4NMUA

Crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor'
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
147
structure length
147
Chain Sequence
SNAADKEKMQIGKEAPNFVVTDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIALDADETDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVVEQIIGEQTKEQLEGYLKKITP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol-disulfide oxidoreductase ResA
publication title Crystal Structure of Thiol-disulfide Oxidoreductase from Bacillus str. 'Ames Ancestor'
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 47
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4nmuA00
1V57A 3P2AA 2HZFA 1DE2A 2DSAA 2IPAA 4MZBA 3WGDA 3BJ5A 3US3A 3Q18A 4ML6A 4ZL8A 5ECQB 5F05A 4O5RA 2IMIA 4E8EA 4OFMA 2P0GA 3WYWA 1EGOA 4ILFA 2E7PA 4IP1A 5DAKA 4MA9A 3G7IA 3FW2A 2ES7A 3JCML 1Q98A 5AIXA 4PUFC 5DCGA 3TDGA 3QAGA 2R3XA 2IIYA 5CRDA 5B7CA 3FR3A 2PERA 1WIKA 4KB3A 5G5FA 3CYNA 1EGRA 3GKMA 3ZYWA 1XCCA 3F0IA 3G7JA 3VWXA 3HZ8A 3FZ9A 2KHPA 1R4WA 4MLYA 2WULA 1T3BA 2LTKA 5D96A 4DSQA 1TDIA 3WT2A 1AW9A 5CRHA 5FWGA 4ZB6A 1Z9HA 1T7PB 4OFNA 2MMAA 4KSMA 4KSOA 3D5JA 2V6OA 1M7TA 4G19A 3FK8A 2WCIA 4K7IA 3C71A 1AQWA 4IVFA 3VURA 4EC0A 2GQKA 1NM3A 2CZ3A 1EEMA 1YDKA 4KX4A 1SENA 1THXA 3RAZA 1URMA 5B8AA 1EEJA 4TW5A 5GSTA 2WGRA 2PBJA 4FYBA 2E0QA 5ECHB 3CRTA 5JWRB 1ERTA 2VD0A 2GSSA 4ECIA 2N5BA 1V98A 3HKRA 1ZGNA 2IFQB 4YAPA 4G9HA 1JLWA 1B9XC 3P7XA 1YY7A 2LRCA 2I4AA 10GSA 1TRUA 1TKDB 4TKYA 4D73A 2OBKA 4HI7A 4EDZA 4TOPA 4POKA 1OC8A 1AIUA 4V2NA 5B8BA 1OKTA 5AIVA 1XWGA 2WFCA 5HQPA 4ZBAA 2PPTA 1HQOA 3J7Yb 3KD0A 3G7YA 3IDVA 1ABAA 2H74A 4LMWA 4TRXA 5DJMA 2L4CA 5DJLA 2IMFA 3WT1A 3GL3A 4HU9A 3DVWA 2LJKA 2OE3A 3F3QA 5CAXA 3LG6A 4MP4A 3FZAA 3BOAA 2HSHA 1Y6EA 2FWFA 4ZILA 3D0ZA 3GNJA 1ILOA 2H71A 3TGZA 5EL8A 3ZREA 2PN8A 4POBA 2N5AA 4WF4A 2JADA 2RM5A 5D9VA 4G10A 2A2SA 3H1NA 2X8CA 5B6MA 1XFLA 4GSSA 3O6TA 1JZOA 4HQZA 2K9FA 2B5XA 1GSFA 4XIHA 2FA4A 1EV4A 3L4NA 3KTLA 1GP1A 1LJRA 5IMVA 4V1Ag 4KDXA 2REMA 5FT3A 1GUKA 5D8IA 2VCXA 3LWAA 4V2LA 3LFLA 1TRWA 3P90A 5H5QA 3RPNA 2IMKA 3D4MA 4NV5A 3MAKA 2K8VA 2GTUA 2DJ1A 2VL2A 3TB2A 3GKKA 2DIYA 4KA0A 5C00A 2DJJA 2O85A 4NV2A 1X5EA 1LBKA 4OD7A 5HFGA 3TKRA 1Z7PA 2FCHA 1A2LA 2XPEA 3GSTA 2R4VA 5EPFA 2YNXA 3Q6OA 1ACVA 2XPDA 3HHVA 6GSWA 3GV1A 3VFIA 3EMXA 3EU3A 4N0ZA 1HNCA 4OCEA 1ZCPA 4OMVA 3UOMA 1RK4A 3KMNA 22GSA 1GNWA 3UBKA 4TR0A 2GSTA 3GH6A 4PXOA 3S9FA 3GFKA 1SD9A 4F2IA 1AUCA 5G2ZA 1TK8B 3L9VA 1FAAA 5ENUA 3WD6A 2IJYA 3QDNA 3EYTA 8GSSA 3M1GA 1PL2A 3F4RA 2H0IA 1PA3A 1A24A 3APSA 3EWLA 3IA1A 5JWQB 1TU8A 2H30A 1O8WA 1BX9A 2OKAA 4XS4B 2V2GA 1TI3A 2AB6A 1VF3A 4N30A 2G0FA 4OCFA 2NTOA 4IQ1A 2FNOA 3ZVJD 4XS1A 1TK0B 2MBSA 2FY6A 3M9JA 4KW6A 2Z9SA 3LQ7A 2VCZA 2HFDA 5CREA 1H4OA 2BJXA 3M8NA 1U6TA 2C3QA 4HU7A 1S3AA 1G6YA 3BCKA 1Z6MA 3HVXA 4IGJA 4L8EA 4MJEA 2IFQA 1QMVA 2DIZA 1GUHA 4OO4A 2M80A 2CQ9A 1KEBA 2GLRA 3LJRA 2TIRA 3IK9A 2ZUPA 4WF5A 4ZIJA 3ZIJA 1G6WA 3SBCA 3UARA 4QL9A 5G30A 2MYGA 2VCQA 6GSTA 2I3YA 5ABRA 3TKSE 2WB9A 2GSQA 2GZZA 4O7HA 2QKEA 5G1LA 1T4ZA 1O6JA 6GSVA 2OACA 4JR4A 1K3LA 1U3IA 1SJZA 4WKWA 5EVOA 3D21A 1YEPA 2G2QA 1NHOA 1GLPA 5IM9A 1N2AA 2NBSA 1K0CA 3IAM2 5GSSA 2FWEA 12GSA 2O8VB 2YOIA 1XBSA 4MZWA 4NHZA 2EIRA 3BBYA 1EOGA 1WWJA 3H4KA 19GSA 3L78A 4PUAA 1M2BA 1R26A 1K0DA 3M9KA 1KBNA 1DUGA 3FEUA 4K7NA 4MJBA 1JLVA 4EF0A 3WGEA 1TW9A 1VF2A 1NSWA 4D73B 4JR6A 2YP6A 2VCWA 5HR0A 3ZIVA 2H70A 3CSHA 1K0MA 1GSUA 2B3SA 5A5KA 1BG5A 3F9UA 3UJ1A 2H6ZA 2HYXA 1J9BA 4TR1A 1B4PA 3MDKA 1SYRA 5A4WA 4NXIA 3LXTA 1SK2A 3IC4A 4I5QA 2H73A 5C04A 1G0TA 3DRNA 1ML6A 4TR4A 3H79A 1R5PA 3CRUA 5D9WA 2FD3A 1GUMA 2HRNA 1M99A 3ZL5A 2H19A 4EDYA 2HLSA 1NW2A 1YJ6A 4PQHA 2ON5A 2GT5A 1T4YA 1WJKA 4YH2A 1SKRB 2YJHA 4N10A 4DSRA 2N5FA 4F0BA 3L9SA 3UBLA 4IW9A 2YZUA 5GAND 1I9DA 2LJAA 3VI5A 4IQAA 4JEDA 3V1WA 3VWWA 5GAPD 3HCZA 2HT9A 3D6IA 2NPBA 1Z5YE 5G1KA 2KUCA 3LGCA 6GSUA 1ST9A 3CTFA 1OC3A 1S3CA 3CSIA 1ERVA 4LA1A 5JCGA 4L5LA 2VM2A 4FO5A 4ACSA 2A4VA 5LD0A 1WMJA 1JZRA 1A0FA 3GA4A 5ECIB 5IMFA 2AYTA 4LMVA 2H01A 4KCEA 3LXZA 1ERWA 2H0HA 2YANA 4XS4A 2I9HA 1B8XA 1TXXA 1A0RP 1XWAA 4MDCA 16GSA 3GH9A 5KN1A 2B1LA 1EP7A 2B7KA 1K3OA 4BA7A 1OC9B 2LRTA 1V2AA 1PMTA 2BTOT 5E4WA 5D73A 3A2WA 3FKFA 2YWMA 3A5WA 5J41A 2HNLA 4XHMA 1A8YA 2OADA 1SYXA 5J9BA 5L71A 4J57E 1AXDA 4WBJA 3UMAA 2H66A 2X64A 3TJJA 3APQA 4BWQA 3EC3A 4MH2A 2HSYA 5HR1A 4AJ6A 2YWOA 2L4QA 2FGXA 2CAIA 2MMOA 2FHEA 3KMOA 1AC1A 1GTAA 3FR9A 2PU9C 4KDUA 2CVBA 1CQHA 3PGTA 2C0FA 5ID2B 3ZTLA 2VCTA 5KEJA 1R5AA 3KH7A 2H1BA 1Q4JA 2JSZA 4AF2A 1RW1A 2LJRA 3KP9A 2K8SA 1LU4A 2YV9A 3IRAA 2QGVA 3IE3A 1TRVA 1K0BA 1X0RA 2C4JA 3HJOA 3GIXA 1Z3EA 2AV4A 4ZXGA 5DQSA 1GSQA 2BMXA 1WOUA 2IMDA 3QCPA 5H5RA 5JCUA 1M0UA 3WGXA 4KH7A 4EO3A 2FWHA 3A2VA 5ECOB 4HQSA 5FHIA 3F6FA 2LRNA 5G5EA 1EV9A 3ERFA 3EU4A 1G7EA 3CXGA 3TUEA 1TTZA 1ZYQB 3F4SA 3RHBA 3GUSA 2L5OA 4EXJA 3IOSA 1GTUA 1FHEA 4G2EA 1HNAA 4EVMA 1GSDA 1XIYA 4IELA 5CRWA 3LEFA 4Q5QA 5IPGA 5J3RA 2GQLA 1GRXA 1QGVA 4DSSB 3HZ4A 1GULA 4PNFA 3I9V2 4MF5A 4KGIA 1AAZA 2PVOC 2IN3A 3CMIA 3H93A 2LV3A 3M3MA 1FO5A 1PQNA 4CW9A 1OKDA 2A2RA 5A4UA 2H76A 3NOFA 3LORA 1VRSD 3PR8A 4RI6A 2LSTA 4ZBDA 3I6AA 1K0NA 9GSSA 2DMMA 3Q74A 4GLTA 3I69A 2CVKA 2C0GA 2C8UA 1PN9A 1X5CA 3DMLA 18GSA 2DJKA 1TP9A 2DC5A 5DVBA 3GKXA 2EIQA 2RUEA 3ZMKA 3KGKA 5D93A 3TKPA 5IIZA 3W8JA 4PNGA 5LNKe 2EC4A 4K8MA 2P5RA 3ERWA 5DQYA 3VI7A 3F3RA 4N0VA 4TR1B 2MZCA 1K0AA 4BPYA 5DBQA 2JZSA 1A23A 3GRXA 3TOUA 2F51A 2WZ9A 2F8AA 4ZBBA 3KH9A 4IS0A 2C80A 5G31A 5COHA 2VO4A 1WP0A 3GHAA 1OC9A 5INYA 4LL4B 3KP8A 4PX1A 2VM1A 1IYHA 1O7UA 5HFIA 1K3YA 3ED3A 2RIIA 1BYEA 4L0WA 2ZCTA 4L0UA 2JSYA 4Q5FA 2NDOA 4Q5NA 4EKZA 3N5OA 4GSNA 3FZ4A 2PGTA 1MDIA 3KJYA 2H72A 2X8HA 2CA8A 2FWGA 2MMNA 4KDYA 4NMUA 3W6GA 4XRAA 5ID2A 5E59A 1MD4A 1A2JA 3QFBC 2E2MA 1PSQA 1GTIA 4GWRA 5AN1A 2YZHA 3HY2A 3N9JA 2FLSA 1X9MB 3F63A 2AJQB 3FZ5A 2KOKA 5CNWA 3TKQA 2C1YA 1SK0A 2M72A 3F8UA 1TI1A 4KAEA 1I5GA 4TXOB 3VK9A 3QD9A 1FW1A 1GH2A 3GN3A 5JWOB 4P3YB 4AGSA 5KN0A 3ZLPA 1X5DA 4X1UA 2I81A 2I1UA 3ME8A 1N8JA 3DGQA 4IJIA 1X9SB 2KP2A 14GSA 2ALBA 4F9ZA 1JHBA 3AY8A 1GWCA 1XZOA 3VLNA 1XWCA 2V32A 3LSZA 1GTBA 3FR6A 4V2MA 3IHQA 3QOUA 4DVCA 5CRGA 2TRCP 3KZQA 3G9BA 2P5QA 3FYGA 1PKZA 3TJKA 4POLA 4DSSA 4GSTA 1E2YA 2PMTA 4RUVA 2VUPA 1U3AA 1V58A 5CYYA 2LKUA 4ZB8A 4NPBA 5F0GA 2VLUA 4HEA2 3BD2A 1J08A 1H75A 4I97A 2H6XA 1MEKA 5IMCA 2RM6A 2JU5A 4I6XA 3DKSA 4BVXA 2YCDA 5F07A 1ZMAA 1YKCA 3D4TA 2L5LA 4OWYA 3C7MA 1M9BA 3TJBA 1SL2B 3FRCA 1S3DA 1OAZA 3IAS2 2XHFA 1FB0A 2J23A 4IJ3A 1SKSB 4WBRD 4QL7A 4YQMA 2DLXA 2QC7A 2R37A 4WXTA 2KP1A 4GCIA 3C73A 5J9CA 2GGTA 1OE8A 3TRXA 5KN2A 2F8FA 4IBPA 3O3TA 4K7OA 4PGTA 1DBYA 1XW9A 2VL3A 1OVNA 1QXHA 4NWYA 1XXUA 3QPMA 4KCAA 3IR4A 3DIEA 4HS1A 1NHYA 1EWXA 3UEMA 4QQ7A 4WR4A 17GSA 3APOA 3W8SA 4O92A 4LLRA 2NVLA 4RQRA 4X43A 4CHSA 2CZ2A 1BEDA 4DEJA 1U88A 1F3AA 2L59A 4OO5A 3GMFA 4WR5A 3OR5A 1E6BA 3ZFBA 4K0GA 3HJMA 2WDUA 1M2AA 2CX3A 2KLXA 5HFKA 1YF0A 3EE2A 4BL7A 4J56E 3RDWA 3VWUA 4LL1B 1YEXA 1FOVA 3HVSA 1BAYA 2E2GA 5ECMB 3HDCA 2RUFA 2JZTA 1K0OA 4MMMA 1B9YC 5ECKB 1W4VA 1XWBA 4O32A 1T00A 3QAVA 2PWJA 1HD2A 2VCVA 1XPVA 2HRFA 4J2FA 3CSJA 4FYUA 1JZWA 1YF1A 3C8EA 2B7JA 4POMA 4MJCA 1SL0B 4OFTA 2C3NA 3QAWA 4ULXA 4F03A 3TOTA 2YPMA 3C1SA 2X8GA 3QFAC 3FY7A 2HXKA 1O85A 4IHUA 4TXOA 1FVJA 3PINA 5B6NA 1SD8A 5KN3A 2MBTA 3A2XA 1VF4A 1HNBA 5AGYA 1QFNA 3ZRDA 3DD3A 3UVTA 1OYJA 2O7KA 2YJ7A 1M9AA 4GQFA 2V1MA 1DSBA 2O87A 1F3BA 11GSA 3L0HA 2VL9A 3KM6A 2VAFA 1ZL9A 1AQXA 5DDLA 3GTUB 2LUSA 5F06A 3KTBA 2DMLA 2IWTA 3DXBA 2VLVA 2H6YA 1F9MA 1WE0A 5GZZB 2GS3A 3TKSC 2MMZA 3F4TA 3M0FA 1B4QA 1O81A 4MCUA 3VWVA 1ZYEA 2CVDA 3QMXA 3U5RE 1T1VA 2VOCA 4FH8A 4EL1A 3IBHA 1JZDA 2GQMA 3KEBA 2R6KA 4WEYA 1FVKA 3SWLA 2J9HA 2OE1A 1UN2A 1CQGA 2VLTA 5J4UA 3ME7A 4F82A 4ZL9A 2H8LA 2CV4A 5J5NA 2OA7A 5IO2A 2GZYA 1F2EA 3UIWA 1XOBA 5IO0A 1QK8A 5DALB 5CO3A 1SK1A 3VPQA 3F6DA 3RPPA 4BVYA 3E3EA 2AHEA 2AAWA 4HUAA 1TRSA 4MZCA 4HZ2A 3HD5A 2F3MA 3CBUA 5DCHA 4MJAA 2FUG2 4JRRA 1PD21 1X9WB 1RQMA 2H75A 4V1Ap 1MD3A 2IL3A 3R2QA 1PGTA 3ZFLA 4K6XA 5ECNB 1T8EB 3TKSA 2O89A 4NAXA 3UVHA 2LS5A 5IOWA 1HYUA 3ERGA 1XWKA 5ECLB 4TVEA 5JCWA 2VIMA 5IMZA 4YAVA 4E8HA 3U6VA 2H0GA 2RLIA 4N11A 2DJ3A 2VL2C 2XC2A 4GQCA 2LNTA 3TRPA 2WS2A 5EY6A 1THOA 3ZITA 4GRFA 4Z7XA 2GDRA 3ZVJA 1TU7A 3EINA 1PKWA 2LQQA 5ECSA 2OJLA 3HYPA 3NZNA 2QSIA 2OE0A 3LYPA 3FHKA 4FIWA 5AISA 3D22A 3E0UA 1ZZYA 1J0FA 3ISOA 2VD1A 2XBQA 4F0CA 3P8WA 6GSXA 2CAQA 1UA5A 1XVWA 4JBBA 4HJ2A 1XVQA 4JE1A 3TCOA 3LYKA 4WETA 1A2MA 2X99A 2EIOA 2GSRA 2YV7A 4TXVA 2V6KA 2XBIA 4MF7A 4XCSA 2L6CA 2ON7A 1G7OA 4CDOA 2IMEA 4YQVA 2HZEB 3C1RA 2FA8A 1B48A 3NIVA 3VPTA 3PH9A 4JZQA 5ELAA 2LEGA 2H1AA 4K1FA 5LCZA 2L57A 3HVVA 4HZ4A 3MNGA 2C0EA 4I8BA 2C3TA 3I43A 1MDJA 3IXRA 4L5OA 5IQYA 3CTGA 1U87A 4ISDA 5ECPB 2B5YA 4MK3A 2K6VA 4BWSA 5IOXA 1XW6A 4GXZA 1SL1B 2DBCA 2WJUA 3IK7A 4IN0A 3MWHA 3TJFA 3GYKA 3GTUA 4ECCA 5D9XA 3DWVA 1ERUA 1GSEA 3EVIA 4MF6A 3TRQA 3UL3A 2GZPA 20GSA 4ID0A 2K18A 1KNGA 5HR2A 1XW5A 3L9UA 5DAKB 3J7Yk 4MABA 1SU9A 4JU5A 2HE3A 4HDEA 4KNDA 5ECRB 4RQXA 3EURA 4ML1A 5HR3A 4ECJA 1F37A 3ZZXA 3GSSA 2V41A 1GSSA 4ZL7A 3KXOA 4I2TA 1PL1A 6GSSA 2P31A 3E9JB 4YQUA 1EOHA 1WPIA 5DALA 4HJMA 2LQOA 3GURA 2OBIA 4MPFA 1W89A 4GTUA 4MH3A 2C0DA 1KTEA 4PURA 2LNSA 5F8BA 3Q19A 3TJGA 1UVZA 2DJ0A 1QUWA 4IP6A 4ECBA 1EP8A 1YQ1A 1WRYA 2AUVA 2B6MA 1FB6A 4IKHA 1TK5B 2B5EA 2R5GA 3HA9A 4AJ8A 5A4VA 4EE0A 4K2DA 1MDKA 3EMPA 1JFUA 1FG4A 1SKWB 3GL5A 3RBTA 2DJ2A 3DYRA 1O8XA 1O73A 4GF0A 4XS6A 3RHCA 4PQIA 1TOFA 2L6DA 2CX4A 3A3TA 1UC7A 1SJ6A 1R7HA 2GT6A 3DEXA 3IV4A 1Z7RA 2WRTA 1BJXA 2GVPA 2YWIA 2YWNA 1TJDA 1XOAA 4Q5RA 1BQ7A 3GX0A 3K8NA 3UAPA 1YZXA 7GSSA 1V9WA 3O76A 5CP1A 4KE3A 1OE7A 1M2DA 3ZMLA 1C72A 4MPGA 1AQVA 1DE1A 4PQ1A 2ZNMA 1YKAA 1SJIA 1QQ2A 3KCMA 2H1DA 5ELGA 4TR3A 3MSZA 3BCIA 2CT6A 1PRXA 1EZKA 2JZRA 2HZEA 4X0XA 1GLQA 2PVQA 4ZB9A 2D2ZA 1PX6A 2HI7A 4XTSA 4TN8A 5D9TA 1VGLA 2M46A 3DVXA 2JACA 4KUNA 3HXSA 3QR6A 2H1GA 4H86A 4XRDA 5H5SA 5IPHA 2YN1A 3HJPA 2R2JA 2TRXA 1V40A 4K0NA 1Z6NA 3KIJA 4AJ7A 1GNEA 1Y25A 5IMDA 4I2UA 2F9SA 3H8QA 4RI7A 2B1KA 1ZOFA 13GSA 1VF1A 1GSYA 3GX8A 3IPZA 1A8LA 1GL8A 4EUYA 4NHWA 3GKNA 4HOJA 1F6MC 1USBA 4K9ZA 1IYIA 1PX7A 6GSYA 2JL4A 1ON4A 4FYCA 1MTCA 2PUKC 5IMAA
chains in the Genus database with same CATH superfamily
1V57A 3P2AA 2HZFA 1DE2A 2DSAA 2IPAA 4MZBA 3WGDA 4G0KA 3BJ5A 3US3A 3Q18A 4ML6A 4ZL8A 5ECQB 5F05A 4O5RA 2IMIA 4E8EA 4OFMA 2P0GA 3WYWA 1EGOA 4ILFA 2E7PA 4IP1A 5DAKA 4MA9A 3G7IA 3FW2A 2ES7A 3JCML 1Q98A 5AIXA 4PUFC 5DCGA 3TDGA 3QAGA 2R3XA 2IIYA 5CRDA 5B7CA 3FR3A 4YKFA 2PERA 1WIKA 4KB3A 5G5FA 3CYNA 1EGRA 3GKMA 3ZYWA 1XCCA 3F0IA 3G7JA 3VWXA 3HZ8A 3FZ9A 2KHPA 1R4WA 4MLYA 2WULA 3IC8A 1T3BA 2LTKA 5D96A 4DSQA 1TDIA 3WT2A 2R0PA 1AW9A 5CRHA 5FWGA 4ZB6A 1Z9HA 1T7PB 4OFNA 2MMAA 4KSMA 4KSOA 3D5JA 2V6OA 1M7TA 4Z2TA 4G19A 3FK8A 2WCIA 2UZ8A 4K7IA 3C71A 1AQWA 4IVFA 3VURA 4EC0A 2GQKA 1NM3A 2CZ3A 1EEMA 1YDKA 4KX4A 1SENA 1THXA 3RAZA 1URMA 5B8AA 1EEJA 4TW5A 5GSTA 2WGRA 2PBJA 4FYBA 2E0QA 5ECHB 3CRTA 5JWRB 1ERTA 2VD0A 2GSSA 4ECIA 2N5BA 1V98A 3HKRA 1ZGNA 2IFQB 4YAPA 1M3JA 4G9HA 1JLWA 1B9XC 3P7XA 1YY7A 2LRCA 2I4AA 10GSA 1TRUA 1TKDB 4TKYA 4D73A 2OBKA 4HI7A 4EDZA 4TOPA 5BMUA 4POKA 1OC8A 1AIUA 4V2NA 5B8BA 1OKTA 5AIVA 1XWGA 2WFCA 2QA2A 5HQPA 4ZBAA 2PPTA 1HQOA 3J7Yb 3KD0A 3G7YA 3IDVA 1ABAA 2H74A 4LMWA 4TRXA 5DJMA 2L4CA 5DJLA 2IMFA 3WT1A 3GL3A 4HU9A 3DVWA 2LJKA 2OE3A 3F3QA 5CAXA 3LG6A 4MP4A 3FZAA 3BOAA 2HSHA 1Y6EA 2FWFA 4ZILA 3D0ZA 3GNJA 1ILOA 2H71A 3TGZA 5EL8A 3ZREA 2PN8A 4POBA 2N5AA 4WF4A 2JADA 2RM5A 5D9VA 4G10A 2A2SA 3H1NA 2X8CA 5B6MA 1XFLA 4GSSA 3O6TA 1JZOA 4HQZA 2K9FA 2B5XA 2QA1A 1GSFA 4XIHA 2FA4A 1EV4A 3L4NA 3MIXA 3KTLA 1GP1A 1LJRA 5IMVA 4O5UA 4V1Ag 4KDXA 2REMA 5FT3A 1GUKA 5D8IA 2VCXA 3LWAA 4V2LA 3LFLA 1TRWA 3P90A 5H5QA 3RPNA 2IMKA 3D4MA 4NV5A 3MAKA 2K8VA 2GTUA 2DJ1A 2VL2A 3TB2A 3GKKA 2DIYA 4KA0A 5C00A 2DJJA 2O85A 4NV2A 1X5EA 1LBKA 4OD7A 5HFGA 3TKRA 1Z7PA 2FCHA 1A2LA 2XPEA 3GSTA 2R4VA 5EPFA 2YNXA 3Q6OA 1ACVA 2XPDA 3HHVA 6GSWA 3GV1A 3VFIA 3EMXA 3EU3A 4N0ZA 1HNCA 4OCEA 1ZCPA 4OMVA 3UOMA 1RK4A 3KMNA 22GSA 1GNWA 3UBKA 4TR0A 2GSTA 3GH6A 4PXOA 2X49A 3S9FA 3GFKA 1SD9A 4F2IA 1AUCA 5G2ZA 1TK8B 3L9VA 1FAAA 5ENUA 3WD6A 2IJYA 3QDNA 3EYTA 8GSSA 3M1GA 1PL2A 3F4RA 2H0IA 1PA3A 1A24A 3APSA 3EWLA 3IA1A 5JWQB 1TU8A 2H30A 1O8WA 1BX9A 2OKAA 4XS4B 2V2GA 1TI3A 2AB6A 1VF3A 4N30A 1PN0A 2G0FA 4OCFA 2NTOA 4IQ1A 2FNOA 3ZVJD 4XS1A 1TK0B 2MBSA 2FY6A 3M9JA 4KW6A 2Z9SA 3LQ7A 2VCZA 2HFDA 5CREA 1H4OA 2BJXA 3M8NA 4G0IA 1U6TA 2C3QA 4HU7A 1S3AA 1G6YA 1PFOA 3BCKA 1Z6MA 3HVXA 4IGJA 4L8EA 4MJEA 2IFQA 1QMVA 2DIZA 1GUHA 4OO4A 2M80A 2CQ9A 1KEBA 2GLRA 3LJRA 2TIRA 3IK9A 2ZUPA 4WF5A 4ZIJA 3ZIJA 1G6WA 3SBCA 3UARA 4QL9A 5G30A 2MYGA 2VCQA 6GSTA 2I3YA 5ABRA 3TKSE 2WB9A 2GSQA 2GZZA 4O7HA 2QKEA 5G1LA 1FOHA 1T4ZA 1O6JA 2R0GA 6GSVA 2OACA 4JR4A 1K3LA 1U3IA 1SJZA 4WKWA 5EVOA 3D21A 1YEPA 2G2QA 1NHOA 1GLPA 5IM9A 1N2AA 2NBSA 1K0CA 3IAM2 5GSSA 2FWEA 12GSA 4O5QA 2O8VB 2A2PA 4ICYA 2YOIA 1XBSA 4MZWA 4NHZA 2EIRA 3BBYA 1EOGA 1WWJA 3H4KA 19GSA 3L78A 4PUAA 1M2BA 1R26A 1K0DA 3M9KA 1KBNA 1DUGA 3FEUA 4K7NA 4MJBA 1JLVA 4EF0A 3WGEA 1S3RA 1TW9A 1VF2A 1NSWA 4D73B 4JR6A 2YP6A 2VCWA 5HR0A 3ZIVA 2H70A 3CSHA 1K0MA 1GSUA 2B3SA 5A5KA 1BG5A 3F9UA 3UJ1A 2H6ZA 2HYXA 1J9BA 4TR1A 1B4PA 3MDKA 1SYRA 5A4WA 4NXIA 3LXTA 1SK2A 3IC4A 4I5QA 2H73A 5C04A 1G0TA 3DRNA 1ML6A 4TR4A 4KF9A 3H79A 1R5PA 3CRUA 5D9WA 2FD3A 1GUMA 2HRNA 1M99A 3ZL5A 2H19A 4EDYA 2HLSA 1NW2A 1YJ6A 4PQHA 2ON5A 2GT5A 1T4YA 1WJKA 4YH2A 2HRKA 1SKRB 2YJHA 4N10A 4DSRA 2N5FA 4F0BA 1XG8A 3L9SA 3UBLA 4IW9A 2YZUA 5GAND 1I9DA 2LJAA 3VI5A 4IQAA 4JEDA 3V1WA 3VWWA 5GAPD 3HCZA 2HT9A 3D6IA 2NPBA 1Z5YE 5G1KA 2KUCA 3LGCA 6GSUA 1ST9A 3CTFA 1OC3A 1S3CA 3CSIA 1ERVA 4LA1A 5JCGA 4L5LA 2VM2A 4FO5A 4ACSA 2A4VA 5LD0A 1WMJA 1JZRA 1A0FA 3GA4A 5ECIB 5IMFA 2AYTA 4LMVA 4Z2RA 2H01A 4KCEA 3LXZA 1ERWA 2H0HA 2YANA 4XS4A 2I9HA 1B8XA 1TXXA 1A0RP 1XWAA 4MDCA 16GSA 3GH9A 5KN1A 2B1LA 1EP7A 2B7KA 1K3OA 4BA7A 1OC9B 2LRTA 1V2AA 1PMTA 2BTOT 5E4WA 5D73A 3A2WA 3FKFA 2YWMA 3A5WA 5J41A 2HNLA 4XHMA 1A8YA 2OADA 1SYXA 5J9BA 5L71A 4J57E 1AXDA 4WBJA 3UMAA 2H66A 2X64A 3TJJA 3APQA 4BWQA 3EC3A 4MH2A 2HSYA 5HR1A 4AJ6A 2YWOA 2L4QA 2FGXA 2CAIA 2MMOA 2FHEA 3KMOA 1AC1A 1GTAA 3FR9A 2PU9C 4KDUA 2CVBA 1CQHA 3PGTA 2C0FA 5ID2B 3ZTLA 2VCTA 5KEJA 1R5AA 3KH7A 2H1BA 1Q4JA 2JSZA 4AF2A 1RW1A 2LJRA 3KP9A 2K8SA 1LU4A 2YV9A 3IRAA 2QGVA 3IE3A 1TRVA 1K0BA 1X0RA 2C4JA 3HJOA 3GIXA 1Z3EA 2AV4A 4ZXGA 5DQSA 1GSQA 2BMXA 1WOUA 2IMDA 3QCPA 5H5RA 5JCUA 1M0UA 3WGXA 4KH7A 4EO3A 2FWHA 3A2VA 5ECOB 4HQSA 5FHIA 3F6FA 2LRNA 5G5EA 1EV9A 3ERFA 4PTSA 3EU4A 1G7EA 3CXGA 3TUEA 1TTZA 1ZYQB 3F4SA 3RHBA 3GUSA 2L5OA 4EXJA 3IOSA 1GTUA 1FHEA 4G2EA 1HNAA 4EVMA 1GSDA 1XIYA 4IELA 5CRWA 3LEFA 4Q5QA 5IPGA 5J3RA 2GQLA 1GRXA 1QGVA 4DSSB 3HZ4A 1GULA 4PNFA 3I9V2 4MF5A 4KGIA 1AAZA 2PVOC 2IN3A 3CMIA 3H93A 2LV3A 3M3MA 1FO5A 1PQNA 4CW9A 1OKDA 2A2RA 5A4UA 2H76A 3NOFA 3LORA 1VRSD 3PR8A 4RI6A 2LSTA 4ZBDA 3I6AA 1K0NA 4BVXB 9GSSA 2DMMA 3Q74A 4GLTA 3I69A 2CVKA 2C0GA 2C8UA 1PN9A 1X5CA 3DMLA 3LW9A 18GSA 2DJKA 1TP9A 2DC5A 4HSCX 3PPUA 5DVBA 3GKXA 2EIQA 2RUEA 2X4AA 3ZMKA 3KGKA 5D93A 3TKPA 5IIZA 4K2XA 3W8JA 4PNGA 5LNKe 2EC4A 4K8MA 2P5RA 3ERWA 5DQYA 3VI7A 3F3RA 4N0VA 4TR1B 2MZCA 1K0AA 4BPYA 5DBQA 2JZSA 1A23A 3GRXA 3TOUA 2F51A 2WZ9A 2F8AA 4ZBBA 3KH9A 4IS0A 2C80A 5G31A 5COHA 2VO4A 1WP0A 3GHAA 1OC9A 5INYA 4LL4B 3KP8A 4PX1A 2VM1A 1IYHA 1O7UA 5HFIA 1K3YA 3ED3A 2RIIA 1BYEA 4L0WA 2ZCTA 5BRTA 4L0UA 2JSYA 4Q5FA 2NDOA 4Q5NA 2R0CA 4EKZA 3N5OA 4GSNA 3FZ4A 2PGTA 1MDIA 4K5SA 3KJYA 2H72A 2X8HA 2CA8A 2FWGA 2MMNA 4KDYA 4NMUA 3W6GA 4XRAA 5ID2A 5E59A 1MD4A 1A2JA 3QFBC 2E2MA 1PSQA 1GTIA 4GWRA 5AN1A 3CQFA 2YZHA 3HY2A 3N9JA 2FLSA 1X9MB 3F63A 3A5IA 1ZYPA 2AJQB 3FZ5A 2KOKA 5CNWA 3TKQA 2C1YA 1SK0A 2M72A 3F8UA 1TI1A 4KAEA 4FQUA 1I5GA 4TXOB 3EPTA 3VK9A 3QD9A 1FW1A 1GH2A 3GN3A 5JWOB 4P3YB 4AGSA 5KN0A 3ZLPA 1ZYNA 1X5DA 4X1UA 2I81A 2I1UA 3ME8A 1N8JA 3DGQA 4IJIA 1X9SB 2KP2A 14GSA 2ALBA 4F9ZA 1JHBA 3AY8A 1GWCA 1XZOA 3VLNA 1XWCA 2V32A 3LSZA 1GTBA 3FR6A 4V2MA 3IHQA 3QOUA 4DVCA 5CRGA 2TRCP 3KZQA 3G9BA 2P5QA 3FYGA 1PKZA 3TJKA 4POLA 4DSSA 4GSTA 1E2YA 2PMTA 4RUVA 2VUPA 1U3AA 1V58A 5CYYA 2LKUA 4ZB8A 4NPBA 5F0GA 2VLUA 4HEA2 3BD2A 1J08A 1H75A 4I97A 2H6XA 1MEKA 5IMCA 2RM6A 2JU5A 4I6XA 3DKSA 4BVXA 2YCDA 5F07A 1ZMAA 1YKCA 3D4TA 2L5LA 4OWYA 3C7MA 1M9BA 3TJBA 1SL2B 3FRCA 5KOXA 1S3DA 4BVYB 1OAZA 3IAS2 2XHFA 1FB0A 2J23A 4IJ3A 1SKSB 4WBRD 2HSMA 4QL7A 4YQMA 2DLXA 2QC7A 2R37A 4WXTA 2KP1A 4GCIA 3C73A 4EIQA 5J9CA 2GGTA 1OE8A 3TRXA 4K5RA 5KN2A 2F8FA 4IBPA 3O3TA 4K7OA 4PGTA 1DBYA 1XW9A 2VL3A 1OVNA 1QXHA 4NWYA 1XXUA 3QPMA 4KCAA 3IR4A 3DIEA 4HS1A 1NHYA 1EWXA 3UEMA 4QQ7A 4WR4A 17GSA 3APOA 3W8SA 4O92A 4LLRA 2NVLA 4RQRA 4X43A 4CHSA 2CZ2A 1BEDA 4DEJA 1U88A 1F3AA 2L59A 4OO5A 3GMFA 4WR5A 3OR5A 1E6BA 3ZFBA 4K0GA 3HJMA 2WDUA 1M2AA 2CX3A 2KLXA 5HFKA 1YF0A 3EE2A 4BL7A 4J56E 3RDWA 3VWUA 4LL1B 1YEXA 1FOVA 4USSA 3HVSA 1BAYA 2E2GA 5ECMB 3HDCA 2RUFA 2JZTA 1K0OA 4MMMA 1B9YC 5ECKB 1W4VA 1XWBA 4O32A 1T00A 3QAVA 2PWJA 1HD2A 2VCVA 1XPVA 2HRFA 4J2FA 3CSJA 4FYUA 1JZWA 2A4HA 1YF1A 3C8EA 2B7JA 4POMA 4MJCA 1SL0B 4OFTA 4MNNA 2C3NA 3QAWA 4ULXA 4F03A 3TOTA 2YPMA 3C1SA 4A5PA 2X8GA 3QFAC 3FY7A 2HXKA 1O85A 4IHUA 4TXOA 1FVJA 3PINA 5B6NA 1SD8A 5KN3A 2DKIA 2MBTA 3A2XA 1VF4A 1HNBA 5AGYA 1QFNA 3ZRDA 3DD3A 3UVTA 1OYJA 2O7KA 2YJ7A 1M9AA 4GQFA 2V1MA 1DSBA 2O87A 1F3BA 11GSA 3L0HA 2VL9A 3KM6A 2VAFA 1ZL9A 1AQXA 5DDLA 3GTUB 2LUSA 5F06A 3KTBA 2DMLA 4YKGA 2IWTA 3DXBA 2VLVA 2H6YA 1F9MA 1WE0A 5GZZB 2GS3A 3TKSC 2MMZA 3F4TA 3M0FA 1B4QA 1O81A 4MCUA 3VWVA 1ZYEA 2CVDA 3QMXA 3U5RE 1T1VA 2VOCA 4FH8A 4EL1A 3IBHA 1JZDA 2GQMA 3KEBA 2R6KA 4WEYA 1FVKA 3SWLA 2J9HA 2OE1A 1UN2A 1CQGA 2VLTA 5J4UA 3ME7A 4F82A 4CY8A 4ZL9A 2H8LA 2CV4A 5J5NA 2OA7A 5IO2A 2GZYA 1F2EA 3UIWA 1XOBA 5IO0A 1QK8A 5DALB 5CO3A 5KOWA 1SK1A 3VPQA 3F6DA 3RPPA 4BVYA 3E3EA 2AHEA 2AAWA 4HUAA 1TRSA 4MZCA 4HZ2A 3HD5A 2F3MA 4CY6A 3CBUA 5DCHA 4MJAA 2FUG2 4JRRA 1PD21 1X9WB 1RQMA 2H75A 4V1Ap 1MD3A 2IL3A 3R2QA 1PGTA 3ZFLA 4K6XA 3FMWA 5ECNB 1T8EB 3TKSA 2O89A 4NAXA 3UVHA 2LS5A 5IOWA 4BIKA 1HYUA 3ERGA 1XWKA 5ECLB 3R3EA 4TVEA 5JCWA 2VIMA 5IMZA 4YAVA 4E8HA 3U6VA 2H0GA 2RLIA 4N11A 2DJ3A 2VL2C 2XC2A 4GQCA 2LNTA 3TRPA 2WS2A 5EY6A 1THOA 3ZITA 4GRFA 4Z7XA 2GDRA 3ZVJA 1TU7A 3EINA 1PKWA 2LQQA 5ECSA 2OJLA 3HYPA 3NZNA 2QSIA 2OE0A 3LYPA 3FHKA 4FIWA 5AISA 3D22A 3E0UA 1ZZYA 1J0FA 3ISOA 2VD1A 2XBQA 4F0CA 3P8WA 6GSXA 2CAQA 1UA5A 1XVWA 4JBBA 4HJ2A 1XVQA 4JE1A 3TCOA 3LYKA 4WETA 1A2MA 2X99A 2EIOA 2GSRA 2YV7A 4TXVA 2V6KA 2XBIA 4MF7A 4XCSA 2L6CA 2ON7A 1G7OA 4CDOA 2IMEA 4YQVA 2HZEB 3C1RA 2FA8A 1B48A 3NIVA 3VPTA 3PH9A 4JZQA 4X4JA 5ELAA 2LEGA 2H1AA 4K1FA 5LCZA 2L57A 3HVVA 4HZ4A 3HVNA 3MNGA 2C0EA 4I8BA 2C3TA 3I43A 1MDJA 3IXRA 4L5OA 5IQYA 3CTGA 1U87A 4ISDA 5ECPB 2B5YA 4BL7B 4MK3A 2K6VA 1M3IA 4BWSA 5IOXA 1XW6A 4GXZA 1SL1B 2DBCA 2WJUA 3IK7A 4IN0A 3MWHA 3TJFA 3GYKA 3GTUA 4ECCA 2HRAA 5D9XA 3DWVA 1ERUA 1GSEA 3EVIA 4MF6A 3TRQA 3UL3A 3IHGA 2GZPA 20GSA 4ID0A 2K18A 1KNGA 5HR2A 1XW5A 3L9UA 5DAKB 3J7Yk 4MABA 1SU9A 4JU5A 2HE3A 4HDEA 4KNDA 5ECRB 4RQXA 3EURA 4ML1A 5HR3A 4ECJA 1F37A 3ZZXA 3GSSA 2V41A 1GSSA 4ZL7A 4Z2UA 3KXOA 4I2TA 1PL1A 6GSSA 4G0LA 2P31A 3E9JB 4YQUA 1EOHA 1WPIA 5DALA 4HJMA 2LQOA 3GURA 2OBIA 4MPFA 1W89A 4GTUA 4MH3A 2C0DA 1KTEA 4PURA 2LNSA 5F8BA 3Q19A 3TJGA 1UVZA 2DJ0A 1QUWA 3MYDA 4IP6A 4ECBA 1EP8A 1YQ1A 1WRYA 2AUVA 2B6MA 1FB6A 4IKHA 1TK5B 2B5EA 2R5GA 3HA9A 4AJ8A 5A4VA 4EE0A 4K2DA 1MDKA 3EMPA 1JFUA 1FG4A 1SKWB 3GL5A 3RBTA 2DJ2A 3DYRA 1O8XA 1O73A 4GF0A 4XS6A 3RHCA 4PQIA 1TOFA 2L6DA 2CX4A 3A3TA 1UC7A 1SJ6A 1R7HA 2GT6A 3DEXA 2DKHA 3IV4A 1Z7RA 2WRTA 1BJXA 2GVPA 2YWIA 2YWNA 1TJDA 1XOAA 4Q5RA 1BQ7A 3GX0A 3K8NA 3UAPA 1YZXA 7GSSA 1V9WA 3O76A 5CP1A 4KE3A 1OE7A 1M2DA 3ZMLA 1C72A 4MPGA 1AQVA 1DE1A 4PQ1A 2ZNMA 1YKAA 1SJIA 1QQ2A 3KCMA 2H1DA 5ELGA 4TR3A 3MSZA 3BCIA 2CT6A 1PRXA 1EZKA 2JZRA 2HZEA 4X0XA 1GLQA 2PVQA 4ZB9A 2D2ZA 1PX6A 2HI7A 4XTSA 4TN8A 5D9TA 1VGLA 2M46A 3DVXA 2JACA 4KUNA 3HXSA 3QR6A 2H1GA 4H86A 4XRDA 5H5SA 5IPHA 2YN1A 3HJPA 2R2JA 2TRXA 1V40A 4K0NA 1Z6NA 3KIJA 4AJ7A 1GNEA 1Y25A 5IMDA 4EIPA 4I2UA 2F9SA 3H8QA 4RI7A 2B1KA 1ZOFA 13GSA 1VF1A 1GSYA 3GX8A 3IPZA 1A8LA 1GL8A 4EUYA 4NHWA 3GKNA 4HOJA 1F6MC 1USBA 4K9ZA 1IYIA 1PX7A 6GSYA 2JL4A 1ON4A 4FYCA 1MTCA 2PUKC 5IMAA
chains in the Genus database with same CATH topology
1V57A 3P2AA 2HZFA 1DE2A 2DSAA 2IPAA 4MZBA 3WGDA 4G0KA 3BJ5A 3US3A 3Q18A 4ML6A 4ZL8A 5ECQB 5F05A 4O5RA 2IMIA 4E8EA 4OFMA 2P0GA 3WYWA 1EGOA 4ILFA 2E7PA 4IP1A 5DAKA 4MA9A 3G7IA 3FW2A 2ES7A 3JCML 1Q98A 5AIXA 4PUFC 5DCGA 3TDGA 3QAGA 2R3XA 2IIYA 5CRDA 5B7CA 3FR3A 4YKFA 2PERA 1WIKA 4KB3A 5G5FA 3CYNA 1EGRA 3GKMA 3ZYWA 1XCCA 3F0IA 3G7JA 3VWXA 3HZ8A 3FZ9A 2KHPA 1R4WA 4MLYA 2WULA 3IC8A 1T3BA 2LTKA 5D96A 4DSQA 1TDIA 3WT2A 2R0PA 1AW9A 5CRHA 5FWGA 4ZB6A 1Z9HA 1T7PB 4OFNA 2MMAA 4KSMA 4KSOA 3D5JA 2V6OA 1M7TA 4Z2TA 4G19A 3FK8A 2WCIA 2UZ8A 4K7IA 3C71A 1AQWA 4IVFA 3VURA 4EC0A 2GQKA 1NM3A 2CZ3A 1EEMA 1YDKA 4KX4A 1SENA 1THXA 3RAZA 1URMA 5B8AA 1EEJA 4TW5A 5GSTA 2WGRA 2PBJA 4FYBA 2E0QA 5ECHB 3CRTA 5JWRB 1ERTA 2VD0A 2GSSA 4ECIA 2N5BA 1V98A 3HKRA 1ZGNA 2IFQB 4YAPA 4G9HA 1JLWA 1B9XC 3P7XA 1YY7A 2LRCA 2I4AA 10GSA 1TRUA 1TKDB 4TKYA 4D73A 2OBKA 4HI7A 4EDZA 4TOPA 5BMUA 4POKA 1OC8A 1AIUA 4V2NA 5B8BA 1OKTA 5AIVA 1XWGA 2WFCA 2QA2A 5HQPA 4ZBAA 2PPTA 1HQOA 3J7Yb 3KD0A 3G7YA 3IDVA 1ABAA 2H74A 4LMWA 4TRXA 5DJMA 2L4CA 5DJLA 2IMFA 3WT1A 3GL3A 4HU9A 3DVWA 2LJKA 2OE3A 3F3QA 5CAXA 3LG6A 4MP4A 3FZAA 3BOAA 2HSHA 1Y6EA 2FWFA 4ZILA 3D0ZA 3GNJA 1ILOA 2H71A 3TGZA 5EL8A 3ZREA 2PN8A 4POBA 2N5AA 4WF4A 2JADA 2RM5A 5D9VA 4G10A 2A2SA 3H1NA 2X8CA 5B6MA 1XFLA 4GSSA 3O6TA 1JZOA 4HQZA 2K9FA 2B5XA 2QA1A 1GSFA 4XIHA 2FA4A 1EV4A 3L4NA 3MIXA 3KTLA 1GP1A 1LJRA 5IMVA 4O5UA 4V1Ag 4KDXA 2REMA 5FT3A 1GUKA 5D8IA 2VCXA 3LWAA 4V2LA 3LFLA 1TRWA 3P90A 5H5QA 3RPNA 2IMKA 3D4MA 4NV5A 3MAKA 2K8VA 2GTUA 2DJ1A 2VL2A 3TB2A 3GKKA 2DIYA 4KA0A 5C00A 2DJJA 2O85A 4NV2A 1X5EA 1LBKA 4OD7A 5HFGA 3TKRA 1Z7PA 2FCHA 1A2LA 2XPEA 3GSTA 2R4VA 5EPFA 2YNXA 3Q6OA 1ACVA 2XPDA 3HHVA 6GSWA 3GV1A 3VFIA 3EMXA 3EU3A 4N0ZA 1HNCA 4OCEA 1ZCPA 4OMVA 3UOMA 1RK4A 3KMNA 22GSA 1GNWA 3UBKA 4TR0A 2GSTA 3GH6A 4PXOA 2X49A 3S9FA 3GFKA 1SD9A 4F2IA 1AUCA 5G2ZA 1TK8B 3L9VA 1FAAA 5ENUA 3WD6A 2IJYA 3QDNA 3EYTA 8GSSA 3M1GA 1PL2A 3F4RA 2H0IA 1PA3A 1A24A 3APSA 3EWLA 3IA1A 5JWQB 1TU8A 2H30A 1O8WA 1BX9A 2OKAA 4XS4B 2V2GA 1TI3A 2AB6A 1VF3A 4N30A 1PN0A 2G0FA 4OCFA 2NTOA 4IQ1A 2FNOA 3ZVJD 4XS1A 1TK0B 2MBSA 2FY6A 3M9JA 4KW6A 2Z9SA 3LQ7A 2VCZA 2HFDA 5CREA 1H4OA 2BJXA 3M8NA 4G0IA 1U6TA 2C3QA 4HU7A 1S3AA 1G6YA 3BCKA 1Z6MA 3HVXA 4IGJA 4L8EA 4MJEA 2IFQA 1QMVA 2DIZA 1GUHA 4OO4A 2M80A 2CQ9A 1KEBA 2GLRA 3LJRA 2TIRA 3IK9A 2ZUPA 4WF5A 4ZIJA 3ZIJA 1G6WA 3SBCA 3UARA 4QL9A 5G30A 2MYGA 2VCQA 6GSTA 2I3YA 5ABRA 3TKSE 2WB9A 2GSQA 2GZZA 4O7HA 2QKEA 5G1LA 1FOHA 1T4ZA 1O6JA 2R0GA 6GSVA 2OACA 4JR4A 1K3LA 1U3IA 1SJZA 4WKWA 5EVOA 3D21A 1YEPA 2G2QA 1NHOA 1GLPA 5IM9A 1N2AA 2NBSA 1K0CA 3IAM2 5GSSA 2FWEA 12GSA 4O5QA 2O8VB 2A2PA 4ICYA 2YOIA 1XBSA 4MZWA 4NHZA 2EIRA 3BBYA 1EOGA 1WWJA 3H4KA 19GSA 3L78A 4PUAA 1M2BA 1R26A 1K0DA 3M9KA 1KBNA 1DUGA 3FEUA 4K7NA 4MJBA 1JLVA 4EF0A 3WGEA 1TW9A 1VF2A 1NSWA 4D73B 4JR6A 2YP6A 2VCWA 5HR0A 3ZIVA 2H70A 3CSHA 1K0MA 1GSUA 2B3SA 5A5KA 1BG5A 3F9UA 3UJ1A 2H6ZA 2HYXA 1J9BA 4TR1A 1B4PA 3MDKA 1SYRA 5A4WA 4NXIA 3LXTA 1SK2A 3IC4A 4I5QA 2H73A 5C04A 1G0TA 3DRNA 1ML6A 4TR4A 4KF9A 3H79A 1R5PA 3CRUA 5D9WA 2FD3A 1GUMA 2HRNA 1M99A 3ZL5A 2H19A 4EDYA 2HLSA 1NW2A 1YJ6A 4PQHA 2ON5A 2GT5A 1T4YA 1WJKA 4YH2A 2HRKA 1SKRB 2YJHA 4N10A 4DSRA 2N5FA 4F0BA 3L9SA 3UBLA 4IW9A 2YZUA 5GAND 1I9DA 2LJAA 3VI5A 4IQAA 4JEDA 3V1WA 3VWWA 5GAPD 3HCZA 2HT9A 3D6IA 2NPBA 1Z5YE 5G1KA 2KUCA 3LGCA 6GSUA 1ST9A 3CTFA 1OC3A 1S3CA 3CSIA 1ERVA 4LA1A 5JCGA 4L5LA 2VM2A 4FO5A 4ACSA 2A4VA 5LD0A 1WMJA 1JZRA 1A0FA 3GA4A 5ECIB 5IMFA 2AYTA 4LMVA 4Z2RA 2H01A 4KCEA 3LXZA 1ERWA 2H0HA 2YANA 4XS4A 2I9HA 1B8XA 1TXXA 1A0RP 1XWAA 4MDCA 16GSA 3GH9A 5KN1A 2B1LA 1EP7A 2B7KA 1K3OA 4BA7A 1OC9B 2LRTA 1V2AA 1PMTA 2BTOT 5E4WA 5D73A 3A2WA 3FKFA 2YWMA 3A5WA 5J41A 2HNLA 4XHMA 1A8YA 2OADA 1SYXA 5J9BA 5L71A 4J57E 1AXDA 4WBJA 3UMAA 2H66A 2X64A 3TJJA 3APQA 4BWQA 3EC3A 4MH2A 2HSYA 5HR1A 4AJ6A 2YWOA 2L4QA 2FGXA 2CAIA 2MMOA 2FHEA 3KMOA 1AC1A 1GTAA 3FR9A 2PU9C 4KDUA 2CVBA 1CQHA 3PGTA 2C0FA 5ID2B 3ZTLA 2VCTA 5KEJA 1R5AA 3KH7A 2H1BA 1Q4JA 2JSZA 4AF2A 1RW1A 2LJRA 3KP9A 2K8SA 1LU4A 2YV9A 3IRAA 2QGVA 3IE3A 1TRVA 1K0BA 1X0RA 2C4JA 3HJOA 3GIXA 1Z3EA 2AV4A 4ZXGA 5DQSA 1GSQA 2BMXA 1WOUA 2IMDA 3QCPA 5H5RA 5JCUA 1M0UA 3WGXA 4KH7A 4EO3A 2FWHA 3A2VA 5ECOB 4HQSA 5FHIA 3F6FA 2LRNA 5G5EA 1EV9A 3ERFA 4PTSA 3EU4A 1G7EA 3CXGA 3TUEA 1TTZA 1ZYQB 3F4SA 3RHBA 3GUSA 2L5OA 4EXJA 3IOSA 1GTUA 1FHEA 4G2EA 1HNAA 4EVMA 1GSDA 1XIYA 4IELA 5CRWA 3LEFA 4Q5QA 5IPGA 5J3RA 2GQLA 1GRXA 1QGVA 4DSSB 3HZ4A 1GULA 4PNFA 3I9V2 4MF5A 4KGIA 1AAZA 2PVOC 2IN3A 3CMIA 3H93A 2LV3A 3M3MA 1FO5A 1PQNA 4CW9A 1OKDA 2A2RA 5A4UA 2H76A 3NOFA 3LORA 1VRSD 3PR8A 4RI6A 2LSTA 4ZBDA 3I6AA 1K0NA 4BVXB 9GSSA 2DMMA 3Q74A 4GLTA 3I69A 2CVKA 2C0GA 2C8UA 1PN9A 1X5CA 3DMLA 3LW9A 18GSA 2DJKA 1TP9A 2DC5A 3PPUA 5DVBA 3GKXA 2EIQA 2RUEA 2X4AA 3ZMKA 3KGKA 5D93A 3TKPA 5IIZA 4K2XA 3W8JA 4PNGA 5LNKe 2EC4A 4K8MA 2P5RA 3ERWA 5DQYA 3VI7A 3F3RA 4N0VA 4TR1B 2MZCA 1K0AA 4BPYA 5DBQA 2JZSA 1A23A 3GRXA 3TOUA 2F51A 2WZ9A 2F8AA 4ZBBA 3KH9A 4IS0A 2C80A 5G31A 5COHA 2VO4A 1WP0A 3GHAA 1OC9A 5INYA 4LL4B 3KP8A 4PX1A 2VM1A 1IYHA 1O7UA 5HFIA 1K3YA 3ED3A 2RIIA 1BYEA 4L0WA 2ZCTA 5BRTA 4L0UA 2JSYA 4Q5FA 2NDOA 4Q5NA 2R0CA 4EKZA 3N5OA 4GSNA 3FZ4A 2PGTA 1MDIA 4K5SA 3KJYA 2H72A 2X8HA 2CA8A 2FWGA 2MMNA 4KDYA 4NMUA 3W6GA 4XRAA 5ID2A 5E59A 1MD4A 1A2JA 3QFBC 2E2MA 1PSQA 1GTIA 4GWRA 5AN1A 2YZHA 3HY2A 3N9JA 2FLSA 1X9MB 3F63A 3A5IA 1ZYPA 2AJQB 3FZ5A 2KOKA 5CNWA 3TKQA 2C1YA 1SK0A 2M72A 3F8UA 1TI1A 4KAEA 4FQUA 1I5GA 4TXOB 3EPTA 3VK9A 3QD9A 1FW1A 1GH2A 3GN3A 5JWOB 4P3YB 4AGSA 5KN0A 3ZLPA 1ZYNA 1X5DA 4X1UA 2I81A 2I1UA 3ME8A 1N8JA 3DGQA 4IJIA 1X9SB 2KP2A 14GSA 2ALBA 4F9ZA 1JHBA 3AY8A 1GWCA 1XZOA 3VLNA 1XWCA 2V32A 3LSZA 1GTBA 3FR6A 4V2MA 3IHQA 3QOUA 4DVCA 5CRGA 2TRCP 3KZQA 3G9BA 2P5QA 3FYGA 1PKZA 3TJKA 4POLA 4DSSA 4GSTA 1E2YA 2PMTA 4RUVA 2VUPA 1U3AA 1V58A 5CYYA 2LKUA 4ZB8A 4NPBA 5F0GA 2VLUA 4HEA2 3BD2A 1J08A 1H75A 4I97A 2H6XA 1MEKA 5IMCA 2RM6A 2JU5A 4I6XA 3DKSA 4BVXA 2YCDA 5F07A 1ZMAA 1YKCA 3D4TA 2L5LA 4OWYA 3C7MA 1M9BA 3TJBA 1SL2B 3FRCA 5KOXA 1S3DA 4BVYB 1OAZA 3IAS2 2XHFA 1FB0A 2J23A 4IJ3A 1SKSB 4WBRD 2HSMA 4QL7A 4YQMA 2DLXA 2QC7A 2R37A 4WXTA 2KP1A 4GCIA 3C73A 4EIQA 5J9CA 2GGTA 1OE8A 3TRXA 4K5RA 5KN2A 2F8FA 4IBPA 3O3TA 4K7OA 4PGTA 1DBYA 1XW9A 2VL3A 1OVNA 1QXHA 4NWYA 1XXUA 3QPMA 4KCAA 3IR4A 3DIEA 4HS1A 1NHYA 1EWXA 3UEMA 4QQ7A 4WR4A 17GSA 3APOA 3W8SA 4O92A 4LLRA 2NVLA 4RQRA 4X43A 4CHSA 2CZ2A 1BEDA 4DEJA 1U88A 1F3AA 2L59A 4OO5A 3GMFA 4WR5A 3OR5A 1E6BA 3ZFBA 4K0GA 3HJMA 2WDUA 1M2AA 2CX3A 2KLXA 5HFKA 1YF0A 3EE2A 4BL7A 4J56E 3RDWA 3VWUA 4LL1B 1YEXA 1FOVA 4USSA 3HVSA 1BAYA 2E2GA 5ECMB 3HDCA 2RUFA 2JZTA 1K0OA 4MMMA 1B9YC 5ECKB 1W4VA 1XWBA 4O32A 1T00A 3QAVA 2PWJA 1HD2A 2VCVA 1XPVA 2HRFA 4J2FA 3CSJA 4FYUA 1JZWA 2A4HA 1YF1A 3C8EA 2B7JA 4POMA 4MJCA 1SL0B 4OFTA 4MNNA 2C3NA 3QAWA 4ULXA 4F03A 3TOTA 2YPMA 3C1SA 4A5PA 2X8GA 3QFAC 3FY7A 2HXKA 1O85A 4IHUA 4TXOA 1FVJA 3PINA 5B6NA 1SD8A 5KN3A 2DKIA 2MBTA 3A2XA 1VF4A 1HNBA 5AGYA 1QFNA 3ZRDA 3DD3A 3UVTA 1OYJA 2O7KA 2YJ7A 1M9AA 4GQFA 2V1MA 1DSBA 2O87A 1F3BA 11GSA 3L0HA 2VL9A 3KM6A 2VAFA 1ZL9A 1AQXA 5DDLA 3GTUB 2LUSA 5F06A 3KTBA 2DMLA 4YKGA 2IWTA 3DXBA 2VLVA 2H6YA 1F9MA 1WE0A 5GZZB 2GS3A 3TKSC 2MMZA 3F4TA 3M0FA 1B4QA 1O81A 4MCUA 3VWVA 1ZYEA 2CVDA 3QMXA 3U5RE 1T1VA 2VOCA 4FH8A 4EL1A 3IBHA 1JZDA 2GQMA 3KEBA 2R6KA 4WEYA 1FVKA 3SWLA 2J9HA 2OE1A 1UN2A 1CQGA 2VLTA 5J4UA 3ME7A 4F82A 4CY8A 4ZL9A 2H8LA 2CV4A 5J5NA 2OA7A 5IO2A 2GZYA 1F2EA 3UIWA 1XOBA 5IO0A 1QK8A 5DALB 5CO3A 5KOWA 1SK1A 3VPQA 3F6DA 3RPPA 4BVYA 3E3EA 2AHEA 2AAWA 4HUAA 1TRSA 4MZCA 4HZ2A 3HD5A 2F3MA 4CY6A 3CBUA 5DCHA 4MJAA 2FUG2 4JRRA 1PD21 1X9WB 1RQMA 2H75A 4V1Ap 1MD3A 2IL3A 3R2QA 1PGTA 3ZFLA 4K6XA 3FMWA 5ECNB 1T8EB 3TKSA 2O89A 4NAXA 3UVHA 2LS5A 5IOWA 1HYUA 3ERGA 1XWKA 5ECLB 3R3EA 4TVEA 5JCWA 2VIMA 5IMZA 4YAVA 4E8HA 3U6VA 2H0GA 2RLIA 4N11A 2DJ3A 2VL2C 2XC2A 4GQCA 2LNTA 3TRPA 2WS2A 5EY6A 1THOA 3ZITA 4GRFA 4Z7XA 2GDRA 3ZVJA 1TU7A 3EINA 1PKWA 2LQQA 5ECSA 2OJLA 3HYPA 3NZNA 2QSIA 2OE0A 3LYPA 3FHKA 4FIWA 5AISA 3D22A 3E0UA 1ZZYA 1J0FA 3ISOA 2VD1A 2XBQA 4F0CA 3P8WA 6GSXA 2CAQA 1UA5A 1XVWA 4JBBA 4HJ2A 1XVQA 4JE1A 3TCOA 3LYKA 4WETA 1A2MA 2X99A 2EIOA 2GSRA 2YV7A 4TXVA 2V6KA 2XBIA 4MF7A 4XCSA 2L6CA 2ON7A 1G7OA 4CDOA 2IMEA 4YQVA 2HZEB 3C1RA 2FA8A 1B48A 3NIVA 3VPTA 3PH9A 4JZQA 4X4JA 5ELAA 2LEGA 2H1AA 4K1FA 5LCZA 2L57A 3HVVA 4HZ4A 3MNGA 2C0EA 4I8BA 2C3TA 3I43A 1MDJA 3IXRA 4L5OA 5IQYA 3CTGA 1U87A 4ISDA 5ECPB 2B5YA 4BL7B 4MK3A 2K6VA 4BWSA 5IOXA 1XW6A 4GXZA 1SL1B 2DBCA 2WJUA 3IK7A 4IN0A 3MWHA 3TJFA 3GYKA 3GTUA 4ECCA 2HRAA 5D9XA 3DWVA 1ERUA 1GSEA 3EVIA 4MF6A 3TRQA 3UL3A 3IHGA 2GZPA 20GSA 4ID0A 2K18A 1KNGA 5HR2A 1XW5A 3L9UA 5DAKB 3J7Yk 4MABA 1SU9A 4JU5A 2HE3A 4HDEA 4KNDA 5ECRB 4RQXA 3EURA 4ML1A 5HR3A 4ECJA 1F37A 3ZZXA 3GSSA 2V41A 1GSSA 4ZL7A 4Z2UA 3KXOA 4I2TA 1PL1A 6GSSA 4G0LA 2P31A 3E9JB 4YQUA 1EOHA 1WPIA 5DALA 4HJMA 2LQOA 3GURA 2OBIA 4MPFA 1W89A 4GTUA 4MH3A 2C0DA 1KTEA 4PURA 2LNSA 5F8BA 3Q19A 3TJGA 1UVZA 2DJ0A 1QUWA 3MYDA 4IP6A 4ECBA 1EP8A 1YQ1A 1WRYA 2AUVA 2B6MA 1FB6A 4IKHA 1TK5B 2B5EA 2R5GA 3HA9A 4AJ8A 5A4VA 4EE0A 4K2DA 1MDKA 3EMPA 1JFUA 1FG4A 1SKWB 3GL5A 3RBTA 2DJ2A 3DYRA 1O8XA 1O73A 4GF0A 4XS6A 3RHCA 4PQIA 1TOFA 2L6DA 2CX4A 3A3TA 1UC7A 1SJ6A 1R7HA 2GT6A 3DEXA 2DKHA 3IV4A 1Z7RA 2WRTA 1BJXA 2GVPA 2YWIA 2YWNA 1TJDA 1XOAA 4Q5RA 1BQ7A 3GX0A 3K8NA 3UAPA 1YZXA 7GSSA 1V9WA 3O76A 5CP1A 4KE3A 1OE7A 1M2DA 3ZMLA 1C72A 4MPGA 1AQVA 1DE1A 4PQ1A 2ZNMA 1YKAA 1SJIA 1QQ2A 3KCMA 2H1DA 5ELGA 4TR3A 3MSZA 3BCIA 2CT6A 1PRXA 1EZKA 2JZRA 2HZEA 4X0XA 1GLQA 2PVQA 4ZB9A 2D2ZA 1PX6A 2HI7A 4XTSA 4TN8A 5D9TA 1VGLA 2M46A 3DVXA 2JACA 4KUNA 3HXSA 3QR6A 2H1GA 4H86A 4XRDA 5H5SA 5IPHA 2YN1A 3HJPA 2R2JA 2TRXA 1V40A 4K0NA 1Z6NA 3KIJA 4AJ7A 1GNEA 1Y25A 5IMDA 4EIPA 4I2UA 2F9SA 3H8QA 4RI7A 2B1KA 1ZOFA 13GSA 1VF1A 1GSYA 3GX8A 3IPZA 1A8LA 1GL8A 4EUYA 4NHWA 3GKNA 4HOJA 1F6MC 1USBA 4K9ZA 1IYIA 1PX7A 6GSYA 2JL4A 1ON4A 4FYCA 1MTCA 2PUKC 5IMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V57 A;  3P2A A;  2HZF A;  1DE2 A;  2DSA A;  2IPA A;  4MZB A;  3WGD A;  3BJ5 A;  3US3 A;  3Q18 A;  4ML6 A;  4ZL8 A;  5ECQ B;  5F05 A;  4O5R A;  2IMI A;  4E8E A;  4OFM A;  2P0G A;  3WYW A;  1EGO A;  4ILF A;  2E7P A;  4IP1 A;  5DAK A;  4MA9 A;  3G7I A;  3FW2 A;  2ES7 A;  3JCM L;  1Q98 A;  5AIX A;  4PUF C;  5DCG A;  3TDG A;  3QAG A;  2R3X A;  2IIY A;  5CRD A;  5B7C A;  3FR3 A;  2PER A;  1WIK A;  4KB3 A;  5G5F A;  3CYN A;  1EGR A;  3GKM A;  3ZYW A;  1XCC A;  3F0I A;  3G7J A;  3VWX A;  3HZ8 A;  3FZ9 A;  2KHP A;  1R4W A;  4MLY A;  2WUL A;  1T3B A;  2LTK A;  5D96 A;  4DSQ A;  1TDI A;  3WT2 A;  1AW9 A;  5CRH A;  5FWG A;  4ZB6 A;  1Z9H A;  1T7P B;  4OFN A;  2MMA A;  4KSM A;  4KSO A;  3D5J A;  2V6O A;  1M7T A;  4G19 A;  3FK8 A;  2WCI A;  4K7I A;  3C71 A;  1AQW A;  4IVF A;  3VUR A;  4EC0 A;  2GQK A;  1NM3 A;  2CZ3 A;  1EEM A;  1YDK A;  4KX4 A;  1SEN A;  1THX A;  3RAZ A;  1URM A;  5B8A A;  1EEJ A;  4TW5 A;  5GST A;  2WGR A;  2PBJ A;  4FYB A;  2E0Q A;  5ECH B;  3CRT A;  5JWR B;  1ERT A;  2VD0 A;  2GSS A;  4ECI A;  2N5B A;  1V98 A;  3HKR A;  1ZGN A;  2IFQ B;  4YAP A;  4G9H A;  1JLW A;  1B9X C;  3P7X A;  1YY7 A;  2LRC A;  2I4A A;  10GS A;  1TRU A;  1TKD B;  4TKY A;  4D73 A;  2OBK A;  4HI7 A;  4EDZ A;  4TOP A;  4POK A;  1OC8 A;  1AIU A;  4V2N A;  5B8B A;  1OKT A;  5AIV A;  1XWG A;  2WFC A;  5HQP A;  4ZBA A;  2PPT A;  1HQO A;  3J7Y b;  3KD0 A;  3G7Y A;  3IDV A;  1ABA A;  2H74 A;  4LMW A;  4TRX A;  5DJM A;  2L4C A;  5DJL A;  2IMF A;  3WT1 A;  3GL3 A;  4HU9 A;  3DVW A;  2LJK A;  2OE3 A;  3F3Q A;  5CAX A;  3LG6 A;  4MP4 A;  3FZA A;  3BOA A;  2HSH A;  1Y6E A;  2FWF A;  4ZIL A;  3D0Z A;  3GNJ A;  1ILO A;  2H71 A;  3TGZ A;  5EL8 A;  3ZRE A;  2PN8 A;  4POB A;  2N5A A;  4WF4 A;  2JAD A;  2RM5 A;  5D9V A;  4G10 A;  2A2S A;  3H1N A;  2X8C A;  5B6M A;  1XFL A;  4GSS A;  3O6T A;  1JZO A;  4HQZ A;  2K9F A;  2B5X A;  1GSF A;  4XIH A;  2FA4 A;  1EV4 A;  3L4N A;  3KTL A;  1GP1 A;  1LJR A;  5IMV A;  4V1A g;  4KDX A;  2REM A;  5FT3 A;  1GUK A;  5D8I A;  2VCX A;  3LWA A;  4V2L A;  3LFL A;  1TRW A;  3P90 A;  5H5Q A;  3RPN A;  2IMK A;  3D4M A;  4NV5 A;  3MAK A;  2K8V A;  2GTU A;  2DJ1 A;  2VL2 A;  3TB2 A;  3GKK A;  2DIY A;  4KA0 A;  5C00 A;  2DJJ A;  2O85 A;  4NV2 A;  1X5E A;  1LBK A;  4OD7 A;  5HFG A;  3TKR A;  1Z7P A;  2FCH A;  1A2L A;  2XPE A;  3GST A;  2R4V A;  5EPF A;  2YNX A;  3Q6O A;  1ACV A;  2XPD A;  3HHV A;  6GSW A;  3GV1 A;  3VFI A;  3EMX A;  3EU3 A;  4N0Z A;  1HNC A;  4OCE A;  1ZCP A;  4OMV A;  3UOM A;  1RK4 A;  3KMN A;  22GS A;  1GNW A;  3UBK A;  4TR0 A;  2GST A;  3GH6 A;  4PXO A;  3S9F A;  3GFK A;  1SD9 A;  4F2I A;  1AUC A;  5G2Z A;  1TK8 B;  3L9V A;  1FAA A;  5ENU A;  3WD6 A;  2IJY A;  3QDN A;  3EYT A;  8GSS A;  3M1G A;  1PL2 A;  3F4R A;  2H0I A;  1PA3 A;  1A24 A;  3APS A;  3EWL A;  3IA1 A;  5JWQ B;  1TU8 A;  2H30 A;  1O8W A;  1BX9 A;  2OKA A;  4XS4 B;  2V2G A;  1TI3 A;  2AB6 A;  1VF3 A;  4N30 A;  2G0F A;  4OCF A;  2NTO A;  4IQ1 A;  2FNO A;  3ZVJ D;  4XS1 A;  1TK0 B;  2MBS A;  2FY6 A;  3M9J A;  4KW6 A;  2Z9S A;  3LQ7 A;  2VCZ A;  2HFD A;  5CRE A;  1H4O A;  2BJX A;  3M8N A;  1U6T A;  2C3Q A;  4HU7 A;  1S3A A;  1G6Y A;  3BCK A;  1Z6M A;  3HVX A;  4IGJ A;  4L8E A;  4MJE A;  2IFQ A;  1QMV A;  2DIZ A;  1GUH A;  4OO4 A;  2M80 A;  2CQ9 A;  1KEB A;  2GLR A;  3LJR A;  2TIR A;  3IK9 A;  2ZUP A;  4WF5 A;  4ZIJ A;  3ZIJ A;  1G6W A;  3SBC A;  3UAR A;  4QL9 A;  5G30 A;  2MYG A;  2VCQ A;  6GST A;  2I3Y A;  5ABR A;  3TKS E;  2WB9 A;  2GSQ A;  2GZZ A;  4O7H A;  2QKE A;  5G1L A;  1T4Z A;  1O6J A;  6GSV A;  2OAC A;  4JR4 A;  1K3L A;  1U3I A;  1SJZ A;  4WKW A;  5EVO A;  3D21 A;  1YEP A;  2G2Q A;  1NHO A;  1GLP A;  5IM9 A;  1N2A A;  2NBS A;  1K0C A;  3IAM 2;  5GSS A;  2FWE A;  12GS A;  2O8V B;  2YOI A;  1XBS A;  4MZW A;  4NHZ A;  2EIR A;  3BBY A;  1EOG A;  1WWJ A;  3H4K A;  19GS A;  3L78 A;  4PUA A;  1M2B A;  1R26 A;  1K0D A;  3M9K A;  1KBN A;  1DUG A;  3FEU A;  4K7N A;  4MJB A;  1JLV A;  4EF0 A;  3WGE A;  1TW9 A;  1VF2 A;  1NSW A;  4D73 B;  4JR6 A;  2YP6 A;  2VCW A;  5HR0 A;  3ZIV A;  2H70 A;  3CSH A;  1K0M A;  1GSU A;  2B3S A;  5A5K A;  1BG5 A;  3F9U A;  3UJ1 A;  2H6Z A;  2HYX A;  1J9B A;  4TR1 A;  1B4P A;  3MDK A;  1SYR A;  5A4W A;  4NXI A;  3LXT A;  1SK2 A;  3IC4 A;  4I5Q A;  2H73 A;  5C04 A;  1G0T A;  3DRN A;  1ML6 A;  4TR4 A;  3H79 A;  1R5P A;  3CRU A;  5D9W A;  2FD3 A;  1GUM A;  2HRN A;  1M99 A;  3ZL5 A;  2H19 A;  4EDY A;  2HLS A;  1NW2 A;  1YJ6 A;  4PQH A;  2ON5 A;  2GT5 A;  1T4Y A;  1WJK A;  4YH2 A;  1SKR B;  2YJH A;  4N10 A;  4DSR A;  2N5F A;  4F0B A;  3L9S A;  3UBL A;  4IW9 A;  2YZU A;  5GAN D;  1I9D A;  2LJA A;  3VI5 A;  4IQA A;  4JED A;  3V1W A;  3VWW A;  5GAP D;  3HCZ A;  2HT9 A;  3D6I A;  2NPB A;  1Z5Y E;  5G1K A;  2KUC A;  3LGC A;  6GSU A;  1ST9 A;  3CTF A;  1OC3 A;  1S3C A;  3CSI A;  1ERV A;  4LA1 A;  5JCG A;  4L5L A;  2VM2 A;  4FO5 A;  4ACS A;  2A4V A;  5LD0 A;  1WMJ A;  1JZR A;  1A0F A;  3GA4 A;  5ECI B;  5IMF A;  2AYT A;  4LMV A;  2H01 A;  4KCE A;  3LXZ A;  1ERW A;  2H0H A;  2YAN A;  4XS4 A;  2I9H A;  1B8X A;  1TXX A;  1A0R P;  1XWA A;  4MDC A;  16GS A;  3GH9 A;  5KN1 A;  2B1L A;  1EP7 A;  2B7K A;  1K3O A;  4BA7 A;  1OC9 B;  2LRT A;  1V2A A;  1PMT A;  2BTO T;  5E4W A;  5D73 A;  3A2W A;  3FKF A;  2YWM A;  3A5W A;  5J41 A;  2HNL A;  4XHM A;  1A8Y A;  2OAD A;  1SYX A;  5J9B A;  5L71 A;  4J57 E;  1AXD A;  4WBJ A;  3UMA A;  2H66 A;  2X64 A;  3TJJ A;  3APQ A;  4BWQ A;  3EC3 A;  4MH2 A;  2HSY A;  5HR1 A;  4AJ6 A;  2YWO A;  2L4Q A;  2FGX A;  2CAI A;  2MMO A;  2FHE A;  3KMO A;  1AC1 A;  1GTA A;  3FR9 A;  2PU9 C;  4KDU A;  2CVB A;  1CQH A;  3PGT A;  2C0F A;  5ID2 B;  3ZTL A;  2VCT A;  5KEJ A;  1R5A A;  3KH7 A;  2H1B A;  1Q4J A;  2JSZ A;  4AF2 A;  1RW1 A;  2LJR A;  3KP9 A;  2K8S A;  1LU4 A;  2YV9 A;  3IRA A;  2QGV A;  3IE3 A;  1TRV A;  1K0B A;  1X0R A;  2C4J A;  3HJO A;  3GIX A;  1Z3E A;  2AV4 A;  4ZXG A;  5DQS A;  1GSQ A;  2BMX A;  1WOU A;  2IMD A;  3QCP A;  5H5R A;  5JCU A;  1M0U A;  3WGX A;  4KH7 A;  4EO3 A;  2FWH A;  3A2V A;  5ECO B;  4HQS A;  5FHI A;  3F6F A;  2LRN A;  5G5E A;  1EV9 A;  3ERF A;  3EU4 A;  1G7E A;  3CXG A;  3TUE A;  1TTZ A;  1ZYQ B;  3F4S A;  3RHB A;  3GUS A;  2L5O A;  4EXJ A;  3IOS A;  1GTU A;  1FHE A;  4G2E A;  1HNA A;  4EVM A;  1GSD A;  1XIY A;  4IEL A;  5CRW A;  3LEF A;  4Q5Q A;  5IPG A;  5J3R A;  2GQL A;  1GRX A;  1QGV A;  4DSS B;  3HZ4 A;  1GUL A;  4PNF A;  3I9V 2;  4MF5 A;  4KGI A;  1AAZ A;  2PVO C;  2IN3 A;  3CMI A;  3H93 A;  2LV3 A;  3M3M A;  1FO5 A;  1PQN A;  4CW9 A;  1OKD A;  2A2R A;  5A4U A;  2H76 A;  3NOF A;  3LOR A;  1VRS D;  3PR8 A;  4RI6 A;  2LST A;  4ZBD A;  3I6A A;  1K0N A;  9GSS A;  2DMM A;  3Q74 A;  4GLT A;  3I69 A;  2CVK A;  2C0G A;  2C8U A;  1PN9 A;  1X5C A;  3DML A;  18GS A;  2DJK A;  1TP9 A;  2DC5 A;  5DVB A;  3GKX A;  2EIQ A;  2RUE A;  3ZMK A;  3KGK A;  5D93 A;  3TKP A;  5IIZ A;  3W8J A;  4PNG A;  5LNK e;  2EC4 A;  4K8M A;  2P5R A;  3ERW A;  5DQY A;  3VI7 A;  3F3R A;  4N0V A;  4TR1 B;  2MZC A;  1K0A A;  4BPY A;  5DBQ A;  2JZS A;  1A23 A;  3GRX A;  3TOU A;  2F51 A;  2WZ9 A;  2F8A A;  4ZBB A;  3KH9 A;  4IS0 A;  2C80 A;  5G31 A;  5COH A;  2VO4 A;  1WP0 A;  3GHA A;  1OC9 A;  5INY A;  4LL4 B;  3KP8 A;  4PX1 A;  2VM1 A;  1IYH A;  1O7U A;  5HFI A;  1K3Y A;  3ED3 A;  2RII A;  1BYE A;  4L0W A;  2ZCT A;  4L0U A;  2JSY A;  4Q5F A;  2NDO A;  4Q5N A;  4EKZ A;  3N5O A;  4GSN A;  3FZ4 A;  2PGT A;  1MDI A;  3KJY A;  2H72 A;  2X8H A;  2CA8 A;  2FWG A;  2MMN A;  4KDY A;  4NMU A;  3W6G A;  4XRA A;  5ID2 A;  5E59 A;  1MD4 A;  1A2J A;  3QFB C;  2E2M A;  1PSQ A;  1GTI A;  4GWR A;  5AN1 A;  2YZH A;  3HY2 A;  3N9J A;  2FLS A;  1X9M B;  3F63 A;  2AJQ B;  3FZ5 A;  2KOK A;  5CNW A;  3TKQ A;  2C1Y A;  1SK0 A;  2M72 A;  3F8U A;  1TI1 A;  4KAE A;  1I5G A;  4TXO B;  3VK9 A;  3QD9 A;  1FW1 A;  1GH2 A;  3GN3 A;  5JWO B;  4P3Y B;  4AGS A;  5KN0 A;  3ZLP A;  1X5D A;  4X1U A;  2I81 A;  2I1U A;  3ME8 A;  1N8J A;  3DGQ A;  4IJI A;  1X9S B;  2KP2 A;  14GS A;  2ALB A;  4F9Z A;  1JHB A;  3AY8 A;  1GWC A;  1XZO A;  3VLN A;  1XWC A;  2V32 A;  3LSZ A;  1GTB A;  3FR6 A;  4V2M A;  3IHQ A;  3QOU A;  4DVC A;  5CRG A;  2TRC P;  3KZQ A;  3G9B A;  2P5Q A;  3FYG A;  1PKZ A;  3TJK A;  4POL A;  4DSS A;  4GST A;  1E2Y A;  2PMT A;  4RUV A;  2VUP A;  1U3A A;  1V58 A;  5CYY A;  2LKU A;  4ZB8 A;  4NPB A;  5F0G A;  2VLU A;  4HEA 2;  3BD2 A;  1J08 A;  1H75 A;  4I97 A;  2H6X A;  1MEK A;  5IMC A;  2RM6 A;  2JU5 A;  4I6X A;  3DKS A;  4BVX A;  2YCD A;  5F07 A;  1ZMA A;  1YKC A;  3D4T A;  2L5L A;  4OWY A;  3C7M A;  1M9B A;  3TJB A;  1SL2 B;  3FRC A;  1S3D A;  1OAZ A;  3IAS 2;  2XHF A;  1FB0 A;  2J23 A;  4IJ3 A;  1SKS B;  4WBR D;  4QL7 A;  4YQM A;  2DLX A;  2QC7 A;  2R37 A;  4WXT A;  2KP1 A;  4GCI A;  3C73 A;  5J9C A;  2GGT A;  1OE8 A;  3TRX A;  5KN2 A;  2F8F A;  4IBP A;  3O3T A;  4K7O A;  4PGT A;  1DBY A;  1XW9 A;  2VL3 A;  1OVN A;  1QXH A;  4NWY A;  1XXU A;  3QPM A;  4KCA A;  3IR4 A;  3DIE A;  4HS1 A;  1NHY A;  1EWX A;  3UEM A;  4QQ7 A;  4WR4 A;  17GS A;  3APO A;  3W8S A;  4O92 A;  4LLR A;  2NVL A;  4RQR A;  4X43 A;  4CHS A;  2CZ2 A;  1BED A;  4DEJ A;  1U88 A;  1F3A A;  2L59 A;  4OO5 A;  3GMF A;  4WR5 A;  3OR5 A;  1E6B A;  3ZFB A;  4K0G A;  3HJM A;  2WDU A;  1M2A A;  2CX3 A;  2KLX A;  5HFK A;  1YF0 A;  3EE2 A;  4BL7 A;  4J56 E;  3RDW A;  3VWU A;  4LL1 B;  1YEX A;  1FOV A;  3HVS A;  1BAY A;  2E2G A;  5ECM B;  3HDC A;  2RUF A;  2JZT A;  1K0O A;  4MMM A;  1B9Y C;  5ECK B;  1W4V A;  1XWB A;  4O32 A;  1T00 A;  3QAV A;  2PWJ A;  1HD2 A;  2VCV A;  1XPV A;  2HRF A;  4J2F A;  3CSJ A;  4FYU A;  1JZW A;  1YF1 A;  3C8E A;  2B7J A;  4POM A;  4MJC A;  1SL0 B;  4OFT A;  2C3N A;  3QAW A;  4ULX A;  4F03 A;  3TOT A;  2YPM A;  3C1S A;  2X8G A;  3QFA C;  3FY7 A;  2HXK A;  1O85 A;  4IHU A;  4TXO A;  1FVJ A;  3PIN A;  5B6N A;  1SD8 A;  5KN3 A;  2MBT A;  3A2X A;  1VF4 A;  1HNB A;  5AGY A;  1QFN A;  3ZRD A;  3DD3 A;  3UVT A;  1OYJ A;  2O7K A;  2YJ7 A;  1M9A A;  4GQF A;  2V1M A;  1DSB A;  2O87 A;  1F3B A;  11GS A;  3L0H A;  2VL9 A;  3KM6 A;  2VAF A;  1ZL9 A;  1AQX A;  5DDL A;  3GTU B;  2LUS A;  5F06 A;  3KTB A;  2DML A;  2IWT A;  3DXB A;  2VLV A;  2H6Y A;  1F9M A;  1WE0 A;  5GZZ B;  2GS3 A;  3TKS C;  2MMZ A;  3F4T A;  3M0F A;  1B4Q A;  1O81 A;  4MCU A;  3VWV A;  1ZYE A;  2CVD A;  3QMX A;  3U5R E;  1T1V A;  2VOC A;  4FH8 A;  4EL1 A;  3IBH A;  1JZD A;  2GQM A;  3KEB A;  2R6K A;  4WEY A;  1FVK A;  3SWL A;  2J9H A;  2OE1 A;  1UN2 A;  1CQG A;  2VLT A;  5J4U A;  3ME7 A;  4F82 A;  4ZL9 A;  2H8L A;  2CV4 A;  5J5N A;  2OA7 A;  5IO2 A;  2GZY A;  1F2E A;  3UIW A;  1XOB A;  5IO0 A;  1QK8 A;  5DAL B;  5CO3 A;  1SK1 A;  3VPQ A;  3F6D A;  3RPP A;  4BVY A;  3E3E A;  2AHE A;  2AAW A;  4HUA A;  1TRS A;  4MZC A;  4HZ2 A;  3HD5 A;  2F3M A;  3CBU A;  5DCH A;  4MJA A;  2FUG 2;  4JRR A;  1PD2 1;  1X9W B;  1RQM A;  2H75 A;  4V1A p;  1MD3 A;  2IL3 A;  3R2Q A;  1PGT A;  3ZFL A;  4K6X A;  5ECN B;  1T8E B;  3TKS A;  2O89 A;  4NAX A;  3UVH A;  2LS5 A;  5IOW A;  1HYU A;  3ERG A;  1XWK A;  5ECL B;  4TVE A;  5JCW A;  2VIM A;  5IMZ A;  4YAV A;  4E8H A;  3U6V A;  2H0G A;  2RLI A;  4N11 A;  2DJ3 A;  2VL2 C;  2XC2 A;  4GQC A;  2LNT A;  3TRP A;  2WS2 A;  5EY6 A;  1THO A;  3ZIT A;  4GRF A;  4Z7X A;  2GDR A;  3ZVJ A;  1TU7 A;  3EIN A;  1PKW A;  2LQQ A;  5ECS A;  2OJL A;  3HYP A;  3NZN A;  2QSI A;  2OE0 A;  3LYP A;  3FHK A;  4FIW A;  5AIS A;  3D22 A;  3E0U A;  1ZZY A;  1J0F A;  3ISO A;  2VD1 A;  2XBQ A;  4F0C A;  3P8W A;  6GSX A;  2CAQ A;  1UA5 A;  1XVW A;  4JBB A;  4HJ2 A;  1XVQ A;  4JE1 A;  3TCO A;  3LYK A;  4WET A;  1A2M A;  2X99 A;  2EIO A;  2GSR A;  2YV7 A;  4TXV A;  2V6K A;  2XBI A;  4MF7 A;  4XCS A;  2L6C A;  2ON7 A;  1G7O A;  4CDO A;  2IME A;  4YQV A;  2HZE B;  3C1R A;  2FA8 A;  1B48 A;  3NIV A;  3VPT A;  3PH9 A;  4JZQ A;  5ELA A;  2LEG A;  2H1A A;  4K1F A;  5LCZ A;  2L57 A;  3HVV A;  4HZ4 A;  3MNG A;  2C0E A;  4I8B A;  2C3T A;  3I43 A;  1MDJ A;  3IXR A;  4L5O A;  5IQY A;  3CTG A;  1U87 A;  4ISD A;  5ECP B;  2B5Y A;  4MK3 A;  2K6V A;  4BWS A;  5IOX A;  1XW6 A;  4GXZ A;  1SL1 B;  2DBC A;  2WJU A;  3IK7 A;  4IN0 A;  3MWH A;  3TJF A;  3GYK A;  3GTU A;  4ECC A;  5D9X A;  3DWV A;  1ERU A;  1GSE A;  3EVI A;  4MF6 A;  3TRQ A;  3UL3 A;  2GZP A;  20GS A;  4ID0 A;  2K18 A;  1KNG A;  5HR2 A;  1XW5 A;  3L9U A;  5DAK B;  3J7Y k;  4MAB A;  1SU9 A;  4JU5 A;  2HE3 A;  4HDE A;  4KND A;  5ECR B;  4RQX A;  3EUR A;  4ML1 A;  5HR3 A;  4ECJ A;  1F37 A;  3ZZX A;  3GSS A;  2V41 A;  1GSS A;  4ZL7 A;  3KXO A;  4I2T A;  1PL1 A;  6GSS A;  2P31 A;  3E9J B;  4YQU A;  1EOH A;  1WPI A;  5DAL A;  4HJM A;  2LQO A;  3GUR A;  2OBI A;  4MPF A;  1W89 A;  4GTU A;  4MH3 A;  2C0D A;  1KTE A;  4PUR A;  2LNS A;  5F8B A;  3Q19 A;  3TJG A;  1UVZ A;  2DJ0 A;  1QUW A;  4IP6 A;  4ECB A;  1EP8 A;  1YQ1 A;  1WRY A;  2AUV A;  2B6M A;  1FB6 A;  4IKH A;  1TK5 B;  2B5E A;  2R5G A;  3HA9 A;  4AJ8 A;  5A4V A;  4EE0 A;  4K2D A;  1MDK A;  3EMP A;  1JFU A;  1FG4 A;  1SKW B;  3GL5 A;  3RBT A;  2DJ2 A;  3DYR A;  1O8X A;  1O73 A;  4GF0 A;  4XS6 A;  3RHC A;  4PQI A;  1TOF A;  2L6D A;  2CX4 A;  3A3T A;  1UC7 A;  1SJ6 A;  1R7H A;  2GT6 A;  3DEX A;  3IV4 A;  1Z7R A;  2WRT A;  1BJX A;  2GVP A;  2YWI A;  2YWN A;  1TJD A;  1XOA A;  4Q5R A;  1BQ7 A;  3GX0 A;  3K8N A;  3UAP A;  1YZX A;  7GSS A;  1V9W A;  3O76 A;  5CP1 A;  4KE3 A;  1OE7 A;  1M2D A;  3ZML A;  1C72 A;  4MPG A;  1AQV A;  1DE1 A;  4PQ1 A;  2ZNM A;  1YKA A;  1SJI A;  1QQ2 A;  3KCM A;  2H1D A;  5ELG A;  4TR3 A;  3MSZ A;  3BCI A;  2CT6 A;  1PRX A;  1EZK A;  2JZR A;  2HZE A;  4X0X A;  1GLQ A;  2PVQ A;  4ZB9 A;  2D2Z A;  1PX6 A;  2HI7 A;  4XTS A;  4TN8 A;  5D9T A;  1VGL A;  2M46 A;  3DVX A;  2JAC A;  4KUN A;  3HXS A;  3QR6 A;  2H1G A;  4H86 A;  4XRD A;  5H5S A;  5IPH A;  2YN1 A;  3HJP A;  2R2J A;  2TRX A;  1V40 A;  4K0N A;  1Z6N A;  3KIJ A;  4AJ7 A;  1GNE A;  1Y25 A;  5IMD A;  4I2U A;  2F9S A;  3H8Q A;  4RI7 A;  2B1K A;  1ZOF A;  13GS A;  1VF1 A;  1GSY A;  3GX8 A;  3IPZ A;  1A8L A;  1GL8 A;  4EUY A;  4NHW A;  3GKN A;  4HOJ A;  1F6M C;  1USB A;  4K9Z A;  1IYI A;  1PX7 A;  6GSY A;  2JL4 A;  1ON4 A;  4FYC A;  1MTC A;  2PUK C;  5IMA A; 
#chains in the Genus database with same CATH topology
 1V57 A;  3P2A A;  2HZF A;  1DE2 A;  2DSA A;  2IPA A;  4MZB A;  3WGD A;  4G0K A;  3BJ5 A;  3US3 A;  3Q18 A;  4ML6 A;  4ZL8 A;  5ECQ B;  5F05 A;  4O5R A;  2IMI A;  4E8E A;  4OFM A;  2P0G A;  3WYW A;  1EGO A;  4ILF A;  2E7P A;  4IP1 A;  5DAK A;  4MA9 A;  3G7I A;  3FW2 A;  2ES7 A;  3JCM L;  1Q98 A;  5AIX A;  4PUF C;  5DCG A;  3TDG A;  3QAG A;  2R3X A;  2IIY A;  5CRD A;  5B7C A;  3FR3 A;  4YKF A;  2PER A;  1WIK A;  4KB3 A;  5G5F A;  3CYN A;  1EGR A;  3GKM A;  3ZYW A;  1XCC A;  3F0I A;  3G7J A;  3VWX A;  3HZ8 A;  3FZ9 A;  2KHP A;  1R4W A;  4MLY A;  2WUL A;  3IC8 A;  1T3B A;  2LTK A;  5D96 A;  4DSQ A;  1TDI A;  3WT2 A;  2R0P A;  1AW9 A;  5CRH A;  5FWG A;  4ZB6 A;  1Z9H A;  1T7P B;  4OFN A;  2MMA A;  4KSM A;  4KSO A;  3D5J A;  2V6O A;  1M7T A;  4Z2T A;  4G19 A;  3FK8 A;  2WCI A;  2UZ8 A;  4K7I A;  3C71 A;  1AQW A;  4IVF A;  3VUR A;  4EC0 A;  2GQK A;  1NM3 A;  2CZ3 A;  1EEM A;  1YDK A;  4KX4 A;  1SEN A;  1THX A;  3RAZ A;  1URM A;  5B8A A;  1EEJ A;  4TW5 A;  5GST A;  2WGR A;  2PBJ A;  4FYB A;  2E0Q A;  5ECH B;  3CRT A;  5JWR B;  1ERT A;  2VD0 A;  2GSS A;  4ECI A;  2N5B A;  1V98 A;  3HKR A;  1ZGN A;  2IFQ B;  4YAP A;  1M3J A;  4G9H A;  1JLW A;  1B9X C;  3P7X A;  1YY7 A;  2LRC A;  2I4A A;  10GS A;  1TRU A;  1TKD B;  4TKY A;  4D73 A;  2OBK A;  4HI7 A;  4EDZ A;  4TOP A;  5BMU A;  4POK A;  1OC8 A;  1AIU A;  4V2N A;  5B8B A;  1OKT A;  5AIV A;  1XWG A;  2WFC A;  2QA2 A;  5HQP A;  4ZBA A;  2PPT A;  1HQO A;  3J7Y b;  3KD0 A;  3G7Y A;  3IDV A;  1ABA A;  2H74 A;  4LMW A;  4TRX A;  5DJM A;  2L4C A;  5DJL A;  2IMF A;  3WT1 A;  3GL3 A;  4HU9 A;  3DVW A;  2LJK A;  2OE3 A;  3F3Q A;  5CAX A;  3LG6 A;  4MP4 A;  3FZA A;  3BOA A;  2HSH A;  1Y6E A;  2FWF A;  4ZIL A;  3D0Z A;  3GNJ A;  1ILO A;  2H71 A;  3TGZ A;  5EL8 A;  3ZRE A;  2PN8 A;  4POB A;  2N5A A;  4WF4 A;  2JAD A;  2RM5 A;  5D9V A;  4G10 A;  2A2S A;  3H1N A;  2X8C A;  5B6M A;  1XFL A;  4GSS A;  3O6T A;  1JZO A;  4HQZ A;  2K9F A;  2B5X A;  2QA1 A;  1GSF A;  4XIH A;  2FA4 A;  1EV4 A;  3L4N A;  3MIX A;  3KTL A;  1GP1 A;  1LJR A;  5IMV A;  4O5U A;  4V1A g;  4KDX A;  2REM A;  5FT3 A;  1GUK A;  5D8I A;  2VCX A;  3LWA A;  4V2L A;  3LFL A;  1TRW A;  3P90 A;  5H5Q A;  3RPN A;  2IMK A;  3D4M A;  4NV5 A;  3MAK A;  2K8V A;  2GTU A;  2DJ1 A;  2VL2 A;  3TB2 A;  3GKK A;  2DIY A;  4KA0 A;  5C00 A;  2DJJ A;  2O85 A;  4NV2 A;  1X5E A;  1LBK A;  4OD7 A;  5HFG A;  3TKR A;  1Z7P A;  2FCH A;  1A2L A;  2XPE A;  3GST A;  2R4V A;  5EPF A;  2YNX A;  3Q6O A;  1ACV A;  2XPD A;  3HHV A;  6GSW A;  3GV1 A;  3VFI A;  3EMX A;  3EU3 A;  4N0Z A;  1HNC A;  4OCE A;  1ZCP A;  4OMV A;  3UOM A;  1RK4 A;  3KMN A;  22GS A;  1GNW A;  3UBK A;  4TR0 A;  2GST A;  3GH6 A;  4PXO A;  2X49 A;  3S9F A;  3GFK A;  1SD9 A;  4F2I A;  1AUC A;  5G2Z A;  1TK8 B;  3L9V A;  1FAA A;  5ENU A;  3WD6 A;  2IJY A;  3QDN A;  3EYT A;  8GSS A;  3M1G A;  1PL2 A;  3F4R A;  2H0I A;  1PA3 A;  1A24 A;  3APS A;  3EWL A;  3IA1 A;  5JWQ B;  1TU8 A;  2H30 A;  1O8W A;  1BX9 A;  2OKA A;  4XS4 B;  2V2G A;  1TI3 A;  2AB6 A;  1VF3 A;  4N30 A;  1PN0 A;  2G0F A;  4OCF A;  2NTO A;  4IQ1 A;  2FNO A;  3ZVJ D;  4XS1 A;  1TK0 B;  2MBS A;  2FY6 A;  3M9J A;  4KW6 A;  2Z9S A;  3LQ7 A;  2VCZ A;  2HFD A;  5CRE A;  1H4O A;  2BJX A;  3M8N A;  4G0I A;  1U6T A;  2C3Q A;  4HU7 A;  1S3A A;  1G6Y A;  1PFO A;  3BCK A;  1Z6M A;  3HVX A;  4IGJ A;  4L8E A;  4MJE A;  2IFQ A;  1QMV A;  2DIZ A;  1GUH A;  4OO4 A;  2M80 A;  2CQ9 A;  1KEB A;  2GLR A;  3LJR A;  2TIR A;  3IK9 A;  2ZUP A;  4WF5 A;  4ZIJ A;  3ZIJ A;  1G6W A;  3SBC A;  3UAR A;  4QL9 A;  5G30 A;  2MYG A;  2VCQ A;  6GST A;  2I3Y A;  5ABR A;  3TKS E;  2WB9 A;  2GSQ A;  2GZZ A;  4O7H A;  2QKE A;  5G1L A;  1FOH A;  1T4Z A;  1O6J A;  2R0G A;  6GSV A;  2OAC A;  4JR4 A;  1K3L A;  1U3I A;  1SJZ A;  4WKW A;  5EVO A;  3D21 A;  1YEP A;  2G2Q A;  1NHO A;  1GLP A;  5IM9 A;  1N2A A;  2NBS A;  1K0C A;  3IAM 2;  5GSS A;  2FWE A;  12GS A;  4O5Q A;  2O8V B;  2A2P A;  4ICY A;  2YOI A;  1XBS A;  4MZW A;  4NHZ A;  2EIR A;  3BBY A;  1EOG A;  1WWJ A;  3H4K A;  19GS A;  3L78 A;  4PUA A;  1M2B A;  1R26 A;  1K0D A;  3M9K A;  1KBN A;  1DUG A;  3FEU A;  4K7N A;  4MJB A;  1JLV A;  4EF0 A;  3WGE A;  1S3R A;  1TW9 A;  1VF2 A;  1NSW A;  4D73 B;  4JR6 A;  2YP6 A;  2VCW A;  5HR0 A;  3ZIV A;  2H70 A;  3CSH A;  1K0M A;  1GSU A;  2B3S A;  5A5K A;  1BG5 A;  3F9U A;  3UJ1 A;  2H6Z A;  2HYX A;  1J9B A;  4TR1 A;  1B4P A;  3MDK A;  1SYR A;  5A4W A;  4NXI A;  3LXT A;  1SK2 A;  3IC4 A;  4I5Q A;  2H73 A;  5C04 A;  1G0T A;  3DRN A;  1ML6 A;  4TR4 A;  4KF9 A;  3H79 A;  1R5P A;  3CRU A;  5D9W A;  2FD3 A;  1GUM A;  2HRN A;  1M99 A;  3ZL5 A;  2H19 A;  4EDY A;  2HLS A;  1NW2 A;  1YJ6 A;  4PQH A;  2ON5 A;  2GT5 A;  1T4Y A;  1WJK A;  4YH2 A;  2HRK A;  1SKR B;  2YJH A;  4N10 A;  4DSR A;  2N5F A;  4F0B A;  1XG8 A;  3L9S A;  3UBL A;  4IW9 A;  2YZU A;  5GAN D;  1I9D A;  2LJA A;  3VI5 A;  4IQA A;  4JED A;  3V1W A;  3VWW A;  5GAP D;  3HCZ A;  2HT9 A;  3D6I A;  2NPB A;  1Z5Y E;  5G1K A;  2KUC A;  3LGC A;  6GSU A;  1ST9 A;  3CTF A;  1OC3 A;  1S3C A;  3CSI A;  1ERV A;  4LA1 A;  5JCG A;  4L5L A;  2VM2 A;  4FO5 A;  4ACS A;  2A4V A;  5LD0 A;  1WMJ A;  1JZR A;  1A0F A;  3GA4 A;  5ECI B;  5IMF A;  2AYT A;  4LMV A;  4Z2R A;  2H01 A;  4KCE A;  3LXZ A;  1ERW A;  2H0H A;  2YAN A;  4XS4 A;  2I9H A;  1B8X A;  1TXX A;  1A0R P;  1XWA A;  4MDC A;  16GS A;  3GH9 A;  5KN1 A;  2B1L A;  1EP7 A;  2B7K A;  1K3O A;  4BA7 A;  1OC9 B;  2LRT A;  1V2A A;  1PMT A;  2BTO T;  5E4W A;  5D73 A;  3A2W A;  3FKF A;  2YWM A;  3A5W A;  5J41 A;  2HNL A;  4XHM A;  1A8Y A;  2OAD A;  1SYX A;  5J9B A;  5L71 A;  4J57 E;  1AXD A;  4WBJ A;  3UMA A;  2H66 A;  2X64 A;  3TJJ A;  3APQ A;  4BWQ A;  3EC3 A;  4MH2 A;  2HSY A;  5HR1 A;  4AJ6 A;  2YWO A;  2L4Q A;  2FGX A;  2CAI A;  2MMO A;  2FHE A;  3KMO A;  1AC1 A;  1GTA A;  3FR9 A;  2PU9 C;  4KDU A;  2CVB A;  1CQH A;  3PGT A;  2C0F A;  5ID2 B;  3ZTL A;  2VCT A;  5KEJ A;  1R5A A;  3KH7 A;  2H1B A;  1Q4J A;  2JSZ A;  4AF2 A;  1RW1 A;  2LJR A;  3KP9 A;  2K8S A;  1LU4 A;  2YV9 A;  3IRA A;  2QGV A;  3IE3 A;  1TRV A;  1K0B A;  1X0R A;  2C4J A;  3HJO A;  3GIX A;  1Z3E A;  2AV4 A;  4ZXG A;  5DQS A;  1GSQ A;  2BMX A;  1WOU A;  2IMD A;  3QCP A;  5H5R A;  5JCU A;  1M0U A;  3WGX A;  4KH7 A;  4EO3 A;  2FWH A;  3A2V A;  5ECO B;  4HQS A;  5FHI A;  3F6F A;  2LRN A;  5G5E A;  1EV9 A;  3ERF A;  4PTS A;  3EU4 A;  1G7E A;  3CXG A;  3TUE A;  1TTZ A;  1ZYQ B;  3F4S A;  3RHB A;  3GUS A;  2L5O A;  4EXJ A;  3IOS A;  1GTU A;  1FHE A;  4G2E A;  1HNA A;  4EVM A;  1GSD A;  1XIY A;  4IEL A;  5CRW A;  3LEF A;  4Q5Q A;  5IPG A;  5J3R A;  2GQL A;  1GRX A;  1QGV A;  4DSS B;  3HZ4 A;  1GUL A;  4PNF A;  3I9V 2;  4MF5 A;  4KGI A;  1AAZ A;  2PVO C;  2IN3 A;  3CMI A;  3H93 A;  2LV3 A;  3M3M A;  1FO5 A;  1PQN A;  4CW9 A;  1OKD A;  2A2R A;  5A4U A;  2H76 A;  3NOF A;  3LOR A;  1VRS D;  3PR8 A;  4RI6 A;  2LST A;  4ZBD A;  3I6A A;  1K0N A;  4BVX B;  9GSS A;  2DMM A;  3Q74 A;  4GLT A;  3I69 A;  2CVK A;  2C0G A;  2C8U A;  1PN9 A;  1X5C A;  3DML A;  3LW9 A;  18GS A;  2DJK A;  1TP9 A;  2DC5 A;  4HSC X;  3PPU A;  5DVB A;  3GKX A;  2EIQ A;  2RUE A;  2X4A A;  3ZMK A;  3KGK A;  5D93 A;  3TKP A;  5IIZ A;  4K2X A;  3W8J A;  4PNG A;  5LNK e;  2EC4 A;  4K8M A;  2P5R A;  3ERW A;  5DQY A;  3VI7 A;  3F3R A;  4N0V A;  4TR1 B;  2MZC A;  1K0A A;  4BPY A;  5DBQ A;  2JZS A;  1A23 A;  3GRX A;  3TOU A;  2F51 A;  2WZ9 A;  2F8A A;  4ZBB A;  3KH9 A;  4IS0 A;  2C80 A;  5G31 A;  5COH A;  2VO4 A;  1WP0 A;  3GHA A;  1OC9 A;  5INY A;  4LL4 B;  3KP8 A;  4PX1 A;  2VM1 A;  1IYH A;  1O7U A;  5HFI A;  1K3Y A;  3ED3 A;  2RII A;  1BYE A;  4L0W A;  2ZCT A;  5BRT A;  4L0U A;  2JSY A;  4Q5F A;  2NDO A;  4Q5N A;  2R0C A;  4EKZ A;  3N5O A;  4GSN A;  3FZ4 A;  2PGT A;  1MDI A;  4K5S A;  3KJY A;  2H72 A;  2X8H A;  2CA8 A;  2FWG A;  2MMN A;  4KDY A;  4NMU A;  3W6G A;  4XRA A;  5ID2 A;  5E59 A;  1MD4 A;  1A2J A;  3QFB C;  2E2M A;  1PSQ A;  1GTI A;  4GWR A;  5AN1 A;  3CQF A;  2YZH A;  3HY2 A;  3N9J A;  2FLS A;  1X9M B;  3F63 A;  3A5I A;  1ZYP A;  2AJQ B;  3FZ5 A;  2KOK A;  5CNW A;  3TKQ A;  2C1Y A;  1SK0 A;  2M72 A;  3F8U A;  1TI1 A;  4KAE A;  4FQU A;  1I5G A;  4TXO B;  3EPT A;  3VK9 A;  3QD9 A;  1FW1 A;  1GH2 A;  3GN3 A;  5JWO B;  4P3Y B;  4AGS A;  5KN0 A;  3ZLP A;  1ZYN A;  1X5D A;  4X1U A;  2I81 A;  2I1U A;  3ME8 A;  1N8J A;  3DGQ A;  4IJI A;  1X9S B;  2KP2 A;  14GS A;  2ALB A;  4F9Z A;  1JHB A;  3AY8 A;  1GWC A;  1XZO A;  3VLN A;  1XWC A;  2V32 A;  3LSZ A;  1GTB A;  3FR6 A;  4V2M A;  3IHQ A;  3QOU A;  4DVC A;  5CRG A;  2TRC P;  3KZQ A;  3G9B A;  2P5Q A;  3FYG A;  1PKZ A;  3TJK A;  4POL A;  4DSS A;  4GST A;  1E2Y A;  2PMT A;  4RUV A;  2VUP A;  1U3A A;  1V58 A;  5CYY A;  2LKU A;  4ZB8 A;  4NPB A;  5F0G A;  2VLU A;  4HEA 2;  3BD2 A;  1J08 A;  1H75 A;  4I97 A;  2H6X A;  1MEK A;  5IMC A;  2RM6 A;  2JU5 A;  4I6X A;  3DKS A;  4BVX A;  2YCD A;  5F07 A;  1ZMA A;  1YKC A;  3D4T A;  2L5L A;  4OWY A;  3C7M A;  1M9B A;  3TJB A;  1SL2 B;  3FRC A;  5KOX A;  1S3D A;  4BVY B;  1OAZ A;  3IAS 2;  2XHF A;  1FB0 A;  2J23 A;  4IJ3 A;  1SKS B;  4WBR D;  2HSM A;  4QL7 A;  4YQM A;  2DLX A;  2QC7 A;  2R37 A;  4WXT A;  2KP1 A;  4GCI A;  3C73 A;  4EIQ A;  5J9C A;  2GGT A;  1OE8 A;  3TRX A;  4K5R A;  5KN2 A;  2F8F A;  4IBP A;  3O3T A;  4K7O A;  4PGT A;  1DBY A;  1XW9 A;  2VL3 A;  1OVN A;  1QXH A;  4NWY A;  1XXU A;  3QPM A;  4KCA A;  3IR4 A;  3DIE A;  4HS1 A;  1NHY A;  1EWX A;  3UEM A;  4QQ7 A;  4WR4 A;  17GS A;  3APO A;  3W8S A;  4O92 A;  4LLR A;  2NVL A;  4RQR A;  4X43 A;  4CHS A;  2CZ2 A;  1BED A;  4DEJ A;  1U88 A;  1F3A A;  2L59 A;  4OO5 A;  3GMF A;  4WR5 A;  3OR5 A;  1E6B A;  3ZFB A;  4K0G A;  3HJM A;  2WDU A;  1M2A A;  2CX3 A;  2KLX A;  5HFK A;  1YF0 A;  3EE2 A;  4BL7 A;  4J56 E;  3RDW A;  3VWU A;  4LL1 B;  1YEX A;  1FOV A;  4USS A;  3HVS A;  1BAY A;  2E2G A;  5ECM B;  3HDC A;  2RUF A;  2JZT A;  1K0O A;  4MMM A;  1B9Y C;  5ECK B;  1W4V A;  1XWB A;  4O32 A;  1T00 A;  3QAV A;  2PWJ A;  1HD2 A;  2VCV A;  1XPV A;  2HRF A;  4J2F A;  3CSJ A;  4FYU A;  1JZW A;  2A4H A;  1YF1 A;  3C8E A;  2B7J A;  4POM A;  4MJC A;  1SL0 B;  4OFT A;  4MNN A;  2C3N A;  3QAW A;  4ULX A;  4F03 A;  3TOT A;  2YPM A;  3C1S A;  4A5P A;  2X8G A;  3QFA C;  3FY7 A;  2HXK A;  1O85 A;  4IHU A;  4TXO A;  1FVJ A;  3PIN A;  5B6N A;  1SD8 A;  5KN3 A;  2DKI A;  2MBT A;  3A2X A;  1VF4 A;  1HNB A;  5AGY A;  1QFN A;  3ZRD A;  3DD3 A;  3UVT A;  1OYJ A;  2O7K A;  2YJ7 A;  1M9A A;  4GQF A;  2V1M A;  1DSB A;  2O87 A;  1F3B A;  11GS A;  3L0H A;  2VL9 A;  3KM6 A;  2VAF A;  1ZL9 A;  1AQX A;  5DDL A;  3GTU B;  2LUS A;  5F06 A;  3KTB A;  2DML A;  4YKG A;  2IWT A;  3DXB A;  2VLV A;  2H6Y A;  1F9M A;  1WE0 A;  5GZZ B;  2GS3 A;  3TKS C;  2MMZ A;  3F4T A;  3M0F A;  1B4Q A;  1O81 A;  4MCU A;  3VWV A;  1ZYE A;  2CVD A;  3QMX A;  3U5R E;  1T1V A;  2VOC A;  4FH8 A;  4EL1 A;  3IBH A;  1JZD A;  2GQM A;  3KEB A;  2R6K A;  4WEY A;  1FVK A;  3SWL A;  2J9H A;  2OE1 A;  1UN2 A;  1CQG A;  2VLT A;  5J4U A;  3ME7 A;  4F82 A;  4CY8 A;  4ZL9 A;  2H8L A;  2CV4 A;  5J5N A;  2OA7 A;  5IO2 A;  2GZY A;  1F2E A;  3UIW A;  1XOB A;  5IO0 A;  1QK8 A;  5DAL B;  5CO3 A;  5KOW A;  1SK1 A;  3VPQ A;  3F6D A;  3RPP A;  4BVY A;  3E3E A;  2AHE A;  2AAW A;  4HUA A;  1TRS A;  4MZC A;  4HZ2 A;  3HD5 A;  2F3M A;  4CY6 A;  3CBU A;  5DCH A;  4MJA A;  2FUG 2;  4JRR A;  1PD2 1;  1X9W B;  1RQM A;  2H75 A;  4V1A p;  1MD3 A;  2IL3 A;  3R2Q A;  1PGT A;  3ZFL A;  4K6X A;  3FMW A;  5ECN B;  1T8E B;  3TKS A;  2O89 A;  4NAX A;  3UVH A;  2LS5 A;  5IOW A;  4BIK A;  1HYU A;  3ERG A;  1XWK A;  5ECL B;  3R3E A;  4TVE A;  5JCW A;  2VIM A;  5IMZ A;  4YAV A;  4E8H A;  3U6V A;  2H0G A;  2RLI A;  4N11 A;  2DJ3 A;  2VL2 C;  2XC2 A;  4GQC A;  2LNT A;  3TRP A;  2WS2 A;  5EY6 A;  1THO A;  3ZIT A;  4GRF A;  4Z7X A;  2GDR A;  3ZVJ A;  1TU7 A;  3EIN A;  1PKW A;  2LQQ A;  5ECS A;  2OJL A;  3HYP A;  3NZN A;  2QSI A;  2OE0 A;  3LYP A;  3FHK A;  4FIW A;  5AIS A;  3D22 A;  3E0U A;  1ZZY A;  1J0F A;  3ISO A;  2VD1 A;  2XBQ A;  4F0C A;  3P8W A;  6GSX A;  2CAQ A;  1UA5 A;  1XVW A;  4JBB A;  4HJ2 A;  1XVQ A;  4JE1 A;  3TCO A;  3LYK A;  4WET A;  1A2M A;  2X99 A;  2EIO A;  2GSR A;  2YV7 A;  4TXV A;  2V6K A;  2XBI A;  4MF7 A;  4XCS A;  2L6C A;  2ON7 A;  1G7O A;  4CDO A;  2IME A;  4YQV A;  2HZE B;  3C1R A;  2FA8 A;  1B48 A;  3NIV A;  3VPT A;  3PH9 A;  4JZQ A;  4X4J A;  5ELA A;  2LEG A;  2H1A A;  4K1F A;  5LCZ A;  2L57 A;  3HVV A;  4HZ4 A;  3HVN A;  3MNG A;  2C0E A;  4I8B A;  2C3T A;  3I43 A;  1MDJ A;  3IXR A;  4L5O A;  5IQY A;  3CTG A;  1U87 A;  4ISD A;  5ECP B;  2B5Y A;  4BL7 B;  4MK3 A;  2K6V A;  1M3I A;  4BWS A;  5IOX A;  1XW6 A;  4GXZ A;  1SL1 B;  2DBC A;  2WJU A;  3IK7 A;  4IN0 A;  3MWH A;  3TJF A;  3GYK A;  3GTU A;  4ECC A;  2HRA A;  5D9X A;  3DWV A;  1ERU A;  1GSE A;  3EVI A;  4MF6 A;  3TRQ A;  3UL3 A;  3IHG A;  2GZP A;  20GS A;  4ID0 A;  2K18 A;  1KNG A;  5HR2 A;  1XW5 A;  3L9U A;  5DAK B;  3J7Y k;  4MAB A;  1SU9 A;  4JU5 A;  2HE3 A;  4HDE A;  4KND A;  5ECR B;  4RQX A;  3EUR A;  4ML1 A;  5HR3 A;  4ECJ A;  1F37 A;  3ZZX A;  3GSS A;  2V41 A;  1GSS A;  4ZL7 A;  4Z2U A;  3KXO A;  4I2T A;  1PL1 A;  6GSS A;  4G0L A;  2P31 A;  3E9J B;  4YQU A;  1EOH A;  1WPI A;  5DAL A;  4HJM A;  2LQO A;  3GUR A;  2OBI A;  4MPF A;  1W89 A;  4GTU A;  4MH3 A;  2C0D A;  1KTE A;  4PUR A;  2LNS A;  5F8B A;  3Q19 A;  3TJG A;  1UVZ A;  2DJ0 A;  1QUW A;  3MYD A;  4IP6 A;  4ECB A;  1EP8 A;  1YQ1 A;  1WRY A;  2AUV A;  2B6M A;  1FB6 A;  4IKH A;  1TK5 B;  2B5E A;  2R5G A;  3HA9 A;  4AJ8 A;  5A4V A;  4EE0 A;  4K2D A;  1MDK A;  3EMP A;  1JFU A;  1FG4 A;  1SKW B;  3GL5 A;  3RBT A;  2DJ2 A;  3DYR A;  1O8X A;  1O73 A;  4GF0 A;  4XS6 A;  3RHC A;  4PQI A;  1TOF A;  2L6D A;  2CX4 A;  3A3T A;  1UC7 A;  1SJ6 A;  1R7H A;  2GT6 A;  3DEX A;  2DKH A;  3IV4 A;  1Z7R A;  2WRT A;  1BJX A;  2GVP A;  2YWI A;  2YWN A;  1TJD A;  1XOA A;  4Q5R A;  1BQ7 A;  3GX0 A;  3K8N A;  3UAP A;  1YZX A;  7GSS A;  1V9W A;  3O76 A;  5CP1 A;  4KE3 A;  1OE7 A;  1M2D A;  3ZML A;  1C72 A;  4MPG A;  1AQV A;  1DE1 A;  4PQ1 A;  2ZNM A;  1YKA A;  1SJI A;  1QQ2 A;  3KCM A;  2H1D A;  5ELG A;  4TR3 A;  3MSZ A;  3BCI A;  2CT6 A;  1PRX A;  1EZK A;  2JZR A;  2HZE A;  4X0X A;  1GLQ A;  2PVQ A;  4ZB9 A;  2D2Z A;  1PX6 A;  2HI7 A;  4XTS A;  4TN8 A;  5D9T A;  1VGL A;  2M46 A;  3DVX A;  2JAC A;  4KUN A;  3HXS A;  3QR6 A;  2H1G A;  4H86 A;  4XRD A;  5H5S A;  5IPH A;  2YN1 A;  3HJP A;  2R2J A;  2TRX A;  1V40 A;  4K0N A;  1Z6N A;  3KIJ A;  4AJ7 A;  1GNE A;  1Y25 A;  5IMD A;  4EIP A;  4I2U A;  2F9S A;  3H8Q A;  4RI7 A;  2B1K A;  1ZOF A;  13GS A;  1VF1 A;  1GSY A;  3GX8 A;  3IPZ A;  1A8L A;  1GL8 A;  4EUY A;  4NHW A;  3GKN A;  4HOJ A;  1F6M C;  1USB A;  4K9Z A;  1IYI A;  1PX7 A;  6GSY A;  2JL4 A;  1ON4 A;  4FYC A;  1MTC A;  2PUK C;  5IMA A; 
#chains in the Genus database with same CATH homology
 1V57 A;  3P2A A;  2HZF A;  1DE2 A;  2DSA A;  2IPA A;  4MZB A;  3WGD A;  4G0K A;  3BJ5 A;  3US3 A;  3Q18 A;  4ML6 A;  4ZL8 A;  5ECQ B;  5F05 A;  4O5R A;  2IMI A;  4E8E A;  4OFM A;  2P0G A;  3WYW A;  1EGO A;  4ILF A;  2E7P A;  4IP1 A;  5DAK A;  4MA9 A;  3G7I A;  3FW2 A;  2ES7 A;  3JCM L;  1Q98 A;  5AIX A;  4PUF C;  5DCG A;  3TDG A;  3QAG A;  2R3X A;  2IIY A;  5CRD A;  5B7C A;  3FR3 A;  4YKF A;  2PER A;  1WIK A;  4KB3 A;  5G5F A;  3CYN A;  1EGR A;  3GKM A;  3ZYW A;  1XCC A;  3F0I A;  3G7J A;  3VWX A;  3HZ8 A;  3FZ9 A;  2KHP A;  1R4W A;  4MLY A;  2WUL A;  3IC8 A;  1T3B A;  2LTK A;  5D96 A;  4DSQ A;  1TDI A;  3WT2 A;  2R0P A;  1AW9 A;  5CRH A;  5FWG A;  4ZB6 A;  1Z9H A;  1T7P B;  4OFN A;  2MMA A;  4KSM A;  4KSO A;  3D5J A;  2V6O A;  1M7T A;  4Z2T A;  4G19 A;  3FK8 A;  2WCI A;  2UZ8 A;  4K7I A;  3C71 A;  1AQW A;  4IVF A;  3VUR A;  4EC0 A;  2GQK A;  1NM3 A;  2CZ3 A;  1EEM A;  1YDK A;  4KX4 A;  1SEN A;  1THX A;  3RAZ A;  1URM A;  5B8A A;  1EEJ A;  4TW5 A;  5GST A;  2WGR A;  2PBJ A;  4FYB A;  2E0Q A;  5ECH B;  3CRT A;  5JWR B;  1ERT A;  2VD0 A;  2GSS A;  4ECI A;  2N5B A;  1V98 A;  3HKR A;  1ZGN A;  2IFQ B;  4YAP A;  4G9H A;  1JLW A;  1B9X C;  3P7X A;  1YY7 A;  2LRC A;  2I4A A;  10GS A;  1TRU A;  1TKD B;  4TKY A;  4D73 A;  2OBK A;  4HI7 A;  4EDZ A;  4TOP A;  5BMU A;  4POK A;  1OC8 A;  1AIU A;  4V2N A;  5B8B A;  1OKT A;  5AIV A;  1XWG A;  2WFC A;  2QA2 A;  5HQP A;  4ZBA A;  2PPT A;  1HQO A;  3J7Y b;  3KD0 A;  3G7Y A;  3IDV A;  1ABA A;  2H74 A;  4LMW A;  4TRX A;  5DJM A;  2L4C A;  5DJL A;  2IMF A;  3WT1 A;  3GL3 A;  4HU9 A;  3DVW A;  2LJK A;  2OE3 A;  3F3Q A;  5CAX A;  3LG6 A;  4MP4 A;  3FZA A;  3BOA A;  2HSH A;  1Y6E A;  2FWF A;  4ZIL A;  3D0Z A;  3GNJ A;  1ILO A;  2H71 A;  3TGZ A;  5EL8 A;  3ZRE A;  2PN8 A;  4POB A;  2N5A A;  4WF4 A;  2JAD A;  2RM5 A;  5D9V A;  4G10 A;  2A2S A;  3H1N A;  2X8C A;  5B6M A;  1XFL A;  4GSS A;  3O6T A;  1JZO A;  4HQZ A;  2K9F A;  2B5X A;  2QA1 A;  1GSF A;  4XIH A;  2FA4 A;  1EV4 A;  3L4N A;  3MIX A;  3KTL A;  1GP1 A;  1LJR A;  5IMV A;  4O5U A;  4V1A g;  4KDX A;  2REM A;  5FT3 A;  1GUK A;  5D8I A;  2VCX A;  3LWA A;  4V2L A;  3LFL A;  1TRW A;  3P90 A;  5H5Q A;  3RPN A;  2IMK A;  3D4M A;  4NV5 A;  3MAK A;  2K8V A;  2GTU A;  2DJ1 A;  2VL2 A;  3TB2 A;  3GKK A;  2DIY A;  4KA0 A;  5C00 A;  2DJJ A;  2O85 A;  4NV2 A;  1X5E A;  1LBK A;  4OD7 A;  5HFG A;  3TKR A;  1Z7P A;  2FCH A;  1A2L A;  2XPE A;  3GST A;  2R4V A;  5EPF A;  2YNX A;  3Q6O A;  1ACV A;  2XPD A;  3HHV A;  6GSW A;  3GV1 A;  3VFI A;  3EMX A;  3EU3 A;  4N0Z A;  1HNC A;  4OCE A;  1ZCP A;  4OMV A;  3UOM A;  1RK4 A;  3KMN A;  22GS A;  1GNW A;  3UBK A;  4TR0 A;  2GST A;  3GH6 A;  4PXO A;  2X49 A;  3S9F A;  3GFK A;  1SD9 A;  4F2I A;  1AUC A;  5G2Z A;  1TK8 B;  3L9V A;  1FAA A;  5ENU A;  3WD6 A;  2IJY A;  3QDN A;  3EYT A;  8GSS A;  3M1G A;  1PL2 A;  3F4R A;  2H0I A;  1PA3 A;  1A24 A;  3APS A;  3EWL A;  3IA1 A;  5JWQ B;  1TU8 A;  2H30 A;  1O8W A;  1BX9 A;  2OKA A;  4XS4 B;  2V2G A;  1TI3 A;  2AB6 A;  1VF3 A;  4N30 A;  1PN0 A;  2G0F A;  4OCF A;  2NTO A;  4IQ1 A;  2FNO A;  3ZVJ D;  4XS1 A;  1TK0 B;  2MBS A;  2FY6 A;  3M9J A;  4KW6 A;  2Z9S A;  3LQ7 A;  2VCZ A;  2HFD A;  5CRE A;  1H4O A;  2BJX A;  3M8N A;  4G0I A;  1U6T A;  2C3Q A;  4HU7 A;  1S3A A;  1G6Y A;  3BCK A;  1Z6M A;  3HVX A;  4IGJ A;  4L8E A;  4MJE A;  2IFQ A;  1QMV A;  2DIZ A;  1GUH A;  4OO4 A;  2M80 A;  2CQ9 A;  1KEB A;  2GLR A;  3LJR A;  2TIR A;  3IK9 A;  2ZUP A;  4WF5 A;  4ZIJ A;  3ZIJ A;  1G6W A;  3SBC A;  3UAR A;  4QL9 A;  5G30 A;  2MYG A;  2VCQ A;  6GST A;  2I3Y A;  5ABR A;  3TKS E;  2WB9 A;  2GSQ A;  2GZZ A;  4O7H A;  2QKE A;  5G1L A;  1FOH A;  1T4Z A;  1O6J A;  2R0G A;  6GSV A;  2OAC A;  4JR4 A;  1K3L A;  1U3I A;  1SJZ A;  4WKW A;  5EVO A;  3D21 A;  1YEP A;  2G2Q A;  1NHO A;  1GLP A;  5IM9 A;  1N2A A;  2NBS A;  1K0C A;  3IAM 2;  5GSS A;  2FWE A;  12GS A;  4O5Q A;  2O8V B;  2A2P A;  4ICY A;  2YOI A;  1XBS A;  4MZW A;  4NHZ A;  2EIR A;  3BBY A;  1EOG A;  1WWJ A;  3H4K A;  19GS A;  3L78 A;  4PUA A;  1M2B A;  1R26 A;  1K0D A;  3M9K A;  1KBN A;  1DUG A;  3FEU A;  4K7N A;  4MJB A;  1JLV A;  4EF0 A;  3WGE A;  1TW9 A;  1VF2 A;  1NSW A;  4D73 B;  4JR6 A;  2YP6 A;  2VCW A;  5HR0 A;  3ZIV A;  2H70 A;  3CSH A;  1K0M A;  1GSU A;  2B3S A;  5A5K A;  1BG5 A;  3F9U A;  3UJ1 A;  2H6Z A;  2HYX A;  1J9B A;  4TR1 A;  1B4P A;  3MDK A;  1SYR A;  5A4W A;  4NXI A;  3LXT A;  1SK2 A;  3IC4 A;  4I5Q A;  2H73 A;  5C04 A;  1G0T A;  3DRN A;  1ML6 A;  4TR4 A;  4KF9 A;  3H79 A;  1R5P A;  3CRU A;  5D9W A;  2FD3 A;  1GUM A;  2HRN A;  1M99 A;  3ZL5 A;  2H19 A;  4EDY A;  2HLS A;  1NW2 A;  1YJ6 A;  4PQH A;  2ON5 A;  2GT5 A;  1T4Y A;  1WJK A;  4YH2 A;  2HRK A;  1SKR B;  2YJH A;  4N10 A;  4DSR A;  2N5F A;  4F0B A;  3L9S A;  3UBL A;  4IW9 A;  2YZU A;  5GAN D;  1I9D A;  2LJA A;  3VI5 A;  4IQA A;  4JED A;  3V1W A;  3VWW A;  5GAP D;  3HCZ A;  2HT9 A;  3D6I A;  2NPB A;  1Z5Y E;  5G1K A;  2KUC A;  3LGC A;  6GSU A;  1ST9 A;  3CTF A;  1OC3 A;  1S3C A;  3CSI A;  1ERV A;  4LA1 A;  5JCG A;  4L5L A;  2VM2 A;  4FO5 A;  4ACS A;  2A4V A;  5LD0 A;  1WMJ A;  1JZR A;  1A0F A;  3GA4 A;  5ECI B;  5IMF A;  2AYT A;  4LMV A;  4Z2R A;  2H01 A;  4KCE A;  3LXZ A;  1ERW A;  2H0H A;  2YAN A;  4XS4 A;  2I9H A;  1B8X A;  1TXX A;  1A0R P;  1XWA A;  4MDC A;  16GS A;  3GH9 A;  5KN1 A;  2B1L A;  1EP7 A;  2B7K A;  1K3O A;  4BA7 A;  1OC9 B;  2LRT A;  1V2A A;  1PMT A;  2BTO T;  5E4W A;  5D73 A;  3A2W A;  3FKF A;  2YWM A;  3A5W A;  5J41 A;  2HNL A;  4XHM A;  1A8Y A;  2OAD A;  1SYX A;  5J9B A;  5L71 A;  4J57 E;  1AXD A;  4WBJ A;  3UMA A;  2H66 A;  2X64 A;  3TJJ A;  3APQ A;  4BWQ A;  3EC3 A;  4MH2 A;  2HSY A;  5HR1 A;  4AJ6 A;  2YWO A;  2L4Q A;  2FGX A;  2CAI A;  2MMO A;  2FHE A;  3KMO A;  1AC1 A;  1GTA A;  3FR9 A;  2PU9 C;  4KDU A;  2CVB A;  1CQH A;  3PGT A;  2C0F A;  5ID2 B;  3ZTL A;  2VCT A;  5KEJ A;  1R5A A;  3KH7 A;  2H1B A;  1Q4J A;  2JSZ A;  4AF2 A;  1RW1 A;  2LJR A;  3KP9 A;  2K8S A;  1LU4 A;  2YV9 A;  3IRA A;  2QGV A;  3IE3 A;  1TRV A;  1K0B A;  1X0R A;  2C4J A;  3HJO A;  3GIX A;  1Z3E A;  2AV4 A;  4ZXG A;  5DQS A;  1GSQ A;  2BMX A;  1WOU A;  2IMD A;  3QCP A;  5H5R A;  5JCU A;  1M0U A;  3WGX A;  4KH7 A;  4EO3 A;  2FWH A;  3A2V A;  5ECO B;  4HQS A;  5FHI A;  3F6F A;  2LRN A;  5G5E A;  1EV9 A;  3ERF A;  4PTS A;  3EU4 A;  1G7E A;  3CXG A;  3TUE A;  1TTZ A;  1ZYQ B;  3F4S A;  3RHB A;  3GUS A;  2L5O A;  4EXJ A;  3IOS A;  1GTU A;  1FHE A;  4G2E A;  1HNA A;  4EVM A;  1GSD A;  1XIY A;  4IEL A;  5CRW A;  3LEF A;  4Q5Q A;  5IPG A;  5J3R A;  2GQL A;  1GRX A;  1QGV A;  4DSS B;  3HZ4 A;  1GUL A;  4PNF A;  3I9V 2;  4MF5 A;  4KGI A;  1AAZ A;  2PVO C;  2IN3 A;  3CMI A;  3H93 A;  2LV3 A;  3M3M A;  1FO5 A;  1PQN A;  4CW9 A;  1OKD A;  2A2R A;  5A4U A;  2H76 A;  3NOF A;  3LOR A;  1VRS D;  3PR8 A;  4RI6 A;  2LST A;  4ZBD A;  3I6A A;  1K0N A;  4BVX B;  9GSS A;  2DMM A;  3Q74 A;  4GLT A;  3I69 A;  2CVK A;  2C0G A;  2C8U A;  1PN9 A;  1X5C A;  3DML A;  3LW9 A;  18GS A;  2DJK A;  1TP9 A;  2DC5 A;  3PPU A;  5DVB A;  3GKX A;  2EIQ A;  2RUE A;  2X4A A;  3ZMK A;  3KGK A;  5D93 A;  3TKP A;  5IIZ A;  4K2X A;  3W8J A;  4PNG A;  5LNK e;  2EC4 A;  4K8M A;  2P5R A;  3ERW A;  5DQY A;  3VI7 A;  3F3R A;  4N0V A;  4TR1 B;  2MZC A;  1K0A A;  4BPY A;  5DBQ A;  2JZS A;  1A23 A;  3GRX A;  3TOU A;  2F51 A;  2WZ9 A;  2F8A A;  4ZBB A;  3KH9 A;  4IS0 A;  2C80 A;  5G31 A;  5COH A;  2VO4 A;  1WP0 A;  3GHA A;  1OC9 A;  5INY A;  4LL4 B;  3KP8 A;  4PX1 A;  2VM1 A;  1IYH A;  1O7U A;  5HFI A;  1K3Y A;  3ED3 A;  2RII A;  1BYE A;  4L0W A;  2ZCT A;  5BRT A;  4L0U A;  2JSY A;  4Q5F A;  2NDO A;  4Q5N A;  2R0C A;  4EKZ A;  3N5O A;  4GSN A;  3FZ4 A;  2PGT A;  1MDI A;  4K5S A;  3KJY A;  2H72 A;  2X8H A;  2CA8 A;  2FWG A;  2MMN A;  4KDY A;  4NMU A;  3W6G A;  4XRA A;  5ID2 A;  5E59 A;  1MD4 A;  1A2J A;  3QFB C;  2E2M A;  1PSQ A;  1GTI A;  4GWR A;  5AN1 A;  2YZH A;  3HY2 A;  3N9J A;  2FLS A;  1X9M B;  3F63 A;  3A5I A;  1ZYP A;  2AJQ B;  3FZ5 A;  2KOK A;  5CNW A;  3TKQ A;  2C1Y A;  1SK0 A;  2M72 A;  3F8U A;  1TI1 A;  4KAE A;  4FQU A;  1I5G A;  4TXO B;  3EPT A;  3VK9 A;  3QD9 A;  1FW1 A;  1GH2 A;  3GN3 A;  5JWO B;  4P3Y B;  4AGS A;  5KN0 A;  3ZLP A;  1ZYN A;  1X5D A;  4X1U A;  2I81 A;  2I1U A;  3ME8 A;  1N8J A;  3DGQ A;  4IJI A;  1X9S B;  2KP2 A;  14GS A;  2ALB A;  4F9Z A;  1JHB A;  3AY8 A;  1GWC A;  1XZO A;  3VLN A;  1XWC A;  2V32 A;  3LSZ A;  1GTB A;  3FR6 A;  4V2M A;  3IHQ A;  3QOU A;  4DVC A;  5CRG A;  2TRC P;  3KZQ A;  3G9B A;  2P5Q A;  3FYG A;  1PKZ A;  3TJK A;  4POL A;  4DSS A;  4GST A;  1E2Y A;  2PMT A;  4RUV A;  2VUP A;  1U3A A;  1V58 A;  5CYY A;  2LKU A;  4ZB8 A;  4NPB A;  5F0G A;  2VLU A;  4HEA 2;  3BD2 A;  1J08 A;  1H75 A;  4I97 A;  2H6X A;  1MEK A;  5IMC A;  2RM6 A;  2JU5 A;  4I6X A;  3DKS A;  4BVX A;  2YCD A;  5F07 A;  1ZMA A;  1YKC A;  3D4T A;  2L5L A;  4OWY A;  3C7M A;  1M9B A;  3TJB A;  1SL2 B;  3FRC A;  5KOX A;  1S3D A;  4BVY B;  1OAZ A;  3IAS 2;  2XHF A;  1FB0 A;  2J23 A;  4IJ3 A;  1SKS B;  4WBR D;  2HSM A;  4QL7 A;  4YQM A;  2DLX A;  2QC7 A;  2R37 A;  4WXT A;  2KP1 A;  4GCI A;  3C73 A;  4EIQ A;  5J9C A;  2GGT A;  1OE8 A;  3TRX A;  4K5R A;  5KN2 A;  2F8F A;  4IBP A;  3O3T A;  4K7O A;  4PGT A;  1DBY A;  1XW9 A;  2VL3 A;  1OVN A;  1QXH A;  4NWY A;  1XXU A;  3QPM A;  4KCA A;  3IR4 A;  3DIE A;  4HS1 A;  1NHY A;  1EWX A;  3UEM A;  4QQ7 A;  4WR4 A;  17GS A;  3APO A;  3W8S A;  4O92 A;  4LLR A;  2NVL A;  4RQR A;  4X43 A;  4CHS A;  2CZ2 A;  1BED A;  4DEJ A;  1U88 A;  1F3A A;  2L59 A;  4OO5 A;  3GMF A;  4WR5 A;  3OR5 A;  1E6B A;  3ZFB A;  4K0G A;  3HJM A;  2WDU A;  1M2A A;  2CX3 A;  2KLX A;  5HFK A;  1YF0 A;  3EE2 A;  4BL7 A;  4J56 E;  3RDW A;  3VWU A;  4LL1 B;  1YEX A;  1FOV A;  4USS A;  3HVS A;  1BAY A;  2E2G A;  5ECM B;  3HDC A;  2RUF A;  2JZT A;  1K0O A;  4MMM A;  1B9Y C;  5ECK B;  1W4V A;  1XWB A;  4O32 A;  1T00 A;  3QAV A;  2PWJ A;  1HD2 A;  2VCV A;  1XPV A;  2HRF A;  4J2F A;  3CSJ A;  4FYU A;  1JZW A;  2A4H A;  1YF1 A;  3C8E A;  2B7J A;  4POM A;  4MJC A;  1SL0 B;  4OFT A;  4MNN A;  2C3N A;  3QAW A;  4ULX A;  4F03 A;  3TOT A;  2YPM A;  3C1S A;  4A5P A;  2X8G A;  3QFA C;  3FY7 A;  2HXK A;  1O85 A;  4IHU A;  4TXO A;  1FVJ A;  3PIN A;  5B6N A;  1SD8 A;  5KN3 A;  2DKI A;  2MBT A;  3A2X A;  1VF4 A;  1HNB A;  5AGY A;  1QFN A;  3ZRD A;  3DD3 A;  3UVT A;  1OYJ A;  2O7K A;  2YJ7 A;  1M9A A;  4GQF A;  2V1M A;  1DSB A;  2O87 A;  1F3B A;  11GS A;  3L0H A;  2VL9 A;  3KM6 A;  2VAF A;  1ZL9 A;  1AQX A;  5DDL A;  3GTU B;  2LUS A;  5F06 A;  3KTB A;  2DML A;  4YKG A;  2IWT A;  3DXB A;  2VLV A;  2H6Y A;  1F9M A;  1WE0 A;  5GZZ B;  2GS3 A;  3TKS C;  2MMZ A;  3F4T A;  3M0F A;  1B4Q A;  1O81 A;  4MCU A;  3VWV A;  1ZYE A;  2CVD A;  3QMX A;  3U5R E;  1T1V A;  2VOC A;  4FH8 A;  4EL1 A;  3IBH A;  1JZD A;  2GQM A;  3KEB A;  2R6K A;  4WEY A;  1FVK A;  3SWL A;  2J9H A;  2OE1 A;  1UN2 A;  1CQG A;  2VLT A;  5J4U A;  3ME7 A;  4F82 A;  4CY8 A;  4ZL9 A;  2H8L A;  2CV4 A;  5J5N A;  2OA7 A;  5IO2 A;  2GZY A;  1F2E A;  3UIW A;  1XOB A;  5IO0 A;  1QK8 A;  5DAL B;  5CO3 A;  5KOW A;  1SK1 A;  3VPQ A;  3F6D A;  3RPP A;  4BVY A;  3E3E A;  2AHE A;  2AAW A;  4HUA A;  1TRS A;  4MZC A;  4HZ2 A;  3HD5 A;  2F3M A;  4CY6 A;  3CBU A;  5DCH A;  4MJA A;  2FUG 2;  4JRR A;  1PD2 1;  1X9W B;  1RQM A;  2H75 A;  4V1A p;  1MD3 A;  2IL3 A;  3R2Q A;  1PGT A;  3ZFL A;  4K6X A;  3FMW A;  5ECN B;  1T8E B;  3TKS A;  2O89 A;  4NAX A;  3UVH A;  2LS5 A;  5IOW A;  1HYU A;  3ERG A;  1XWK A;  5ECL B;  3R3E A;  4TVE A;  5JCW A;  2VIM A;  5IMZ A;  4YAV A;  4E8H A;  3U6V A;  2H0G A;  2RLI A;  4N11 A;  2DJ3 A;  2VL2 C;  2XC2 A;  4GQC A;  2LNT A;  3TRP A;  2WS2 A;  5EY6 A;  1THO A;  3ZIT A;  4GRF A;  4Z7X A;  2GDR A;  3ZVJ A;  1TU7 A;  3EIN A;  1PKW A;  2LQQ A;  5ECS A;  2OJL A;  3HYP A;  3NZN A;  2QSI A;  2OE0 A;  3LYP A;  3FHK A;  4FIW A;  5AIS A;  3D22 A;  3E0U A;  1ZZY A;  1J0F A;  3ISO A;  2VD1 A;  2XBQ A;  4F0C A;  3P8W A;  6GSX A;  2CAQ A;  1UA5 A;  1XVW A;  4JBB A;  4HJ2 A;  1XVQ A;  4JE1 A;  3TCO A;  3LYK A;  4WET A;  1A2M A;  2X99 A;  2EIO A;  2GSR A;  2YV7 A;  4TXV A;  2V6K A;  2XBI A;  4MF7 A;  4XCS A;  2L6C A;  2ON7 A;  1G7O A;  4CDO A;  2IME A;  4YQV A;  2HZE B;  3C1R A;  2FA8 A;  1B48 A;  3NIV A;  3VPT A;  3PH9 A;  4JZQ A;  4X4J A;  5ELA A;  2LEG A;  2H1A A;  4K1F A;  5LCZ A;  2L57 A;  3HVV A;  4HZ4 A;  3MNG A;  2C0E A;  4I8B A;  2C3T A;  3I43 A;  1MDJ A;  3IXR A;  4L5O A;  5IQY A;  3CTG A;  1U87 A;  4ISD A;  5ECP B;  2B5Y A;  4BL7 B;  4MK3 A;  2K6V A;  4BWS A;  5IOX A;  1XW6 A;  4GXZ A;  1SL1 B;  2DBC A;  2WJU A;  3IK7 A;  4IN0 A;  3MWH A;  3TJF A;  3GYK A;  3GTU A;  4ECC A;  2HRA A;  5D9X A;  3DWV A;  1ERU A;  1GSE A;  3EVI A;  4MF6 A;  3TRQ A;  3UL3 A;  3IHG A;  2GZP A;  20GS A;  4ID0 A;  2K18 A;  1KNG A;  5HR2 A;  1XW5 A;  3L9U A;  5DAK B;  3J7Y k;  4MAB A;  1SU9 A;  4JU5 A;  2HE3 A;  4HDE A;  4KND A;  5ECR B;  4RQX A;  3EUR A;  4ML1 A;  5HR3 A;  4ECJ A;  1F37 A;  3ZZX A;  3GSS A;  2V41 A;  1GSS A;  4ZL7 A;  4Z2U A;  3KXO A;  4I2T A;  1PL1 A;  6GSS A;  4G0L A;  2P31 A;  3E9J B;  4YQU A;  1EOH A;  1WPI A;  5DAL A;  4HJM A;  2LQO A;  3GUR A;  2OBI A;  4MPF A;  1W89 A;  4GTU A;  4MH3 A;  2C0D A;  1KTE A;  4PUR A;  2LNS A;  5F8B A;  3Q19 A;  3TJG A;  1UVZ A;  2DJ0 A;  1QUW A;  3MYD A;  4IP6 A;  4ECB A;  1EP8 A;  1YQ1 A;  1WRY A;  2AUV A;  2B6M A;  1FB6 A;  4IKH A;  1TK5 B;  2B5E A;  2R5G A;  3HA9 A;  4AJ8 A;  5A4V A;  4EE0 A;  4K2D A;  1MDK A;  3EMP A;  1JFU A;  1FG4 A;  1SKW B;  3GL5 A;  3RBT A;  2DJ2 A;  3DYR A;  1O8X A;  1O73 A;  4GF0 A;  4XS6 A;  3RHC A;  4PQI A;  1TOF A;  2L6D A;  2CX4 A;  3A3T A;  1UC7 A;  1SJ6 A;  1R7H A;  2GT6 A;  3DEX A;  2DKH A;  3IV4 A;  1Z7R A;  2WRT A;  1BJX A;  2GVP A;  2YWI A;  2YWN A;  1TJD A;  1XOA A;  4Q5R A;  1BQ7 A;  3GX0 A;  3K8N A;  3UAP A;  1YZX A;  7GSS A;  1V9W A;  3O76 A;  5CP1 A;  4KE3 A;  1OE7 A;  1M2D A;  3ZML A;  1C72 A;  4MPG A;  1AQV A;  1DE1 A;  4PQ1 A;  2ZNM A;  1YKA A;  1SJI A;  1QQ2 A;  3KCM A;  2H1D A;  5ELG A;  4TR3 A;  3MSZ A;  3BCI A;  2CT6 A;  1PRX A;  1EZK A;  2JZR A;  2HZE A;  4X0X A;  1GLQ A;  2PVQ A;  4ZB9 A;  2D2Z A;  1PX6 A;  2HI7 A;  4XTS A;  4TN8 A;  5D9T A;  1VGL A;  2M46 A;  3DVX A;  2JAC A;  4KUN A;  3HXS A;  3QR6 A;  2H1G A;  4H86 A;  4XRD A;  5H5S A;  5IPH A;  2YN1 A;  3HJP A;  2R2J A;  2TRX A;  1V40 A;  4K0N A;  1Z6N A;  3KIJ A;  4AJ7 A;  1GNE A;  1Y25 A;  5IMD A;  4EIP A;  4I2U A;  2F9S A;  3H8Q A;  4RI7 A;  2B1K A;  1ZOF A;  13GS A;  1VF1 A;  1GSY A;  3GX8 A;  3IPZ A;  1A8L A;  1GL8 A;  4EUY A;  4NHW A;  3GKN A;  4HOJ A;  1F6M C;  1USB A;  4K9Z A;  1IYI A;  1PX7 A;  6GSY A;  2JL4 A;  1ON4 A;  4FYC A;  1MTC A;  2PUK C;  5IMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...