4NM4H

Crystal structure of broadly neutralizing antibody cr8043
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
223
structure length
219
Chain Sequence
QVQLVQSGAEVKKPGASVKLSCKASGYTFTAYSMHWVRQAPGQSLEWLGWINTAIGNTQYSQKFQDRVTITRDTSARTSYMELSSLRSGDTAVYFCARGASWDARGWSGYWGKGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antibody CR8043, Light Chain
publication title A common solution to group 2 influenza virus neutralization.
pubmed doi rcsb
molecule tags Immune system
total genus 40
structure length 219
sequence length 223
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nm4H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nm4H01
1OTUC 1RHHA 5HYJB 3CSYB 2QADB 3SBWC 4JN2A 3S3PA 1C5CH 3FOMA 3VXTB 3MCLL 3UROR 4PRPE 1GIGL 1MELA 2ZPKL 3GMPA 3STZA 1AO7D 5CMAA 1ZWIA 3WO4B 3L3OB 3L7EB 4N5UA 1T0PB 4XBEH 4ORZC 4CMHB 1O7SA 4WUKH 3BP7A 4JFED 1N8ZB 5C07E 5SV3A 4YO0A 4AYFA 4ZPTB 1IEAB 3I6LD 2CKBB 3CMOL 1A3RL 1U8LA 1BZ7A 1HQRB 4RMUA 4ZODA 5TDOA 3O6FB 5D7IF 5AZ2L 2AXJA 3SDXF 5MEOB 3KPNA 4MNQD 5HGGS 5TFSH 3VWJC 3MJ8A 3BAEL 1GAFH 5J1AB 3HI6L 3QXDB 1AGFB 2F5AH 3G5XB 1EBAA 4X8XA 3GB7B 1G6RL 1SYVB 4DTGL 3BN3B 3MYJB 4X6EB 3C60A 5I18L 5KZCD 2QHLA 4QKXB 4TNVF 3TA3A 1H5BC 3D25B 5EC2A 2KPNA 4NZRL 3QA3A 5FKAB 1G6RA 2R2HB 4WEBL 1A7PL 4QXWA 3C6LB 4M43L 1AP2B 4PJBE 4LSRH 1KNOA 1T1YA 1A9EA 3VG9B 3CSBA 3ZKSD 2NZIA 1ZHKB 1KJMA 2XRAH 1QQDB 2VRAA 3IDYB 4JFPA 4LASH 1MVUB 2JF1A 4HIHA 4JQIL 1Z0MA 3MGTB 5GHWH 3WNKA 5F89B 4X7EC 3TYGL 2ZUQC 1N26A 2EDLA 5C0GA 1FNGA 2J1KA 4PP2A 3MRBA 1PD6A 4JFYB 2P7TB 2VLRA 2C1PA 1PZUB 4LHUD 4Q58C 5IW6A 5CLWA 4LGRB 1Z9SA 4L8CA 1HXMB 3AS2A 3IJYA 4MQ7A 4E41E 3P73A 4D2NA 2X70B 1BAFH 1U3HD 1IL1A 4Z7NE 4ZNEA 3B9KD 2APTA 1OD9A 2FH6A 3AB0C 1CE1H 1G7PB 1YC8A 1OOAA 1F11A 4WWKC 3FOLB 4JGMA 5DUPH 2KDGA 2VXUH 5CEZH 1GVIA 4HDIA 1F90L 2WBJD 1QR1B 5EZOL 1YMHB 5J13C 1D9KB 2AXFB 3ALWA 5GXBB 3BDYH 2O61A 4WW2F 4WIQA 4AIZB 3OKMB 4HJ0D 1JJUA 3KR3L 5CKGA 1JNHB 3VGAB 5CP7B 4YBLC 5IIEB 3P40A 1OF2B 3EYSL 3TZVD 4OM0H 5C70A 4X6DA 3DBXA 1OAYL 5CSGA 5EORL 3PXJA 2EC9T 4Z0XA 4WJ5B 1RZIB 2BJML 3QIUC 3VWJB 2PO6D 4OUOA 1MFCH 4QRPA 4TNWK 2DTML 2WINB 3OTTA 2J8UF 1Q9LB 4QRTA 5ID1B 3RL1A 4UT9H 4M6ML 3MLRH 7FABH 5BZDB 1JI2A 3QT2A 5JOFA 1QVOA 3C09C 5BJTA 1YA5A 2XNAB 5T3XL 3C2SA 5SX5K 4OCRH 1T7ZA 3PQYE 1DQJA 5FGSA 2AV7B 3V7MA 3BEVB 1ULVA 4XNZB 4JKWA 4Y8AA 1EAJA 1M7DA 3B5GA 4LSVH 3IDNA 1C1EL 3EW3B 4FFWD 1MCKA 5HHMD 4LLVA 4HS8H 5CEXA 3SO3B 5C0RH 4JN1H 5BO1L 3QNXA 1BZ9A 4NKDA 4RIRA 2HT3C 3MA7B 4R4FH 1KJ3H 5GSVB 2D7NA 2XN9B 3WXWL 4HHAA 3FRUA 2MSPA 3PWPB 5DK2B 5BQ7A 3VXRA 3BOVA 5D5MA 2DWEA 4PRID 1U9KA 4FMKA 3MRIB 3AB0B 1KLUA 3K4AA 4RISH 5IHZB 1JGEA 4XTRD 4WWKB 3UJJL 1AC6A 1S8DB 3GKZA 3QFJA 1XGPB 5DMGC 4XGZB 3SDAA 1MUJA 4LVNB 43C9A 1ZGLA 2F53E 3NFPA 1D5MA 4MQTB 3VFTB 3KWWB 4EI5D 3NOIA 2XTJB 1D5BB 1JZ8A 1I8LC 2AJ3B 1S7RA 3HE6C 3WLBB 2GJZA 3MFFA 2FHFA 2R1YB 3U4BL 1LE5A 4JRYA 1OSPH 1LO3H 3DI3B 3X12B 1JIBA 3QI9B 4I0PD 3V6OA 4KK6C 5MERA 3MUY1 3PHQA 5CEZD 3D48R 1GGCH 2FSEA 4HKJA 4UUJA 3CX5K 1K8DB 2DLGA 3RWGB 4JQXC 4LSUL 1VB9A 1KPRB 3FB6A 4OLXL 1OAXL 4F8QA 1R3JA 2H8PB 1JUFB 1EFXB 3ULVF 4OKVB 4V1DA 4Z95H 5J1TC 2A6DA 3RUGF 5JIKA 5GGSA 2FNBA 1A7RH 4MDJB 4TSAH 1MFBH 2BVEA 4BYHA 3AXLA 1ZVYA 1UB5B 3RZWA 1DLFH 3BPOB 5AYQA 1RD6A 2P5EA 1WWCA 4Z77B 4ZUVB 4HIJA 2YN3A 2UY6A 2D7QA 4QRSB 5C7XH 5E8DH 5L88L 4W4OC 4CVZB 4XC3L 4X9GA 5C6TL 1R3HA 4X99B 3T0EB 4PY7B 1IGMH 4GKOA 4M93B 5DWUH 4LEXH 2JK5B 4PB0H 1JGVL 3CH1A 1EVTC 3OX8B 3RGVC 3OGCB 2P24A 4G80B 4QRUB 5E2WH 5KSAD 1WCBA 3PV6B 4IRJA 3UJTL 3U46A 2FBJL 1MQKH 3QDJE 4YQXH 1AC0A 1UENA 1ZA3B 2YC1A 4JCMA 3DURA 4M1DL 3MRMA 3NFSL 4PJHB 4AEHL 2C9AA 1SBBA 2JJUA 3SY0A 1MRDH 3CFDB 2ZP0T 1J87A 3FMGL 1DEEB 4H5SB 1FNEA 4WV1A 4L29B 4WHYG 1AKJD 3V0AC 2ZOKB 2EEBA 1A4JB 1N0XH 4FZ8H 4QOKD 5IVXE 5IVZA 3C5SA 4TVSa 3EOTL 1MNUH 2XKNB 3RA7L 5HVHB 2EYSB 2CD0A 1T1ZB 3HE6B 4M7ZC 4PRNA 1BJ1H 3CX2A 1UZ8A 2A9MH 4FS0A 2R2EB 4MNQE 3PJSB 1YEGL 1PG7X 4K2UH 3O6KH 3P11L 5JZ7D 1T3FA 4HXBL 3AS0A 4KKAC 2BNUA 3DI2B 4C54A 1GOGA 2ATKA 3DV6A 4RGOL 1BBDL 4BH8A 1JF5A 2EE3A 4OLVL 4Y5YC 4YR6B 4QNPE 3STBA 1E4KC 1OQXA 5KAQF 3LAFA 2NX5B 4NC1E 4LKCA 4ERSL 4F7MA 4PJAB 2ADJB 2CO6B 4LPVA 5K9JH 4JY5H 4RCAA 1TNNA 3LQAH 3LN4B 4EEEA 1VACB 2GKIA 4HMDA 4MD4A 1VERA 4QYOA 3IKKA 3SDYL 3ME0A 4Z7WF 5K9QI 1TVDA 3QG7H 2AI0H 3GSQA 3GIVA 5TE7L 1U92A 4OGAC 4MB5A 2GAZA 4F7CA 2J6EL 4MS8C 1CLYH 3NABL 4MA1B 1DN0B 4KRLB 4NN7C 1YECL 3IFNH 2BZDA 1B3JA 5F9DC 4IJ3C 5DJXB 2E9BA 4N5ED 4PJGF 2J6EA 4X8JA 5ISZE 4PJDB 1ZTXH 3QYCA 5SWSD 5I0DA 1ZVSB 2N7AA 5IFJA 3MRKB 2FDBP 2E8ZA 2VAAB 3RPIA 1JZ3A 4AMKH 2AVGA 3OJDB 1U36A 3HC3L 4MJ2A 1AY1L 4LSQH 3IVKB 2Y1VA 2DI8A 3PWUA 5CSBA 3R1GL 3BUTA 1NEUA 1GGIH 5KJRL 4JREC 5DEZA 4QEGA 1N6VA 5F3HA 4Q7DA 5IOPA 5I1IH 2GTWB 4P46D 1FZKB 5GRUH 1KGCE 4X6BA 4YGVA 2VDPL 4EQ2A 1GC1L 3DRQA 2N4IA 5I2IA 1RZFL 4P5KB 4N0UE 4BH7B 5LGJB 4NM4L 3CAFA 1D5ZA 2WV3A 3HRZB 1YJDC 4U49A 3ARXA 3MCKA 2B39A 1WFNA 1N64L 4K9EH 2AK4E 1KELL 4ONOA 3RWHA 1LEKB 2R8SH 3TLRA 1I1AB 5EO9A 3BISA 4DUXA 1OPGH 1SJHB 5A2KH 3N0PB 1T66D 3RHWF 2OJZH 1PEWA 4JPWL 3X11B 2NTSP 3A67H 4HUXA 4W6YB 2F74A 4I3SL 2IAND 2V7NA 4OLUL 2J8UB 1B4JH 3JWDH 4JAMA 4R0LC 5C08B 1E6OL 3GMOB 4OIAA 4NQDB 2Q3ZA 4AT6A 5MP6H 5FYLD 4QO1A 3MRNA 5C71A 5K9OB 2FLRT 1CCZA 5JDSB 1KIRB 3TT1L 4L3EB 1A6WL 1H3PL 4X4ME 4KTYA 4XVUD 1GOFA 4G8IB 2NY1C 4LLMA 4L9LB 3W5MA 2ZCHH 5I1AA 3EJJX 4KDVA 3KPSA 5TF1L 5FYKH 1BD2D 3TBWA 5BV7C 5E8PB 4OJFL 3H6JA 4JM4H 3DXAA 3RAJH 3P4NA 4XP5L 5JNYA 4R2GB 3D6GA 1IC5H 2X4QA 2E5EA 4HF5L 4KHTL 5DVLA 4TQEH 1G0DA 4DGIH 2OK0L 2P1YA 4I0KA 1P7QB 1FV1A 4NQCB 3NCCB 2F54A 2I60L 4XBGA 4ZXBC 4OV5B 3OB0H 4KPHL 4FTVD 4OLZL 3PWJA 4PREB 3G5ZA 3LZFL 2ZCKL 3NTCH 3ZYJA 2HRPL 3VFNB 1A5FH 1UZ6E 1E27A 2V5TA 5DD6A 2FD6H 4MCYB 3QBTB 4PJ5D 5IVOA 4KI5D 5D7JD 4PY8J 4RAVA 1UWXK 3QXAB 5B39A 3HB3D 5JW5A 1FYTA 2J5LB 1FLRH 4P3WA 4XCCL 3B2VL 4NWUH 2Y6SD 5IT2H 1NPUA 1C7SA 1IT9H 5IUSA 1BHGA 5CEZE 3DUUB 2NNAA 1ED3A 4PGJA 5E1AA 2WP3O 3U9PL 2AP2A 2W9DH 4L4TB 5KS9A 4KKBD 4EN3A 1BM3L 1ZLVK 3RNKA 4XNYL 3RTQC 4YHOH 3VFMA 5I8OL 4GW4A 1A6PA 2FB4H 2YSSB 2ARWA 5E5UB 2VQ1A 3IDMA 4U1GB 1FP5A 2NY5C 4FG6D 5JW4Q 3J8F7 2QQLH 1J8KA 3IS1X 1FVDB 3L9RB 2J8OA 3TO4D 2DBJA 4YGAB 3L3HA 4Y4HA 1R3KA 4LCUB 4UDTB 5MEQB 3DVNA 4M5ZL 1J8HA 2NY0D 3IJSA 2XY1A 4GMTL 3GSWB 1P84J 3LQZA 3DVIA 1PAMA 2X4RA 3A6OA 3HE7A 3WJJA 4OQ1A 1KN2H 3ULUF 3AU1A 2NY1B 5DVMA 5ACZA 1PYWB 4GRWH 3U0PA 1Q1JH 2CDFA 3S8WA 4PJIA 2R69L 3WV0A 2N7BA 2KQNA 2JIXB 4LAQH 5F88B 1CLOL 1TCRB 2J4WL 2VLKD 3LPWA 1IE5A 3C5ZB 2XG5A 5GGTL 2A0LD 4D9QE 4WW1A 2LVCA 1F97A 4PLJC 2VMFA 5IVNA 3LV3A 3D85B 3H2WA 4LVHB 1QSFD 4P5TB 3W11D 1FYHB 5GGTA 3NA9L 2GUOA 2ZKHL 1S7TA 2W60A 4YHIB 3OR7B 3T1WA 1IKNC 4DGVH 2C3GA 4QOKE 3X3FL 5DMIH 4TUOA 4NFDA 4YHLH 3RDTA 1MI5A 2AERT 4P23D 3VXOA 3HA0A 2PR4H 2V9QA 3L3JA 2IGFL 5C0BB 3RBGA 2OL3L 2QQQA 1OP5H 3OJVC 3O0RL 5EU7C 2VOTA 4EXPX 1CQYA 4DZBB 1CXFA 2CKNA 4HC1L 4L8BA 2OL3A 1C08A 1I9JL 3MRLA 2NXYC 4FABL 1TZHA 2ADFL 5EU5B 1NGZA 5GGRA 5EUOE 1JHTB 4HC1A 3MV9A 4L5FH 3MYZA 4QGTA 4IRZH 5CLTA 5KVMC 1T4KB 4U7KA 4Z7QE 4MJ4A 1M05B 2EZ0D 1OW0C 3BRFA 5KSBA 3MJ6A 4GG8A 1II4E 4UQ3B 1NMAH 4PJ8C 3V5HA 4RAUB 4IMLB 2VH5L 4KFZC 4XVTL 5JHDD 1WZ1L 4XHJD 4ZAKA 1QP1A 1GJIA 5D70L 2XZAH 3UYRL 4XP4L 2EDFA 5FA3B 3HPLB 4NZDA 4ZPVA 5IMKB 3QR2A 2AJUH 5I1KH 2R9HC 4JJ5B 3GMLA 4GBXD 2D7MA 5ESQA 3KVQA 3B9EA 5IQ9A 2V17H 5J12C 2EE2A 4ZOBA 1E4JA 1G9MC 2H41A 4HUUB 2BOCB 4YDVA 1FL3A 5I8EB 4APQC 5E08H 4MXVF 5GRWA 3BQUA 4PJGB 3H3PL 2BSSB 4V2CB 5D9SB 3SQOL 3MNZA 1A6TA 5BXFA 2AJYH 5KVFL 5EZJB 3KPRD 2CLRA 1EHAA 1IQDA 1AHWB 3N9GL 4J6RH 1JWUA 2G60H 3BP4A 5EB9A 1S9YA 2A6JB 3IGAA 4J3VA 3VFPB 5DJDA 2ADGB 3HZKB 1RU9L 4HD9A 3CSYA 5HYJA 4M4RA 1RJCA 3ZYZA 1AE6H 5J9PB 5IR1B 2A77H 1CE6B 4KMQA 1QHPA 4G6MH 3IDXH 3VXTA 1I3RB 3IF1B 5IFAH 3T2OA 4OZHE 4AL8H 1IBGL 1KCLA 2W0LA 1FSKB 2YA1A 4LSSH 4DGYL 1QFHA 5JMOC 4NHCH 3O3AB 5BVPH 3QSKB 3C2AH 3NPZB 4RDQG 4WHTB 3L3OA 3L7EA 2O5ZH 2YMXH 2CKBL 2NXYB 4HLZG 1EHNA 4R90L 4PJEB 4ZPTA 1IEAA 4RGNC 1EK3A 2CKBA 3MREB 4QXGL 3UPAA 1HQRA 2WP3T 4FQXC 2NY3D 1RVFL 3RBSA 2NLJB 3O6FA 2YS4A 3ZKND 1A6VL 5MEOA 4OQTL 4JFFD 4PJ8B 2NYYD 3AGVA 2XIDA 4HK0B 1EHLH 2BERA 1Q94B 3QXDA 1AGFA 4U1HB 3G5XA 2A6KB 2CUHA 4OQTA 3GB7A 4HH8A 1SYVA 3MYJA 4X6EA 5F9OL 4NZJA 3T3MF 1EO5A 1BD2E 5IV2B 4FXLA 3D25A 2IBZY 4LL9A 4CDHA 2H9GB 5FKAA 2R2HA 2D3VA 3C6LA 2Y5EA 1AP2A 1CU4H 2IALB 5J12B 4KTDL 3ARPA 1ZHKA 1QQDA 4PV8B 4AH2B 4OZGE 2VR9A 3EYUH 1UXSB 4Y1AD 1MAJA 1MVUA 3SJVE 1RZGB 3MGTA 1HH9B 4PGZA 5F89A 1JGDB 4NSKB 3UO1H 3LRSB 5JIIA 5CJQH 3HNVL 4GJTB 1A3LL 4KI5E 1G6VK 1RZKC 1S7QB 4HJJL 3F7YB 4JFYA 4PJ7F 5IMMB 4R96B 2P7TA 5J7CC 3VI4E 3KGRA 1N2RB 4OZIE 2NY7L 4MWFB 2BNQE 1HXMA 4K8RC 4TVPH 3UTPD 2X70A 4J4PC 4JPKL 1EVUA 1RUQH 2EDHA 2R0ZH 1T2JA 1YNLH 1G7PA 3TJEL 5E56A 3FOLA 5JPMB 1KEGL 1CWVA 1QR1A 1YMHA 3AUVA 1D9KA 2AXFA 5ICZB 3MRFB 1WICA 3EHBD 4AIZA 4WI8A 3OKMA 1ZANH 3TJHC 3M8OL 4ODWB 4WFEE 1JNHA 5EO1B 1H8NA 3BAEH 5IIEA 1G9NC 4RGNB 3TC9A 3W2DH 1OF2A 3HI6H 1UEYA 3O3BB 5I1EL 1XGQA 2WLYA 1IMHC 4K94L 4KZDL 4PD4K 4JHZA 4WUUE 1MIEH 2RQ8A 2VR4A 4WJ5A 1RZIA 5B38G 3MJ9L 1KB9J 4NZRH 2FX9H 3VWJA 4G5ZL 3VXMD 1HH6B 2YRPA 1MAML 2WINA 3HNSL 1A7PH 4LHJB 4J23A 1Q9LA 5ID1A 2R4SL 3MJ9A 1F8TH 5FOBA 2J12B 4DQOL 1PQZB 4K23H 2WWKO 4S1RL 2GJ6D 1PJ9A 5J89A 2VLKE 2CGRL 3TYGH 1TVBB 1O7VA 1CDHA 3FO1B 3ZDZF 1B2WH 1PX4A 1LP9F 5DVKA 2AV7A 4CRPA 3B2UC 1CYGA 1J0IA 4ZUWB 1OGTB 3GFUA 1F3DH 3F58L 4DJMA 3EUUA 4OCXL 1ZA6B 1XGTB 2VO5A 5J3HC 3MA7A 1C8PA 5FYKE 5GSVA 4P9ML 1KUMA 2XN9A 4TYUA 4YNYB 3PWPA 5DK2A 3N1GC 1PX3A 3O8XD 4O2FB 1F2QA 5FYJL 5EU6B 4LSDA 4PUBL 4LGSB 5GJTH 2ZUYA 1Q9OB 3MRIA 4OT1H 1CIDA 5IHZA 4DKAA 4WWKA 2VDML 4PB9L 1S8DA 5F9JB 1KJ2H 4XGZA 1OGAB 3LS5L 3JVGA 5HYSB 5LBSH 3VH8B 3VFTA 3KWWA 4P2QA 1D5BA 4YXKL 1RJZB 2AJ3A 3M1BB 3WLBA 2VL5B 3T0VA 3GMNB 4YXHL 2R1YA 3KLDA 4ELME 3VXNB 2DBLL 4JPVL 3X12A 3QI9A 3W0WE 4YDJB 5JHDE 1CDGA 1F4YH 1WAAA 4JFDB 1INQB 5JUEL 4ZOCA 3V4UH 1CLCA 2EDWA 5DS8B 3MO1B 3H9HB 1U8JB 3K1DA 3QDHA 5DRWB 4HUKB 1K8DA 3CFIC 3RWGA 4NBXB 4LFHD 2OTUB 4QWWD 3LS4L 1KPRA 3K2MC 4KXZH 4J3WA 1RUML 2H8PA 5T3XH 1PG7H 4PV9B 1ZOXA 2VXVL 1JUFA 1EFXA 3B4NA 4OKVA 2Y07L 1VCAA 5E2VL 1T20B 4MA3B 2R0LH 1FBIL 1U3ZA 4HWZB 25C8H 3CX5J 4MDJA 3C60D 3JWOL 5E2UL 5BO1H 1VEPA 3S88L 1UB5A 4GKZB 5E5MB 3KPRE 4Z77A 1UYWH 2JJSC 4ZUVA 4QRSA 4M02A 5HTSA 3WXWH 1VFUA 4OFYA 3I9GL 4CVZA 2P44B 1Q72L 4X99A 3T0EA 4PY7A 1QR4A 3BESR 2JK5A 4Q0XL 4GRWE 2VDNH 4ZFZB 12E8L 1QSVA 3BDXA 4JGJA 5EOQH 2LV4A 5IB4B 4RA0C 2W9LA 3OX8A 2F19L 3UJJH 4S11A 4OD1L 4QRUA 3UTSB 5M95B 4UT7L 3KYNB 1R0AL 4K71C 3PV6A 4BZ1H 2BNRB 3Q5YA 3NCYP 2VLRD 1QHOA 1ZA3A 3U0TB 1H15B 4XB8A 2C5DC 4H0IA 4PJHA 5L2KB 5E00B 5ALBH 4LCWB 3CFDA 4PRHB 1DEEA 5CD3B 1CK0L 3SKMB 4HGWB 5K33A 4H5SA 4L29A 4G9FB 4JRWA 2ZOKA 4RMQA 1A4JA 5I15L 1CXHA 3BKJH 1JI1A 1I8LA 2XKNA 5DDHB 2EYSA 3HE6A 1T1ZA 1NFDB 3G6JB 1I9EA 4DEPB 2R2EA 4JFFE 3PJSA 2QQKL 3G9VA 4PGBB 4KHXL 4IBLT 5FCUL 2VWEE 4N90D 3BIKB 4M7KL 3DPBA 1L9NA 1I1YB 1H0DB 1FE8H 1CXIA 3HPJB 3D39B 4YAQB 1RQ5A 4YR6A 1O5DT 2PN5A 4U2YA 2X1OA 2NX5A 4ZUTB 1SQ2N 3V52H 3F7PC 4PJAA 2ADJA 3BPCB 1SEQH 3RVXD 3LN4A 3EDDA 1NC2B 1JBJA 1VACA 2BVTA 2VZUA 4NQXB 1IFHL 4Y1AE 2X1PA 3ZKMD 3KLSA 4XC3H 5C6TH 5ITFB 2HFTA 4N68A 2VSCA 5C0CB 1CFQA 2HH0L 4KWUA 1QYGH 3UZVB 2GY7B 4Z7OF 2WWKT 3FQTB 2AXHA 1DN0A 1DQDL 4YDLC 1FGVH 3FHQA 5DJXA 3HR6A 2FO4B 5JO5B 4NC1C 1CBVL 4PJDA 3C5JB 1JZ2A 2APBA 3X3GL 3CFKB 5CJXA 3MRKA 3CUPB 4PJ7B 2VAAA 3FMGH 2COQA 3GEWB 2WUCH 3OJDA 4GLRI 2JJTA 4TUKL 4RSVA 2DQEH 3IVKA 3NH7L 3SGJA 1KENL 1TJGH 3VXRD 4M6NL 1X5IA 3RA7H 1WUNT 2EDOA 2BHZA 4PJCA 3BX7C 4DKDC 2GTWA 1FZKA 4AG4L 3QXVA 3QFJD 3D18B 1G7LB 1F3JB 3SDAD 1U3HC 1FIGL 4NUJB 4P5KA 4BH7A 5LGJA 2D7PA 4LIQL 1MRCH 3HRZA 3TV3H 4F9LA 3BGMA 2VC2H 4RGOH 2IFFH 4DUVA 1G7QB 2WBJC 2Y23A 3HUJB 1LEKA 4JRYD 4ERSH 1I1AA 1SJHA 2V9RA 3I6GB 1DQLL 1OWRM 4KROD 4HJ0C 4KAQL 4PLOB 1U3JA 1SBSH 3GSVB 3X11A 4JKKA 3SDYH 2J8UA 1TZGL 3TZVC 5D7IE 3GMOA 4NQDA 4M00A 3D2UB 4RZCB 1CN4A 5K9OA 5H94B 5JDSA 5EN2B 4V1DD 1KIRA 2PO6C 3OF6A 4L3EA 2IWGA 4MDIB 5DRXB 3JUYA 1LHZA 1G7MB 4G8IA 4IHOB 1HINL 1N0LA 2X44D 4L9LA 5DRZB 3RKPA 3BZEB 4XCYB 4QTIH 1F00I 4XNMB 2E6JA 1PG7W 3ARVA 4HMCA 4JDTL 2P5ED 3D0LB 2V2XB 5E8PA 4UI2A 2D2OA 5F7UA 2O5YL 3D9AL 3R1GH 3N1FC 1WTLA 1YEHH 5KJRH 4IEFB 2ILLA 4XB7A 5FM4A 3P0GB 4YX2L 3ARFB 3F6IA 1BREA 5KTEL 1P7QA 5DRNB 4NQCA 2EIBA 4OV5A 2VDPH 4PREA 5ERWB 4IRJD 5ILTH 2YPVH 2XA8L 3DGGA 3BH8B 1XFPA 4G7YH 1RZFH 3VFNA 2V7HB 4AIOA 1MJJB 4MCYA 4X6FB 4BKLB 1MJ7L 3QXAA 1N64H 1KELH 4TVPE 1OARL 2ICES 3SDCB 1CG9B 1HEZB 4WTZG 3RL2B 1RJLB 2Z35B 3HCVB 4XTRC 3V5DB 4EXKA 3DUUA 1JP5A 5DI8B 4JR9H 4JPWH 4L4TA 1DEDA 1DUYB 4OLUH 3PHSA 4K7PL 3E3QE 3L5XH 4EI5C 4BZ2L 4MNGB 1E6OH 2YSSA 4U6TA 1I7UB 3DHJA 5IJKC 1FC2D 1DANT 4ZUSB 1FVDA 3WD5L 3L9RA 4I0PC 1A7NL 1GSMA 2LU4A 2WUBL 5INCB 1BBJB 4LCUA 4UDTA 2BVPB 5MEQA 2CMRL 4NN6B 43CAB 3ESUF 5TF1H 3GSWA 2HFGH 3MV8E 2HMID 2VAJA 2Q86B 1C12B 1PYWA 4XP5H 3OV6A 5DQDL 3JV0A 1OHQA 3FFCB 4JDZB 4KHTH 2VUYA 4HF5H 3MRPB 3BO8B 4BA8A 5I1JL 4BK4A 4KPHH 2JIXA 4OLZH 2VLRE 3LZFH 2APXA 1TCRA 5F88A 5D2LF 5D2NC 1RULH 2HRPH 3C5ZA 1RJYB 4GAFB 4PBVC 5GRXG 2DKUA 4OD2B 3WUZA 4RFNB 1DBJH 2FGWL 4H8WH 4TSCL 2H1PH 1F02I 2FJFB 1G0XA 3O3DB 3D85A 3VXUB 4P5TA 3MLWH 1NANI 4QRRB 3G9AB 4YHIA 3QDAA 3OR7A 1NMCB 4XCCH 3B2VH 3TF7C 3LKPB 1NGQL 5GIRB 5IEHB 3Q6FB 4B50A 4TOYH 5KSAC 3NIGE 4MAYB 1BFOB 4JFZH 1T2QL 3WIHL 5C0BA 5ADPL 4XNYH 4N90E 1BMGA 5I8OH 4PRIB 4JHWL 5F7EL 2FX8L 1IEBB 4DZBA 3WNMA 4XMLL 1X4YA 4CKVX 4L8SB 3WIHA 1YY9D 1BVKB 5F1IA 3MLTB 3WFCL 4LCYB 4BSWB 5EU5A 1JHTA 4QF1B 2NY5L 4WCYL 1ZEAH 3RIAF 1JZ6A 4QRPE 2OXGA 1MFDH 3GM0A 4JZOB 1T4KA 5CS7A 4BSJA 1I8IB 1JWSB 4M5ZH 4GG6F 1M05A 1MCRA 5HHOB 3HN3A 4ZO8A 5EOCL 5FHBH 2AQ3A 3AVEA 1MQ8A 4UQ3A 3GRWH 5KANI 5LG1A 4LOUD 1NEZG 4RAUA 4IMLA 4X98A 1IGFL 5BW7C 3GBML 2R69H 2KL6A 5FA3A 3HPLA 3ESVF 5IMKA 2DQHL 4OIIL 2XXCB 1CLOH 5T3XE 5IWLC 4JJ5A 1FFOB 2QSTA 15C8L 5EDXA 2BHUA 4X80L 1TJIH 4HUUA 2BOCA 5I8EA 2EDDA 3DYOA 1L7TL 5H37G 1KACB 2ZKHH 3KPSD 2BSSA 5EA0H 3O2VH 5D9SA 2GEEA 5D2NB 2K7PA 3VXRE 5D5ME 4KTEH 4X6CA 4P59H 4OI7A 5EZJA 3DXAD 5AAWA 3SGKC 1AHWA 4J8RA 5GS3A 1K2DB 3KPLB 3VFPA 2DQIL 2IGFH 3FQXB 2ADGA 4N5EC 1IKNA 1HIML 1U8KB 1EBPA 2F54D 2A2QT 3RNQB 3UCRA 5J9PA 4F7PB 5IR1A 2YEZB 3LVEA 1CE6A 4M62L 4OCWH 1CL7L 2JTDA 2MCPL 1I3RA 1XCQB 3IF1A 2C4FU 5D71H 5LXGH 2X2YA 4FABH 5C0FB 1UM5H 3S7GA 3VJ6B 1X7QB 3UC0L 2AV1A 3O3AA 2LU7A 1NCBH 4KUZL 3V6OE 1EHXA 4WHTA 2UUDH 1TMCB 1QLRB 4P46C 1N5YL 2Z31C 3QEGL 1T03H 1FVCB 1LO2H 2DM3A 2OI9C 5D6DC 4PJEA 4EN3D 2HKHL 2ZUSA 3MREA 5JW4R 4D0CB 3HC4H 4AZ8A 1WZ1H 3N85H 5HPOA 3H7BB 4U2ZA 5D70H 2NLJA 2EDNA 4XP4H 2X40A 4V1DE 1ZHBB 2FR4B 1U0QA 3H8NA 4H25B 4PJ8A 5EUKB 1MF2L 4HK0A 1N6UA 3O4LB 4E42B 4U1HA 2A6KA 1T66C 4Y4HD 3W9DB 1A3QA 2JB5L 3CXDL 5IV2A 2H9GA 1XAUA 5KN5B 3SE3C 1RIHH 2PYFB 5H35B 2HKFH 3SQOH 2HWZL 3KPPB 3HE7D 1IM3A 4YHYB 1URLA 2IAMB 2IALA 3KPMB 1QFUL 1YNTA 4X83A 1FH5L 3DVFA 4PV8A 4AH2A 5I17B 4F9PC 1RZGA 4BQBA 2KBGA 2ZNWA 1HH9A 5L0QC 3GMRB 1JGDA 1KEMH 5TE4L 3MV7E 4NSKA 3LRSA 3GDBA 2YRZA 2H2PC 1A7QH 1BGXL 3RVUD 4UBDD 4OCMC 5A2JH 1S7QA 3F7YA 1IBGH 5D8JH 2G75B 4R96A 5IMMA 5B3NA 3L3DB 3LN9A 4QY8B 1Q0YL 1N2RA 4HQQL 5EC1B 4Q9QL 4MWFA 3L5WB 4M7LT 2OTPA 5JDJA 1SHMA 1JYVA 4XI5D 5CGYC 5DD5H 4NO0B 3ZSTA 2EH8L 1CT8A 5JPMA 1W8NA 1IEHA 5FXCH 3RDTD 3V2AR 1MI5D 3GJFK 4R90H 1IJ9A 1U8HB 4XAKD 5ICZA 3MRFA 4Z8FH 4PJXB 1RVFH 35C8L 3WIIL 5D7JC 1BFSA 1S7WB 5D93C 1A6VH 4ODHL 1T22B 2Z31B 3HB3C 4ODWA 5EO1A 2Y6SC 5SX4I 3O3BA 5IGXH 5CJ5A 4POYA 4CU7A 3MV9D 2Q8AH 1RUAH 2E6PA 1A7OH 5JQHC 4NNPL 2Z8SA 5T1KB 3WFDL 1C5DB 4KKBC 4LEOB 4XP9L 4L4VD 2ENYA 4XMKH 2H45A 3T08A 1DJSA 1HH6A 3SCMC 2E3VA 4Y5VC 3S37L 2MJWA 1PQZA 4FG6C 3ZKXC 3BT2H 1EERB 3AC0A 3TO4C 1MWAB 2X10A 5JHLL 1TVBA 4Q9BA 2BY0A 3FO1A 3HNVH 2OBGA 1SJXA 2X9XA 3W82A 2NY0C 2OCFD 1A6ZB 2DJ4A 4ZUWA 1L7IH 3H9ZA 1OGTA 3O2DH 1XGRB 4NDMB 1RZKL 2K7QA 5F7KC 1ZA6A 3BQUD 1EXUB 4G8FB 1XGTA 4U05A 3IDJB 5HYFA 3TJEH 1NLDL 2DLFL 1KEGH 5F1SA 4NPYB 4YNYA 2B5IB 5CFHA 5T1MB 4O2FA 5EU6A 2A0LC 4J4PA 1Q9OA 4TUJB 3LHPL 4UZGA 1PSKH 5HYJD 2QADD 5F9JA 3W11C 3WBDA 1OGAA 5D7LE 6FABL 3QXTA 3TEUA 1ND0B 5HYSA 3VH8A 5BS0B 4EIZC 1I8KB 1RJZA 1AQDB 1G9NL 3K3QA 1I3VA 4HW6A 4NYLB 1CZ8H 3M1BA 5FGCB 2VL5A 2OYPA 4P23C 2I24N 3GMNA 2ORBH 2YXFA 4TSBL 2PTUA 1E6JL 3MJ9H 4QRQB 1EX0A 2NZ9C 2OX5A 5LGHL 3VXNA 5E6YA 4G5ZH 4YDJA 1KXVC 4Z7UB 1YNKH 5IKCB 3EOBB 5E5RB 5FUCE 4JFDA 1INQA 3FZUD 2Q3AA 4Y88A 3G5YB 4UB0L 5DS8A 4D9RD 3MO1A 1ZLWK 3H9HA 1U8JA 3O6FD 2NTFB 5DRWA 4QCIB 2OTUA 3WE6B 4F57L 3SCMB 1MIMH 5A43C 2DRUA 1IGTB 4IIQC 2V2WB 1L0YA 3ARQA 4PV9A 1DBKL 4Y5VB 2DAVA 3QQ9D 2F8VA 1T20A 2EZ0C 1KYOK 1VESA 4MA3A 1I75A 3ZKXB 4HWZA 4PLNC 3F58H 3KPSE 4R4ND 3HMWH 1BF2A 4OCXH 2WQRA 3BMWA 2AEPL 4XHJC 3O9WB 1IAKB 1AGDB 4GKZA 4K3JH 3DXAE 5E5MA 1NGXB 2FGZA 5FM5O 3C6LD 3FB5A 1X44A 4JO3H 2W0FB 4PJBF 3SKNB 2D03L 2ERJC 3ZYOA 2F54E 4GBXC 2IBZX 4ZFZA 4PUBH 3S4SG 1DBAH 5IB4A 2QQNL 5JW3H 1IGIH 1PZ5B 2UZIL 4LQFL 2I5YH 4HGKC 3UTSA 1LWRA 3KYNA 5CUSL 5FYKU 5C2UB 2FATL 2BNRA 3P0YL 1TQBC 4FNLL 3ALPA 1FYTE 3U0TA 1H15A 1OTUD 4XNXH 5B38B 5BOZG 4YXKH 5L2KA 4ZO7A 5E00A 2KZWA 2UY7A 4K3DL 4LCWA 3H9SB 4PRHA 4JG1L 1CGSL 1GPOL 3SKMA 4HGWA 1JPTH 5LWYH 4G9FA 2DBLH 2H32B 4JPVH 3VFGL 2X9YA 4X7SL 3S37X 3UMTA 3JV5A 1I85C 1QEWB 1D9KD 3IFLL 4R26H 3NBNA 5DDHA 4ONGL 1NFDA 3G6JA 1N7ML 3TYFB 1QFOA 3H0TB 4C59B 4Z5RB 1UH3A 2F15A 3BIKA 1I1YA 1KIPB 4DVRL 5ETUB 3D39A 1UA6H 4YAQA 1NDGB 1HKLL 1J8HE 5IB3B 3FO9B 4JO2H 1EO7A 4ZUTA 4LSTH 1WZMA 3VWJD 4IIQB 2NY3C 3BPCA 1TETH 3I2CH 3KJ4C 1NC2A 3ZKNC 4NQXA 3VG0H 2X05A 4AEIL 3I9GH 3QCTH 1M71B 2NYYC 4Q6IC 4POZD 5ITFA 3DUSB 2R0KL 4WWID 5C0CA 2BVOA 2ID5A 4RRPG 2BY2A 3ZTNH 3QFDB 4OFPA 3SGEI 3FQTA 2VR5A 2XPGA 2ERJB 5FFLA 1P6FA 1RFDL 2FO4A 1QFWH 2R1XB 5JO5A 3ZHLA 4M8QB 1AXSB 3C5JA 4N8CL 3S36H 4C4KO 3N1MC 3CFKA 4IOIB 3CUPA 4DAGL 2BXZA 4KJQC 3CXHJ 1NMBL 1R5IB 3EJYD 5D7SH 3BGAA 3F7QA 3LIZH 4M7LH 5I74B 2XN9D 1ZXQA 3PWPD 5I15H 5IQ7L 5LQBL 4OZFB 3O11B 4GSDL 5JW4N 1X5XA 3JV4B 4I5BB 4Y19B 3RJQB 5HHVL 1YEFH 5HD8D 4WWKD 3EYFB 1XF4B 5FYJD 1DDHB 4WENB 1RUKH 3D18A 1G7LA 3HS0B 3V6BR 1F3JA 2VTFA 4NUJA 2I26N 1CDJA 3K1KC 3X14B 3ETBF 1QBML 5DJZB 2XTJD 3VA6A 2D0FA 3S6CA 5HYIA 4U7SA 3QUZB 1G7QA 3HUJA 1AIFA 4U1MB 1LMKA 3FHAA 3QUKB 3EHBC 3QI9D 3I6GA 1QBLH 1BJMA 3ARRA 1DUZB 1X5AA 1IFHH 3GSVA 3KJ6H 1P9MC 2RR3A 1S3KH 3V6FB 3CVHB 2NY2C 1S9XB 3Q1SL 5F8RC 3D2UA 1V7ML 5GISH 5L8LB 4RZCA 1XGYH 3U30B 2CR3A 1EEZB 1AD9B 5H94A 1FFNB 1EFXD 5EN2A 4MAUH 1DQDH 4MDIA 5DRXA 2F8XC 2JCCB 3MXWL 1G7MA 1HHHB 2P5WB 4G7VL 4X9FA 4IHOA 5FUOH 1WISA 3DNKA 3X3GH 5DRZA 3BZEA 1NSNL 4GAGL 2CLZB 3WFZA 4XCYA 3U4AA 4XNMA 4JGUA 2AGJL 4UT6H 3PDGA 3L3GB 2V2XA 4OFYD 3GIZL 4K3GA 4LLYB 1KENH 4QXUL 3T0ED 5IFHL 3P77B 5HYJE 3BD5A 3EYVB 2DD8H 1EPFA 3ARFA 4M48H 4AG4H 5DRNA 3E2HB 4U1LB 1J12A 4KH2A 5ERWA 3BH8A 5IBTH 5I1CL 2V7HA 1MJJA 4LIQH 4X6FA 5HHXL 4BKLA 1MCDA 3PGCB 3MLUH 2OR9H 4LHUA 4QHUB 1ACZA 3MLVL 1DQMH 3SDCA 1CG9A 1HEZA 4KKCD 1XF3A 1DQLH 3RL2A 1RJLA 2Z35A 3HCVA 3V5DA 5DI8A 5IVXF 3BH9B 4D9RE 3QCUL 1DUYA 4JY6B 1KOAA 1WWWX 2IFGA 4MNGA 4N0YH 1AJ7L 1I7UA 1I3GL 3T4AB 4ZUSA 3SKJL 4R8WH 1CFVL 1U8MB 4HXAH 2NY2B 4QNPF 5INCA 1HINH 1BBJA 2NX5D 1J0JA 2BVPA 5E9DB 5DJ8B 2DM7A 4HAGA 5CWSB 5FCSH 43CAA 2K3TA 4JDTH 4KQ3H 4QWWC 1U41A 4NRZB 1B6UA 4MZ2A 4C56E 2Q86A 1EEUA 3L3IB 1C12A 3D9AH 5DD3L 2XQYG 4N1CA 4AM0B 1MY7A 3FFCA 3WLWD 4PJBB 4JDZA 4YX2H 1MCFA 1KBGH 3BO8A 3MRPA 2AAVA 2GJ6B 3C60C 5KTEH 3JTTB 5J8OA 4GS7C 1PY9A 1RJYA 4OD2A 4OM1H 3UEZA 5IEKB 5KSUB 1HYSD 4NJ9L 1R3IH 2D31B 2FJFA 3O3DA 2HP4A 2E8YA 4K3HA 4C4KT 1G0YR 4QRRA 1YJDH 2VDRH 4NKOB 4F15C 1IARB 2CIKB 4M61B 4KGJA 3LKPA 4YWGL 2BDNH 4OD3L 2VSDA 4CMMB 3P3YA 4E41B 5GIRA 2ZCLH 5IEHA 1F13A 5T5NG 2UYLB 3Q6FA 3ES6B 3U2SB 4MAYA 1BFOA 3RVWC 1U8IB 5CJOH 1K3IA 1XZ0B 4PRIA 3QIBD 3GBNL 1IEBA 4NQEB 1GCFA 3T0AA 4MQSB 4L8SA 1BVKA 1E4WL 3CH8A 3MLTA 4LNRB 5BMFH 2EDXA 4LCYA 4BSWA 1FFRA 2OR7A 3WD5H 1KCRL 2AW2A 3TIEB 4QF1A 5AG8A 2X41A 5CZXC 2WUBH 1WFOA 3F12B 1LK2B 4JZOA 3OG4B 4DN3H 1I1AD 4WO4B 1I8IA 4NQSB 1JWSA 4IDJL 1JPSL 2FH8A 2VYRE 4TTDC 5HHOA 4O5LL 4Q9RH 4N1HB 1TDQA 4F7TB 3LSOB 4ZS7L 2DIAA 3B9AA 5DXWA 2J88L 5DQDH 5BV7H 4QHKJ 4UIKL 5C08D 2FECL 3FO2B 1EZVX 1IAIH 4NQDD 5F71A 5I1JH 1F4WL 5IJVA 3OF6D 4L3ED 5I76B 3NIFF 3RVXC 3PP3H 1FNHA 4P9HL 1GXEA 3ZKMC 4RWYL 1IC4H 4YDIL 3RU8L 1XF1A 4UTBH 3I3DA 3HI5H 3MODL 4Y16B 4O58L 3PWPE 4O2EB 5D2NA 3T77B 2I07A 3S34L 1NGQH 1W0VA 2JJVA 1EFQA 4HZLB 1OB1B 3K0WA 4HKZB 4XVJL 5HDQL 4R2GD 3DECA 2IG2H 3KPLA 1K2DA 1T2QH 4P3DB 5FYJE 3FQXA 2C3HA 3V95A 1LEIB 3O3EB 1QFWM 4F15B 1P7QD 2B20A 4NQCD 1KCSL 1U8KA 4LRNH 3RNQA 2FX8H 4F7PA 2C26A 4P2QE 2YEZA 3SE9L 5IESL 2O5XH 1XCQA 3OAYK 1K3ZA 4PLKD 4RMRA 3WFCH 1UZ6F 3VXSB 3JV6B 5C0FA 2Y36L 3VJ6A 4MJIE 4WCYH 1P1ZB 3D1MC 4KV5E 3ZL4L 4UQ2B 5DZOA 3VRIB 1TQCC 1WAAE 1QLRA 1BQLL 1WIOA 3VGFA 4YK4C 5E7BA 5EOCH 3BKYH 1FVCA 4L4TD 5IHLB 3QUML 4KQ4L 1C5BH 4D0CA 5J56B 1IGFH 4OTXL 3H7BA 4UTAL 2YPKB 1P4BL 4NKIL 1DE4B 1SM3H 3KLAB 3MLSL 5L6YH 1S7SB 4E9LA 2BRRH 3QUMA 3BRDA 3U0WH 1ZHBA 2FR4A 2G2RB 4H25A 5CJBA 5EUKA 3CDFA 5DO2D 1MCOL 3O4LA 3QO1B 4E42A 5F1NA 2ICEB 4KROC 3V6OC 4X80H 5IB1B 2D7TL 3W9DA 1NBVL 4JO4L 3GKWH 5FKPB 4G6KL 5ECJE 5JMRA 3LRGA 1L7TH 5C0EB 4WU5A 1A8JH 5KN5A 5IWLA 2PYFA 5H35A 3KPPA 4TRPH 2IAMA 2EKJA 2OQJA 3KPMA 4LLDB 1OAQH 2NY1D 1EUUA 3SEPA 1P5VA 5SWQA 1NLBL 1TPXC 5C0AB 4LGPB 3GMRA 2JIXD 4NZUL 5I73C 5F7NC 1T6VN 3C5ZD 1QLEL 1CL7H 3UYPA 1NCCH 2ZG2A 2G75A 1ZAGA 3L3DA 3UC0H 4QY8A 1IAMA 2VITB 3V4VH 5EC1A 4P5TD 3L5WA 3QDJB 4ODTH 2GK2A 2JELH 3IKCB 1I7TB 5GGSY 4NO0A 1NEZB 3EO9L 1CICC 2NXZC 1U8HA 4U6VH 4CN1A 4MLIA 4PJXA 4I3RH 5C0BD 3T2NL 1U8PB 3L7FB 4MB4A 3CFBB 1R3LB 1S7WA 2RHEA 1Q9KA 1T22A 2Z31A 5BRZB 5D6DA 4CADB 2CQVA 4DN4L 4M1CD 4HG4K 2NX5E 2VZ3A 4B0MM 5DHVB 1YQVL 5EUOF 4PJAE 1AGEB 4WI4A 3ZE0F 2VUOA 1WTGT 1C5DA 4LEOA 3V4PL 2WIMA 1G9MH 4Z7QF 3CJJA 3NACH 4UAOB 5F9WB 1ZS8B 5C2BL 3QH3B 1MWAL 5HHPB 1FH5H 4MXWL 4U1KB 1VGEL 5D7KD 4GAJH 4D9LH 1MWAA 5TE4H 4YHZL 3U1SL 2F5BL 4GAYB 3MMEB 4WGWB 3QPQD 1BGXH 4AK1A 4PJDE 4LFHG 1A6ZA 2HMIC 5T1DL 2W38A 4FFZL 3RP1A 3IDGB 1XGRA 4NDMA 3PGDB 4G8FA 1EXUA 3HNTL 3N06B 5ISZB 3IDJA 2DS4A 4MD0B 3MSPA 4PJCE 4NPYA 3M17A 1CTNA 4NZTH 5T1MA 3NZ8B 4CJ0A 2YD2A 4TUJA 3LD8B 3O6ML 3HG1E 8FABB 3QULB 3DARA 1NCAH 1FL6B 4OSUL 1NGWA 1CICB 4Y5XB 1VDGA 5HGHB 2NXZB 5J11C 4OZHF 1D3CA 1EV2E 1FG2B 1A64A 2DQGH 4LIQE 5BS0A 1I8KA 4TULL 3OJ2C 5DFVD 4PJ5A 1AQDA 4NYLA 3RWJB 4NNPH 3U79A 3WFDH 1GGBH 2PETA 1KCVL 4QRQA 1A4KB 1YPZB 4DW2H 1Z5LA 1F58L 2NXYD 1KXQE 2GTZB 1VA9A 2AK4B 2R56L 3IFOB 4Z7UA 2QR0B 1B9ZA 3EOBA 3PF2A 1YY9C 5C86A 4NQDE 4ZOAA 4D3CL 3O6LL 3G5YA 5DK3A 2FECI 1QD0A 5GQBA 5I1HL 1S9KC 1GC1C 3FB7B 2NTFA 4QCIA 3WE6A 3SCMA 4L3EE 3R8QA 1IGTA 2GYSA 2V2WA 4PRAA 2ESVB 4LP5A 4Y5VA 4OCLC 3QG6B 5J1SC 1VPOL 3RX8A 1XIWB 1JZ4A 1RZKH 3QHFL 1BFVL 2E7LA 3MXVL 1W2KT 3QP3A 4M9PA 3O9WA 2E6QA 1IAKA 2XZQL 5C0DB 1AGDA 3WFEL 3SOBH 2R9HD 1IAIM 1NGXA 4K8RH 2DLFH 1EEYA 1A47A 2W0FA 5CKAA 2VXQL 3SKNA 2W07A 1F4HA 5I6XC 4NM8L 2IPTL 3GSNB 4OZGF 1UEMA 2NY4C 1J0HA 4Z7VF 1PZ5A 2PYED 2V9TA 5D2LE 1U6AH 6FABH 2A83B 4KI5F 1WWAX 3B6SA 2ZZUT 1CFBA 3T04D 1KFAH 2Y06L 1UJTA 4EDXB 3E1F1 1JHKL 1V7NH 3OPZL 3VI4F 5B38A 2ZSWB 1G9NH 4OZIF 1FGNH 5AYUH 3H9SA 3U9UB 1F6FB 1MAKA 3X17A 3MZTA 3L5JA 3TN0B 5I9QB 1E6JH 2H32A 4L4TE 1MFEH 2E27H 2EDYA 5A1AA 1PLGH 1PW3A 4ISVB 1QEWA 1EA9C 1Q38A 5EOCJ 4I1NB 4Z78A 1J05B 3QUYB 3TYFA 3H0TA 1NBQA 1DL7L 3CZFB 4Z76B 4Z5RA 4X4XB 1JTPA 2D4DA 1JNJA 3BRGC 2IQ9H 2H6PB 1KIPA 5ETUA 2BVUA 4RGND 1DBKH 3X13B 1XR9B 3G6DL 3P0VL 2ZJSL 4OF0A 4PJFF 1TZIB 4LARL 1NDGA 2W9EH 5JQ6H 3S3SA 3FO9A 3K7UA 3NZHH 4P4KB 5B21A 2YD5A 3SHSA 4EN3C 3WYRA 5CINH 4IIQA 4ZD3H 2WWMD 3JUZA 5I0ZA 3OKDB 1HKFA 3C8HA 1UG9A 1J18A 2D03H 1M71A 2J2ZA 1Y6MR 3DUSA 1U8OB 2AJVL 4S1SL 1UWGH 1JPFB 2QQNH 3BP5B 4Y4HC 1CD8A 5I30L 4CW1B 4LQFH 3QFDA 3HFML 4N8VG 3NPSB 2FATH 3WS6A 5I6XB 3VD4A 2D4FA 1A02N 5DD0H 2R1XA 2NY4B 4M8QA 4RMVA 1AXSA 1E28B 3EZJB 4G3YL 4IOIA 5E4IA 1Z3GL 5F96H 1U93B 1EJ6A 1GPOH 4AEFA 3VW3L 1R5IA 5FM5M 3MOAL 5DEFB 4X7SH 5C0BE 3CFCH 3I50L 4HBCL 1L0QA 4OZFA 5KAQG 3O11A 1QNZL 5CILL 3RVUC 5EU6D 2X9WA 3JV4A 4UBDC 1PBYA 4I5BA 3NVQA 4ONGH 4J4PD 2DF3A 3VD5A 3TT3H 3KHOA 2LAGB 3WHXB 4WI2A 5A2IH 3EYFA 4GQ9H 2E9IA 1XF4A 1DDHA 2XZZA 2BRQA 1OGAD 3A6BH 3HS0A 5HGBB 4DVRH 3X14A 3VGDA 1A0QL 4YIQB 5DJZA 5CAYB 5L7XH 3QUZA 1HKLH 3RDTC 1FAIH 1IC7L 4R3SB 4M5YH 1F4XH 3UJIH 3T4YB 3VCLB 3QUKA 5MENE 1AR1D 4ELMF 4RGMB 1JHLL 3DX6B 2FRGP 3CVHL 4JG0L 5DHXB 1DUZA 4JFDD 1YEJH 5D7KE 4TTGA 5FM8A 3S4SB 4CVUA 2DQFB 4JB9H 3V6FA 1FAKT 4XNUL 3PIQB 3OR6B 2DI7A 2R0KH 3CVHA 4M7JL 1S9XA 3HMXL 3TVMB 4MB3A 4TPRH 4YUEL 3VXQB 1P4LB 4RFOL 4U3CA 5IB5B 3MLXL 1EEZA 1YC7A 1PGRB 3HMXA 1FFNA 4LLAA 5ANME 4M1GH 1JK8A 2R29L 3MNVB 3L5HA 2JCCA 1DSFL 2P5WA 2BY1A 2NW3B 1PFCA 4C55A 5T5NF 5T1LB 3E8UL 3MFGB 5B3JE 5F97E 4DAGH 2UWEB 2CLZA 4X6CE 5GGRY 3T8XB 3QJFB 1JGLL 3L3GA 3IU3B 4LLYA 4WGVB 1N6QL 2QSCL 2CRMA 4XPGL 1D5IL 3Q6GH 3EYVA 4TNWF 4GRWF 5E99L 5C9KA 5HHVH 3DO7B 3ZMRA 3UTSD 4U1LA 2HA1A 1YYML 5KW9H 4RAHA 2YD3A 2AABL 2I9LB 1OP3H 1SMOA 4U0RB 3PGCA 5L2KD 3EZ8A 4LCWD 5DFWH 4QHUA 1I3UA 1XR8B 4WDIB 4CNIB 3HRPA 4G9FD 4PJEE 2QADC 1JF6A 1FRGL 3ZE2F 5KVDL 5FDYA 3VFWB 2QSQA 3BH9A 4FMFA 2B1AH 3PUCA 4JY6A 4H20L 4LSPL 3WO4C 1KULA 3LKQB 3T4AA 4Y4FC 3NCBB 1WEJL 3D39D 2XZCL 3CCHB 4CMHC 4LDOB 1U91B 1SEBB 1U8MA 4GMSL 3MXWH 5D1ZD 3EFDL 3INUL 5KVGH 1ADQH 1HSAB 2P45B 1ACYL 4FQLH 3CDYA 3AMLA 5E9DA 3FZUC 3I75B 5DJ8A 2MOVA 4EOWH 5CWSA 2B0SL 4NIKB 3O6FC 3LEYL 2QKIB 3L6FB 1SYSB 1NC2D 4NRZA 4KUCD 5DYOB 1LDPH 3KYAA 1WITA 5LAXB 4XP6L 3TWCL 1JMZA 4XCFL 5SWZE 1V8HA 3GIZH 1W72B 3L3IA 4DOHB 5IFHH 1FJ1B 3NCJL 3QQ9C 5C0CD 4AM0A 4XMPL 4LCCC 2ATPB 4XPBL 4LF3B 2GJ6A 2M2DA 1K5NB 4R4NC 5TPWL 3JTTA 4S10A 3OAZH 2IBBA 3SJVB 2ED7A 3LMJH 5EZIL 5I1CH 5KSUA 5IEKA 4GW1B 1BIIB 3C6LC 5HHXH 3MRJA 2YK1H 2XWJB 2D31A 4R6UA 1M7IB 1RY7B 4KU1A 1YUHB 3VG9C 2FBOJ 2R4RL 3NAAL 3IDYC 1CFNB 3CZJA 3MLVH 4ZNCD 2ARJB 4NKOA 2CIKA 4M61A 1RPQA 4OZIB 5TDNB 3LH2H 2BNQB 2OM5A 4CMMA 4E41A 4NP4L 1GRWA 2BVQB 2ARJQ 2UYLA 3ES6A 3O4OC 5DMYA 1Z2KA 4MA8L 5E4EC 1H3TA 1U8IA 1Q9WB 2FL5B 1P5UA 1XZ0A 2OP4L 1AJ7H 4RGNE 4ALAH 4NQEA 2DL2A 4UV7L 1AH1A 4DKEH 4LNRA 1I3GH 1RZ7L 1CXKA 1IGCL 1JPGB 5F72S 4YFLI 2BP3A 4ORGB 4OLEA 3FT2B 3TIEA 4XXCA 1UFUA 5FV1L 1D9KC 1IC1A 1WZLA 3F12A 5F7YC 1LK2A 2MPAH 1NAMH 2YUZA 4WO4A 4NQSA 2AEQL 4HPOL 1S5IH 4OCSL 3CFEB 5B39G 4Y4FB 1JV5B 1KC5H 4H88L 4ODBD 4ODVL 3VE0B 4F7TA 3LSOA 2D9CA 3VGAC 4U33A 4URTB 3FL7A 1QFPA 3GI8H 1DANU 1KB5H 4HIXL 1S7VB 2OJEB 5EBWB 4PP1C 3D2UD 5GGQL 1IRAY 5EU4A 1JN6B 4BUHA 1IKFH 2X4OB 4K94C 5I76A 2B2XL 2BK8A 3MUGB 1LE9B 3KPTA 4WFHD 3BVNB 2PUQT 4LCCB 1UM4L 4WTZA 4POZC 5DQJB 3QHZL 5LCVH 5DHYB 4Y16A 4O2EA 4KGLA 1K85A 5DQ9B 4OD3H 4L8DB 4J3UA 2VXTH 5DGQA 4HZLA 1OB1A 4A6YB 4HKZA 4XNZC 4P3DA 3ARFD 1LEIA 4TN9A 1DFBL 2DQTH 3O3EA 3T3PE 3ZDXE 1DBML 1V3MA 1QRKA 4HH9B 4I3GA 1H3WM 1X5YA 3RY6A 3KXFE 4KRPC 4FQIH 3SO3C 3WKML 3EYQC 5E2TH 1E4WH 3O4OB 3ZO0A 3EJYC 2Y7QB 5FA4B 1IQWH 3VXSA 3P30L 2XTLA 3JV6A 5E4EB 5C09B 3CLFL 1P1ZA 1YDPB 5I1LB 4F2MB 1UH2A 1XF5B 4UQ2A 3SDCD 4D94A 4OF6A 3VRIA 4PG2C 4JFDE 5MHSD 5HD8C 1WC7B 5CZVH 1NBZB 3ZT7A 5DUML 4LVNC 4XPHL 1U42A 3BSZH 3JVGC 2J88H 3S35X 1JGUL 2YPKA 4UIKH 1DE4A 2XTJC 3KLAA 1TLKA 1S7SA 5K9KB 3H3KA 5FECB 4MD5B 1JRHI 2G2RA 3QDGB 1F4WH 3EGSB 4G8EB 2MFNA 1FORH 1J1PH 3QO1A 3QI9C 2ICEA 2ICWB 3TO2B 3VFOB 5DR5L 5JXEA 5IB1A 4P2OB 3BGFB 5FKPA 1NFKA 1EUTA 4RWYH 4HT1H 2IEPA 5C0EA 3P4OB 1D6EB 2WANA 4JQVC 2EIEA 3ROOB 2A9NL 4P0DA 5DLMH 4P2RB 1A6UL 4BQ8A 4LLDA 3MGAA 4KMLB 3R0NA 1ZT1B 3TH2T 1IGJB 3PDDA 3FFCD 2BCKB 4G9DB 5D1QB 4KVCH 5C0AA 3AREC 4XC1H 3MLZL 1KN4L 3U7YH 2BFVL 4YHNB 2BNRE 4UMGA 1CD9B 3QXUA 4FQ2L 2ADIB 2DMCA 2PNDA 2APVA 3HZVB 1ZMYA 1CGTA 5L2KE 4JKPL 4QXTB 3BPOC 3I6KB 4WI5A 2ITCB 3PG2A 3JWOC 4JM2B 4PRHE 2I9TB 1V05A 2FWOB 3BUYB 4Q97A 4EDWL 4YE4H 2VITA 3VXUD 1J0ZA 4CU8A 2B8OT 4G9FE 3PGFL 4O02L 3QDJA 5FYJU 4QRRD 3T0EC 4BELD 4YPJA 4M93C 3IKCA 4KRPB 1I7TA 4HKXB 3QQ3B 1MJUH 1BQLH 2HT4D 3RI5F 1B4RA 1NFDE 1MJ8L 1NEZA 3G6JE 1MCSA 2MQCA 4LVOC 4MAYD 3HZYB 3QUMH 3NIGF 2F9BT 3OKLB 1U8PA 3L7FA 3CFBA 1P4BH 4FQJL 1R3LA 4NKIH 1QLFB 4ZSOE 3QCVL 5BRZA 4X6DF 2D9QB 2P43B 4CADA 1ZT7B 4KKCC 1NL0H 4BZYA 4FP8L 5D72H 3BEWA 5DHVA 4ONFH 5EIIB 3LPFA 1MH5B 4FQCL 1AGEA 3EDKA 3IJHA 4NNYA 4X5WB 1FC1A 1NBVH 2Y9RT 5FOJA 2P8LB 2Q87A 5HVHC 2HN7B 5KSVB 3BE1L 5L9DH 4I77L 1J5OH 5HHOD 1BQUA 1ZS8A 1KLGA 5DVOA 3IT8D 3BWAB 4OAWA 5E1HB 3QH3A 1ERNA 5C0CE 5HHPA 1QPPA 1CLZH 2F58L 4Z6AT 1NLBH 4U1KA 1OM3L 5H8DA 1NH6A 1BX2B 4OLYL 5CIPB 1JWMB 3QEHB 4GAYA 1QZ1A 3MMEA 5EU3B 3MR9B 4UU9B 4HX1B 3CK0H 3PHOB 4GT7A 3EO0B 4OV6F 3QJHB 2PCPB 2R2CA 3IDGA 4QLRA 3AREB 3PGDA 2M1KA 5HGDB 3UTTE 1CGUA 3QDMB 2FIRT 3QIWC 3BJLA 1HHIB 5HVWA 4G6JL 3AFLA 4BQCA 1I7ZB 2W91A 3DMMB 5ISZA 5HHNB 3WLWC 4MD0A 3LEVH 3SE8H 4UIMB 4UINL 4DKFL 4XCNB 3LEXB 5D5MF 1Q0XL 4PR5B 4GXVL 4MA1C 2NR6D 1ORQB 1P7HL 3NZ8A 1QBBA 1WSST 4U6HB 3ZYIA 1HYSC 3UZQA 1WBZB 1BP3B 5FO8B 4KMTH 4JFXB 5CJXC 8FABA 3QULA 4GXUM 1FL6A 4MYWB 3VFRB 1CICA 4Y5XA 1M1SA 5HGHA 4JFQB 4KK9D 1C5CL 2CJUL 4LVOB 1MREH 2JJTC 4YC2B 1FG2A 1AO7E 2BX5A 1ZLUH 2R23B 2B1HL 1RMFH 4KJYB 3SGJC 1NDMB 3R06B 4W6WB 3RWJA 1XGUB 4XBPB 3V4PH 1KTKE 1A4KA 1YPZA 4JFEE 4Y2DB 1JTOA 2NY6B 2GTZA 4XBEL 2AK4A 3IFOA 3QIBC 4WW2C 2QR0A 3I6LE 3OKEB 3MACL 4M4PA 5IHBA 4G6FB 5T33L 3FB7A 5FYLH 3PP4H 5TQ0H 4F9LC 1UH4A 3IAQA 4YHZH 3U1SH 2F5BH 2VLMD 3K46A 2XWTB 1I1AC 4WFHE 2ESVA 5D7IB 3O4LD 4HUMB 3SDXB 2F5AL 3QG6A 1MCLA 4RBPH 5IBUG 1XIWA 3LCYA 5GJSH 1MCBA 4BJLA 4NHUB 3KYMB 5C0DA 1U58B 5FF6B 3GSNL 1U8NB 2IAMD 5EH1A 1OP9A 3CC5B 5DMKB 4UDUB 1SY6H 3NIDE 2I27N 2XRAL 3DWTA 3GSNA 3QIWB 4YHKL 1J0YA 4LASL 1I4FB 3CMGA 5ACLA 3KS0H 4HPYH 4MJ6A 4L9LC 3W39A 3CVIH 3BKMH 3MJ7B 2A83A 4UNUA 4EDXA 1EJOL 5ABDE 4XWGH 3VRLF 3OMZA 4X4ZA 3U9UA 4R2GC 5CMAB 1UM6H 2X7LB 4U1IB 1BAFL 3TN0A 1CE1L 3ALXA 4NO0D 1F58H 5DUPL 2VXUL 4ISVA 4E0RB 3V5KB 4XX1E 3FRPG 3P2TA 4YO0B 4PLKC 4QHMB 1J05A 3BDYL 3QUYA 5I1HH 1PVHA 2X4UB 2VKXA 3CZFA 4Z76A 1RUPH 4X4XA 3L1OL 2Z31D 2ED8A 3QIBB 4WW2B 2H6PA 4UILH 2J5LC 3B5HA 4FFYH 3MJ8B 3THML 1NAKL 4LPCA 3X13A 1XR9A 1TZIA 4OF8A 1VPOH 5JA8B 4P4KA 5T1KD 3QHFH 4DVBB 5E03A 3TA3B 3MXVH 4IRSB 3V0WL 3BYTA 2E7MA 1DQQB 2IPUG 2XZQH 1D5XB 1MFCL 3WFEH 1T7YA 4W68A 3FFDB 3T0DA 3OKDA 3FFCE 4U1GC 3U48A 3MLRL 4NM8H 2IPTH 5DO2C 1Z6JT 3MV8B 1U8OA 1FZOB 1JPFA 1OTTC 3BP5A 3ULVC 1BLNB 4CW1A 4K3EH 4OCRL 3NIFE 3GJFB 5HHME 4QRRE 2Y06H 4WTWA 4K7PY 2DQUH 3H42H 1E28A 4LSVL 4F37K 4ZFOB 3OPZH 3BZDA 3WHE1 5DJYB 4HS8L 2H2PD 2YA0A 1NGPH 4H1LH 1U93A 3T2PA 5DJCB 2W1NA 3B9VA 4JN1L 5C0RL 1TJHL 1IL1B 3D3VB 5DEFA 5TH2B 2VDLL 2Z8WC 1D7FA 1N3NA 5EWIL 3C5ZC 4PRIE 4Q6YA 1MPAL 1OSZB 4S0TD 5CGYD 3WHXA 3VGEA 1FL5B 4RISL 4LVHC 4P5TC 4PGDB 2DL9A 4FN0A 3V8OA 5HGBA 3B8YA 4Y4KD 1XH3B 4D0BB 5HYQB 3UTQB 5BS0D 3G6DH 3P0VH 4YIQA 1KJ2B 3VFVB 1X4ZA 4KY1H 4R3SA 5HHOE 4Z0XB 1OAUL 5DZLA 5F7DB 4Y89A 1OSPL 3T4YA 3VCLA 1LO3L 5FAAA 4NGHL 3E0GA 4QRPB 1KT2A 5ADOL 5CZKA 3DX6A 3FQRA 3BZFB 3P4MB 3V0VB 4HAFA 4GKNB 3S4SA 1JYXA 2DQFA 4WTXA 1EO8H 3PIQA 3OR6A 4M1CC 2C4XA 3LKNB 1CD0A 5F6IC 3TVMA 2XACC 4X7FC 5JA9A 2EDBA 3SCMD 3JZ7A 3FQUB 3VXQA 3MLYH 1P4LA 4U6XB 5IB5A 1QO3B 3ZDYE 3IXTB 3LOWA 2CIIB 4Z95L 1CD1B 1TITA 3MNVA 1J7VR 4NCDA 3NCFB 4R9HA 4EJ1C 2W0PA 2NW3A 1A7RL 1HI6A 5D2NE 1N5AB 5T1LA 4TSAL 3B83A 1XT5A 1Z3GH 4ETYA 1Y18B 2UWEA 3O9WD 3RUGB 4NRYB 3VW3H 4OZFH 1EAPB 4XRCA 3T8XA 4FXKB 3QJFA 3MOAH 1UACH 3IU3A 4M8VA 4HSQA 2DM2A 4HBCH 3QPQC 4OUUB 5CILH 3TH3T 1IGML 5DWUL 4LEXL 1QSEB 3DO7A 1MY5A 4PB0L 4JE4B 4MQXD 1FO0H 4LVEA 1U3YA 5IMOB 5T5FH 4GRLB 2I9LA 4RNRB 2R0WH 3SGDI 1OCWH 5C6PB 1A0QH 3WXVH 4OFDA 1AHWC 3H9SD 1QACA 5SX5H 4EI6B 1YEEH 1UJ3B 1MRDL 1MRFH 1UQSB 3EYOB 1XR8A 4WDIA 3P4LA 4CNIA 1UCBL 3CPLB 4NOBA 1HNGA 5KS9F 2OZ4H 5J6HB 3FT3B 1HSBB 4JG0H 1MHEB 1N0XL 3VFWA 1MNUL 3PHQB 3T0BA 1KXTB 4RRPA 3KG5A 1FSKC 2J3SA 5C0ND 4HKJB 2NZ9D 5ITBH 1MEXL 5DFVC 3HAEB 2VQTA 3O4LE 4N8VB 3FAXA 4K2UL 4RFOH 3O6KL 1KPUB 3LKQA 1J1XL 1AI1H 3CCHA 1U91A 1SEBA 5KOVC 5HSFA 3REVB 3KYKH 5F6IB 1BOGB 1HSAA 3ZE0E 3MGOB 3EJZC 2CUMA 3E8UH 3I75A 3UTOA 5IW1B 3EKCA 1W72L 4L4VA 1N4XL 4NCC2 2QKIA 3L6FA 1SYSA 4JY5L 5K9JL 3F8UB 5DYOA 5LAXA 3W81A 4HIJB 1W72A 2IJ0C 1MCNA 1NJ9B 1JF1B 4PJIF 2CK2A 3QG7L 1FJ1A 2AI0L 2CSPA 4PJ9B 2VJXA 1ZLSH 1FNLA 4EUPH 2ATPA 5ELIA 1LO5B 4J2XA 4LF3A 1K5NA 4Z7WB 2EEDA 3OAUH 3SJVA 1FN4B 3KS0J 4FXGB 1CLYL 4R97C 2AABH 4EVNB 3MV7B 4GW1A 1BIIA 5SWSE 3RY5A 2FO1A 1WF5A 2AXGB 2XWJA 3DUHA 4YFEA 1M7IA 3GI9H 5ENWB 2H2SD 4O4YH 4HCRH 1YUHA 4LCIH 1CFNA 1ZSDB 1X5ZA 2ARJA 3RWCB 1J1OH 2X5PA 4AMKL 4OZIA 1WT5A 2BNQA 4PJXE 2BVQA 4LSQL 4ODXB 4UNVA 4HFWB 3C5SB 1GGIL 4Y19D 3WSQL 1Q9WA 2FL5A 4FHBD 4M03A 5I1IL 2NPLX 3OZ9L 5F7MC 3KNBB 4LSPH 1JFQH 1HK6A 1CGVA 1T3FB 2CO7B 1JPGA 1PY4A 2XZCH 3DX9B 3IU4L 4ORGA 4NUGL 3GJEB 3FT2A 4MJ5B 3QUZD 3M45A 3EFDH 3INUH 3CLEH 4K9EL 1BWWA 2PXYB 5KSBF 2CK0H 1EMTH 2R8SL 3CFEA 5FHAH 1PKOA 1OPGL 4Y4FA 1JV5A 5FO7B 3VE0A 5ICXB 2L7JA 4AEEA 2IANE 3TWCH 2OJZL 1HZHH 3REWB 1N8ZA 3A67L 3NFNB 3MPCA 1B4JL 3HI1B 5CD5D 5FYLE 1S7VA 2OJEA 4XPBH 4Y0GA 5EBWA 1E4XL 4X9BA 1JN6A 5TPWH 3S35H 5F7FA 5MP6L 1KF9B 1AR2A 1Y0LB 3MBEC 5J1AA 3MUGA 2E7BA 1LE9A 2WWMC 4DZ8B 1K9TA 4Z0BH 2P5WD 3BVNA 4FFVC 5C1MB 5DD1L 4LCCA 3V8CA 1K6QL 1QSZA 2R4RH 1KIQB 5DQJA 1KTLB 5DHYA 4L1DA 3OKKB 4R97B 4A6YL 3CSGA 3ULUC 5FYKL 2Z91B 5DQ9A 2WLZA 4L8DA 4GRMB 4LBEB 4JM4L 3RAJL 2ZG1A 4A6YA 3RZCB 1Z9OA 4KJQD 4HWEL 5EPMB 1NCDH 4R7NB 4FTVE 1VENA 4NT6B 4TQEL 5D96B 4DGIL 4Z7VE 2OP4H 3EBAA 2V2TB 4X6BB 3GSXB 5BS0E 1VSCA 3MTRA 1F6AB 2PYEB 3NTCL 4LMQI 4PJ5E 2MWCA 4GW5B 1A5FL 3L5IA 3MCLH 1IGCH 5C09A 4GKSB 1GIGH 4ONHB 5D7LB 1YDPA 2ZPKH 3GO1L 5B4MD 3EDJA 2P49B 5I1LA 5EZLB 2VN7A 5IMLB 4J12A 1VADB 4Z7UE 1XF5A 3WFBL 1FLRL 2AEQH 4KRNA 3MA9L 2LTQB 1WC7A 5IROA 1NUFA 2YPLB 4H88H 2R15A 4ODVH 1FPTL 4U1JB 2GITB 1NBZA 2EC8A 5A40E 5DMJB 3BW9B 4FRWA 3CMOH 1A3RH 5HGAB 4YHOL 2RJMA 1PKQB 5HHQB 3R8BB 5K9KA 5AZ2H 5GGQH 5FECA 4MD5A 5I8CB 3DIFB 3PWVB 3QDGA 3EGSA 4G8EA 5CP7A 4CN4A 4HIEB 1MCPL 4D0DB 1AR1C 1G7IB 2ICWA 2NY2D 4PJFE 3TO2A 5AD0B 3ARBC 3VFOA 4GO6B 1G6RH 4GXUN 4P2OA 4DTGH 5E9DD 5I18H 1UM4H 5E7FA 3WN5C 1A9BB 3P4OA 1D6EA 3WO3B 3MBEB 3ROOA 4NWTL 5HDBE 1FDLL 4WEBH 3ZT5A 3SQBA 4P2RA 4M43H 1KN2L 1ZT1A 4BFGA 1IGJA 1UXWB 4NFBA 2BCKA 4G9DA 5D1QA 5BZDA 4JQIH 2WIIB 1DFBH 4YHNA 2VNCA 2XNAA 2ADIA 3BZ4B 4LAQL 3HZVA 1AD0B 1T04B 4QXTA 3I6KA 3MROB 5DD6B 2ITCA 3BEVA 3P30H 3H9SE 4JM2A 1QSFE 2I9TA 2FWOA 4JPIB 3BUYA 1A7BA 3CLFH 5B39B 1UB6B 4HKXA 3QQ3A 4DGVL 4E41D 2HTKD 1I1FB 4X7CC 3RVVD 4YHLL 5DUMH 2NNAB 3HZYA 1F90H 5EZOH 4XPHH 3MRDB 1I1RA 3OKLA 1BVZA 1AGCB 4PG2A 5F1OB 1GGYA 4NQED 1I9IL 3KR3H 2EO9A 2IPKB 2DQDL 1XGPA 2IADB 2DQCL 5E6ID 1WGOA 4O2CB 1A1NB 3EYSH 1UADC 4I4WB 2X42A 2CXKA 4HV8B 1IAOB 5EIIA 1MH5A 4X5WA 5IF0B 2P8LA 1OAYH 4IRZL 5EORH 2HN7A 4WO4D 5KSVA 3ARWA 3WMSA 4DEPC 4J3SA 1T21B 2BJMH 2CLVB 4XPTL 5KOMC 3UPCA 2YOCA 2DTMH 2X4RB 1UWXH 3HHRB 3BWAA 3ARBB 1NMAL 4M6MH 3DV4B 3ARGB 4UNTA 5GS2D 3WNOA 3WN5B 2QHRL 3HZMB 1BX2A 2XZAL 4JQVA 5CIPA 5D1ZC 1HCFX 3MLZH 3QEHA 5EU3A 3MR9A 4UU9A 2XV6B 3QEUB 4HX1A 3VMOA 1ZLVH 2AJUL 3PHOA 5I1KL 3EO0A 1ONQB 3QJHA 3S98A 1A14L 2PCPA 4EDWH 3AREA 4LHQB 3MRGB 1AXIB 1C1EH 5HGDA 5I8KL 3QDMA 3OHXB 1HHIA 3PGFH 1BQSA 4PGCB 4Y16D 1I7ZA 3DMMA 2AS5M 5HHNA 2DLTA 1FHGA 1CGYA 3M07A 4UIMA 4I18B 4A2MA 4XCNA 3LEXA 3C9NB 4ETQB 2AJYL 2BY3A 4PR5A 1ORQA 4J6RL 1YN6B 4U6HA 3BMVA 4HKBB 5FO8A 1BOYA 4JFXA 4JKMA 3VWKB 4BM7A 3OGCA 3VFRA 3QCVH 4G80A 5DJ2B 3NMEA 4G6AD 5DHVH 2A77L 3TPUB 4JANB 4JFQA 5IFAL 3VXSD 4AL8L 3RVWD 3W5NA 1WIUA 3GGWB 4W70A 4FP8H 2R23A 3SDDB 2FZ3B 5GGRB 4KJYA 1QKZL 2MTPA 3OG6B 1NDMA 3R06A 4KV5F 2XY2A 1XGUA 4XBPA 2CDEB 2QJDA 3C2AL 2RCSL 3MX0A 9CGTA 4WU7B 3BE1H 4Y2DA 4I77H 1OAKL 2O5ZL 3JSSA 3U4BH 3VXPB 5DSCB 1ODAA 1WAAF 3OKEA 4LQ1A 3ZE2E 1OD7A 5CZXD 1YEKL 2F58H 1OM3H 4ZAKB 1V5JA 5JR1L 4OLYH 1E4XI 4TTDD 3TIDB 1OLZA 5TF0A 2OS7A 1C16B 4LSUH 1MCIA 4OLXH 5DC9B 2DJUA 4LNVA 1OAXH 2JCCE 2XWTA 2P5WE 1LILA 5D7IA 4AIXA 1DLHB 1EHLL 3SDXA 1JVKA 3RWIB 5JXED 2GFBB 2GW5A 5D1ZB 1KCUL 1R5WB 1NUDA 4NN5B 2XA3A 4ZMAT 2BOBB 1DVFC 1U58A 5FF6A 1U8NA 2WAHA 1A6TB 3CSPA 1CU4L 4OF5A 3CC5A 5DMKA 5CP3A 5L88H 1V3JA 1K8IB 4I2XE 4G8GB 3QIWA 3EYUL 5C0AD 1I4FA 3GSRB 3IGAB 1DBBL 5I1DB 5GZNC 4JKLA 4HIIB 1JGVH 2V5RA 3UO1L 4KDTA 5LVEA 5GS0C 4U1NB 3MJ7A 5CJQL 4F3FB 2CJUH 3IFPB 3RIFK 3UJTH 4PJHF 2FBJH 2R2BB 3SGDH 2B1HH 1BF8A 3UTPE 3D5OF 5F7WC 7CGTA 3QDJD 4M1DH 1ZVSA 3NFSH 4AEHH 3TFKD 4TVPL 2X7LA 4U1IA 2YKLL 3O81A 8CGTA 1RUQL 2R0ZL 3ARFC 1IM9B 1YNLL 3GHBL 2K1MA 4E0RA 3MACH 4JVWA 3QWOB 3V5KA 3EOTH 4YH6A 4QHMA 5T33H 3QO0B 2X4UA 1T1WB 1YEGH 2VDKL 2ICWI 5BRZD 1ZANL 3QIBA 4WW2A 3P11H 3SDCC 4MMXC 4HXBH 3W2DL 3DX8B 5E9DE 5T3ZL 5HYSG 2NW2B 4LLWB 1F4AA 4PJAF 3VH8G 1MIEL 1BBDH 4OLVH 4DVBA 3VXME 4IRSA 1DQQA 1D5XA 2FX9L 4YXLL 1EZVY 3GSNH 2XICA 3FFDA 3PL6B 1F8TL 4WI6A 4CBPA 3OB0K 2GJ6E 4U0QB 3MV8A 1FZOA 4YHKH 3UAJC 4K23L 5TE7H 4C56B 3QHTC 4WEMB 3OGOE 1DVFB 5C08A 2HFEB 1BLNA 2FYYB 3MC0A 4FQ1L 2J6EH 1WIPA 4NN6C 4ZFOL 1B2WL 3NABH 4LRIA 4F58L 4PJDF 4LLQB 3GJFA 1YECH 2XQYK 3TBVB 1EJOH 4ZFOA 4YEEA 1LP9B 1WQVT 5DJYA 1CXLA 5D4QA 1I7RB 5DJCA 5ISZD 3QUXC 2VDQL 5J0BA 2Y5TB 1BZQK 4PG9B 3D3VA 4KJPD 5K59E 3HC3H 5TH2A 1NUNB 1AY1H 2Z0BA 3DJ9A 4PJCF 5JIPA 3MOBL 4I8DA 5DFTA 4RFNC 4NQEE 1OSZA 5GJTL 2OR8A 4UOW1 2ZSVB 4OT1L 1FL5A 4AJ0A 3L1OH 2VERN 1KJ2L 1CICD 3GZKA 4PGDA 5EBGA 1GC1H 2NXZD 4XP1L 5IBUB 1NMCC 1KB9K 1OT2A 1XH3A 1KGCD 1NAKH 3THMH 4D0BA 3UTQA 5HYQA 5LBSL 2DB8A 4NM4H 1KJ2A 2GCYB 2HT4C 3VFVA 1XGQB 4HWUA 3ARSA 4MAYC 4MLSA 3WL9B 3MUJA 4I0CC 2A6IB 3V0WH 3B5TA 5F7DA 2AK4D 1DP0A 1UKSA 2ZNXA 3BZFA 1Y6KR 3P4MA 3V0VA 2C3VB 4L8SC 1F4YL 4GKNA 5E94B 5E8EB 3V4UL 5FOBB 2UV3A 3K4DA 4I3SH 1H5BB 3QEQB 3LKNA 4X0KB 3SE4C 2CRZA 3FQUA 3WFHB 4G43B 4OFIA 4U6XA 1G7HB 1QO3A 4R4BB 1CGXA 4NKMB 2ESVD 1PG7L 3ULVL 3IXTA 2CIIA 1CD1A 3TT1H 1WV7T 1A6WH 1H3PH 2R0LL 1XIWD 3MNWB 25C8L 5GGVL 1RK1B 1N5AA 5MEPB 1Y18A 3FQNB 4N1EA 3RUGA 2ZUQB 2C3XA 4NRYA 1EAPA 1TJHH 4MVBD 3BWUC 2EXYD 4FXKA 3U36B 1UYWL 1OP5K 3R4DA 2VDLH 1M6OB 3BYYA 2YUVA 1YYLL 4OJFH 1MCHA 5EWIH 4OUUA 3VU2A 1MPAH 2VDNL 1KJVB 1QSEA 3QUXB 4OI9A 5EOQL 1INEL 2OK0H 3VXSE 2I60H 1B88A 5IMOA 3JXAA 3CU1A 4DK6A 4J1UB 2ZCKH 4P9HC 2HJLB 4GRLA 4RNRA 4BZ1L 4JO1L 5J13B 1BWMA 3UBXG 5D6CB 2Q76B 4E5XB 4KZEL 4P2QB 1JE6A 3HC0B 4ZNEE 3KLHD 1ITCA 4EI6A 5ALBL 1UJ3A 2NR6C 4ZFGL 1UQSA 5DC0A 3EYOA 1OAUH 4MJIB 3TN0D 1OTSD 3DHMA 1EH9A 5E70A 3CPLA 5FB8B 4NGHH 4YBLB 3QNYB 5ADOH 5J6HA 3FT3A 1HSBA 1MHEA 1ZGLM 2DWDB 2FJHB 3BKJL 4RX4A 4KK9C 3U9PH 3QUYD 2GI7A 2DLEA 2C7UB 1BM3H 1GZQB 3QWRA 3QIUB 3HAEA 3U7WL 1JCKA 4N8VA 3V9FA 1KPUA 1QBAA 4X6DE 2GT9B 1I9RL 1FE8L 1F5WA 4NQTA 1F6LL 3REVA 1BOGA 4P4KD 4YZFE 3MGOA 3PABB 3BKCL 3C09B 2NMSA 5IW1A 3Q2CA 3V52L 2BC4B 2OMNA 4M3KB 3UTZB 3PWNB 1SEQL 4GMTH 3RVTD 4WHCA 1D6VL 5C0AE 4ZOEA 2ZUTA 5A2FA 1NJ9A 1GHFL 1JF1A 3VRJB 1H8OA 4PJ9A 2JLLA 4JRXB 1LO5A 1QYGL 2G5BB 3GUTB 1T89A 4Z7WA 2EO1A 1FN4A 4FXGA 4WI3A 2J4WH 4EVNA 2QV2A 1AFVL 3MV7A 5GGTH 4AENB 5DURD 1FGVL 2NY4D 4YHYC 2AXGA 3UYOD 1X5HA 2IAMC 4XAWL 5ENWA 1FFPB 4D9QD 3LKRB 2XYCA 1ZSDA 5D1XC 3NA9H 1XF2B 4PJGA 3RWCA 1UCBH 2WUCL 3X3FH 3WIFB 4ODXA 5ICYB 1BECA 2P48B 2DQEL 4K7PX 1OAZL 4HFWA 1TJGL 1S9WB 1RZ8B 2DIBA 2A6JA 3QFJE 5BRZE 1S78D 2OL3H 3HZKA 1MEXH 2MMXA 3O0RH 3RWFB 3KNBA 1S7XB 2BSTB 3ARDC 3VD9A 4TNVK 4HC1H 4PPTA 4CVXB 1J1XH 1I9JH 3DX9A 3U82B 1MRCL 3GJEA 2ADFH 3TV3L 4MJ5A 2P42B 2VC2L 4JRYE 2IFFL 1YMMB 4L1HA 2WZPD 1WFUA 2OSLB 2DI9A 2PXYA 2YWYA 4XCEB 4LHUG 1W72H 4PFEA 4FA8A 1P69B 3MCG1 1N4XH 3OKOB 5FO7A 5ICXA 3REWA 1SBSL 1X3DA 3NFNA 5A3ID 2VH5H 3HI1A 4XVTH 1E0OB 2E7HA 5ALCL 3TVMD 1CFQB 3UYRH 4CDGC 1TIUA 1K4DB 4AQOA 5AZEL 4XX1G 1Y0LA 1Q94A 4DZ8A 2XFXB 1CQKA 2XKUA 3ZTJH 3IRZA 5T1LD 1KIQA 4LAJH 5A16B 4CAGA 3RGHA 3RGVB 5B3JF 1KTLA 2P5EE 4X6CF 3H3PH 1CXEA 3OKKA 3P9WB 4QTIL 1FZMB 2Z91A 4GRMA 1S5HB 4LBEA 1DQTA 5KVFH 3RZCA 1HDMB 2FHCA 3MQIA 3N9GH 1YEHL 1UXSA 1CI5A 1RV6X 5D1XB 3WSQH 4PJCB 5EPMA 4CL7A 1KG0B 4R7NA 4PTUB 4NT6A 1RU9H 4OGYL 2V2TA 2Y25A 3OZ9H 2PTTB 1RIVL 3GSXA 5FUZL 1F6AA 2AEIT 2PYEA 2YPVL 5ILTL 4G7YL 3HG1B 4GW5A 3IU4H 5B22A 4GKSA 4M7ZB 4NUGH 1CFTB 4ONHA 5D7LA 1YPZE 2B5IC 3BGMB 3VRLE 4DGYH 1TTGA 5EZLA 4MHHI 5IMLA 1VHPA 1VADA 3ARDB 3MUHL 2A74B 2RIKA 3DETD 1BJ8A 3F5WB 2CKBH 3VFUB 4PJEF 2YPLA 3N1PC 4U1JA 2GITA 5GRYA 2HYMA 3F7RA 4JR9L 4DWHA 4Y5YB 3BW9A 4Y4KC 4QXGH 5HGAA 3L5XL 4Z9KB 1L6XA 4BUGA 1PKQA 4QT5B 5HHQA 2ESVE 1E4XH 4KXZI 4JHAL 5I8CA 3DIFA 3PWVA 4OQTH 4IS6B 5HI4D 3K2UL 1VFOA 3C8DA 3FQWB 3QRGL 4HIEA 4D0DA 3AAZB 3QZWG 1G7IA 5AD0A 5DD1H 3RI5K 1K6QH 4XWOD 5F9OH 1EGJL 1A9BA 1FIEA 4I48B 3MBEA 4A6YH 2HFGL 3LPGA 3ILPB 4NN7B 4GQPH 2Z93B 1EGJA 4IJ3B 4PD4J 3ULUL 2KZ1B 1LO0L 4KTDH 1TENA 1UXWA 3MRRB 4Z18A 4KDWA 5LGKA 1Z9LA 3OXRB 4HWEH 3IB4A 2WIIA 3I84A 2PW2B