2QE5A 1FNXH 4F25A 3F44A 1TL7A 4RWWA 2XBPA 2CNOB 4B3OA 4M5LA 4L3KA 3CMAS 1Q78A 1JXEA 2IBOA 2L08A 4NLWA 1SL0A 2QX0A 3I4HX 1A0OB 1VRQC 2H4YB 4NLVA 2VG7B 1QE1B 4RL1A 2GO8A 4A8QA 2V94A 4QWBA 3JSMA 3GONA 2HVDA 1CPZA 2VQFF 4YDXA 1JIHA 1EARA 1FTRA 1MWZA 4Y2MA 1VK3A 2RQKA 4HHHA 4CZCA 2IRXA 1JMTA 3QYYA 3SV4A 3V4MA 5HQMA 1U1OA 5IC6B 2Z57B 4O4GB 3GIIA 1RUSA 2WK4A 4KGMA 5IZHA 2V8HA 2AJQA 4M5JA 3BV8A 2OMLA 1SL1A 3PRVA 2L9WA 2OPSA 3KJVB 1FXDA 4U95A 4NYOA 3OFHA 4JV1A 1P27B 5CD4H 3OUYB 3D6FB 3HVAA 4J9OA 4QWDA 3M9OB 4DSJA 4IH5A 2V67A 4JI7J 1JLQA 3RAMA 2GW8A 1QSLA 4LSNA 1I6JA 3T5KA 4I2QB 1S1TA 3M9MB 4PPDA 3MEGA 4CRJA 2FJBB 5B0CA 2FY1A 3V81A 1J2VA 3OVBA 5HP1A 2ZBRA 1F3VA 2BQRA 4PWUA 4CP5A 2MZQA 2YQ0A 1FDDA 4NXMF 3OJSA 5KFOA 4FBTA 3LAMA 3PY8A 4LRDA 2EKYA 1X4AA 2YWWA 2D9PA 2LMIA 2MZRA 5AE1A 1ZA1B 1N54B 4M1KA 1VS3A 2HKEA 4P2MA 1WEZA 2UV8A 4LF1A 5E7OB 4F4YA 2E7XA 5EN1A 3ZZOA 1SI9A 1HI8A 2B3TB 3KKFA 3PDNA 1Z1ZA 3EZOA 2HVIA 2Z8QA 1RTHB 2YNGA 3PYGA 2HNDB 2LEPA 1YHQS 3MMJA 3NGTA 2V2KA 8ATCB 3A8JA 3F41A 3CD6S 3BBCA 2LDIA 2M9KA 1YJ9S 4I7FA 3HKZD 1XIQA 4GMKA 3M2RB 2HHPA 5CYQA 2QSFA 3M7VA 4WTOB 1TTHB 1NKCA 4DR6F 4OZ5A 4PG4A 4ECZA 3UN5A 4BBYA 3J7YI 1AYEA 4KTQA 1RT3B 3N0VA 1S77D 3ULHA 1YKWA 4QIVA 5GAGI 3M8QA 3D6HB 4CLTA 3AQOA 2DNQA 3DMJB 3N9UC 4JI8J 3NNHA 3EPIA 5ETMA 2RQMA 2WBRA 2B8QA 2RHSB 3FFIB 1M1GA 3MM7B 4WYLA 1FNOA 4CYUB 3IMQJ 3RU0A 5KT7A 3R2CJ 4KKOB 4QU7A 1RWNB 1RT5B 1FERA 3C15A 4LF9J 4D3GA 4WF9Q 4JI1F 2FYXA 4U9RA 1S6UA 2PGCA 2OHDA 3FBBA 3DLEA 1Y5NB 3H4BA 2IM1A 1S79A 3TRGA 2RJZA 1V3RA 3HCXA 2UXBF 1UEKA 3DXBA 3B4MA 2YH1A 1Y7PA 5HBMA 1JNZB 4ZK7M 2HIYA 2V8GA 5I4MA 1HBMA 5HMYA 4WFNQ 3M1VB 1NJWA 2GMJA 4G1QA 1M5PC 1R0BG 4OI3A 3GR1A 3KG1A 2VDIA 2IHR1 4WP9A 2H51B 2HS0A 5A0YB 2OUGA 2EFGA 2N3LA 1AFJA 1RT1B 3PR5B 3PO5A 2B7BB 2YKMA 3TAQA 2YXLA 2VG6A 3J7Z5 4WXWA 3TZZA 1U1KA 4H4KA 1GK8A 5DETA 5F8LA 1Q5VA 3P49B 1JX4A 4JV2A 5T14A 4O0NA 3DYAB 3VCDA 3NNAA 3KLIA 1TZ0A 4PR6A 4CT9A 3EVMA 2AU0A 4DCOB 1EP4A 5BYQA 4DSFA 1DTTA 1GMWA 2LU1A 1IWGA 4XK8C 1Q16B 4F4AA 2V4RA 2DXDA 2ATLA 2FDNA 1UKUA 5EWEA 1VLYA 1UVLA 2ROPA 2GX8A 4NA3A 3R5GA 3HO1A 3PX0A 1ROFA 4ZPCA 3HK2A 1BXNA 5J1EA 1RBOB 1QSSA 2DGWA 2XYGB 1AT1B 2VFUA 3T5LA 2WOMA 1BE4A 3DOLA 3F73A 2XI2A 2XO6A 1KVIA 2BANA 4ELUA 5KT5A 4AL5A 3NXZA 2DT9A 2OJ3A 1Q82T 3SDEB 3H2LA 2R7WA 3GTYX 4OZ0A 4EI2A 4EO6A 1IN0A 2OPPA 1EKRA 1JKHA 2YPZA 3MR6A 4YEAA 3ENQA 1YJVA 3BREA 4O3RA 1VQ9S 3OVAA 2ZH4A 1JLEB 2W2MP 5J2MB 3W8GA 4A8MP 1TFYA 2WSEC 1VK8A 4Q7AA 4ED4A 4LRCA 2W4DA 3L7PA 1X4HA 1OSDA 2HRTA 5C2GA 1N0VC 3KYLA 1ACMB 4JI3F 3PFOA 2MQQA 3TO8A 3ZC4A 4JYAJ 5H9FK 2C28A 1AA1B 5ETQA 4B3SJ 4NEYA 2B4OA 3H5XA 2LDYA 1OY9A 1UUJA 2K3IA 3M2UB 4DZ6A 2Z2LA 4C3MA 2VODA 2CQIA 2ZZTA 3FZ2A 2W7OA 5L38A 2O01C 1IBMJ 1H72C 2DH9A 4M5DA 4BHQA 1N5TA 1HIYA 2BZ2A 3OQ2A 4J9SA 2ZDOA 3H2VE 4ID5A 3T5JA 1F0XA 3IG1A 4LF7J 3KK1B 1OPIA 2OD6A 3E2EA 1SKUB 2RQ4A 4B3TF 4NCGB 1LW2B 1SC3B 4KGXB 2AZ1A 4KY3A 3PIPQ 4B9LA 1A7GE 4KGZB 1HFEL 2GV1A 1S9EB 3MCNA 4ATNA 3CJTA 2DGXA 2DRAA 3K8VA 2IYGA 4PKDB 1RI7A 2RRBA 5KG6A 4KHRA 1OWXA 5AXKA 3NAIA 4USHA 1YK9A 1HNZF 1LK5A 4DX8H 3M6UA 1OS5A 5GAEI 3B54A 1IQZA 1I1GA 1UW4A 1VC5A 3UDCA 1SKWA 2VA2A 1NDKA 4QIGA 2KHDA 3EGZA 2MEWA 3I56S 5D4NA 5HAOA 3D3CJ 2NYIA 4RW6A 4J9QA 4RW9B 1F5AA 2KXNB 3MM6B 3PIOQ 1JLGB 3NCQA 2YNHB 1HBUB 3PJ9A 3TUZC 2VUGA 4U67Q 4BWJA 4YMEA 4Y00A 3K8WA 2FB0A 1S12A 2MPUA 3HFKA 1R8HA 2RKIB 1D0EA 1IR1A 2QYCA 2DR6A 4ZPWR 3ZZUA 5GAHU 4DR7J 3LOUA 2CPYA 4I6WA 4QCLA 2IAJA 2AJ2A 4KYZA 2L9NA 4QR0A 5HMWA 1APSA 3DRRA 2Z2MA 2J6UA 2JC1A 1RWKB 2BUNA 1FRJA 1H7XA 4WYWA 2MKIA 3T3FA 1TKZA 2X1BA 1TL1B 1WHWA 5F8NA 3O6QA 3D4JA 3PYFA 3W8PA 5LOQA 2DD8S 3SFGA 2MLYA 1VQNS 2ACMA 1YX2A 4U96A 4KO0B 2HWHA 3V6HA 4CNZA 3E51A 4K4UA 2GVDA 3DRPA 5ETTA 2YKPA 4LR8A 4RX6A 3M30B 3WDOA 5FLXY 1GMWD 1NK5A 3N6NA 3NL0A 1FXLA 3TA1A 1AW0A 1H74A 3I5BA 3AY0A 2B8PA 3I31A 3NS5A 4GKJF 2XZDB 4JI2J 2EFPA 3AA9A 3THVA 2XS5A 1WHVA 4WIQA 3W9JA 3V6JA 2XGPA 3RZAA 1TUVA 2QMXA 2QSWA 4X2BA 1RT2B 2JLFA 1TL3A 2PN6A 2W8KA 3LP0B 3N6LA 1HHTP 3OXGA 4UY85 2VG5A 1AUDA 2ZJQQ 2EEYA 2FZKB 3MEDA 2ZBQA 4NMXA 4ZP8A 3QLHB 3RAQA 3DRSA 2VBYA 4PCQA 1F3FA 2RUSA 2HURA 5JMNA 1KQGB 3KUEA 4C98A 3HJFA 2D3ZA 3MOJB 2XWYA 2HHXA 3G4SS 1NM2A 4HH1A 3UVJB 3NG8A 4MKBA 3POTA 5GMEA 2J8SA 4A8WA 4A46A 4NPOA 2L3MA 3R7SB 1ZH5A 1S57A 1QJHA 2G9OA 3EYZA 2KU7A 5FDLB 1FK9A 4O44A 4LR9A 2ZM6J 1PCAA 1UMJA 4USVA 2G4BA 2VFSA 4URSA 4HEA9 1C2PA 3W2WA 2ILZA 2G0CA 2XEXA 3DDIA 1UJ6A 3Q23A 4DBQA 4U8YA 4R5PB 2MGZA 2J9CA 1J5OB 4LFCJ 1BLUA 3H5SA 5J1PA 4DQIA 4OZJA 1SJ3P 3TOQA 5KFRA 1UVIA 1RE1B 3U1NA 2KKHA 4YN3B 3AODA 5HJXA 2K1RB 4DFJA 4K50A 3I96A 4B9SA 5L39A 4TKTA 3X3UA 4YQWA 1FRXA 1RA6A 3MM8B 3T1HJ 1LQ9A 3CE8A 4W4MA 2WVEA 3NMRA 1HARA 3G6XA 1TMJA 3IBCB 3BR8A 2D3O1 1TL4A 3T41A 2AYEA 2GFFA 1WHXA 3UD3P 2F7VA 2DGSA 5K14A 4ID8A 3FSYA 5F0WA 2IJRA 3T6JA 2DPJA 4MYUA 3DOMB 2LYVA 3CJ2A 1W2BR 2EC0A 1Y4ZB 3ELHA 3VAHA 5A8RA 2BEFA 1AUSL 4WBFA 3SQOP 3S6EA 5L1JA 3KMQA 4NI2B 3A3OB 4QYZJ 1T7PA 3L7OA 3AWRA 3HXMA 4DUZJ 3R3TA 2NS1B 3MXHP 4HHUA 2XMMA 3W5ZA 3J81Y 2Q1LA 1JLBA 2MQNA 2DY1A 3B78A 3GZ7A 4DR5F 2NREA 4O23A 1E6YA 3HI9A 2QMWA 4P74A 3KLEA 1RA7A 3D0HE 2M2BA 1RCXB 5KFWA 1CS4B 1V5IB 1C0UA 2KJWA 3E01A 1VJWA 2LXFA 1DZ5A 4OX9F 1XR6A 2HFUA 2J5AA 1XERA 3PHEA 1IJFB 2W7PA 2ABYA 2C2RA 1S9FA 1DBDA 1WD6A 1KP6A 1NMEB 3ZFVA 1PKUA 5KFYA 3HD2A 3C46A 2LQ9A 1Q8KA 1VRTA 3QATA 2OGUA 1SJRA 1RWVB 3H98A 4ELTA 1M0SA 2HSEB 2ZKTA 4AL7A 2AP6A 3C14A 3OTOJ 1HNIB 2VC1A 2CQBA 4DV4F 3H40A 1CQMA 2F9DA 1LWEB 4YY3J 1U7LA 3JSRA 5M2UA 3MAQA 1Z2LA 1RWPB 3KK3A 2JVRA 2WVCA 1KQFB 2ALZA 1S0OA 2JNJA 4OYWA 3T9ZA 2E66A 3A8EA 1RAGB 4KGVB 1UVNA 3I0RB 2A1BA 2I5JB 2HMIB 2VHGA 1BQXA 3FQLA 1WEXA 2NR0A 2BXJA 1OYDA 3Q8YA 3NRBA 5F41A 2VFRA 3J7YU 4KFBA 4DX5A 1T0TV 4N76A 3ISND 1NHUA 4QPXA 4J9VA 2BJDA 1HNXF 1LFWA 3MWBA 4PQAA 1FD8A 2YNIB 3DC2A 3SSQA 2V5HG 5GAGU 1SUQA 1YZ6A 4A8OA 2FJWA 2ROGA 2W4CA 4ZA1A 2XG8A 3UWTA 3QJPA 4BWMA 2F5GA 2VQFJ 4QZVB 3C6UA 2KZMA 3LANA 5F8JA 3DLGB 1H7WA 4I2PA 1WACA 5E3QA 1LK7A 4AYBD 5GMDA 5DLFA 4IRCA 2H5EA 4IR1A 4LVNP 1ZPWX 1S1UA 2HLTA 1YBTA 1HI0P 4F2SA 4QU6A 2ASYA 4NL5A 2XMAA 1VI7A 2MY7A 2VICA 1KQSR 1TL7B 5K8OA 2ZBPA 1WWHA 4B3OB 3OTCA 2XZWA 4DFMA 1U1NA 4DFPA 2NPFA 2OKQA 4IO9Q 4GKKJ 2FJVA 1UVKA 3CD7A 3ONQA 1NJYA 3TAPA 2MSTA 4OYPA 4F02A 4ED6A 4Q8EA 5DM6Q 5HATA 2ZE2A 4RZRA 3HULA 3V6KA 2IVFB 3CJSA 1DTQA 2C2MB 2Q79A 3JSMB 3KNAA 2J7WA 3DOKB 4TN2A 4C4WA 4Y0FA 5E5NA 3CXCR 2PI5A 2ZHAA 5L9XA 3BS9A 5FJ4A 4TXSA 1Q5YA 2EWHA 2BQUA 1M5HA 2KXHA 2FC9A 3KJNB 2IPOB 3AH6A 5ETOA 3BB5A 2OPSB 2Y8YA 1HYSA 2XC9A 4ILMA 4Y34A 2ZBCA 2HVZA 2FVPA 2EK1A 2R7XA 1XBWA 2R2TA 2MSSA 4DOZA 3HLUA 1NPRA 3L7UA 2E9RX 2SXLA 2CFXA 1JLQB 2AZ3A 2N3OA 4RNOA 5EWFA 4UQTA 2D74B 2MHNA 1HWJA 1L3VA 1XR7A 5KFNA 3VAGA 2HNZA 3V81B 2Q6BA 4DL5A 3OL9A 3WIVA 5CHCB 4DV7J 4C6AA 5D78A 1UFLA 3K58A 4P7VA 1J5EJ 2YTCA 2ZH7A 2KJVA 1RAHB 2DEIA 3GFHA 2V1SA 3NGRA 3T6BA 1RTDA 4MIWA 3IRWP 5EWGA 1O8BA 2E1AA 2NXCA 3CDBA 1KHVA 1EAYC 1TKDA 4FYYB 3HSZA 3LH2S 2DR9A 4DV1F 1I5OB 5KG3A 2XLJA 1FRIA 3OD2A 1UJ4A 2X3GA 1FCAA 4OYIA 2ZH1A 3DXSX 1U6ZA 2P2CB 3RBXA 1TV6A 3CJ3A 3ZTPA 4BC9A 3THTA 3N01A 2YKAA 4QOTA 4LF4J 4ZPVR 2ZH8A 1SH0A 2E1MC 5THWA 1S4FA 2I38A 1BGXT 1EETA 5B0FA 4GO5X 4OZLA 5E3CA 1X4GA 1QTNB 3LO3A 4USUA 1YRUA 3BSAA 2DRDA 2C3YA 4ZVEA 1OIAA 2XSJA 3FC9A 2ZH3A 2DHXA 1AB8A 2XNRA 2WRMA 2DGVA 1HWUA 5JVGQ 1NB7A 2IVYA 1AROP 1YTYA 4DR3F 3C19A 3EGNA 1S72S 1U25A 3TJAA 1R0AA 2GC8A 4ETXA 4PXCA 4ZCKA 5GAEU 4P2SA 1HL6A 1G4CA 3NS7B 4FYVB 1Q7YT 3IFEA 4ALZA 2H48B 4YP3A 2CYYA 4Y28C 1U1PA 3MPDA 5F3ZA 1S0NA 2FQQB 3C15B 2P6TA 2IC3B 3RB6A 4DR1F 4OYBA 3CJ0A 3LGMA 3ZNJ1 3DLEB 1BHNA 2HIQA 3EXCX 2HHUA 1FX2A 4J9MA 4NRUA 1LWFA 1SH2A 2E5JA 2O3DA 3CDAA 2VJVA 1QAIA 5KFPA 1GTHA 1GXUA 2FTRA 2ZOGA 4BDPA 1ZZNA 2DNPA 3J7A1 1M1KT 4FYXB 2H5IB 2XMJA 1WC1A 1R31A 2WW4A 3TVYA 1ZM9A 4YB7A 1R89A 5KAKA 2MJNA 4ZPAA 3MPYA 4R0JA 5AT1B 2AX0A 2DR8A 1UWBB 3PO4A 2NLWA 4ZP9A 1JK9B 3R1LA 1H3DA 4IDKA 4FF3A 3CC4S 3PR4A 3OHAA 2QRRA 1WSRA 4NLSA 1C1CB 2OEKA 1DTTB 2GJFA 3QIDA 4Z2XA 2PDAA 1YJWS 4DUYJ 2WB1D 3MF5A 3UO0A 3QGPA 4WE1A 5A2QU 5J2QA 5J1EB 3PZPA 4QPTA 3NCPA 4GVBB 2EC2A 2N7YA 3CMES 2IJFA 1L5UA 3RBZA 2W24A 2MKYA 3A8KA 4ER8A 1SL2A 4OYOA 3SZ2A 4OJGA 3LP2A 5L8RC 2HG4A 3K5OA 2CQGA 1QTMA 2B51A 2KYZA 2MB0B 7AT1B 1ZETA 1VJQA 2GIQA 2HFSA 2D69A 3BZQA 2HGLA 1S7HA 1JKHB 4YFUA 2CPJA 2GCFA 3DGVA 1X4FA 2QJ3A 5B0BA 5B08A 3HFVA 2QYGA 2VBWA 2Z56B 3PTWA 3QQCD 3CCQS 4A4JA 3FCVA 4ED0A 2XGQA 3NGDA 2XY7A 4FF4A 4LQ3A 3ZZZA 1XMQJ 5G4DA 1PILA 1LOUA 1XK8A 2RHQB 3RYLA 3VQSA 4NLGA 1VQPS 3NKYA 3JB9k 2FUG9 5E3PA 3UFCX 1XNRJ 3CCUS 3TAMB 1EKSA 4YB1P 4J9PA 1KSPA 4FPIA 3SMZA 4IOAQ 5GMKa 3IM9A 4OHWA 2HQGA 4QW9A 3OLAA 4NRTA 1VQKS 1MMLA 2ZWOA 4ID5B 1E6VA 3IG1B 3AOCA 3TARA 1RWWB 1QLNA 4YR2A 3RJMB 2OFGX 4QIWD 1V9OA 2QG9B 4O3QA 3ZZPA 2A6OA 2NSCA 4RU2A 3UQSA 3O8WA 2OTJS 5IQQA 5KFEA 2AIRB 3V6DA 1H98A 1OPZA 1RT4A 5IS2A 1FEEA 1X5SA 1NK8A 3LP1A 3IWXA 4F50A 1NHVA 1B0TA 1VQLS 3FBCA 4USKA 4OLOA 3GU0A 3UN3A 1MLAA 4JI8F 5CAAA 3MZIA 4PYAA 1IBLJ 4IFVB 2ATCB 4NZ0A 1N5QA 3QFHA 2ZOMA 2MKJA 2CXEA 3KLHA 2GIFA 4EU0A 2M0GB 2EK6A 4P72A 4LF9F 1QM9A 4O0IA 4EK2A 2DPIA 2DNYA 4RW6B 5ETPA 1G6BA 2EBEA 3KLVA 2BE7D 2FJXA 4K4TA 2HBZB 3TQEA 3Q2SC 3BQ0A 1UPPA 4WP3A 1M90T 5I42A 2UUCJ 1D9AA 3UPFA 2DKOB 2H9ZA 4EO8A 1W25A 4P52A 4TVAB 2YWEA 1F5CA 3HSJA 3OXFA 2V6AA 4DL0C 3HDSA 3GV8B 1S5ZA 4JP8A 2EFVA 2DY9A 4ANDA 4B3RJ 1KR4A 2CPEA 5I3UB 4C0OC 4QYZK 1IQTA 1U45A 2R7OA 5DDOC 3KHHA 4WFZA 4CDIA 1Q1KA 4P6QA 1TKZB 4XPCA 4OI6A 2A2CA 2YPYA 1WOSA 2PEBA 1M5SA 3HHDA 1REVA 5CH7B 5C5JA 2PC6A 3EJMA 4ZIVA 2C3PA 3AAWB 3HT3A 3VALA 2CWKA 2H65B 3KHLA 6AT1B 3Q83A 2GVDB 3G2XA 3DGPA 3MCSA 3TW0A 3A3PB 2Y0SD 3VVTA 5KFXA 3MECA 4ZP7A 5KFKA 1KFDA 1CULB 2JOQA 1ULRA 4X65J 1N5SA 1RT7A 3TEGA 3UCUP 1RYRA 1HBOB 3JTPA 2XCAA 2JEFA 1WKLA 3RAXA 1T03B 3AHPA 2VJUA 4DLGA 3GLJA 2CPHA 1PBAA 3EXYA 3A1YG 2RE1A 2IDLA 1U6BA 3M8YA 2HLUA 4PPZA 4K59A 4X4TA 3VTIA 2R2UA 4G1IA 2UXCJ 4OLPA 1NKEA 3J7ZT 2UP1A 2BE9B 4NXNF 2VG5B 3FRYA 1FVQA 3EZ5A 1RHRB 2OELA 3PEHA 4A8SA 2G1DA 2FHKA 1HQEA 4L76A 2AMCB 2CADA 3GIRA 1K0VA 3PKMA 1SJ1A 2VL1A 1GX6A 3DHXA 2PI4A 3FSIA 2N7CA 4JYAF 4ZHRA 4PQUB 5C42A 1RQ0A 1YG0A 2CJBA 2HYIB 2CJYB 2R8GA 3T1AA 4MK8A 4PABA 4ECVA 1S1VA 4IRKA 2AQ4A 2V9KA 1FHTA 1YSJA 2JFDA 2V2ZA 1FFGB 1LEOA 1V5VA 2OIHA 1VQMS 2ZZNA 5C25A 1IBMF 4OI2A 2CQ4A 4WWSA 4UOCA 3S1TA 3R27A 2PIIA 1TP7A 2GGPA 4ANEA 2J9DA 4HHJA 1B7FA 1MMDA 4BS2A 2BRLA 2WONA 1RISA 1B4SA 1VCTA 2BW2A 4O44B 2DR7A 2Y1IA 3NGKA 4NLUA 1U8WA 4LF7F 5KFHA 2E9ZA 3PVXA 5HROA 1QUPA 3W2WB 1GEHA 2V63A 4F8RA 2LVWA 3BKFA 2KYXA 3N5FA 1FT8A 4CH1A 2GMHA 4Q5VA 3EICA 3UD5A 2DXFA 5JXSA 1U2CA 3TNVA 2JX2A 1CJKA 3LALA 3WC0A 4WU3A 4N7TA 5HN0A 4EYHB 4X4SA 4TNOA 3RR7A 2NQPA 5EDWA 2YY3A 4NYZA 3IRXA 2MKCA 3DLLQ 1IBCB 3DN9A 1HWLA 3PW7A 3BSOA 4J5OA 3OLBA 4H54A 2CQCA 2DNHA 2DR5A 1D9DA 1PJ6A 1VHFA 5DDPC 4ZVPB 3W9HA 4C8OA 1X8DA 3W62A 3FDSA 1UETA 2AEMA 1DY3A 1M5OC 2JEGA 4CO2A 4Q0BA 3GJQB 3PKYA 1AZSB 2OTLS 1REGX 1S48A 2DNRA 3HHLA 1WKKA 1TK8A 3C3LA 2F1FA 3OV7A 5A8RB 1YQHA 1NJIT 4NLXA 1GMVA 1SQFA 3Q8SB 4ZLJA 2VQEJ 4RKUC 2QC3A 1TU0B 4CLLA 2PFFB 1NSKL 3W63A 4DR2J 3WBZA 3IO1A 1JLFA 2V0NA 3WX4A 3D1QA 3R9LA 1JLBB 1KC8T 3TZYA 3SCKE 1XN9A 2MQMA 1F1BB 1Y3JA 1E6YB 3BGLA 4L3NA 4KSEB 1RHMB 1FKOA 3KLEB 2MLZA 1NBEB 2OAUA 1X9WA 3HHEA 4LF2A 3CIZA 1VLOA 3R1HA 2YQ3A 3BSNA 1WC6A 1C0UB 1C1BA 1WORA 2QIFA 5CYMB 1Y11A 2QL5B 3KUGA 3LQVA 1KWMA 1NK6A 2EFNA 2E1PA 3GMGA 2R7QA 4NZ7A 5HVFA 2MQOA 3GE9A 4A8YA 4F3MA 1UW9A 3SSSA 1CJTB 3MOZA 1DQ9A 3HP6A 1U1LA 1ZAWA 4R0EA 4G65A 1JJHA 3TX8A 4JI2F 4K4ZA 2YNFA 1H2TZ 1XQIA 4NWBA 2V50A 2V4QA 4OYZA 4USTA 1RXOB 1T3OA 3MMBA 1TKXA 3DI6A 4RU9A 1R8PA 4DPWA 4W92B 2PA8D 3KK3B 3PXGa 7FD1A 1S49A 3O1LA 2CUYA 4Z37A 4DL2A 2Y1JA 4NLQA 4KIAA 3IGNA 3OL7A 2FLPA 1HD1A 5LXRA 3GR0A 1S97A 1XMBA 3W2VA 1LV5A 4NLOA 3MM5B 2WCXA 3TQ1A 2ASDA 2VOOA 4XAKA 3HM9A 1XR5A 2QN6B 1GNKA 1VISA 1ZS6A 2FLOA 4WXOA 4U7CA 4X62J 3G6YA 2J9EA 1P8GA 5KFDA 3VGTA 4WPAA 2RAQA 2CVIA 2HGNA 2OSRA 4FF2A 3FK4A 3RUBL 4YUDA 4ED2A 3K2YA 2LCWA 1S6PA 2OPQA 5H9EJ 2M3DA 5E3AA 1HHSA 1IKWB 3I55S 1MU2A 2CIMA 1RWUA 5CCMA 2CJQA 3C6UB 2B4VA 3K5PA 4I2PB 1ZTTA 1NXIA 3ILJA 3CGIA 5J2NB 1ICEB 4LSLA 1YBUA 2XHWA 4CLKA 4OJHA 4LFCF 4N5SA 1YJ7A 2VPWB 2GA7A 4DU7A 2HVHA 2APOA 4E0DA 1WOOA 1S1XA 1RT6B 2AYGA 3M2VB 1HD0A 4MIBA 2D41A 2AX1A 2CQ0A 2VBZA 4QWAA 4DSIA 2VASA 4WTYA 3WIUA 3G8SA 3R5BA 2X1FA 2BJ3A 4DQQA 2GZOA 3MGJA 3NGSA 1IBKJ 1DTQB 3G82A 2KXFA 2HHWA 4MKAA 2ZITA 3VAIA 4ED3A 4IFYB 4CTAA 3QAUA 4FN5A 2HPUA 1EIYB 4CCHA 2QA4S 1YRTA 3KG4A 1Q79A 1W7WA 4LUBA 2P9CA 4E98A 3ENAA 5CABA 2BACA 3HHLD 2FGCA 3K7RA 3VR1A 2VFVA 1ZA2B 3B6BA 3WC2A 1RWOB 1WEYA 4MJKA 1QE1A 4ZLPA 2GQQA 3IXQA 4LREA 3D9BA 3BKTA 5B0DA 3TUJC 1VGYA 4LMZA 4NEZA 2ZNYA 2ZDPA 5KOXA 5HVGA 3NBPB 4BC7A 1PC4A 4K5SA 2CQ2A 1FJCA 1XC9A 1EHWA 2HBYB 2ERRA 2ZHOA 3Q8UA 1IM6A 2F40A 1MW7A 3N6MA 2E5LJ 1RAAB 1G3OA 5D15A 1NH7A 1TQLA 1CEZA 3H0PA 4CH0S 4DV0J 4P2XA 4JV5J 4M5GA 2RRAA 4X4OA 1PGZA 2E5GA 1RTDB 2M88A 3OUYA 4ZVOB 2ZH2A 3OTOF 2LXUA 4IQXA 2W25A 1RAFB 3TVZA 2XY6A 3HHKA 2VU5A 1GH8A 3I87A 3BR9A 1TV6B 4TU7A 3GCXP 3OFFA 4DSKA 3FEYB 2C2OB 3BGOP 3KG0A 1UEUA 2GHPA 2KH9A 3K57A 3MM9B 1N5VA 4ZVHA 1WTBA 4K8RA 2DXEA 3IC1A 2OSQA 1XMOJ 2XM3A 1WNEA 4C7QA 4LJMA 2OI2A 4M8LA 1PYOB 4DI6A 5KFQA 2C1EB 3CO9A 4YR0A 2D7SA 3VGSA 3MMCA 4KGKA 1T02A 1U6FA 4P75A 4MFBA 1N32J 5LMUJ 2NUUG 3U27A 2WB4A 2HAIA 4Q45A 4C11A 1TMMA 1S6QB 3GFXA 2FY8A 2HVEA 1R0AB 2CWXA 2MXYA 2JEIA 2CA9A 2CJAA 1VRUA 4BLGA 5JUMA 4FXVA 2R7UA 2KRBA 4KRWA 1KNZA 1SKSA 3M2RA 1K44A 4DV6F 5K9FA 1U47A 2N4CA 5DG9A 3JQJA 3QIPA 2XMKA 3QRPA 2RQCA 4IG3B 1TKTB 2YWGA 8AT1B 1RT3A 3BYPA 1KRPA 3D6TB 2ILYA 3U1MA 2BYCA 1S1WA 4K4YA 4ILRA 2CNLB 2G2OA 1FESA 4GKKF 2KB2A 1HQUA 4HLBA 2HGMA 2Z2YB 3O5TB 1CG2A 3DMJA 3CSKA 5HLFB 4B9TA 2DGUA 4RUAA 2M5YA 3PNIA 3KFWX 3ZZYA 1GX5A 4B08A 5MLCV 1HW8A 1HWKA 3MM7A 2DHHA 5DQIA 1RT5A 5KG4A 3VAMA 4DPUA 3TUIC 4OFZA 5HQ8A 2X3DA 2KT5A 3UDVA 2RF2A 4OIXA 4I6AA 1YI2S 1VDHA 5K20B 2R8KA 3FGVA 5HMZA 2CJ9A 2MTLA 2H4WB 3P5TL 3BO4A 3FEXB 2UUAJ 4F67A 5D4LA 3M6WA 1N56A 2DGTA 3R5JB 4KPYA 1TAQA 4WZQA 1OY8A 5A0YA 1O51A 3CT9A 4X4VA 4IR9A 3MUTP 2VBXA 3HT0A 2W9CB 3QO9B 4F0HA 3UCGA 3MEEA 4CLYA 2HFZA 5F0UA 2J8AA 2HRYA 2DHGA 3DYAA 4ED8A 2W9AA 4ZVRB 5F8HA 2RNEA 2QLFB 1TK5A 3L09A 1RWXB 2BOPA 1F9EB 1SBRA 1D3WA 1WSVA 1FFSB 1MROA 3MD3A 1NZ8A 4DV7F 2A6MA 1BQMA 5EX0A 2AT1B 3GCWP 5G0RA 2FGOA 4XIUA 2CKWA 1HBNB 1J5EF 3FRZA 2CG8A 2FLNA 3UNGC 3IWNC 4PUOB 1FRKA 4KV8A 1V3SA 2ZNZA 2K3KA 2JDJA 3CUNA 2D68A 2AJ4A 3JTNA 4M5KA 2NXJA 3QT5A 3CDWA 4IG0B 2EFOA 5BJRA 3SDEA 2NCKL 3BDEA 2D3UA 1T3NA 4J9UE 1JLCA 4DPOA 1YZ7A 1NUEA 3BSCA 3QMQA 1I51B 2EVZA 4OMFG 3G6VA 3CWJA 4LF4F 1FJ7A 1JB0C 1E6VB 4OYXA 1W2IA 1KLNA 3OXLA 1MSWD 1Y5LB 1RHKB 2NXNA 3H2UB 1GAOA 4RWXA 3B8HA 5DG8A 5KT4A 3RG6A 2AGPA 4ZPBA 5KOWA 4UZCA 4OHXA 3RB3A 3N28A 2MKKA 3M2UA 3PFEA 4TYAA 1H0HB 5HL7Q 1VBYA 4FKXA 3LP1B 3MTKA 2A10A 5L1KA 9ATCB 3D28A 4O3SA 4UF4A 3D1OA 3PM9A 4FBUA 1RHUB 1UL3A 4LFAJ 1G7CB 3WX8A 4OI4A 3KLHB 3D0GE 2CPXA 4LR7A 2NYHA 5MAOA 2GAGC 3L95X 2QA1A 4NCGA 3DLKA 3ZTRA 4FP9A 3I4PA 1Q8IA 2BE2A 1S9EA 5KFMA 1NNDA 3FCWA 1QD1A 4TLQA 1X9MA 4DV2J 2LQ8A 2POKA 2XMUA 2MMYA 4EBDA 2OMOA 1H73A 2A18A 5DQGA 4B3MJ 4B9UA 1UVMA 1JNRB 2CAJA 2K7JA 2F8MA 4DSEA 3TWZA 2R7VA 4QWEA 2DIVA 5IT4A 3D67A 2R42A 5AXMA 1T9TA 1S9GA 1NK9A 5A6WA 4X4RA 3QT7A 3MAHA 3CC2S 2B4PA 2XY5A 1RWMB 3Q8RB 2F3JA 4OV6A 4YB5A 2IY5B 4QBUA 3BGFA 2L9DA 1JLGA 4NXNJ 1WKJA 2HHSA 4PG5A 3Q8QB 1SCJB 1HI1A 2AWZA 1REVB 1YRXA 5DZ7A 1VBXA 5IT0A 3X1LB 4CNYA 2AYMA 2AEJA 1RSCA 2UU9J 3W1YC 3QJLA 1PAUB 4DUYF 5J2PB 2GQCA 3DGPB 5FIIA 1SJQA 3MDFA 3P5BP 4C8YA 1X7VA 2FZCB 3MECB 2KL8A 3LWLA 1SJ4P 2BR0A 2CJXB 3CVKA 3KLGB 1U2RA 2OEJA 1ZAVA 4DX6A 1RT7B 3OW2R 3O2IA 4DF8A 5KT2A 3AFGA 3ZTSA 3K59A 5A8WA 2J76E 1VIXA 1WF0A 2UUTA 3R5AA 3NWGA 3SCIE 1X5OA 4ZCIA 2OPRB 4RUCA 2F63A 1HKAA 2WSCC 5JVHQ 2DEJA 3MR5A 2WSFC 3QNWB 1TVRB 4KO0A 4DV3F 3H5YA 2QV6A 4YDDB 3M30A 3GJTB 3HVRA 3MUMP 4ECRA 3CJKB 3B4DA 3DRYA 1HQEB 2AV5A 4P2FA 1F60B 4MK7A 5DG7A 1R27B 1ZBTA 3FCHA 2Y0BB 5C42B 3CCSS 1XMQF 3LAKA 5HVHA 2JEJA 3QT8A 1N4LA 3U1LA 1YGYA 1LW0B 1RTZA 4ECTA 5RUBA 1S1VB 4DJBA 2KFYA 4H4OA 3CD0A 4OJ1A 3TYTA 2FZGB 5DO2A 5C25B 1RT2A 1XNRF 2FVCA 3LP0A 2I1RA 4NOHA 2C3OA 3IS9A 1ITPA 2GGPB 3C66A 5BR8J 2GJIA 5H9EK 2K7KA 1JQGA 1CJUB 3QLHA 3CJQA 4AE5A 3JAMU 1P9QC 3S8SA 4U8VA 2VPYB 5DS7A 1TELA 4KR0B 4S0MA 4DL4A 2N4DA 3MPWA 1FJGF 2V8VA 3MFIA 3QWPA 2MQPA 2ZC4A 4V1Ak 3NCRA 3UVJA 2ZKUA 5BYRA 4ZJOA 1SB6A 4QR1A 3KK2A 4OL8A 2V9WA 1OYEA 2I2YA 1CJKB 1RCOB 2HZAA 1KDNA 2R2RA 1S6OA 2O5DA 2CZVC 2BOAA 3ET6A 1IBLF 5IWAF 5FDLA 3FUYA 2KHCA 2DBBA 4L74A 5D4PA 2VKRA 1MWQA 2HQCA 2HHHF 3FSXA 2ZC3A 3HKWA 4K0KJ 1F6TA 3DFEA 3MMAA 1DLOA 3CMQA 1A9NB 3U02A 3JQKA 1J5OA 2J6SA 2GMLA 1L3UA 4Q0BB 2CPDA 4MKVA 3V5RA 5CZXA 4OHVA 4OX6A 2UUCF 1WUUA 2K1RA 2XMWA 3P8BB 5EGYA 3RRHA 4PG8A 2XI3A 4DFKA 1VQOS 5ETKA 3RR8A 1X0FA 2CRLA 2BDPA 1U1RA 4HACB 4NA2A 1IM4A 3DLBA 2HWTA 4O3OA 4CLFA 4B3RF 1WG4A 5A2QY 1H2UX 3C2PA 5KG5A 1JLFB 3M8ZA 1BY9A 3NOGA 3P3DA 1KKHA 4DSLA 1FRMA 2R4FA 2MKSA 3A8IA 2ZUGA 2Q6CA 5HQLA 1Q53A 2Q3PA 1FKOB 4OQJA 2KM8C 2F9JA 3PW2A 1N48A 2OLWA 1XTZA 1IKYB 4L6V3 4RUBA 1U1QA 3DOMA 3H42A 5B0AA 4CLPA 3PW4A 1O0PA 3KLFB 4NLYA 2EKNA 2E7WA 4J90A 3W9IA 4IRDA 3OT9A 2ZJRQ 1FTCA 2W1BA 2ZOFA 3CB4A 3UR0A 1PYTA 5T7LA 2D3OR 2FD2A 4DEZA 4Y2IA 1B70B 5KT6A 3D68A 3JSBA 1RLDA 1XJWB 2VA3A 4X65F 2AF6A 4DG1B 1S0MA 2BJ7A 5F8MA 1IKVB 3RGIA 3RRKA 1L3TA 2KZZA 1U2FA 3DM2A 2JJ4D 3C8YA 3I32A 1EJ7L 5LSOA 1SQGA 4H4MB 2X1AA 3MMBB 3DI6B 3UCZP 2XZTB 1D1UA 2AKWB 4FVCA 1D8YA 2UXCF 4CLSA 3GJSB 3CDEA 3T1YJ 2QMUB 2Z2ZA 3OTBA 5KG2A 4ECQA 4ERDA 4WJBA 4FNHA 4I69A 3AJDA 2CQDA 3JTOA 3S7RA 3D5MA 2E5HA 4N8NA 3W2VB 2XMVA 4LSZB 4ZP6A 2X7IA 3H59A 2CNKB 1LWCB 3OR1A 1HNIA 2M4MA 5GVQA 3VZIA 4OHZA 1S10A 3FNNA 1ELOA 2Y3YA 2WVDA 5A8KB 4O4RA 4ED7A 4N77A 2BJ8A 1S6PB 1NSAA 2VOPA 3DCAA 1B3TA 4ZVGA 4B02A 4H4KC 3GYNA 2CPFA 5DZ6A 3I0RA 1RU1A 2I5JA 1MU2B 2MYFA 1DRZA 4WIIA 1FKPA 5A76A 1KTQA 3QWUA 2K8GA 3BJYA 2D1CA 4KC5A 1R6YA 1NPKA 5E41A 1NAQA 4LSLB 4QIEA 4I1TA 1C0TB 1N34J 2FJDB 1FVSA 2P5VA 3R5CA 3Q2TC 9RUBA 4U7UK 4PXBA 2YNIA 3I0SB 1RYSA 1S1XB 3OR2A 3LGNA 3NWRA 5KFLA 1NCLA 2HBRB 4USMA 4FF1A 2R8HA 2BBEA 2W2OP 3D1HA 1RACB 2P6SA 1TFWA 2IVMA 5IT9U 2FVQA 2W2NP 4ELVA 1X4EA 3SQGB 1WC5A 4KHPJ 2DRBA 3RB0A 3M8PB 4DN0A 1EQ0A 2HRUA 2Y9HA 3JS9A 1H2VZ 1GT8A 2QTWA 1FDBA 2EBGA 3PYDA 4L73A 1IKXB 1TK0A 3HZEA 1R3NA 4PZVA 3OL8A 4URQU 5ETNA 3GJRB 4W90B 4ICLA 3WZ0A 1Z2ZA 2ZWPA 3DNCA 1YWXA 2UUBF 3DLHA 4F7VA 2HNYB 4C2MA 4KBIA 2VQEF 3FEZA 2NZCA 4F4KA 2LA6A 2Z30B 3TZXA 2C2NA 2XYHB 1R6VA 2JWNA 3JXOA 1KONA 2J9DE 3VV2B 1SC1B 4DS4A 4FVMA 2IA6A 2EG1A 5E3RA 2QFIA 2Z0GA 4DR2F 1PAEX 2EFQA 1K1SA 4TQRA 5LT5A 1MG7A 2MQLA 4K2XA 4C0HA 2CPZA 3F56A 2LLZA 4DV5J 1LXNA 2HAFA 3ZNUA 3DOKA 1ZM4A 3I5CA 3BPSP 3UN2A 4RW8A 5L9NA 2RH3A 1U0HB 3TA2A 2RMLA 3MHYA 5LL6d 4OZNA 3D0IE 3RW7A 2XHCA 2RS2A 2LXIA 5IC4B 1SXLA 6FD1A 3VAFA 1VQ4S 1RAEB 3G87A 2XTJP 3PEJA 2L48A 4F36A 2PE8A 2FLLA 3CJ5A 2XNQA 4P9SA 1RABB 3AB2B 5IM0A 5LM7E 3GB0A 2GNKA 3GQCA 5K8PA 3CNQP 1RAJA 2QL9B 1NK7A 4K2JA 4NLTA 3QRRA 4USJC 2I0XA 2RVJA 2WHOA 1UFKA 4K4XA 2BX6A 4DV6J 1QSYA 3KTQA 2O67A 1HR0F 2I9SA 1VYAA 1N0UA 5ETRA 5I3PA 3V2UC 4X4NA 5JJBA 4XTTA 4TY8A 1KVJA 3EMTA 5HMXA 1CJVB 2UXDF 2CQ3A 2CQ1A 1KS2A 1GTEA 2W9BA 4TU8A 2AGOA 2VIHA 3N79A 3MR7A 4PWWA 4WP8A 3FBFA 5AJ3J 3ITHA 3GIMA 3OBIA 3HD1A 4X62F 3ZTQA 1ZTWA 3MMCB 2FVSA 2DNGA 4MFBB 5IV3A 2KRRA 1MN9A 1FA0A 5KG1A 4IOCQ 4NA1A 4A8XA 4C11B 5KT3A 3C16A 3Q89A 1SKRA 5LMNJ 3MR2A 1VRUB 3VAJA 2AJ0A 4PWDA 2IA0A 4F04B 4WFXA 1RTJA 1FFWB 3FKBA 4RLEA 4C8ZA 1QAXA 3QIPB 4FYWB 2PEHA 2YWKA 4ECYA 3IP0A 4BCAA 2CVEA 5KFFA 3TVKA 2DYAA 1SV5A 2DCUB 5KFUA 3H7HB 2RRNA 3G96A 3GSDA 1S1WB 1BMQB 4PAAA 4DL6A 5J1NA 4NLDA 2LQBA 4P10A 1Y5IB 1RKIA 1HQUB 4N47A 3PG9A 1HA1A 5C24A 5GADI 1WF1A 2BKOA 4ETZA 4LT6A 3DDNA 3BPDA 4DN9A 3ZO7A 4F3OA 3EGVA 5D4OA 3A13A 2W2PP 4LSNB 3J80U 1S1TB 1N36J 1IBKF 2IC3A 2W2QP 3DRXA 2YH0A 3MEGB 3T19A 2RF2B 5HP1B 3TEHB 5B0GA 4CLWA 4Q44A 3ZTOA 3QT6A 3G8QA 4FXDA 2O1PA 1KQKA 2E1CA 3ISNC 2BABA 4HVZA 4JI4F 4CWBA 3MFHA 3W3SA 1FXRA 4OHYA 2VF3A 4Y6IA 1R7IA 3DKDA 4C9DA 1WG5A 3CW2C 2HHQA 4EZ9A 1H38A 1RADB 1HW9A 4RW7A 4CQ1A 2V2QA 1UWBA 4UT4A 2YNGB 3T5HA 3MEEB 2F4VJ 2U1AA 4J37A 3KJQB 2KM8B 2FHOB 1C1CA 2BKPA 4KJIA 1KOOA 1PJ7A 4I7FB 2DGOA 2CDQA 2IMWP 1L3SA 5CYQB 1B99A 3LTOA 5BYSA 1I94J 1P1TA 2DNMA 1MROB 2AJFE 4LF5J 2E5LF 4TU9A 3PCOB 1BQMB 1MN7A 1WELA 2HQFA 5C2CA 5G0RB 3P4UB 4M94A 2XTCA 1SIZA 4GVBA 4DV0F 4JV5F 4LVOP 3A12A 4KV8B 4LFBJ 4Y65A 3M8QB 2QA4G 3W65A 4IUFA 1ZM3A 4DQRA 3K0JA 1Y00A 4R25A 2HK2A 3MUVP 2MQ8A 2VPXB 1XNQJ 4B9VA 3BKUA 1VMBA 1JLCB 3CCTA 3QFWA 2OD4A 4ITSA 3CCVS 1RAIB 2AHOB 3D2WA 2IJNA 2OP5A 1RBAA 1NK4A 3W61A 2KI2A 1PSDA 4I67A 4AFFA 3RW6A 2DO0A 3AD9C 4K7QA 4HKQA 3EE3A 5EUHA 1FO1A 1XMOF 4J9RA 3CTRA 4HDHA 1T94A 1NB2A 5HBMB 4DF4A 3MTJA 3U7JA 1S99A 1UA1A 2B5JA 1HBMB 4DR4J 4KHMA 4G1QB 4KQZA 2JLGA 1ZM2A 1N32F 4OZ3A 5LMUF 2IFXA 3L9ZA 2ASJA 4JUZA 4KH1B 4NE9C 1X5PA 2R2SA 4G1PA 3TAMA 5L46A 2BJEA 3QJJA 3G6ES 2YKMB 3QSYB 4A47A 3JYTA 4IYQA 3GPAA 2VG6B 2ZH9A 2WW8A 1YJUA 2V4JA 1N6QA 3FBEA 2GIRA 4I64A 1HNVA 1FWPA 3KLIB 2RB7A 4YHHF 2W4PA 3DLKB 2JRSA 1EP4B 4MT1A 2V8PA 3A3NB 1R8AA 3I9V9 2BE2B 1NJZA 3UD4P 3BN7A 1FD2A 1YDLA 2HK3A 3P45B 4GO7X 4ZVSB 4MIAA 1ZZFA 4X64J 2Y1RI 4Y2KA 1LWXA 2WOMB 3DOLB 2LQJA 4IFVA 2I8EA 2BANB 2E9TA 3V4IA 3KDOA 3KDNA 3GFYA 1S9GB 1X31C 3OTEA 4ECXA 3CC7S 1U24A 3PJXA 2OPPB 5D3GA 2KVIA 4MMOA 1RTIA 2Q43A 3H8YA 3IWLA 4DV3J 1AFIA 2ALYB 2CG4A 2ZHBA 2ZH6A 4XPEA 1OMSA 2UUAF 2VDHA 1PIEA 5E33A 3MURP 1HNWJ 2J0QD 1J27A 4LQ9A 1F9FA 4EBCA 1EB0A 3KHRA 2QZ8A 1P6TA 3QGIA 4QWCA 5I3UA 4AT1B 1P9YA 1F2HA 4GC7A 3I82A 4HTIA 3NP5A 4LBHA 3TUPA 1T8EA 1M1HA 4C8LA 2XTEA 3WQPA 1SC4B 4ZOSA 3TJ9A 5KFJA 4TLRA 3GYGA 4M5DB 3ADAC 4L72B 5A8WB 3LGHA 2LEBA 2PMHA 1QVFR 3TANA 1SVDA 5D0GA 4GRSA 3M32A 2XCPA 4LIRA 4DPXA 2F8HA 3KUHA 4K4SA 1KHWA 4JBCA 4K4VA 4MKYA 3IM8A 2JFKA 3NLCA 2JSXA 2ZD1A 1FJGJ 2R7SA 1HMVA 4AD6A 3HPOA 4RW4A 3PRBA 4PG6A 1M5VC 2CZ9A 3VAKA 1CULA 3M05A 1Q4RA 1UZDA 2YKOA 3BEGB 3VWSA 3IBFB 4EBEA 1RHQB 3HJVA 4ED5A 1WOPA 1HBOA 2BJ9A 3SEOA 4FDFA 2OEMA 4YS2A 4YR3A 4EEYA 1ZPVA 1OQ3A 1T03A 4CIOA 1VBKA 2VC0A 5IWAJ 4JI6J 4H4OB 4LF8J 2XB2D 4A8KA 1DQ8A 1JJ4A 3IS9B 1TR0A 2XSFA 2HHHJ 3QPIA 3MR3A 2O66A 3H90A 1K73T 3AD7C 2M8DB 1VQ8S 4WKRA 2DH7A 5F3TA 1GXLA 2DH8A 2BMBA 3SCJE 2QO3A 1VC6A 4PRFA 4IO1A 2B9WA 4PQUA 2BKNA 4N8OA 4P71A 2ASLA 3FVYA 3MD1A 4DMZA 4Z7CA 1R8BA 3KK2B 1NH8A 1T05A 4MTPA 3HMJG 2Q66A 4M5NA 1T9VA 2IAJB 2IRYA 1CC7A 3Q24A 1O5JA 3MCOA 3ET6B 4URGA 2K06A 3EM1A 4LFAF 2AGQA 3DRRB 4USIA 1FKAF 3N5BA 4IQMA 2NUHA 1N52B 3BYRA 3AA8A 3M6VA 4DL7A 2XMTA 3HFZB 3R5DA 1K9MT 3EVOA 2XS2A 2HWIA 4ECWA 1DQAA 2DITA 3PJWA 4IKAA 4KB7A 3ETOA 1F5BA 3MMAB 4ED1A 1DLOB 2DNNA 3LA0A 2ROEA 1HPZA 3DRPB 4DV2F 5ITHA 1JLAA 3JSYA 4M5MA 1LXJA 1N33J 3EDQB 2E7VA 2W01A 4DL3A 3FMWA 4B3MF 5B0EA 2XTDA 2C3MA 4ZN1A 1KN6A 3OFGA 1NDLA 1DJ0A 3LW5C 1WDDA 4LF6J 2X1GA 2G2ZA 5KG7A 4ES3A 2ZUAA 3CJ4A 5T41A 4F4XA 5K8NA 1QDUB 2UV8G 1TL3B 5K5MA 1I3OB 1VQ6S 4QW8A 1UTAA 2DB1A 1U49A 1U48A 5AE2A 1OSCA 2HQ3A 1AZSA 3MEDB 2W8LA 3DRSB 4E8UA 2B6AA 3M9NB 1FWKA 3K5LA 1QAYA 2UU9F 2C2EA 1RP5A 4JI0J 1VQ5S 4M63A 4PG7A 2G13A 4ECUA 2F8EX 5T7LB 3OVSA 4F2RA 3BGRA 4WU2A 2J0SD 2DO4A 3POTB 4XDDA 3D6MB 1L3KA 4QYRA 4HL9A 3SIPB 1OJ4A 2DCLA 1RDRA 2KT3A 3DM2B 3RB4A 4NZ6A 4TY9A 2V8DA 3R7BB 3EX7B 2GAHC 3AT1B 4DS5A 1NKBA 3ZZ0A 1FK9B 3CCRS 2V2VA 4EMDA 3NEKA 1HWIA 5CYMA 2DNKA 1RBLA 4R8UA 3C6TA 2BM0A 5KFSA 4JI5J 1QVGR 2PD1A 5KFIA 3GIJA 3R6GB 4HT5A 3F0NA 2YVSA 4FS2A 1GMUA 1M5KC 3TP2A 2MGZB 1CJTA 2GVZA 2KTQA 3RRGA 3NS6A 4ZLNA 5KFAA 4X4QA 4WFYA 3GG0A 1T9XA 4RNHA 1Q8BA 3OR1B 2B9XA 4PXEA 1NU4A 2R7TA 1CLFA 3G86A 3AX3A 3UR3C 2AEFA 1YJNS 2PFDA 2M70A 5KFBA 3TJ8A 4B9NA 2DGQA 4OI1A 4RBUA 1NK0A 2JC0A 2RDDA 2OO4A 5LJ3Y 3ZZTA 1LFPA 1SC6A 4QR2A 2R3VA 3PV8A 5BR8F 4KH0B 1K0TA 4X66F 2XULA 4MK9A 4WCEQ 5K14B 5IFMA 4AQYJ 1Z4UA 1FKPB 4X84A 2HFNA 2YKNA 3N4WA 4RPFA 1H6KX 4OX8A 2CZ4A 4Y2AA 4MH8A 4HYKA 2CNNB 3MM5A 4PXDA 2G0JA 2ZVSA 3HF5A 1TUGB 2UUBJ 1Y9OA 3FMBA 2IM2A 4I0WA 1NSPA 4HT7A 3BDPA 3PYEA 2HQIA 4KAIA 2UUWA 2XLKA 2ACYA 3HVTA 5ETVA 5U47A 4QJVA 1FNMA 3OR2B 1D09B 1C4AA 1EZZB 1IKWA 1BQNA 5GADU 1LNQA 4CLUA 5B7WA 1F2GA 1YIJS 2QGFB 4NCBA 5CD4A 3Q86A 1RKJA 4K0KF 2PO4A 3BH6B 3E01B 5J2NA 3HHNB 5KFTA 5C7PA 3R8YA 2KO1A 3MAAA 3PX6A 1U26A 5HO4A 1NSQA 3CIMA 1NHKL 2VH7A 2OH2A 3I5AA 2WVFA 1IUJA 3TA0A 4ICLB 2C2ZB 1VRTB 3D54A 1RT6A 4LRAA 3M2VA 5HJYA 1K47A 3D66A 5ETSA 2F65A 2KFNA 1CQNA 4RBTA 1U4BA 1QUVA 3C14B 3CJRA 2P9EA 5K8MA 3Q22A 2E29A 2YQ1A 4EWTA 2Z58B 1U1MA 2E5IA 2HZCA 1DURA 4L75A 2EI5A 3OTDA 3ENWA 2B56A 3W60A 1DFDA 4IFYA 2LECA 2CJKA 1HR0J 5DDQC 4RW8B 1CBKA 3ILLA 5DRKA 2YX1A 5DGAA 3SCLE 1T9WA 4NXMJ 3D7SB 4RJVA 2M52A 2G1HA 2JVOA 2UXDJ 3CCJS 3AJ1A 2YWFA 5F8GA 4ZVQB 2HS4A 4KFBB 4PYDA 3TR5A 2BQ3A 2IDEA 1UWAA 2PT0A 2HBQB 3S01A 2PSZA 1WI6A 4NCAA 1RHJB 2HHVA 1SUQB 2X51A 5IM0B 3OPKA 2VD3A 1N88A 3O44A 3NBPA 5F9LA 2KG1A 4U6PA 1BC6A 1OY6A 2DISA 4OZ2A 4ZJQA 1U09A 2ZVIA 5CXTA 1P1LA 3T1YF 3VZHA 1N5YA 4DR6J 4W98A 3Q8PB 4HI2A 2MLXA 2UVWA 4WK1A 1RK8A 1ZAXA 4UY8T 3MPUB 4TY8B 4O3NA 1S1UB 3JAMY 2LP4A 2IIHA 2DJWA 2GO9A 2W9BB 3GP9A 1YITS 4CH7A 1S76D 4UUWA 3ITHB 5DGBA 3IBWA 5ADZA 2R7RA 1KFSA 5LSRA 4ES2A 2LFVA 1GFWB 1PBUA 3OJUA 2B0GA 4J9KA 2JLEA 1NRKA 2KFZA 3US5A 2ZE2B 2NPIA 3VVUA 2H54B 3C16B 4CI0B 3H20A 5E0OA 4QQBA 4PWDB 2UVRA 4JI1J 1KLMA 1RTJB 3M4XA 3MM9A 3EPGA 4ECSA 4QIFA 3VGVA 2DVIA 4DCPB 1SQEA 2MKHA 2UXBJ 1FJEB 1S0VA 4EZ6A 2HS3A 1SPBP 1VQ7S 1SH3A 1CSJA 1N34F 4UOGA 4G3IA 1HLWA 1SV5B 1V3ZA 4JI4J 1UEVA 4CO5A 5F8IA 2YKQA 3KOAA 2VG7A 2KDOA 3IAM9 2H3EB 1HYSB 1VQSA 4FZVA 1S6QA 2EW9A 1VR6A 1Q86T 3OHBA 5C24B 1X5TA 4GVLA 3CEDA 5LJ5Y 3MCMA 3VGUA 2D9OA 1YVFA 4ZN3A 4FNIA 2WZ1A 2J7UA 2UVVA 1UP1A 4KHPF 2Y8WA 1IR0A 3E3XA 2J6TA 2M8HA 4FS1A 1Q7LB 2HNZB 2YX7A 4IG3A 1URNA 2IBKA 4ENOA 1TKTA 1T9YA 1HHQA 4O4GA 5IXUA 3BM7A 4K4WA 4C8NA 3SFUA 3BN4A 3WHIA 4IH6A 1S59A 5ETLA 2F4FA 5DM7Q 2PMWA 5D0EA 1KTVA 3KJVA 4Q43A 1KOHA 5KFCA 2FHJA 5HLFA 2GQ2A 2MZJA 5KG0A 3R97A 3KWMA 3H4DA 4WFBQ 4I2QA 1VIOA 4EGLA 4DV5F 3QZ8A 4RW7B 3OFEA 2FHMA 1FRHA 3SI8A 5HSPA 2C42A 1EQMA 5FLXU 2QLJB 2J0XA 5HI7A 1FEHA 2KN4A 1UFWA 3HVWA 3ILIA 1EETB 2FVRA 3BQ1A 4F26A 1Q8LA 3CJ8A 4JI3J 3EUNA 2DNZA 3FJ2A 4NLPA 3SYZA 4OZ1A 5DLGA 3ZZRA 2XSJB 1UA0A 2NZ4A 4B9MA 5KTQA 3IA0A 2YWHA 2ADBA 5SUHA 4DDFA 3H5UA 4DZDA 2V68A 2W9CA 3QO9A 1T9UA 1RTHA 4JI7F 1JXVA 2B9YA 2V1TA 2HNDA 2GHVC 4XDCA 4UQGA 4WZMA 3RTVA 2DNLA 1ZOTA 1MWYA 3RBDA 1Q95G 8RUCA 4OJ3A 4B3TJ 4YHHJ 1K8AT 2BW7A 2HHTA 4Q8FA 1HBNA 2AYBA 1URRA 1R8CA 3HHLC 4PUOA 1NPPA 4U7UD 1B64A 1LWFB 4JOUA 5AJ3F 2B5JB 1SIWB 1N8RT 4NYPA 1HNZJ 2AW0A 2WTFA 4IG0A 4C48A 1S7IA 1PJ5A 4CO4A 3GIKA 4C8KA 3FQKA 2ZJPQ 3ETMA 3FFIA 2FIUA 3BGUA 1CVJA 1CC8A 4CYUA 4DQSA 4KKOA 3JYTB 5LMNF 1VBZA 4RR5A 4ZVFA 3GWCA 3ILOA 2IM0A 1QY7A 3K5NA 2WAQD 2V4JB 3JQMA 1X9SA 3GILA 4IDKB 2H1YA 1G2EA 3W66A 1T95A 1FI4A 1N6QB 2R9LA 5IT9Y 1HNVB 2A2DA 2V34A 2DK2A 2NXUA 3O3LA 2IMOA 4I4BA 2DNOA 1Q0NA 4ANCA 1YJTA 3M1VA 4Q2MA 3QBCA 3UE2A 4WE1B 3QRQA 3LPEA 2Z4PA 2LEAA 5J2QB 3H25A 4KE5A 1RT1A 3AB4B 1WC0A 3PACA 2CDRB 4IOBA 1X4BA 3UW1A 4ZVUB 4TYBA 1PO6A 2J0WA 3M8RA 2JH3A 3V4IB 3LP2B 2KT2A 2UVUA 4ILLA 4Z7YA 3CCMS 2RILA 4KPCA 1N36F 1V6HA 3DU6A 6FDRA 5D3GB 1WDTA 4DU8A 2MDAA 1RTIB 5I3QA 4JV0A 2KG0A 3AOAA 3TX0A 3Q8VA 3AX5A 2LA4A 3TI0A 5KFVA 2P8IA 2EXUA 3QSIA 2RD5C 1MMNA 4HI1A 4D3HA 1HQ2A 3W5YA 3J81U 5HK4A 1JXLA 1PG5B 2BRKA 4GKJJ 4DPYA 3MI7X 5CYJA 1BWEA 1YJRA 4NMLA 2FHJD 4C0BA 2GJ2A 3M8SA 4Y2CA 2MZTA 2ADCA 4V19X 2BVZA 3BH7B 2F4VF 3D3BJ 1JLEA 1D8ZA 4F4WA 1IR2A 2E1RA 2FC8A 5J2MA 3M32B 4J9NA 1X60A 5F9NA 1X4DA 3MPVA 3UNYA 5M2RA 1I94F 4ZPTR 5J2PA 4UW2A 1BD6A 4LF5F 2XYPB 3OSPA 5EHHA 4CT8A 2ZD1B 5D6GA 1RAOA 3LF0A 4KT0C 1DAXA 1HMVB 1NEEA 4RW4B 5EX3A 3V6DB 4X4PA 4UZBA 3KLGA 1RT4B 4LFBF 4C8MA 2LU2A 3KHGA 1R43A 3IAS9 4MAKA 4FYDA 1UJ5A 3T9NA 2QT7A 1KVKA 3MEKA 2VZ9A 5DDRC 4EUVA 2ZFHA 4OYAA 2HFOA 5H1SV 5DQHA 1XNQF 2QFJA 1DARA 2ZZMA 4Q2LA 2OPRA 3P96A 4NLRA 5KFGA 4ZCMA 3KK1A 4USWA 2IRUA 1TVRA 2P9GA 4UOFA 5AE3A 1LW2A 4ZIWA 3SXLA 5D0HA 2BA9A 4DWIA 2FJEB 5A6PA 3CJKA 3QAEA 2QEXS 3TZWA 4LBPA 3M6XA 1VQYA 5KFZA 3PRDA 1D9FA 4PEOA 4OI0A 3SV3A 4HR2A 4NX9A 4DXLA 3QGHA 1BWVA 4HTJA 2H5JB 5I42B 1QAJA 1FE0A 4F0MA 5L1LA 2HFVA 4FKYA 4DR4F 4B3SF 3EZUA 4MYTA 2AJ1A 3K5MA 1LW0A 4X4UA 3UI3A 4IH7A 5AXNA 4Y3CA 2DIUA 1T05B 2CQHA 2VFTA 2RUGA 4YB6A 1IJEB 3FZBA 4O3PA 3G9CA 2G2YA 1Y0HA 3HX9A 3W7BA 2BJ1A 1KEKA 3LUYA 4F0KA 2PMZD 4RW9A 1B0VA 1CJUA 3MM6A 3QGGA 3PW5A 3CD5A 1PC5A 2YNHA 1HBUA 4LBIA 2VB6A 3Q0AA 2C2KB 1NLKL 3OSNA 2XQCA 3J80Y 3KMSA 2VV5A 2OFHX 3VHQA 2WBMA 4DUTA 3HZGA 2RKIA 2QLWA 2COLA 4ZPDA 3PX4A 1HPZB 2RSQA 3ICLA 2N82B 4OYMA 2J7KA 1FF2A 3AQPA 2L41A 4E2FB 1YLXA 1JLAB 4X64F 1X4CA 3E8OA 1OM2A 3R7NB 1FWLA 4C97A 5IOLA 1WTFA 1FX4A 5DJBA 1WI8A 4DR5J 1G1XA 3NOCA 4ZMMA 1WC3A 2MY8A 2VPZB 3EWGA 1TL1A 3IR7B 2JHEA 2E44A 1JWWA 4ZS6A 1K1QA 1O6XA 4M95A 3J7AN 2YBVA 3BO3A 4OX9J 4ZITA 2XS7A 1OO0B 5CCLA 1NJXA 1TL5A 3DHWC 4HH0A 4I68A 2WVBA 4N41A 4F4ZA 2B6AB 2ZEJA 2DHSA 3AXKA 1B0PA 3SSRA 1UZHA 1HNWF 1XWLA 3EDRB 3DLJA 4DR7F 4HACA 4ZHRB 2W7AA 1Q81T 3AJ2A 3CO0P 2I6WA 4DV4J 4M5HA 3BGRB 2RS8A 4UTGA 3K17A 1PYSB 1RB0A 3CULA 5CA5A 2R8IA 3AX2A 4AXIA 4ZKAA 4M5IA 3P6YC 3NNCA 2MZ1A 2WONB 4F3QA 4X66J 4DX7A 5CZVA 1IKYA 2IYIA 3EVWA 3RBEA 4R8UB 1U02A 3C6TB 2RT3A 4C3KA 5HROB 3KLFA 4CO0A 5H9FJ 3HSDA 3VQTA 4I56A 3KJFB 7FDRA 2CPIA 3OL6A 4RNNA 2ZH5A 3SBMA 1Y3KA 4G6VB 1R0CB 3GFZA 1AXQA 2JZ5A 4WFAQ 1VFJA 2GVZB 1HNXJ 1A6LA 2VONA 3GYXB 2B7CB 4DG1A 3NY0A 1JJCB 1IKVA 3A4TA 3VF0B 1FDAA 4V19J 1EX8A 4JI6F 4H4MA 3IRXB 5HANA 4DQPA 5D77A 3CDUA 3I6PA 4LF8F 2B9EA 4TQSA 4CO1A 3L3CA 1B7YB 2RIJA 1X0PA 3AXMA 1IWAA 1MNEA 4AUKA 1RZMA 2CQPA 3CCWA 3QZ7A 3IN5A 1VOMA 1U8SA 3W5XA 1YBAA 4XO0A 4R5PA 2YKNB 3R6LB 3HHLB 3UDLA 2G0IA 1W26A 3CPWR 1LWCA 4A48A 5CQGA 3K89A 1ZYQA 5D0RA 4RO0A 1OQ6A 3KXDA 3AD8C 1XEZA 3G71S 3MM8A 3HVTB 4ZDNA 4P7TA 3CF5Q 5A8KA 4AXJA 4DCJB 2XWXA 4RBVA 2QL7B 4OV1A 2RU3A 1S4EA 1BQNB 1BUXA 4UUXA 1VHIA 4YOEA 2YX4A 2ZBIA 2ZM6F 4LIWA 1FRLA 4UOHA 3CCZA 2C22A 1UPMB 2B4UA 2KVQE 4FXWA 1RJJA 1C1BB 4ZCLA 3J81j 2LKZA 1DHMA 2A3JA 3THPA 2JL9A 3MAAB 1C0TA 2K2PA 1JJ2R 3BO2A 1F9HA 3BBBA 4EYIB 5GAHI 3DDKA 5E2QA 4NI2A 2FPHX 3BF4A 3I0SA 1N33F 1UCNA 1RGVA 2LQ5A 1U0SA 1VC0A 2RU9A 1RU2A 2XLIA 1Y10A 2YNFB
chains in the Genus database with same CATH topology
1IXKA 1W2IA 3GFHA 4IQMA 1KLNA 3OXLA 3T6BA 2NUHA 1RTDA 1N52B 4MIWA 3IRWP 5EWGA 3T1HF 1O8BA 2E1AA 3CDBA 1MSWD 1Y5LB 1KHVA 3AA8A 1TKDA 3M6VA 4LF6F 4DL7A 3LH2S 1UAWA 3H2UB 1GAOA 4DV1F 2XMTA 2DR9A 2HW3A 4RWXA 2XZ2A 3R5DA 5KG3A 4RNMA 1K9MT 3SQGA 2XLJA 2XS2A 2HWIA 3B8HA 1FRIA 5DG8A 4ECWA 1TKXB 1DQAA 1UJ4A 4WK3A 5KT4A 1UVJA 2GHWA 2DITA 2X3GA 2AGPA 1FCAA 3PJWA 4IKAA 4ZPBA 4KB7A 5KOWA 3ETOA 1F5BA 3M8PA 4OHXA 3RB3A 2QA2A 3MMAB 4ED1A 3N28A 4WKYA 1DLOB 3LPYA 2MKKA 2ZH1A 2DNNA 3DXSX 1U6ZA 3M2UA 3ISZA 2ROEA 3PFEA 4TYAA 1H0HB 1HPZA 2BV3A 5HL7Q 1VBYA 3DRPB 3LP1B 1TV6A 3CJ3A 3MTKA 5M2PA 2A10A 4ES1A 5L1KA 2AD9A 4BC9A 3D28A 4DV2F 2DTJA 1FE4A 3THTA 5ITHA 3GV7B 3IR6B 1JLAA 3JSYA 3N01A 4O3SA 2YKAA 1IKXA 1LXJA 3NMAA 4DL3A 2B43A 2FJAB 3DU5A 3FMWA 4QOTA 3D1OA 4B3MF 4B17A 5B0EA 2XTDA 3PM9A 4ZPVR 2ZH8A 4FBUA 1SH0A 2C3MA 2E1MC 1UL3A 5THWA 1S4FA 1G7CB 3I9ZA 4OI4A 2I38A 2HNYA 1BGXT 1KN6A 1EETA 5B0FA 4GO5X 3OFGA 4OZLA 4JI0F 5D8HB 3KLHB 5E3CA 1X4GA 3D0GE 2CPXA 2QLXA 3GV5B 1DJ0A 3LW5C 2MJUA 5MAOA 3LO3A 2MHEA 3L95X 2QA1A 3EGWB 4RUHA 1YRUA 4OX7A 2X1GA 3BSAA 2C3YA 4NCGA 5KG7A 3DLKA 4ES3A 4ZVEA 4DUZF 4FP9A 2XO7A 1OIAA 2XSJA 3CJ4A 3I4PA 4HDGA 3PW0A 5T41A 4F4XA 1Q8IA 2ZH3A 2DHXA 1LWEA 2BM1A 2BE2A 5K8NA 2XNRA 4FPRA 2UV8G 1TL3B 1S9EA 5K5MA 2WRMA 4C3LA 5KFMA 1NZAA 2DGVA 1VQ6S 1HWUA 2IM3A 4QW8A 2RDJA 2DB1A 5JVGQ 1U49A 1NNDA 2OPQB 3LWMA 5AE2A 1OSCA 1U48A 1C4CA 2HQ3A 1NB7A 2IVYA 4TLQA 1X9MA 1AROP 1YTYA 4DR3F 4K5RA 3IR5B 2POKA 2XMUA 2MMYA 3EGNA 2OMOA 3MEDB 4EBDA 1S72S 1U25A 2DHAA 2W8LA 1R0AA 2GC8A 2A18A 5DQGA 4ETXA 4GC6A 4PXCA 3B82A 3DRSB 4ZCKA 4E8UA 5GAEU 2HMIA 4P2SA 2B6AA 1HL6A 5B09A 3M9NB 4I6YA 4B9UA 5FD1A 3K5LA 4EFAC 3ENVA 1UVMA 1JNRB 1QAYA 2UU9F 1TAUA 2C2EA 1RP5A 1Q7YT 3IFEA 4ALZA 1VQ5S 4J9LA 2K7JA 4YP3A 2F8MA 4JI5F 4M63A 2CYYA 4DSEA 1N5YB 2R7VA 4Y28C 4QWEA 4PG7A 2DIVA 1U1PA