4NMUA

Crystal structure of thiol-disulfide oxidoreductase from bacillus str. 'ames ancestor'
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
147
structure length
147
Chain Sequence
b'SNAADKEKMQIGKEAPNFVVTDLEGKKIELKDLKGKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIALDADETDIAVKNFVNQYGLKFPVAIDKGQKIIGTYGVGPLPTSFLIDKDGKVVEQIIGEQTKEQLEGYLKKITP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol-disulfide oxidoreductase ResA
publication title Crystal Structure of Thiol-disulfide Oxidoreductase from Bacillus str. 'Ames Ancestor'
rcsb
source organism Bacillus anthracis
molecule tags Oxidoreductase
total genus 47
structure length 147
sequence length 147
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00578 AhpC-TSA AhpC/TSA family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4nmuA00
1MD3A 1AXDA 1O8WA 2CVBA 17GSA 3F4TA 4RQXA 3F9UA 1YF0A 3UARA 3DGQA 3TOUA 4GQFA 5COHA 5KN2A 1SKWB 1TP9A 3EURA 1XW9A 4EKZA 3ME8A 2I3YA 1K0BA 1XVQA 3GNJA 2GTUA 1T3BA 3UIWA 1K0AA 3LYPA 4K7IA 1J0FA 3ED3A 1T7PB 2DMMA 1V98A 3DD3A 1K0CA 5HR1A 3A5WA 2YV9A 2DJ2A 5B8AA 2LNSA 2PGTA 1TRVA 12GSA 4J2FA 2LKUA 3WD6A 3IAS2 2XBQA 5ECQB 1X9WB 2B1KA 4RUVA 2DBCA 4YQVA 3EYTA 1ZMAA 5G1KA 5B6MA 1G7OA 4IN0A 2H76A 1GTIA 2LSTA 3KH7A 2OA7A 4YQUA 2JACA 1T8EB 3LORA 4K2DA 1SK1A 1XOBA 1XIYA 4L0WA 5ECSA 4POKA 3N5OA 1EOHA 3VWWA 4D73B 1ZGNA 2GZZA 4WEYA 3QAGA 4NXIA 1Z7RA 5ABRA 5IMFA 1TK8B 4KB3A 3WT1A 1YZXA 2N5FA 8GSSA 2MMZA 2M46A 4F82A 1V9WA 3GH6A 4NWYA 3GHAA 2F51A 3GSTA 2IJYA 2OBIA 1T1VA 3HCZA 1S3AA 2B5YA 2LNTA 3QMXA 4N10A 5J9CA 1YKCA 3RPPA 4V1Ap 2LUSA 2OACA 3N9JA 3IXRA 3FZ9A 1ABAA 4QQ7A 1VF3A 1MD4A 1XCCA 3QAWA 4YAVA 3DKSA 3FKFA 1SJZA 3UL3A 2HNLA 3U5RE 3IPZA 4JR6A 5JWOB 2YV7A 2MYGA 4DSQA 1WE0A 2DJ1A 4FYCA 5F07A 4K7OA 4N0VA 2TRXA 4J56E 1H4OA 2PMTA 3KM6A 1DE1A 4O92A 3GX8A 2EIRA 2DJJA 1Z3EA 14GSA 3CYNA 3HZ4A 4MA9A 4G9HA 3ZFLA 3VURA 3DIEA 5DALB 1QUWA 4GQCA 2P31A 3TKSC 1OC8A 1GTBA 3ERFA 5CREA 5HFGA 4K0NA 3VI7A 4ML1A 3KCMA 4ID0A 1LJRA 5A4UA 3CSHA 2H72A 1DBYA 2V1MA 5IPHA 3ZZXA 3O6TA 1QMVA 4ILFA 2YN1A 5D73A 3HDCA 3TKSE 3DMLA 4JZQA 5AIVA 2IPAA 4EDYA 3KMNA 3ZL5A 3R2QA 1Q98A 4OFNA 4KCAA 2XHFA 3RBTA 2LJKA 2RUEA 4HQSA 1XXUA 4ECCA 2FUG2 1ZL9A 1QXHA 2HYXA 4XS1A 3ZYWA 3DWVA 2HRNA 4HJMA 1FB6A 4PQHA 2HSHA 2OE1A 1JZDA 2IWTA 2H30A 1G6YA 1EOGA 1JLVA 18GSA 4MCUA 4WF5A 1XWGA 3GKXA 1OE7A 4MDCA 5ELGA 5D9WA 5ELAA 1BG5A 3EINA 2R3XA 3FYGA 1N2AA 5ID2A 1SK2A 2K6VA 5DAKB 3EU4A 5CYYA 4ULXA 2CQ9A 3A2VA 1FVKA 2XPEA 1JZOA 3TRXA 5B6NA 4HQZA 2VLUA 3TJJA 4ZL9A 4MPFA 1GNEA 1GSDA 2YP6A 5C00A 4HS1A 3HHVA 2GSTA 2P5QA 4DSSB 3NIVA 4PQ1A 4ZXGA 5EY6A 2BTOT 5AN1A 2ALBA 4IQ1A 2IL3A 4AF2A 3J7Yb 1Z5YE 4BVYA 2CX3A 1IYHA 4ML6A 1W89A 4K1FA 4MABA 13GSA 2C0GA 2YPMA 1YDKA 2QSIA 2F8AA 5IMAA 3C1SA 5DDLA 3L9SA 2H19A 5H5QA 1JLWA 1PKZA 4CDOA 5F06A 2VL9A 4XS4A 5CRDA 1OVNA 2L59A 4P3YB 5ECIB 3IBHA 2LRTA 2TIRA 5CP1A 3L4NA 4ZBBA 1E6BA 5GAPD 5DCHA 3BJ5A 1AW9A 2HXKA 5D9XA 4HU9A 4F03A 4TW5A 5IMZA 2IMDA 1CQHA 1B8XA 1K3OA 3D4MA 5FWGA 2JZTA 4Q5QA 1MDIA 2D2ZA 2ZCTA 4LL1B 1YJ6A 1NM3A 1Y6EA 1A0RP 2CAIA 2O87A 3MAKA 3L9VA 4DVCA 4G10A 1QK8A 4Z7XA 4ZB6A 1K0DA 5J5NA 4BVXA 1WPIA 1LBKA 2H1GA 2V32A 4V2MA 2FWEA 1HYUA 3LEFA 4IW9A 1PRXA 3KTBA 1AQXA 2VM2A 1AAZA 2YWMA 1PX7A 3EU3A 1A2LA 1O7UA 2YNXA 4J57E 1A2MA 4X43A 4ZILA 3OR5A 1JZRA 1RW1A 4ECJA 5KN3A 3TRPA 4XIHA 2K8VA 4ZB8A 2G0FA 2P5RA 4N30A 2H66A 4I2UA 3IK7A 1ERVA 1QGVA 3C71A 4GWRA 4JEDA 4TR1B 2CVDA 4IKHA 4GSNA 2JL4A 2KP2A 3LWAA 4TRXA 1PKWA 3J7Yk 2I9HA 1M0UA 4AJ8A 3CTGA 3SBCA 2HLSA 1O8XA 3IDVA 3UMAA 4HDEA 3HZ8A 4XTSA 2YWOA 5INYA 2WFCA 3FEUA 3KP9A 2FA4A 4ISDA 5ECHB 5LD0A 1X9SB 3GUSA 1I9DA 5EPFA 4EF0A 2R5GA 5HR2A 1URMA 5ENUA 3W8JA 1ML6A 1R7HA 4MP4A 1EGOA 3IHQA 4JBBA 4K7NA 3RDWA 2JZSA 1V57A 2C3QA 6GSYA 3ZLPA 4O5RA 2L6CA 3GTUA 1EEJA 5JCWA 1YY7A 3D6IA 3P2AA 4IHUA 4POMA 5CRGA 4LMVA 3APQA 3GFKA 1XPVA 3UBKA 1G6WA 4QL7A 3VWUA 4G2EA 2O89A 1OE8A 3DVXA 2PERA 1K3LA 4E8HA 1GSQA 2R4VA 4XHMA 1R26A 3I43A 1XFLA 5H5SA 6GSXA 4ZBAA 2KOKA 2VOCA 2P0GA 4ECBA 2MMOA 3IV4A 5F0GA 3F4SA 1Z9HA 1GSUA 1KNGA 5G1LA 3ZTLA 3FHKA 1SKRB 4ACSA 3FR9A 1YEXA 3GRXA 4EXJA 1GUHA 2YZHA 5J41A 2N5AA 2C0FA 1VF4A 3TOTA 1B9YC 3ZITA 3QPMA 2BMXA 4YAPA 3F4RA 3GL3A 1S3DA 2AV4A 2OKAA 2E0QA 1M2BA 2IN3A 1GLQA 2DIYA 2VD1A 1FOVA 5HFIA 3H4KA 2K9FA 3QR6A 1AQWA 4KDXA 11GSA 2GVPA 1ERWA 3HVXA 2X8HA 5GSTA 1M9BA 4BWSA 4I8BA 3QCPA 16GSA 1R5PA 4D73A 4IQAA 2OADA 4WBJA 4OMVA 4GRFA 2C1YA 4IP1A 2AB6A 3PH9A 4PUAA 3IK9A 3BOAA 1OYJA 1S3CA 4NHWA 2A2SA 1FAAA 2X8CA 1T00A 1T4ZA 2KUCA 2WGRA 3FR3A 1HNAA 2L4QA 1JHBA 3HYPA 3HD5A 2VCXA 3LXTA 4L8EA 4POBA 3F8UA 4F2IA 5G5EA 5D9TA 1GUKA 2LEGA 1U3AA 4KH7A 4BWQA 2CVKA 5ECOB 3TGZA 3MWHA 1NSWA 2VLVA 3ZRDA 2F8FA 2WZ9A 1DUGA 1QFNA 1ILOA 1WOUA 2J23A 5F05A 2XC2A 3GKKA 3TCOA 1OC3A 2YJ7A 1A23A 1TXXA 3D0ZA 2R2JA 1X0RA 1GWCA 2NTOA 4KX4A 4ZL7A 5DJMA 3TJGA 3G9BA 3Q74A 2DLXA 3ZVJA 3E9JB 4E8EA 5ECKB 1GL8A 3HVSA 4MPGA 5CRWA 2IFQB 5DALA 4KNDA 1J08A 1GP1A 2IMKA 5A5KA 2VL2A 6GSTA 4PQIA 1RQMA 3ZFBA 1GSYA 2GLRA 2PVQA 2FWHA 1M9AA 2RIIA 4WBRD 5IOXA 3F6FA 2DMLA 2DC5A 5CNWA 4EC0A 4GXZA 2LTKA 3WGDA 1YKAA 3HY2A 1A2JA 4ZIJA 5J3RA 4LA1A 1AC1A 2WCIA 4K9ZA 2H6YA 1NHYA 2GZYA 2FWFA 4TVEA 4IP6A 5JWRB 3I9V2 2AUVA 1Z6NA 4FYBA 1ERTA 1ZCPA 2H74A 3NOFA 3VWVA 2C3NA 3TKPA 1GSFA 2J9HA 2LRNA 5IPGA 3ZMLA 2DSAA 3LJRA 3VK9A 1VF2A 2X8GA 2LQOA 5GZZB 1RK4A 5LNKe 3H8QA 5ECPB 1UVZA 2M72A 3F6DA 1HD2A 3PGTA 1XWCA 3C7MA 2C80A 2WB9A 5DAKA 2PU9C 5AIXA 2ZNMA 3I6AA 3D4TA 3E3EA 2XBIA 2YOIA 1WJKA 1F6MC 1EP7A 2B6MA 3SWLA 4PNGA 3RPNA 3RHBA 2H0GA 2VCQA 1H75A 4DSSA 3TJBA 2C4JA 3DEXA 2AYTA 4BPYA 4ZL8A 4IVFA 1SYXA 1ERUA 3GA4A 2WULA 3APOA 4EE0A 5DVBA 1XZOA 1TU7A 3HJOA 5C04A 2JSZA 10GSA 5DBQA 1TDIA 1V40A 2FNOA 2FCHA 2EIQA 5IQYA 3K8NA 3ZMKA 1KBNA 1B9XC 4L5LA 1TW9A 1Y25A 5HR0A 3KD0A 4GF0A 1AQVA 3E0UA 4JE1A 4IS0A 2RM5A 4OCFA 5IO2A 3UVHA 3ZIJA 2N5BA 2I81A 1YEPA 4X1UA 2H73A 3M8NA 4MJCA 2CZ3A 3GN3A 1WP0A 5DCGA 5F8BA 3Q19A 3EMPA 4ZBDA 1PA3A 2GQKA 1TRUA 2V2GA 4I6XA 5EVOA 4MJAA 3VWXA 3Q6OA 2H01A 4KSOA 4G19A 3DXBA 3JCML 3PR8A 2GSSA 4KCEA 1PL1A 3GL5A 4NHZA 2FD3A 2YANA 2CZ2A 2CAQA 1THOA 5FT3A 4IBPA 1G7EA 1GTUA 3P90A 3M3MA 1WWJA 4OO5A 1N8JA 1TKDB 3IR4A 4RQRA 2HRFA 5E4WA 2E2GA 2WDUA 1ZZYA 1BAYA 1THXA 3GKNA 1ZOFA 2HZFA 4NV2A 5GAND 2VD0A 2B7KA 2MBSA 3TKSA 2XPDA 3BCIA 2V6OA 2I1UA 4KDUA 5IMVA 1PL2A 4I97A 1FO5A 2VL3A 1UC7A 4KE3A 3WYWA 2V41A 1EZKA 4FIWA 3F3QA 2VM1A 2DJKA 3WGXA 2GZPA 1PD21 4GLTA 1Z6MA 3CBUA 3U6VA 4K8MA 1K0OA 4TR1A 4WETA 4IGJA 1GNWA 4MJBA 5G31A 3TJFA 3P7XA 5ECNB 3O76A 5IM9A 3H1NA 4PURA 2FWGA 2DJ3A 4WR5A 2IIYA 3F3RA 3VLNA 4PXOA 1F9MA 4TR3A 3GH9A 3QFBC 3TB2A 1MDJA 3CSIA 3EVIA 1VRSD 1DSBA 3CMIA 3V1WA 2R6KA 1B4PA 3CRTA 3M0FA 2QC7A 1JFUA 3GSSA 4V2LA 2R37A 2PUKC 20GSA 3QFAC 5ECMB 3G7IA 4FYUA 1WRYA 1R5AA 2IMFA 3FZ4A 4GSSA 3L9UA 1U88A 2YWNA 1PSQA 1M2DA 1T4YA 1W4VA 4RI7A 5D8IA 1HNBA 3DVWA 1LU4A 1GSEA 1EGRA 1O85A 4MH2A 4IJ3A 3F63A 1O81A 3FZ5A 1TI1A 4JU5A 4I5QA 1U6TA 2GS3A 2A4VA 4BA7A 3HA9A 1K0NA 4X0XA 1XW5A 3RHCA 1C72A 4PUFC 4KGIA 1SU9A 2GQMA 4AGSA 1X9MB 3GKMA 5GSSA 4L5OA 4F0BA 1VF1A 2BJXA 2VUPA 4TKYA 1J9BA 1EEMA 1F3AA 4TXOA 3ZREA 3KH9A 1OC9B 1BJXA 3F0IA 4RI6A 5J4UA 3UEMA 4HUAA 4HEA2 3KP8A 4Q5NA 3UOMA 2JU5A 1TU8A 2DJ0A 4XS6A 4TXOB 2NDOA 2AJQB 1KTEA 1TK5B 2LS5A 2REMA 3A2WA 2C0EA 4OFMA 1NW2A 3UBLA 5KEJA 1F3BA 4OD7A 1SJ6A 5FHIA 1R4WA 5HQPA 4N0ZA 4PNFA 1TI3A 5AISA 3A3TA 1FVJA 1XOAA 1ON4A 2PWJA 2YWIA 3IOSA 4MK3A 1GTAA 5JWQB 2NPBA 5A4VA 3UAPA 3W6GA 2QGVA 5D93A 4KW6A 4ECIA 2FA8A 5ECRB 3KTLA 1G0TA 4EDZA 4IJIA 4AJ6A 1FHEA 2MZCA 2RUFA 4K6XA 2PVOC 2M80A 4WR4A 4F0CA 2PN8A 4TR4A 5CAXA 3RAZA 2G2QA 4F9ZA 3S9FA 2PBJA 4MJEA 1ZYQB 1QQ2A 3G7YA 2LJRA 2JZRA 4TXVA 1JZWA 1OKDA 2HT9A 4LMWA 1MTCA 1EV9A 3LYKA 1M7TA 5A4WA 3DRNA 2H6XA 5H5RA 1TJDA 4K0GA 2X64A 4JR4A 4NAXA 3FZAA 4V2NA 2H71A 6GSVA 2VAFA 2H1DA 3CTFA 3TKQA 4MLYA 1X5DA 4MZCA 4O32A 1U87A 1VGLA 2YZUA 1XVWA 3MSZA 3PINA 7GSSA 2A2RA 3FRCA 3HJMA 2H0IA 2GDRA 2VLTA 2IFQA 3KJYA 3QOUA 1X5CA 1F2EA 1GRXA 1TTZA 3LG6A 5IMDA 1SL2B 3HJPA 2H75A 1PQNA 2O7KA 1AUCA 4KUNA 5D9VA 4XRAA 4KAEA 4GCIA 2NVLA 2O8VB 2H1BA 3HXSA 2K8SA 3FY7A 1BX9A 4HJ2A 2OE0A 4H86A 3TKRA 3KXOA 2C8UA 19GSA 2IMEA 3C8EA 3KMOA 2LJAA 3ERWA 5D96A 3M1GA 1HQOA 3LXZA 4HZ2A 2GSQA 3IC4A 4KSMA 3M9JA 3IRAA 5CO3A 2X99A 3C73A 4POLA 2VCVA 2NBSA 3WT2A 4TN8A 3LQ7A 2YJHA 2L57A 4CHSA 4PGTA 5B7CA 3TDGA 3FK8A 3MDKA 5LCZA 5G30A 2HFDA 1B48A 3L0HA 2B7JA 1I5GA 2GGTA 1OAZA 1ZYEA 3CXGA 3KEBA 2FLSA 3LFLA 2RM6A 4WXTA 1GULA 3AY8A 4TR0A 1X5EA 4I2TA 3L78A 4HI7A 4L0UA 1CQGA 2MBTA 2VCTA 1A0FA 2GSRA 2L6DA 3FW2A 1Z7PA 2L5OA 2L4CA 3CRUA 22GSA 3BD2A 1HNCA 1K0MA 3TJKA 1PGTA 5EL8A 1EWXA 4GTUA 5KN1A 4KA0A 4HOJA 2B1LA 3G7JA 2FHEA 2MMNA 1F37A 2FGXA 3ZVJD 3UJ1A 1GSSA 2KHPA 2VCWA 4OFTA 2HE3A 2L5LA 5CRHA 1TOFA 4EO3A 1O73A 1MDKA 2EC4A 5KN0A 1EP8A 4ZB9A 1YF1A 1SKSB 1XBSA 4MH3A 3A2XA 4OCEA 2QKEA 3M9KA 1SK0A 6GSWA 2VO4A 3Q18A 1IYIA 9GSSA 1M2AA 1XWAA 5AGYA 1BYEA 1V58A 2ES7A 4OWYA 2CV4A 3NZNA 1GUMA 3VI5A 4XCSA 1KEBA 3D5JA 1ACVA 3D22A 2AHEA 2MMAA 5JCUA 2WS2A 2OBKA 4TOPA 4HZ4A 5IOWA 1FG4A 5ID2B 4QL9A 4OO4A 1SENA 2GQLA 2OE3A 1XW6A 1XWKA 2F3MA 2KP1A 2HZEA 3ISOA 3GV1A 2VIMA 2C3TA 1AIUA 1U3IA 4Q5FA 2B3SA 2PPTA 4EUYA 2B5XA 2JADA 3HKRA 2B5EA 3VFIA 2ON7A 2WRTA 1Q4JA 1SD9A 3O3TA 1M99A 3US3A 2CA8A 4MZWA 2H6ZA 2HZEB 1PMTA 1XWBA 3BCKA 1WMJA 3GYKA 1A8YA 4MF6A 1E2YA 3QDNA 4MF7A 2V6KA 2RLIA 4N11A 2KLXA 5IMCA 3HVVA 5E59A 1TK0B 2C0DA 3EWLA 3C1RA 4EVMA 3KGKA 6GSSA 1FB0A 1DE2A 2DIZA 4MZBA 5HR3A 1GLPA 2TRCP 3BBYA 3FR6A 4EL1A 1PN9A 5JCGA 4XS4B 2YCDA 4NV5A 4FH8A 5DQYA 5G2ZA 3TUEA 5DQSA 3EE2A 2GT5A 1ST9A 2K18A 4O7HA 4XRDA 2O85A 2F9SA 4V1Ag 2H8LA 4GSTA 1TRSA 4MMMA 3EMXA 3KIJA 1YQ1A 3DYRA 5J9BA 4MF5A 2H0HA 4AJ7A 3GX0A 5HFKA 1PX6A 4WKWA 2VCZA 3GMFA 3MNGA 3GURA 3ME7A 4DEJA 4KDYA 1SJIA 1B4QA 2OJLA 3IAM2 2E2MA 4YQMA 2EIOA 2I4AA 5IO0A 3ERGA 4IELA 2GT6A 2E7PA 3WGEA 1OKTA 3P8WA 2H70A 1UN2A 3VPQA 4FO5A 2LQQA 5ECLB 2Z9SA 2WJUA 3TRQA 3VPTA 1SL0B 1UA5A 4YH2A 3I69A 2IMIA 3QAVA 1NHOA 3H79A 2ON5A 4LLRA 3D21A 1O6JA 3EC3A 1A24A 2ZUPA 1SD8A 2HSYA 1TRWA 2VL2C 1V2AA 4Q5RA 3KZQA 1WIKA 6GSUA 3UVTA 3IE3A 1EV4A 3GIXA 5DJLA 2AAWA 3IA1A 4BL7A 4NMUA 3W8SA 4NPBA 1BEDA 2LRCA 2LV3A 4CW9A 5IIZA 1K3YA 2FY6A 3H93A 1OC9A 1MEKA 5G5FA 1GH2A 3LSZA 4JRRA 2CX4A 2JSYA 3CSJA 4HU7A 4WF4A 4LL4B 3APSA 3LGCA 1USBA 1A8LA 5B8BA 4DSRA 3ZIVA 2CT6A 1SYRA 1BQ7A 3GTUB 1FW1A 2HI7A 3QD9A 4PX1A 5L71A 1SL1B 2H1AA
chains in the Genus database with same CATH superfamily
1MD3A 1AXDA 1O8WA 2CVBA 17GSA 3F4TA 4RQXA 3F9UA 1YF0A 3UARA 3DGQA 3TOUA 4GQFA 5COHA 5KN2A 1SKWB 1TP9A 3EURA 1XW9A 4EKZA 3ME8A 2I3YA 1K0BA 1XVQA 3GNJA 2GTUA 1T3BA 3UIWA 1K0AA 3LYPA 4K7IA 1J0FA 3ED3A 1T7PB 2DMMA 1V98A 3DD3A 1K0CA 5HR1A 3A5WA 2YV9A 2DJ2A 5B8AA 2LNSA 2PGTA 1TRVA 12GSA 4J2FA 2LKUA 3WD6A 3IAS2 2XBQA 5ECQB 1X9WB 2B1KA 4RUVA 2DBCA 4YQVA 3EYTA 1ZMAA 5G1KA 5B6MA 1G7OA 4IN0A 2H76A 4Z2TA 1GTIA 2LSTA 3HVNA 3KH7A 2OA7A 4YQUA 2JACA 1T8EB 3LORA 4K2DA 1SK1A 1XOBA 1XIYA 4L0WA 5ECSA 4POKA 3N5OA 1EOHA 3VWWA 4D73B 1ZGNA 2GZZA 4WEYA 3QAGA 4NXIA 1Z7RA 5ABRA 5IMFA 4YKGA 1TK8B 4KB3A 3WT1A 1YZXA 2N5FA 8GSSA 2MMZA 2M46A 4F82A 1V9WA 3GH6A 4NWYA 3GHAA 2F51A 3GSTA 2IJYA 2OBIA 1T1VA 3HCZA 1S3AA 2B5YA 2LNTA 3QMXA 4N10A 5J9CA 1YKCA 3RPPA 4V1Ap 2LUSA 2OACA 3N9JA 3IXRA 3FZ9A 1ABAA 4QQ7A 1VF3A 1MD4A 1XCCA 3QAWA 4YAVA 3DKSA 3FKFA 1SJZA 3UL3A 2X4AA 2HNLA 3U5RE 3IPZA 4JR6A 5JWOB 2YV7A 3FMWA 2MYGA 4DSQA 2DKHA 1WE0A 2DJ1A 4FYCA 5F07A 4K7OA 4N0VA 2TRXA 4J56E 1H4OA 2PMTA 3KM6A 1DE1A 4O92A 3GX8A 2EIRA 2DJJA 1Z3EA 14GSA 3CYNA 3HZ4A 4MA9A 4G9HA 3ZFLA 3VURA 3DIEA 5DALB 1QUWA 4GQCA 2P31A 3TKSC 1OC8A 1GTBA 3ERFA 5CREA 5HFGA 4K0NA 3VI7A 4ML1A 3KCMA 4ID0A 1LJRA 1ZYNA 5A4UA 3CSHA 2H72A 1DBYA 2V1MA 5IPHA 3ZZXA 3O6TA 1QMVA 4ILFA 2YN1A 5D73A 3HDCA 3TKSE 3DMLA 4JZQA 4Z2RA 5AIVA 2R0CA 2IPAA 4EDYA 3KMNA 2HSMA 3ZL5A 3R2QA 1Q98A 4OFNA 4KCAA 2XHFA 3RBTA 2LJKA 2RUEA 4HQSA 1XXUA 4ECCA 2FUG2 1ZL9A 5BRTA 1QXHA 2HYXA 4XS1A 3ZYWA 3DWVA 2HRNA 4HJMA 1FB6A 4PQHA 2HSHA 2OE1A 1JZDA 2IWTA 2H30A 1G6YA 1EOGA 1JLVA 18GSA 4MCUA 4WF5A 1XWGA 3GKXA 1OE7A 4MDCA 5ELGA 5D9WA 5ELAA 1BG5A 3EINA 5BMUA 2R3XA 3FYGA 1N2AA 5ID2A 4X4JA 1SK2A 2K6VA 5DAKB 3EU4A 5CYYA 4ULXA 2CQ9A 3A2VA 1FVKA 2XPEA 1JZOA 3TRXA 5B6NA 4HQZA 2VLUA 3TJJA 4ZL9A 4MPFA 1GNEA 1GSDA 2YP6A 5C00A 4HS1A 3HHVA 2GSTA 2P5QA 4DSSB 3NIVA 4PQ1A 4ZXGA 5KOWA 5EY6A 2BTOT 5AN1A 2ALBA 4IQ1A 2IL3A 4AF2A 3J7Yb 1Z5YE 4BVYA 2CX3A 1IYHA 4ML6A 1W89A 4K1FA 4MABA 13GSA 2C0GA 2YPMA 1YDKA 2QSIA 2F8AA 5IMAA 3C1SA 5DDLA 3L9SA 2A4HA 2H19A 5H5QA 1JLWA 1PKZA 4CDOA 1XG8A 5F06A 2VL9A 4XS4A 5CRDA 2QA2A 1OVNA 2L59A 4P3YB 5ECIB 3IBHA 2LRTA 2TIRA 5CP1A 3L4NA 4ZBBA 1E6BA 5GAPD 5DCHA 3BJ5A 1AW9A 2HXKA 5D9XA 4HU9A 4F03A 4TW5A 5IMZA 2IMDA 1CQHA 1B8XA 1K3OA 3D4MA 5FWGA 2JZTA 4Q5QA 1MDIA 2D2ZA 2ZCTA 4LL1B 1YJ6A 1NM3A 1Y6EA 1A0RP 2CAIA 2O87A 3MAKA 3L9VA 4DVCA 4G10A 1QK8A 4Z7XA 4ZB6A 1K0DA 5J5NA 4BVXA 1WPIA 1LBKA 2H1GA 2V32A 4V2MA 2FWEA 1HYUA 3LEFA 4IW9A 1PRXA 3KTBA 1AQXA 2VM2A 1AAZA 2YWMA 1PX7A 3EU3A 1A2LA 1O7UA 2YNXA 4J57E 1A2MA 4X43A 4ZILA 3OR5A 1JZRA 1RW1A 4ECJA 5KN3A 2A2PA 3TRPA 4XIHA 2K8VA 4ZB8A 2G0FA 2P5RA 4N30A 2H66A 4I2UA 3IK7A 1ERVA 1QGVA 3C71A 4GWRA 4JEDA 4TR1B 2CVDA 4IKHA 4GSNA 2JL4A 2KP2A 3LWAA 4TRXA 1PKWA 3J7Yk 2I9HA 1M0UA 4AJ8A 3CTGA 3SBCA 2HLSA 1O8XA 3IDVA 3UMAA 4HDEA 3HZ8A 4XTSA 2YWOA 5INYA 2WFCA 3FEUA 4YKFA 3KP9A 2FA4A 4ISDA 5ECHB 5LD0A 1X9SB 3GUSA 1I9DA 5EPFA 4EF0A 2R5GA 5HR2A 1URMA 5ENUA 3W8JA 1ML6A 1R7HA 4MP4A 1EGOA 3IHQA 4JBBA 4K7NA 3RDWA 2JZSA 1V57A 2C3QA 6GSYA 3ZLPA 4O5RA 2L6CA 3GTUA 1EEJA 5JCWA 1YY7A 3D6IA 3P2AA 4IHUA 4POMA 5CRGA 4LMVA 3APQA 3GFKA 1XPVA 3UBKA 1G6WA 4QL7A 3VWUA 4G2EA 2O89A 1OE8A 5KOXA 3DVXA 2PERA 1K3LA 4E8HA 1GSQA 2R4VA 4XHMA 1R26A 3I43A 1XFLA 4MNNA 5H5SA 6GSXA 4ZBAA 2KOKA 2VOCA 2P0GA 4ECBA 2MMOA 3IV4A 5F0GA 3F4SA 1Z9HA 1GSUA 3MYDA 1KNGA 5G1LA 3ZTLA 3FHKA 1SKRB 4ACSA 3FR9A 1YEXA 3GRXA 4EXJA 1GUHA 2YZHA 5J41A 2N5AA 2C0FA 1VF4A 3TOTA 1B9YC 3ZITA 3QPMA 2BMXA 4YAPA 3F4RA 3GL3A 1S3DA 2AV4A 2OKAA 2E0QA 1M2BA 2IN3A 1GLQA 2DIYA 2VD1A 1FOVA 5HFIA 3H4KA 2K9FA 3QR6A 1AQWA 4KDXA 11GSA 2GVPA 1ERWA 3HVXA 2X8HA 5GSTA 1M9BA 4BWSA 4I8BA 3QCPA 16GSA 1R5PA 4FQUA 4D73A 4IQAA 2OADA 4WBJA 2X49A 4OMVA 4GRFA 2C1YA 4IP1A 2AB6A 3PH9A 4PUAA 3IK9A 3BOAA 1OYJA 1S3CA 4NHWA 2A2SA 1FAAA 2X8CA 3PPUA 1T00A 1T4ZA 2KUCA 2WGRA 4A5PA 3FR3A 1S3RA 1HNAA 2L4QA 1JHBA 3HYPA 3HD5A 2VCXA 3LXTA 4L8EA 4POBA 3F8UA 4F2IA 5G5EA 5D9TA 1GUKA 2LEGA 1U3AA 4KH7A 4BWQA 2CVKA 5ECOB 3TGZA 3MWHA 1NSWA 2VLVA 3ZRDA 2F8FA 2WZ9A 1DUGA 4K2XA 1QFNA 1ILOA 1WOUA 2J23A 5F05A 2XC2A 3GKKA 3TCOA 1OC3A 2YJ7A 1A23A 1TXXA 3D0ZA 2R2JA 1X0RA 1GWCA 2NTOA 4KX4A 4ZL7A 5DJMA 3TJGA 3G9BA 3Q74A 2DLXA 3ZVJA 3E9JB 4E8EA 5ECKB 1GL8A 3HVSA 4MPGA 5CRWA 2IFQB 5DALA 4KNDA 1J08A 1GP1A 2IMKA 5A5KA 2VL2A 6GSTA 4PQIA 1RQMA 3ZFBA 1GSYA 2GLRA 2PVQA 2FWHA 1M9AA 2RIIA 4WBRD 5IOXA 3F6FA 2DMLA 2DC5A 5CNWA 4EC0A 4GXZA 2LTKA 3WGDA 1YKAA 3HY2A 1A2JA 4ZIJA 5J3RA 4LA1A 1AC1A 2WCIA 4K9ZA 2H6YA 1NHYA 2GZYA 2FWFA 4TVEA 4IP6A 5JWRB 3I9V2 2AUVA 1Z6NA 4FYBA 1ERTA 1ZCPA 1M3IA 2H74A 3NOFA 3VWVA 2C3NA 4USSA 3TKPA 1GSFA 2J9HA 2LRNA 5IPGA 3ZMLA 2DSAA 3LJRA 3VK9A 1VF2A 2X8GA 2LQOA 5GZZB 1RK4A 5LNKe 3H8QA 5ECPB 1UVZA 2M72A 4O5QA 3F6DA 1HD2A 3PGTA 1XWCA 3C7MA 2C80A 4G0LA 2WB9A 5DAKA 2PU9C 5AIXA 2ZNMA 2R0PA 3I6AA 3D4TA 2HRKA 3E3EA 2XBIA 2YOIA 1WJKA 1F6MC 1EP7A 2B6MA 3SWLA 4PNGA 3RPNA 3RHBA 2H0GA 2VCQA 1H75A 4DSSA 3TJBA 2C4JA 3DEXA 2AYTA 4BPYA 4ZL8A 4IVFA 1SYXA 1ERUA 3GA4A 2WULA 3APOA 4EE0A 5DVBA 1XZOA 1TU7A 3HJOA 5C04A 2JSZA 10GSA 2DKIA 5DBQA 1TDIA 1V40A 2FNOA 2FCHA 2EIQA 5IQYA 4K5SA 3K8NA 3ZMKA 1KBNA 1B9XC 4L5LA 1TW9A 1Y25A 5HR0A 3KD0A 4GF0A 1AQVA 3E0UA 4JE1A 4IS0A 2RM5A 4OCFA 5IO2A 3UVHA 3ZIJA 2N5BA 2I81A 1YEPA 4X1UA 2H73A 3M8NA 4MJCA 2CZ3A 3GN3A 1WP0A 5DCGA 5F8BA 3Q19A 3EMPA 4ZBDA 1PA3A 2GQKA 3IHGA 1TRUA 2V2GA 4I6XA 5EVOA 4MJAA 3VWXA 3Q6OA 2H01A 4KSOA 4G19A 3DXBA 3JCML 3PR8A 2GSSA 4KCEA 1PL1A 3GL5A 4NHZA 2FD3A 2YANA 2CZ2A 2CAQA 1THOA 5FT3A 4Z2UA 4IBPA 1G7EA 1GTUA 3P90A 3M3MA 1WWJA 4OO5A 1N8JA 1TKDB 3IR4A 4RQRA 2HRFA 5E4WA 2E2GA 2WDUA 1ZZYA 1BAYA 1THXA 3GKNA 1ZOFA 2HZFA 4NV2A 5GAND 2VD0A 2B7KA 2MBSA 3TKSA 2XPDA 3BCIA 2V6OA 2I1UA 4KDUA 5IMVA 1PL2A 4I97A 4EIPA 1FO5A 2VL3A 1UC7A 4KE3A 3WYWA 2V41A 1EZKA 4FIWA 3F3QA 2VM1A 2DJKA 3WGXA 2GZPA 1PD21 4GLTA 1Z6MA 3CBUA 3U6VA 4K8MA 1K0OA 4TR1A 4WETA 4IGJA 1GNWA 4MJBA 5G31A 3TJFA 3P7XA 5ECNB 3O76A 5IM9A 3H1NA 4PURA 2FWGA 2DJ3A 4WR5A 3LW9A 2IIYA 3F3RA 3VLNA 4PXOA 1F9MA 4TR3A 3GH9A 3QFBC 3TB2A 1MDJA 3CSIA 3EVIA 1VRSD 1DSBA 3CMIA 3V1WA 2R6KA 1B4PA 3CRTA 3M0FA 2QC7A 1JFUA 3GSSA 4V2LA 2R37A 2PUKC 20GSA 3QFAC 5ECMB 3G7IA 4FYUA 1WRYA 1R5AA 2IMFA 3FZ4A 4GSSA 3L9UA 1U88A 2YWNA 1PSQA 1M2DA 1T4YA 1W4VA 4RI7A 5D8IA 1HNBA 3DVWA 1LU4A 1M3JA 1GSEA 1EGRA 3CQFA 1O85A 4MH2A 4IJ3A 3F63A 1O81A 3FZ5A 1TI1A 4JU5A 4I5QA 1U6TA 2GS3A 2A4VA 4BA7A 3HA9A 1K0NA 4X0XA 1XW5A 3RHCA 1C72A 4PUFC 4KGIA 1SU9A 2GQMA 4AGSA 1X9MB 3GKMA 5GSSA 4BL7B 4L5OA 4F0BA 1VF1A 2BJXA 2VUPA 4TKYA 1J9BA 2UZ8A 1EEMA 1F3AA 4TXOA 3ZREA 3KH9A 1OC9B 1BJXA 3F0IA 4RI6A 5J4UA 3UEMA 4HUAA 4HEA2 3KP8A 4Q5NA 3UOMA 2JU5A 1TU8A 2DJ0A 4XS6A 4TXOB 2NDOA 2AJQB 1KTEA 1TK5B 2LS5A 2REMA 3A2WA 3A5IA 2C0EA 3EPTA 4OFMA 1NW2A 3UBLA 5KEJA 1F3BA 4OD7A 1SJ6A 5FHIA 1R4WA 4BIKA 5HQPA 2QA1A 4N0ZA 4PNFA 1TI3A 5AISA 3A3TA 1FVJA 1XOAA 1ON4A 2PWJA 2YWIA 3IOSA 1FOHA 4MK3A 1GTAA 5JWQB 2NPBA 5A4VA 3UAPA 3W6GA 2QGVA 5D93A 4KW6A 4ECIA 2FA8A 5ECRB 3KTLA 1G0TA 4EDZA 4IJIA 4AJ6A 1FHEA 2MZCA 2RUFA 4K6XA 2PVOC 2M80A 4WR4A 4F0CA 2PN8A 4TR4A 5CAXA 3RAZA 2G2QA 4F9ZA 3S9FA 2PBJA 4MJEA 1ZYQB 4KF9A 1QQ2A 3G7YA 2LJRA 2JZRA 4TXVA 1JZWA 1OKDA 2HT9A 4LMWA 1MTCA 1EV9A 3LYKA 1M7TA 5A4WA 3DRNA 2H6XA 5H5RA 1TJDA 4K0GA 2X64A 4JR4A 4NAXA 3FZAA 4V2NA 2H71A 6GSVA 2VAFA 2H1DA 3CTFA 1PN0A 4MLYA 3TKQA 1X5DA 4MZCA 4O32A 1U87A 1VGLA 2YZUA 1XVWA 3MSZA 3PINA 7GSSA 2A2RA 3FRCA 3HJMA 2H0IA 2GDRA 2VLTA 2IFQA 3KJYA 3QOUA 1X5CA 1F2EA 1GRXA 1TTZA 3LG6A 5IMDA 1SL2B 3HJPA 2H75A 1PQNA 2O7KA 1AUCA 4KUNA 5D9VA 4XRAA 4KAEA 4GCIA 2NVLA 2O8VB 2H1BA 3HXSA 2K8SA 3FY7A 1BX9A 4HJ2A 2OE0A 4H86A 3TKRA 3KXOA 2C8UA 19GSA 2IMEA 3C8EA 3KMOA 2LJAA 3ERWA 5D96A 3M1GA 1HQOA 3LXZA 4HZ2A 2GSQA 3IC4A 4ICYA 4KSMA 3M9JA 3IRAA 5CO3A 2X99A 3C73A 4POLA 4G0KA 2VCVA 2NBSA 3WT2A 4TN8A 3LQ7A 2YJHA 2L57A 4CHSA 4PGTA 5B7CA 3TDGA 3FK8A 3MDKA 5LCZA 5G30A 2HFDA 1B48A 3L0HA 2B7JA 1I5GA 2GGTA 1OAZA 1ZYEA 3CXGA 3KEBA 2FLSA 3LFLA 2RM6A 4WXTA 1GULA 3AY8A 4TR0A 1X5EA 4I2TA 4K5RA 3L78A 4HI7A 4L0UA 1CQGA 2MBTA 2VCTA 1A0FA 2GSRA 2L6DA 3FW2A 1Z7PA 2L5OA 2L4CA 3CRUA 22GSA 3BD2A 1HNCA 1K0MA 3TJKA 1PGTA 5EL8A 1EWXA 4GTUA 5KN1A 4KA0A 4HOJA 2B1LA 3G7JA 2FHEA 2MMNA 1F37A 2FGXA 3ZVJD 3UJ1A 1GSSA 2KHPA 2VCWA 4OFTA 2HE3A 2L5LA 5CRHA 1TOFA 4EO3A 1O73A 2HRAA 1MDKA 2EC4A 5KN0A 1EP8A 4ZB9A 1YF1A 1SKSB 1XBSA 4MH3A 3A2XA 4OCEA 2QKEA 3M9KA 1SK0A 6GSWA 2VO4A 3Q18A 1IYIA 9GSSA 1M2AA 1XWAA 5AGYA 1BYEA 1V58A 2ES7A 4OWYA 2CV4A 3NZNA 1GUMA 3VI5A 1ZYPA 4XCSA 1KEBA 3D5JA 1ACVA 3D22A 2AHEA 2MMAA 5JCUA 4CY8A 2WS2A 2OBKA 4TOPA 4HZ4A 5IOWA 1FG4A 5ID2B 4QL9A 4OO4A 1SENA 2GQLA 2OE3A 1XW6A 1XWKA 2F3MA 2KP1A 2HZEA 3ISOA 3GV1A 2VIMA 2C3TA 1AIUA 1U3IA 4Q5FA 2B3SA 2PPTA 4EUYA 2B5XA 2JADA 3HKRA 2B5EA 3VFIA 2ON7A 2WRTA 1Q4JA 1SD9A 3O3TA 1M99A 3US3A 2CA8A 4MZWA 2H6ZA 2HZEB 1PMTA 1XWBA 2R0GA 3BCKA 1WMJA 3GYKA 1A8YA 4MF6A 4O5UA 1E2YA 3QDNA 4MF7A 2V6KA 2RLIA 4N11A 2KLXA 4BVYB 5IMCA 3HVVA 5E59A 1TK0B 2C0DA 3EWLA 3C1RA 4EVMA 3KGKA 6GSSA 1FB0A 1DE2A 2DIZA 4MZBA 5HR3A 1GLPA 2TRCP 3BBYA 3FR6A 4EL1A 1PN9A 5JCGA 4XS4B 2YCDA 4G0IA 4NV5A 4FH8A 5DQYA 5G2ZA 3TUEA 5DQSA 3EE2A 2GT5A 1ST9A 2K18A 4O7HA 3IC8A 4XRDA 2O85A 2F9SA 4V1Ag 2H8LA 4GSTA 1TRSA 4MMMA 3EMXA 3R3EA 3KIJA 1YQ1A 3DYRA 5J9BA 4MF5A 2H0HA 4AJ7A 3GX0A 5HFKA 1PX6A 4WKWA 2VCZA 3GMFA 3MNGA 3GURA 3ME7A 4DEJA 4KDYA 1SJIA 1B4QA 2OJLA 3IAM2 2E2MA 4YQMA 2EIOA 4BVXB 2I4AA 5IO0A 3ERGA 4IELA 2GT6A 2E7PA 3WGEA 1OKTA 3P8WA 2H70A 1UN2A 3MIXA 4PTSA 3VPQA 4FO5A 2LQQA 5ECLB 2Z9SA 2WJUA 3TRQA 3VPTA 1SL0B 1UA5A 4YH2A 3I69A 2IMIA 3QAVA 1NHOA 3H79A 2ON5A 4LLRA 3D21A 1O6JA 3EC3A 1A24A 2ZUPA 1SD8A 2HSYA 1TRWA 1PFOA 2VL2C 1V2AA 4Q5RA 3KZQA 1WIKA 6GSUA 3UVTA 3IE3A 4HSCX 4EIQA 1EV4A 3GIXA 5DJLA 2AAWA 3IA1A 4BL7A 4NMUA 3W8SA 4NPBA 1BEDA 2LRCA 2LV3A 4CW9A 5IIZA 1K3YA 2FY6A 3H93A 1OC9A 1MEKA 5G5FA 1GH2A 3LSZA 4JRRA 2CX4A 2JSYA 3CSJA 4HU7A 4WF4A 4LL4B 3APSA 3LGCA 1USBA 1A8LA 5B8BA 4CY6A 4DSRA 3ZIVA 2CT6A 1SYRA 1BQ7A 3GTUB 1FW1A 2HI7A 3QD9A 4PX1A 5L71A 1SL1B 2H1AA
chains in the Genus database with same CATH topology
1MD3A 1AXDA 1O8WA 2CVBA 17GSA 3F4TA 4RQXA 3F9UA 1YF0A 3UARA 3DGQA 3TOUA 4GQFA 5COHA 5KN2A 1SKWB 1TP9A 3EURA 1XW9A 4EKZA 3ME8A 2I3YA 1K0BA 1XVQA 3GNJA 2GTUA 1T3BA 3UIWA 1K0AA 3LYPA 4K7IA 1J0FA 3ED3A 1T7PB 2DMMA 1V98A 3DD3A 1K0CA 5HR1A 3A5WA 2YV9A 2DJ2A 5B8AA 2LNSA 2PGTA 1TRVA 12GSA 4J2FA 2LKUA 3WD6A 3IAS2 2XBQA 5ECQB 1X9WB 2B1KA 4RUVA 2DBCA 4YQVA 3EYTA 1ZMAA 5G1KA 5B6MA 1G7OA 4IN0A 2H76A 4Z2TA 1GTIA 2LSTA 3KH7A 2OA7A 4YQUA 2JACA 1T8EB 3LORA 4K2DA 1SK1A 1XOBA 1XIYA 4L0WA 5ECSA 4POKA 3N5OA 1EOHA 3VWWA 4D73B 1ZGNA 2GZZA 4WEYA 3QAGA 4NXIA 1Z7RA 5ABRA 5IMFA 4YKGA 1TK8B 4KB3A 3WT1A 1YZXA 2N5FA 8GSSA 2MMZA 2M46A 4F82A 1V9WA 3GH6A 4NWYA 3GHAA 2F51A 3GSTA 2IJYA 2OBIA 1T1VA 3HCZA 1S3AA 2B5YA 2LNTA 3QMXA 4N10A 5J9CA 1YKCA 3RPPA 4V1Ap 2LUSA 2OACA 3N9JA 3IXRA 3FZ9A 1ABAA 4QQ7A 1VF3A 1MD4A 1XCCA 3QAWA 4YAVA 3DKSA 3FKFA 1SJZA 3UL3A 2X4AA 2HNLA 3U5RE 3IPZA 4JR6A 5JWOB 2YV7A 3FMWA 2MYGA 4DSQA 2DKHA 1WE0A 2DJ1A 4FYCA 5F07A 4K7OA 4N0VA 2TRXA 4J56E 1H4OA 2PMTA 3KM6A 1DE1A 4O92A 3GX8A 2EIRA 2DJJA 1Z3EA 14GSA 3CYNA 3HZ4A 4MA9A 4G9HA 3ZFLA 3VURA 3DIEA 5DALB 1QUWA 4GQCA 2P31A 3TKSC 1OC8A 1GTBA 3ERFA 5CREA 5HFGA 4K0NA 3VI7A 4ML1A 3KCMA 4ID0A 1LJRA 1ZYNA 5A4UA 3CSHA 2H72A 1DBYA 2V1MA 5IPHA 3ZZXA 3O6TA 1QMVA 4ILFA 2YN1A 5D73A 3HDCA 3TKSE 3DMLA 4JZQA 4Z2RA 5AIVA 2R0CA 2IPAA 4EDYA 3KMNA 2HSMA 3ZL5A 3R2QA 1Q98A 4OFNA 4KCAA 2XHFA 3RBTA 2LJKA 2RUEA 4HQSA 1XXUA 4ECCA 2FUG2 1ZL9A 5BRTA 1QXHA 2HYXA 4XS1A 3ZYWA 3DWVA 2HRNA 4HJMA 1FB6A 4PQHA 2HSHA 2OE1A 1JZDA 2IWTA 2H30A 1G6YA 1EOGA 1JLVA 18GSA 4MCUA 4WF5A 1XWGA 3GKXA 1OE7A 4MDCA 5ELGA 5D9WA 5ELAA 1BG5A 3EINA 5BMUA 2R3XA 3FYGA 1N2AA 5ID2A 4X4JA 1SK2A 2K6VA 5DAKB 3EU4A 5CYYA 4ULXA 2CQ9A 3A2VA 1FVKA 2XPEA 1JZOA 3TRXA 5B6NA 4HQZA 2VLUA 3TJJA 4ZL9A 4MPFA 1GNEA 1GSDA 2YP6A 5C00A 4HS1A 3HHVA 2GSTA 2P5QA 4DSSB 3NIVA 4PQ1A 4ZXGA 5KOWA 5EY6A 2BTOT 5AN1A 2ALBA 4IQ1A 2IL3A 4AF2A 3J7Yb 1Z5YE 4BVYA 2CX3A 1IYHA 4ML6A 1W89A 4K1FA 4MABA 13GSA 2C0GA 2YPMA 1YDKA 2QSIA 2F8AA 5IMAA 3C1SA 5DDLA 3L9SA 2A4HA 2H19A 5H5QA 1JLWA 1PKZA 4CDOA 5F06A 2VL9A 4XS4A 5CRDA 2QA2A 1OVNA 2L59A 4P3YB 5ECIB 3IBHA 2LRTA 2TIRA 5CP1A 3L4NA 4ZBBA 1E6BA 5GAPD 5DCHA 3BJ5A 1AW9A 2HXKA 5D9XA 4HU9A 4F03A 4TW5A 5IMZA 2IMDA 1CQHA 1B8XA 1K3OA 3D4MA 5FWGA 2JZTA 4Q5QA 1MDIA 2D2ZA 2ZCTA 4LL1B 1YJ6A 1NM3A 1Y6EA 1A0RP 2CAIA 2O87A 3MAKA 3L9VA 4DVCA 4G10A 1QK8A 4Z7XA 4ZB6A 1K0DA 5J5NA 4BVXA 1WPIA 1LBKA 2H1GA 2V32A 4V2MA 2FWEA 1HYUA 3LEFA 4IW9A 1PRXA 3KTBA 1AQXA 2VM2A 1AAZA 2YWMA 1PX7A 3EU3A 1A2LA 1O7UA 2YNXA 4J57E 1A2MA 4X43A 4ZILA 3OR5A 1JZRA 1RW1A 4ECJA 5KN3A 2A2PA 3TRPA 4XIHA 2K8VA 4ZB8A 2G0FA 2P5RA 4N30A 2H66A 4I2UA 3IK7A 1ERVA 1QGVA 3C71A 4GWRA 4JEDA 4TR1B 2CVDA 4IKHA 4GSNA 2JL4A 2KP2A 3LWAA 4TRXA 1PKWA 3J7Yk 2I9HA 1M0UA 4AJ8A 3CTGA 3SBCA 2HLSA 1O8XA 3IDVA 3UMAA 4HDEA 3HZ8A 4XTSA 2YWOA 5INYA 2WFCA 3FEUA 4YKFA 3KP9A 2FA4A 4ISDA 5ECHB 5LD0A 1X9SB 3GUSA 1I9DA 5EPFA 4EF0A 2R5GA 5HR2A 1URMA 5ENUA 3W8JA 1ML6A 1R7HA 4MP4A 1EGOA 3IHQA 4JBBA 4K7NA 3RDWA 2JZSA 1V57A 2C3QA 6GSYA 3ZLPA 4O5RA 2L6CA 3GTUA 1EEJA 5JCWA 1YY7A 3D6IA 3P2AA 4IHUA 4POMA 5CRGA 4LMVA 3APQA 3GFKA 1XPVA 3UBKA 1G6WA 4QL7A 3VWUA 4G2EA 2O89A 1OE8A 5KOXA 3DVXA 2PERA 1K3LA 4E8HA 1GSQA 2R4VA 4XHMA 1R26A 3I43A 1XFLA 4MNNA 5H5SA 6GSXA 4ZBAA 2KOKA 2VOCA 2P0GA 4ECBA 2MMOA 3IV4A 5F0GA 3F4SA 1Z9HA 1GSUA 3MYDA 1KNGA 5G1LA 3ZTLA 3FHKA 1SKRB 4ACSA 3FR9A 1YEXA 3GRXA 4EXJA 1GUHA 2YZHA 5J41A 2N5AA 2C0FA 1VF4A 3TOTA 1B9YC 3ZITA 3QPMA 2BMXA 4YAPA 3F4RA 3GL3A 1S3DA 2AV4A 2OKAA 2E0QA 1M2BA 2IN3A 1GLQA 2DIYA 2VD1A 1FOVA 5HFIA 3H4KA 2K9FA 3QR6A 1AQWA 4KDXA 11GSA 2GVPA 1ERWA 3HVXA 2X8HA 5GSTA 1M9BA 4BWSA 4I8BA 3QCPA 16GSA 1R5PA 4FQUA 4D73A 4IQAA 2OADA 4WBJA 2X49A 4OMVA 4GRFA 2C1YA 4IP1A 2AB6A 3PH9A 4PUAA 3IK9A 3BOAA 1OYJA 1S3CA 4NHWA 2A2SA 1FAAA 2X8CA 3PPUA 1T00A 1T4ZA 2KUCA 2WGRA 4A5PA 3FR3A 1HNAA 2L4QA 1JHBA 3HYPA 3HD5A 2VCXA 3LXTA 4L8EA 4POBA 3F8UA 4F2IA 5G5EA 5D9TA 1GUKA 2LEGA 1U3AA 4KH7A 4BWQA 2CVKA 5ECOB 3TGZA 3MWHA 1NSWA 2VLVA 3ZRDA 2F8FA 2WZ9A 1DUGA 4K2XA 1QFNA 1ILOA 1WOUA 2J23A 5F05A 2XC2A 3GKKA 3TCOA 1OC3A 2YJ7A 1A23A 1TXXA 3D0ZA 2R2JA 1X0RA 1GWCA 2NTOA 4KX4A 4ZL7A 5DJMA 3TJGA 3G9BA 3Q74A 2DLXA 3ZVJA 3E9JB 4E8EA 5ECKB 1GL8A 3HVSA 4MPGA 5CRWA 2IFQB 5DALA 4KNDA 1J08A 1GP1A 2IMKA 5A5KA 2VL2A 6GSTA 4PQIA 1RQMA 3ZFBA 1GSYA 2GLRA 2PVQA 2FWHA 1M9AA 2RIIA 4WBRD 5IOXA 3F6FA 2DMLA 2DC5A 5CNWA 4EC0A 4GXZA 2LTKA 3WGDA 1YKAA 3HY2A 1A2JA 4ZIJA 5J3RA 4LA1A 1AC1A 2WCIA 4K9ZA 2H6YA 1NHYA 2GZYA 2FWFA 4TVEA 4IP6A 5JWRB 3I9V2 2AUVA 1Z6NA 4FYBA 1ERTA 1ZCPA 2H74A 3NOFA 3VWVA 2C3NA 4USSA 3TKPA 1GSFA 2J9HA 2LRNA 5IPGA 3ZMLA 2DSAA 3LJRA 3VK9A 1VF2A 2X8GA 2LQOA 5GZZB 1RK4A 5LNKe 3H8QA 5ECPB 1UVZA 2M72A 4O5QA 3F6DA 1HD2A 3PGTA 1XWCA 3C7MA 2C80A 4G0LA 2WB9A 5DAKA 2PU9C 5AIXA 2ZNMA 2R0PA 3I6AA 3D4TA 2HRKA 3E3EA 2XBIA 2YOIA 1WJKA 1F6MC 1EP7A 2B6MA 3SWLA 4PNGA 3RPNA 3RHBA 2H0GA 2VCQA 1H75A 4DSSA 3TJBA 2C4JA 3DEXA 2AYTA 4BPYA 4ZL8A 4IVFA 1SYXA 1ERUA 3GA4A 2WULA 3APOA 4EE0A 5DVBA 1XZOA 1TU7A 3HJOA 5C04A 2JSZA 10GSA 2DKIA 5DBQA 1TDIA 1V40A 2FNOA 2FCHA 2EIQA 5IQYA 4K5SA 3K8NA 3ZMKA 1KBNA 1B9XC 4L5LA 1TW9A 1Y25A 5HR0A 3KD0A 4GF0A 1AQVA 3E0UA 4JE1A 4IS0A 2RM5A 4OCFA 5IO2A 3UVHA 3ZIJA 2N5BA 2I81A 1YEPA 4X1UA 2H73A 3M8NA 4MJCA 2CZ3A 3GN3A 1WP0A 5DCGA 5F8BA 3Q19A 3EMPA 4ZBDA 1PA3A 2GQKA 3IHGA 1TRUA 2V2GA 4I6XA 5EVOA 4MJAA 3VWXA 3Q6OA 2H01A 4KSOA 4G19A 3DXBA 3JCML 3PR8A 2GSSA 4KCEA 1PL1A 3GL5A 4NHZA 2FD3A 2YANA 2CZ2A 2CAQA 1THOA 5FT3A 4Z2UA 4IBPA 1G7EA 1GTUA 3P90A 3M3MA 1WWJA 4OO5A 1N8JA 1TKDB 3IR4A 4RQRA 2HRFA 5E4WA 2E2GA 2WDUA 1ZZYA 1BAYA 1THXA 3GKNA 1ZOFA 2HZFA 4NV2A 5GAND 2VD0A 2B7KA 2MBSA 3TKSA 2XPDA 3BCIA 2V6OA 2I1UA 4KDUA 5IMVA 1PL2A 4I97A 4EIPA 1FO5A 2VL3A 1UC7A 4KE3A 3WYWA 2V41A 1EZKA 4FIWA 3F3QA 2VM1A 2DJKA 3WGXA 2GZPA 1PD21 4GLTA 1Z6MA 3CBUA 3U6VA 4K8MA 1K0OA 4TR1A 4WETA 4IGJA 1GNWA 4MJBA 5G31A 3TJFA 3P7XA 5ECNB 3O76A 5IM9A 3H1NA 4PURA 2FWGA 2DJ3A 4WR5A 3LW9A 2IIYA 3F3RA 3VLNA 4PXOA 1F9MA 4TR3A 3GH9A 3QFBC 3TB2A 1MDJA 3CSIA 3EVIA 1VRSD 1DSBA 3CMIA 3V1WA 2R6KA 1B4PA 3CRTA 3M0FA 2QC7A 1JFUA 3GSSA 4V2LA 2R37A 2PUKC 20GSA 3QFAC 5ECMB 3G7IA 4FYUA 1WRYA 1R5AA 2IMFA 3FZ4A 4GSSA 3L9UA 1U88A 2YWNA 1PSQA 1M2DA 1T4YA 1W4VA 4RI7A 5D8IA 1HNBA 3DVWA 1LU4A 1GSEA 1EGRA 1O85A 4MH2A 4IJ3A 3F63A 1O81A 3FZ5A 1TI1A 4JU5A 4I5QA 1U6TA 2GS3A 2A4VA 4BA7A 3HA9A 1K0NA 4X0XA 1XW5A 3RHCA 1C72A 4PUFC 4KGIA 1SU9A 2GQMA 4AGSA 1X9MB 3GKMA 5GSSA 4BL7B 4L5OA 4F0BA 1VF1A 2BJXA 2VUPA 4TKYA 1J9BA 2UZ8A 1EEMA 1F3AA 4TXOA 3ZREA 3KH9A 1OC9B 1BJXA 3F0IA 4RI6A 5J4UA 3UEMA 4HUAA 4HEA2 3KP8A 4Q5NA 3UOMA 2JU5A 1TU8A 2DJ0A 4XS6A 4TXOB 2NDOA 2AJQB 1KTEA 1TK5B 2LS5A 2REMA 3A2WA 3A5IA 2C0EA 3EPTA 4OFMA 1NW2A 3UBLA 5KEJA 1F3BA 4OD7A 1SJ6A 5FHIA 1R4WA 5HQPA 2QA1A 4N0ZA 4PNFA 1TI3A 5AISA 3A3TA 1FVJA 1XOAA 1ON4A 2PWJA 2YWIA 3IOSA 1FOHA 4MK3A 1GTAA 5JWQB 2NPBA 5A4VA 3UAPA 3W6GA 2QGVA 5D93A 4KW6A 4ECIA 2FA8A 5ECRB 3KTLA 1G0TA 4EDZA 4IJIA 4AJ6A 1FHEA 2MZCA 2RUFA 4K6XA 2PVOC 2M80A 4WR4A 4F0CA 2PN8A 4TR4A 5CAXA 3RAZA 2G2QA 4F9ZA 3S9FA 2PBJA 4MJEA 1ZYQB 4KF9A 1QQ2A 3G7YA 2LJRA 2JZRA 4TXVA 1JZWA 1OKDA 2HT9A 4LMWA 1MTCA 1EV9A 3LYKA 1M7TA 5A4WA 3DRNA 2H6XA 5H5RA 1TJDA 4K0GA 2X64A 4JR4A 4NAXA 3FZAA 4V2NA 2H71A 6GSVA 2VAFA 2H1DA 3CTFA 1PN0A 4MLYA 3TKQA 1X5DA 4MZCA 4O32A 1U87A 1VGLA 2YZUA 1XVWA 3MSZA 3PINA 7GSSA 2A2RA 3FRCA 3HJMA 2H0IA 2GDRA 2VLTA 2IFQA 3KJYA 3QOUA 1X5CA 1F2EA 1GRXA 1TTZA 3LG6A 5IMDA 1SL2B 3HJPA 2H75A 1PQNA 2O7KA 1AUCA 4KUNA 5D9VA 4XRAA 4KAEA 4GCIA 2NVLA 2O8VB 2H1BA 3HXSA 2K8SA 3FY7A 1BX9A 4HJ2A 2OE0A 4H86A 3TKRA 3KXOA 2C8UA 19GSA 2IMEA 3C8EA 3KMOA 2LJAA 3ERWA 5D96A 3M1GA 1HQOA 3LXZA 4HZ2A 2GSQA 3IC4A 4ICYA 4KSMA 3M9JA 3IRAA 5CO3A 2X99A 3C73A 4POLA 4G0KA 2VCVA 2NBSA 3WT2A 4TN8A 3LQ7A 2YJHA 2L57A 4CHSA 4PGTA 5B7CA 3TDGA 3FK8A 3MDKA 5LCZA 5G30A 2HFDA 1B48A 3L0HA 2B7JA 1I5GA 2GGTA 1OAZA 1ZYEA 3CXGA 3KEBA 2FLSA 3LFLA 2RM6A 4WXTA 1GULA 3AY8A 4TR0A 1X5EA 4I2TA 4K5RA 3L78A 4HI7A 4L0UA 1CQGA 2MBTA 2VCTA 1A0FA 2GSRA 2L6DA 3FW2A 1Z7PA 2L5OA 2L4CA 3CRUA 22GSA 3BD2A 1HNCA 1K0MA 3TJKA 1PGTA 5EL8A 1EWXA 4GTUA 5KN1A 4KA0A 4HOJA 2B1LA 3G7JA 2FHEA 2MMNA 1F37A 2FGXA 3ZVJD 3UJ1A 1GSSA 2KHPA 2VCWA 4OFTA 2HE3A 2L5LA 5CRHA 1TOFA 4EO3A 1O73A 2HRAA 1MDKA 2EC4A 5KN0A 1EP8A 4ZB9A 1YF1A 1SKSB 1XBSA 4MH3A 3A2XA 4OCEA 2QKEA 3M9KA 1SK0A 6GSWA 2VO4A 3Q18A 1IYIA 9GSSA 1M2AA 1XWAA 5AGYA 1BYEA 1V58A 2ES7A 4OWYA 2CV4A 3NZNA 1GUMA 3VI5A 1ZYPA 4XCSA 1KEBA 3D5JA 1ACVA 3D22A 2AHEA 2MMAA 5JCUA 4CY8A 2WS2A 2OBKA 4TOPA 4HZ4A 5IOWA 1FG4A 5ID2B 4QL9A 4OO4A 1SENA 2GQLA 2OE3A 1XW6A 1XWKA 2F3MA 2KP1A 2HZEA 3ISOA 3GV1A 2VIMA 2C3TA 1AIUA 1U3IA 4Q5FA 2B3SA 2PPTA 4EUYA 2B5XA 2JADA 3HKRA 2B5EA 3VFIA 2ON7A 2WRTA 1Q4JA 1SD9A 3O3TA 1M99A 3US3A 2CA8A 4MZWA 2H6ZA 2HZEB 1PMTA 1XWBA 2R0GA 3BCKA 1WMJA 3GYKA 1A8YA 4MF6A 4O5UA 1E2YA 3QDNA 4MF7A 2V6KA 2RLIA 4N11A 2KLXA 4BVYB 5IMCA 3HVVA 5E59A 1TK0B 2C0DA 3EWLA 3C1RA 4EVMA 3KGKA 6GSSA 1FB0A 1DE2A 2DIZA 4MZBA 5HR3A 1GLPA 2TRCP 3BBYA 3FR6A 4EL1A 1PN9A 5JCGA 4XS4B 2YCDA 4G0IA 4NV5A 4FH8A 5DQYA 5G2ZA 3TUEA 5DQSA 3EE2A 2GT5A 1ST9A 2K18A 4O7HA 3IC8A 4XRDA 2O85A 2F9SA 4V1Ag 2H8LA 4GSTA 1TRSA 4MMMA 3EMXA 3R3EA 3KIJA 1YQ1A 3DYRA 5J9BA 4MF5A 2H0HA 4AJ7A 3GX0A 5HFKA 1PX6A 4WKWA 2VCZA 3GMFA 3MNGA 3GURA 3ME7A 4DEJA 4KDYA 1SJIA 1B4QA 2OJLA 3IAM2 2E2MA 4YQMA 2EIOA 4BVXB 2I4AA 5IO0A 3ERGA 4IELA 2GT6A 2E7PA 3WGEA 1OKTA 3P8WA 2H70A 1UN2A 3MIXA 4PTSA 3VPQA 4FO5A 2LQQA 5ECLB 2Z9SA 2WJUA 3TRQA 3VPTA 1SL0B 1UA5A 4YH2A 3I69A 2IMIA 3QAVA 1NHOA 3H79A 2ON5A 4LLRA 3D21A 1O6JA 3EC3A 1A24A 2ZUPA 1SD8A 2HSYA 1TRWA 2VL2C 1V2AA 4Q5RA 3KZQA 1WIKA 6GSUA 3UVTA 3IE3A 4EIQA 1EV4A 3GIXA 5DJLA 2AAWA 3IA1A 4BL7A 4NMUA 3W8SA 4NPBA 1BEDA 2LRCA 2LV3A 4CW9A 5IIZA 1K3YA 2FY6A 3H93A 1OC9A 1MEKA 5G5FA 1GH2A 3LSZA 4JRRA 2CX4A 2JSYA 3CSJA 4HU7A 4WF4A 4LL4B 3APSA 3LGCA 1USBA 1A8LA 5B8BA 4CY6A 4DSRA 3ZIVA 2CT6A 1SYRA 1BQ7A 3GTUB 1FW1A 2HI7A 3QD9A 4PX1A 5L71A 1SL1B 2H1AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MD3 A;  1AXD A;  1O8W A;  2CVB A;  17GS A;  3F4T A;  4RQX A;  3F9U A;  1YF0 A;  3UAR A;  3DGQ A;  3TOU A;  4GQF A;  5COH A;  5KN2 A;  1SKW B;  1TP9 A;  3EUR A;  1XW9 A;  4EKZ A;  3ME8 A;  2I3Y A;  1K0B A;  1XVQ A;  3GNJ A;  2GTU A;  1T3B A;  3UIW A;  1K0A A;  3LYP A;  4K7I A;  1J0F A;  3ED3 A;  1T7P B;  2DMM A;  1V98 A;  3DD3 A;  1K0C A;  5HR1 A;  3A5W A;  2YV9 A;  2DJ2 A;  5B8A A;  2LNS A;  2PGT A;  1TRV A;  12GS A;  4J2F A;  2LKU A;  3WD6 A;  3IAS 2;  2XBQ A;  5ECQ B;  1X9W B;  2B1K A;  4RUV A;  2DBC A;  4YQV A;  3EYT A;  1ZMA A;  5G1K A;  5B6M A;  1G7O A;  4IN0 A;  2H76 A;  1GTI A;  2LST A;  3KH7 A;  2OA7 A;  4YQU A;  2JAC A;  1T8E B;  3LOR A;  4K2D A;  1SK1 A;  1XOB A;  1XIY A;  4L0W A;  5ECS A;  4POK A;  3N5O A;  1EOH A;  3VWW A;  4D73 B;  1ZGN A;  2GZZ A;  4WEY A;  3QAG A;  4NXI A;  1Z7R A;  5ABR A;  5IMF A;  1TK8 B;  4KB3 A;  3WT1 A;  1YZX A;  2N5F A;  8GSS A;  2MMZ A;  2M46 A;  4F82 A;  1V9W A;  3GH6 A;  4NWY A;  3GHA A;  2F51 A;  3GST A;  2IJY A;  2OBI A;  1T1V A;  3HCZ A;  1S3A A;  2B5Y A;  2LNT A;  3QMX A;  4N10 A;  5J9C A;  1YKC A;  3RPP A;  4V1A p;  2LUS A;  2OAC A;  3N9J A;  3IXR A;  3FZ9 A;  1ABA A;  4QQ7 A;  1VF3 A;  1MD4 A;  1XCC A;  3QAW A;  4YAV A;  3DKS A;  3FKF A;  1SJZ A;  3UL3 A;  2HNL A;  3U5R E;  3IPZ A;  4JR6 A;  5JWO B;  2YV7 A;  2MYG A;  4DSQ A;  1WE0 A;  2DJ1 A;  4FYC A;  5F07 A;  4K7O A;  4N0V A;  2TRX A;  4J56 E;  1H4O A;  2PMT A;  3KM6 A;  1DE1 A;  4O92 A;  3GX8 A;  2EIR A;  2DJJ A;  1Z3E A;  14GS A;  3CYN A;  3HZ4 A;  4MA9 A;  4G9H A;  3ZFL A;  3VUR A;  3DIE A;  5DAL B;  1QUW A;  4GQC A;  2P31 A;  3TKS C;  1OC8 A;  1GTB A;  3ERF A;  5CRE A;  5HFG A;  4K0N A;  3VI7 A;  4ML1 A;  3KCM A;  4ID0 A;  1LJR A;  5A4U A;  3CSH A;  2H72 A;  1DBY A;  2V1M A;  5IPH A;  3ZZX A;  3O6T A;  1QMV A;  4ILF A;  2YN1 A;  5D73 A;  3HDC A;  3TKS E;  3DML A;  4JZQ A;  5AIV A;  2IPA A;  4EDY A;  3KMN A;  3ZL5 A;  3R2Q A;  1Q98 A;  4OFN A;  4KCA A;  2XHF A;  3RBT A;  2LJK A;  2RUE A;  4HQS A;  1XXU A;  4ECC A;  2FUG 2;  1ZL9 A;  1QXH A;  2HYX A;  4XS1 A;  3ZYW A;  3DWV A;  2HRN A;  4HJM A;  1FB6 A;  4PQH A;  2HSH A;  2OE1 A;  1JZD A;  2IWT A;  2H30 A;  1G6Y A;  1EOG A;  1JLV A;  18GS A;  4MCU A;  4WF5 A;  1XWG A;  3GKX A;  1OE7 A;  4MDC A;  5ELG A;  5D9W A;  5ELA A;  1BG5 A;  3EIN A;  2R3X A;  3FYG A;  1N2A A;  5ID2 A;  1SK2 A;  2K6V A;  5DAK B;  3EU4 A;  5CYY A;  4ULX A;  2CQ9 A;  3A2V A;  1FVK A;  2XPE A;  1JZO A;  3TRX A;  5B6N A;  4HQZ A;  2VLU A;  3TJJ A;  4ZL9 A;  4MPF A;  1GNE A;  1GSD A;  2YP6 A;  5C00 A;  4HS1 A;  3HHV A;  2GST A;  2P5Q A;  4DSS B;  3NIV A;  4PQ1 A;  4ZXG A;  5EY6 A;  2BTO T;  5AN1 A;  2ALB A;  4IQ1 A;  2IL3 A;  4AF2 A;  3J7Y b;  1Z5Y E;  4BVY A;  2CX3 A;  1IYH A;  4ML6 A;  1W89 A;  4K1F A;  4MAB A;  13GS A;  2C0G A;  2YPM A;  1YDK A;  2QSI A;  2F8A A;  5IMA A;  3C1S A;  5DDL A;  3L9S A;  2H19 A;  5H5Q A;  1JLW A;  1PKZ A;  4CDO A;  5F06 A;  2VL9 A;  4XS4 A;  5CRD A;  1OVN A;  2L59 A;  4P3Y B;  5ECI B;  3IBH A;  2LRT A;  2TIR A;  5CP1 A;  3L4N A;  4ZBB A;  1E6B A;  5GAP D;  5DCH A;  3BJ5 A;  1AW9 A;  2HXK A;  5D9X A;  4HU9 A;  4F03 A;  4TW5 A;  5IMZ A;  2IMD A;  1CQH A;  1B8X A;  1K3O A;  3D4M A;  5FWG A;  2JZT A;  4Q5Q A;  1MDI A;  2D2Z A;  2ZCT A;  4LL1 B;  1YJ6 A;  1NM3 A;  1Y6E A;  1A0R P;  2CAI A;  2O87 A;  3MAK A;  3L9V A;  4DVC A;  4G10 A;  1QK8 A;  4Z7X A;  4ZB6 A;  1K0D A;  5J5N A;  4BVX A;  1WPI A;  1LBK A;  2H1G A;  2V32 A;  4V2M A;  2FWE A;  1HYU A;  3LEF A;  4IW9 A;  1PRX A;  3KTB A;  1AQX A;  2VM2 A;  1AAZ A;  2YWM A;  1PX7 A;  3EU3 A;  1A2L A;  1O7U A;  2YNX A;  4J57 E;  1A2M A;  4X43 A;  4ZIL A;  3OR5 A;  1JZR A;  1RW1 A;  4ECJ A;  5KN3 A;  3TRP A;  4XIH A;  2K8V A;  4ZB8 A;  2G0F A;  2P5R A;  4N30 A;  2H66 A;  4I2U A;  3IK7 A;  1ERV A;  1QGV A;  3C71 A;  4GWR A;  4JED A;  4TR1 B;  2CVD A;  4IKH A;  4GSN A;  2JL4 A;  2KP2 A;  3LWA A;  4TRX A;  1PKW A;  3J7Y k;  2I9H A;  1M0U A;  4AJ8 A;  3CTG A;  3SBC A;  2HLS A;  1O8X A;  3IDV A;  3UMA A;  4HDE A;  3HZ8 A;  4XTS A;  2YWO A;  5INY A;  2WFC A;  3FEU A;  3KP9 A;  2FA4 A;  4ISD A;  5ECH B;  5LD0 A;  1X9S B;  3GUS A;  1I9D A;  5EPF A;  4EF0 A;  2R5G A;  5HR2 A;  1URM A;  5ENU A;  3W8J A;  1ML6 A;  1R7H A;  4MP4 A;  1EGO A;  3IHQ A;  4JBB A;  4K7N A;  3RDW A;  2JZS A;  1V57 A;  2C3Q A;  6GSY A;  3ZLP A;  4O5R A;  2L6C A;  3GTU A;  1EEJ A;  5JCW A;  1YY7 A;  3D6I A;  3P2A A;  4IHU A;  4POM A;  5CRG A;  4LMV A;  3APQ A;  3GFK A;  1XPV A;  3UBK A;  1G6W A;  4QL7 A;  3VWU A;  4G2E A;  2O89 A;  1OE8 A;  3DVX A;  2PER A;  1K3L A;  4E8H A;  1GSQ A;  2R4V A;  4XHM A;  1R26 A;  3I43 A;  1XFL A;  5H5S A;  6GSX A;  4ZBA A;  2KOK A;  2VOC A;  2P0G A;  4ECB A;  2MMO A;  3IV4 A;  5F0G A;  3F4S A;  1Z9H A;  1GSU A;  1KNG A;  5G1L A;  3ZTL A;  3FHK A;  1SKR B;  4ACS A;  3FR9 A;  1YEX A;  3GRX A;  4EXJ A;  1GUH A;  2YZH A;  5J41 A;  2N5A A;  2C0F A;  1VF4 A;  3TOT A;  1B9Y C;  3ZIT A;  3QPM A;  2BMX A;  4YAP A;  3F4R A;  3GL3 A;  1S3D A;  2AV4 A;  2OKA A;  2E0Q A;  1M2B A;  2IN3 A;  1GLQ A;  2DIY A;  2VD1 A;  1FOV A;  5HFI A;  3H4K A;  2K9F A;  3QR6 A;  1AQW A;  4KDX A;  11GS A;  2GVP A;  1ERW A;  3HVX A;  2X8H A;  5GST A;  1M9B A;  4BWS A;  4I8B A;  3QCP A;  16GS A;  1R5P A;  4D73 A;  4IQA A;  2OAD A;  4WBJ A;  4OMV A;  4GRF A;  2C1Y A;  4IP1 A;  2AB6 A;  3PH9 A;  4PUA A;  3IK9 A;  3BOA A;  1OYJ A;  1S3C A;  4NHW A;  2A2S A;  1FAA A;  2X8C A;  1T00 A;  1T4Z A;  2KUC A;  2WGR A;  3FR3 A;  1HNA A;  2L4Q A;  1JHB A;  3HYP A;  3HD5 A;  2VCX A;  3LXT A;  4L8E A;  4POB A;  3F8U A;  4F2I A;  5G5E A;  5D9T A;  1GUK A;  2LEG A;  1U3A A;  4KH7 A;  4BWQ A;  2CVK A;  5ECO B;  3TGZ A;  3MWH A;  1NSW A;  2VLV A;  3ZRD A;  2F8F A;  2WZ9 A;  1DUG A;  1QFN A;  1ILO A;  1WOU A;  2J23 A;  5F05 A;  2XC2 A;  3GKK A;  3TCO A;  1OC3 A;  2YJ7 A;  1A23 A;  1TXX A;  3D0Z A;  2R2J A;  1X0R A;  1GWC A;  2NTO A;  4KX4 A;  4ZL7 A;  5DJM A;  3TJG A;  3G9B A;  3Q74 A;  2DLX A;  3ZVJ A;  3E9J B;  4E8E A;  5ECK B;  1GL8 A;  3HVS A;  4MPG A;  5CRW A;  2IFQ B;  5DAL A;  4KND A;  1J08 A;  1GP1 A;  2IMK A;  5A5K A;  2VL2 A;  6GST A;  4PQI A;  1RQM A;  3ZFB A;  1GSY A;  2GLR A;  2PVQ A;  2FWH A;  1M9A A;  2RII A;  4WBR D;  5IOX A;  3F6F A;  2DML A;  2DC5 A;  5CNW A;  4EC0 A;  4GXZ A;  2LTK A;  3WGD A;  1YKA A;  3HY2 A;  1A2J A;  4ZIJ A;  5J3R A;  4LA1 A;  1AC1 A;  2WCI A;  4K9Z A;  2H6Y A;  1NHY A;  2GZY A;  2FWF A;  4TVE A;  4IP6 A;  5JWR B;  3I9V 2;  2AUV A;  1Z6N A;  4FYB A;  1ERT A;  1ZCP A;  2H74 A;  3NOF A;  3VWV A;  2C3N A;  3TKP A;  1GSF A;  2J9H A;  2LRN A;  5IPG A;  3ZML A;  2DSA A;  3LJR A;  3VK9 A;  1VF2 A;  2X8G A;  2LQO A;  5GZZ B;  1RK4 A;  5LNK e;  3H8Q A;  5ECP B;  1UVZ A;  2M72 A;  3F6D A;  1HD2 A;  3PGT A;  1XWC A;  3C7M A;  2C80 A;  2WB9 A;  5DAK A;  2PU9 C;  5AIX A;  2ZNM A;  3I6A A;  3D4T A;  3E3E A;  2XBI A;  2YOI A;  1WJK A;  1F6M C;  1EP7 A;  2B6M A;  3SWL A;  4PNG A;  3RPN A;  3RHB A;  2H0G A;  2VCQ A;  1H75 A;  4DSS A;  3TJB A;  2C4J A;  3DEX A;  2AYT A;  4BPY A;  4ZL8 A;  4IVF A;  1SYX A;  1ERU A;  3GA4 A;  2WUL A;  3APO A;  4EE0 A;  5DVB A;  1XZO A;  1TU7 A;  3HJO A;  5C04 A;  2JSZ A;  10GS A;  5DBQ A;  1TDI A;  1V40 A;  2FNO A;  2FCH A;  2EIQ A;  5IQY A;  3K8N A;  3ZMK A;  1KBN A;  1B9X C;  4L5L A;  1TW9 A;  1Y25 A;  5HR0 A;  3KD0 A;  4GF0 A;  1AQV A;  3E0U A;  4JE1 A;  4IS0 A;  2RM5 A;  4OCF A;  5IO2 A;  3UVH A;  3ZIJ A;  2N5B A;  2I81 A;  1YEP A;  4X1U A;  2H73 A;  3M8N A;  4MJC A;  2CZ3 A;  3GN3 A;  1WP0 A;  5DCG A;  5F8B A;  3Q19 A;  3EMP A;  4ZBD A;  1PA3 A;  2GQK A;  1TRU A;  2V2G A;  4I6X A;  5EVO A;  4MJA A;  3VWX A;  3Q6O A;  2H01 A;  4KSO A;  4G19 A;  3DXB A;  3JCM L;  3PR8 A;  2GSS A;  4KCE A;  1PL1 A;  3GL5 A;  4NHZ A;  2FD3 A;  2YAN A;  2CZ2 A;  2CAQ A;  1THO A;  5FT3 A;  4IBP A;  1G7E A;  1GTU A;  3P90 A;  3M3M A;  1WWJ A;  4OO5 A;  1N8J A;  1TKD B;  3IR4 A;  4RQR A;  2HRF A;  5E4W A;  2E2G A;  2WDU A;  1ZZY A;  1BAY A;  1THX A;  3GKN A;  1ZOF A;  2HZF A;  4NV2 A;  5GAN D;  2VD0 A;  2B7K A;  2MBS A;  3TKS A;  2XPD A;  3BCI A;  2V6O A;  2I1U A;  4KDU A;  5IMV A;  1PL2 A;  4I97 A;  1FO5 A;  2VL3 A;  1UC7 A;  4KE3 A;  3WYW A;  2V41 A;  1EZK A;  4FIW A;  3F3Q A;  2VM1 A;  2DJK A;  3WGX A;  2GZP A;  1PD2 1;  4GLT A;  1Z6M A;  3CBU A;  3U6V A;  4K8M A;  1K0O A;  4TR1 A;  4WET A;  4IGJ A;  1GNW A;  4MJB A;  5G31 A;  3TJF A;  3P7X A;  5ECN B;  3O76 A;  5IM9 A;  3H1N A;  4PUR A;  2FWG A;  2DJ3 A;  4WR5 A;  2IIY A;  3F3R A;  3VLN A;  4PXO A;  1F9M A;  4TR3 A;  3GH9 A;  3QFB C;  3TB2 A;  1MDJ A;  3CSI A;  3EVI A;  1VRS D;  1DSB A;  3CMI A;  3V1W A;  2R6K A;  1B4P A;  3CRT A;  3M0F A;  2QC7 A;  1JFU A;  3GSS A;  4V2L A;  2R37 A;  2PUK C;  20GS A;  3QFA C;  5ECM B;  3G7I A;  4FYU A;  1WRY A;  1R5A A;  2IMF A;  3FZ4 A;  4GSS A;  3L9U A;  1U88 A;  2YWN A;  1PSQ A;  1M2D A;  1T4Y A;  1W4V A;  4RI7 A;  5D8I A;  1HNB A;  3DVW A;  1LU4 A;  1GSE A;  1EGR A;  1O85 A;  4MH2 A;  4IJ3 A;  3F63 A;  1O81 A;  3FZ5 A;  1TI1 A;  4JU5 A;  4I5Q A;  1U6T A;  2GS3 A;  2A4V A;  4BA7 A;  3HA9 A;  1K0N A;  4X0X A;  1XW5 A;  3RHC A;  1C72 A;  4PUF C;  4KGI A;  1SU9 A;  2GQM A;  4AGS A;  1X9M B;  3GKM A;  5GSS A;  4L5O A;  4F0B A;  1VF1 A;  2BJX A;  2VUP A;  4TKY A;  1J9B A;  1EEM A;  1F3A A;  4TXO A;  3ZRE A;  3KH9 A;  1OC9 B;  1BJX A;  3F0I A;  4RI6 A;  5J4U A;  3UEM A;  4HUA A;  4HEA 2;  3KP8 A;  4Q5N A;  3UOM A;  2JU5 A;  1TU8 A;  2DJ0 A;  4XS6 A;  4TXO B;  2NDO A;  2AJQ B;  1KTE A;  1TK5 B;  2LS5 A;  2REM A;  3A2W A;  2C0E A;  4OFM A;  1NW2 A;  3UBL A;  5KEJ A;  1F3B A;  4OD7 A;  1SJ6 A;  5FHI A;  1R4W A;  5HQP A;  4N0Z A;  4PNF A;  1TI3 A;  5AIS A;  3A3T A;  1FVJ A;  1XOA A;  1ON4 A;  2PWJ A;  2YWI A;  3IOS A;  4MK3 A;  1GTA A;  5JWQ B;  2NPB A;  5A4V A;  3UAP A;  3W6G A;  2QGV A;  5D93 A;  4KW6 A;  4ECI A;  2FA8 A;  5ECR B;  3KTL A;  1G0T A;  4EDZ A;  4IJI A;  4AJ6 A;  1FHE A;  2MZC A;  2RUF A;  4K6X A;  2PVO C;  2M80 A;  4WR4 A;  4F0C A;  2PN8 A;  4TR4 A;  5CAX A;  3RAZ A;  2G2Q A;  4F9Z A;  3S9F A;  2PBJ A;  4MJE A;  1ZYQ B;  1QQ2 A;  3G7Y A;  2LJR A;  2JZR A;  4TXV A;  1JZW A;  1OKD A;  2HT9 A;  4LMW A;  1MTC A;  1EV9 A;  3LYK A;  1M7T A;  5A4W A;  3DRN A;  2H6X A;  5H5R A;  1TJD A;  4K0G A;  2X64 A;  4JR4 A;  4NAX A;  3FZA A;  4V2N A;  2H71 A;  6GSV A;  2VAF A;  2H1D A;  3CTF A;  3TKQ A;  4MLY A;  1X5D A;  4MZC A;  4O32 A;  1U87 A;  1VGL A;  2YZU A;  1XVW A;  3MSZ A;  3PIN A;  7GSS A;  2A2R A;  3FRC A;  3HJM A;  2H0I A;  2GDR A;  2VLT A;  2IFQ A;  3KJY A;  3QOU A;  1X5C A;  1F2E A;  1GRX A;  1TTZ A;  3LG6 A;  5IMD A;  1SL2 B;  3HJP A;  2H75 A;  1PQN A;  2O7K A;  1AUC A;  4KUN A;  5D9V A;  4XRA A;  4KAE A;  4GCI A;  2NVL A;  2O8V B;  2H1B A;  3HXS A;  2K8S A;  3FY7 A;  1BX9 A;  4HJ2 A;  2OE0 A;  4H86 A;  3TKR A;  3KXO A;  2C8U A;  19GS A;  2IME A;  3C8E A;  3KMO A;  2LJA A;  3ERW A;  5D96 A;  3M1G A;  1HQO A;  3LXZ A;  4HZ2 A;  2GSQ A;  3IC4 A;  4KSM A;  3M9J A;  3IRA A;  5CO3 A;  2X99 A;  3C73 A;  4POL A;  2VCV A;  2NBS A;  3WT2 A;  4TN8 A;  3LQ7 A;  2YJH A;  2L57 A;  4CHS A;  4PGT A;  5B7C A;  3TDG A;  3FK8 A;  3MDK A;  5LCZ A;  5G30 A;  2HFD A;  1B48 A;  3L0H A;  2B7J A;  1I5G A;  2GGT A;  1OAZ A;  1ZYE A;  3CXG A;  3KEB A;  2FLS A;  3LFL A;  2RM6 A;  4WXT A;  1GUL A;  3AY8 A;  4TR0 A;  1X5E A;  4I2T A;  3L78 A;  4HI7 A;  4L0U A;  1CQG A;  2MBT A;  2VCT A;  1A0F A;  2GSR A;  2L6D A;  3FW2 A;  1Z7P A;  2L5O A;  2L4C A;  3CRU A;  22GS A;  3BD2 A;  1HNC A;  1K0M A;  3TJK A;  1PGT A;  5EL8 A;  1EWX A;  4GTU A;  5KN1 A;  4KA0 A;  4HOJ A;  2B1L A;  3G7J A;  2FHE A;  2MMN A;  1F37 A;  2FGX A;  3ZVJ D;  3UJ1 A;  1GSS A;  2KHP A;  2VCW A;  4OFT A;  2HE3 A;  2L5L A;  5CRH A;  1TOF A;  4EO3 A;  1O73 A;  1MDK A;  2EC4 A;  5KN0 A;  1EP8 A;  4ZB9 A;  1YF1 A;  1SKS B;  1XBS A;  4MH3 A;  3A2X A;  4OCE A;  2QKE A;  3M9K A;  1SK0 A;  6GSW A;  2VO4 A;  3Q18 A;  1IYI A;  9GSS A;  1M2A A;  1XWA A;  5AGY A;  1BYE A;  1V58 A;  2ES7 A;  4OWY A;  2CV4 A;  3NZN A;  1GUM A;  3VI5 A;  4XCS A;  1KEB A;  3D5J A;  1ACV A;  3D22 A;  2AHE A;  2MMA A;  5JCU A;  2WS2 A;  2OBK A;  4TOP A;  4HZ4 A;  5IOW A;  1FG4 A;  5ID2 B;  4QL9 A;  4OO4 A;  1SEN A;  2GQL A;  2OE3 A;  1XW6 A;  1XWK A;  2F3M A;  2KP1 A;  2HZE A;  3ISO A;  3GV1 A;  2VIM A;  2C3T A;  1AIU A;  1U3I A;  4Q5F A;  2B3S A;  2PPT A;  4EUY A;  2B5X A;  2JAD A;  3HKR A;  2B5E A;  3VFI A;  2ON7 A;  2WRT A;  1Q4J A;  1SD9 A;  3O3T A;  1M99 A;  3US3 A;  2CA8 A;  4MZW A;  2H6Z A;  2HZE B;  1PMT A;  1XWB A;  3BCK A;  1WMJ A;  3GYK A;  1A8Y A;  4MF6 A;  1E2Y A;  3QDN A;  4MF7 A;  2V6K A;  2RLI A;  4N11 A;  2KLX A;  5IMC A;  3HVV A;  5E59 A;  1TK0 B;  2C0D A;  3EWL A;  3C1R A;  4EVM A;  3KGK A;  6GSS A;  1FB0 A;  1DE2 A;  2DIZ A;  4MZB A;  5HR3 A;  1GLP A;  2TRC P;  3BBY A;  3FR6 A;  4EL1 A;  1PN9 A;  5JCG A;  4XS4 B;  2YCD A;  4NV5 A;  4FH8 A;  5DQY A;  5G2Z A;  3TUE A;  5DQS A;  3EE2 A;  2GT5 A;  1ST9 A;  2K18 A;  4O7H A;  4XRD A;  2O85 A;  2F9S A;  4V1A g;  2H8L A;  4GST A;  1TRS A;  4MMM A;  3EMX A;  3KIJ A;  1YQ1 A;  3DYR A;  5J9B A;  4MF5 A;  2H0H A;  4AJ7 A;  3GX0 A;  5HFK A;  1PX6 A;  4WKW A;  2VCZ A;  3GMF A;  3MNG A;  3GUR A;  3ME7 A;  4DEJ A;  4KDY A;  1SJI A;  1B4Q A;  2OJL A;  3IAM 2;  2E2M A;  4YQM A;  2EIO A;  2I4A A;  5IO0 A;  3ERG A;  4IEL A;  2GT6 A;  2E7P A;  3WGE A;  1OKT A;  3P8W A;  2H70 A;  1UN2 A;  3VPQ A;  4FO5 A;  2LQQ A;  5ECL B;  2Z9S A;  2WJU A;  3TRQ A;  3VPT A;  1SL0 B;  1UA5 A;  4YH2 A;  3I69 A;  2IMI A;  3QAV A;  1NHO A;  3H79 A;  2ON5 A;  4LLR A;  3D21 A;  1O6J A;  3EC3 A;  1A24 A;  2ZUP A;  1SD8 A;  2HSY A;  1TRW A;  2VL2 C;  1V2A A;  4Q5R A;  3KZQ A;  1WIK A;  6GSU A;  3UVT A;  3IE3 A;  1EV4 A;  3GIX A;  5DJL A;  2AAW A;  3IA1 A;  4BL7 A;  4NMU A;  3W8S A;  4NPB A;  1BED A;  2LRC A;  2LV3 A;  4CW9 A;  5IIZ A;  1K3Y A;  2FY6 A;  3H93 A;  1OC9 A;  1MEK A;  5G5F A;  1GH2 A;  3LSZ A;  4JRR A;  2CX4 A;  2JSY A;  3CSJ A;  4HU7 A;  4WF4 A;  4LL4 B;  3APS A;  3LGC A;  1USB A;  1A8L A;  5B8B A;  4DSR A;  3ZIV A;  2CT6 A;  1SYR A;  1BQ7 A;  3GTU B;  1FW1 A;  2HI7 A;  3QD9 A;  4PX1 A;  5L71 A;  1SL1 B;  2H1A A; 
#chains in the Genus database with same CATH topology
 1MD3 A;  1AXD A;  1O8W A;  2CVB A;  17GS A;  3F4T A;  4RQX A;  3F9U A;  1YF0 A;  3UAR A;  3DGQ A;  3TOU A;  4GQF A;  5COH A;  5KN2 A;  1SKW B;  1TP9 A;  3EUR A;  1XW9 A;  4EKZ A;  3ME8 A;  2I3Y A;  1K0B A;  1XVQ A;  3GNJ A;  2GTU A;  1T3B A;  3UIW A;  1K0A A;  3LYP A;  4K7I A;  1J0F A;  3ED3 A;  1T7P B;  2DMM A;  1V98 A;  3DD3 A;  1K0C A;  5HR1 A;  3A5W A;  2YV9 A;  2DJ2 A;  5B8A A;  2LNS A;  2PGT A;  1TRV A;  12GS A;  4J2F A;  2LKU A;  3WD6 A;  3IAS 2;  2XBQ A;  5ECQ B;  1X9W B;  2B1K A;  4RUV A;  2DBC A;  4YQV A;  3EYT A;  1ZMA A;  5G1K A;  5B6M A;  1G7O A;  4IN0 A;  2H76 A;  4Z2T A;  1GTI A;  2LST A;  3HVN A;  3KH7 A;  2OA7 A;  4YQU A;  2JAC A;  1T8E B;  3LOR A;  4K2D A;  1SK1 A;  1XOB A;  1XIY A;  4L0W A;  5ECS A;  4POK A;  3N5O A;  1EOH A;  3VWW A;  4D73 B;  1ZGN A;  2GZZ A;  4WEY A;  3QAG A;  4NXI A;  1Z7R A;  5ABR A;  5IMF A;  4YKG A;  1TK8 B;  4KB3 A;  3WT1 A;  1YZX A;  2N5F A;  8GSS A;  2MMZ A;  2M46 A;  4F82 A;  1V9W A;  3GH6 A;  4NWY A;  3GHA A;  2F51 A;  3GST A;  2IJY A;  2OBI A;  1T1V A;  3HCZ A;  1S3A A;  2B5Y A;  2LNT A;  3QMX A;  4N10 A;  5J9C A;  1YKC A;  3RPP A;  4V1A p;  2LUS A;  2OAC A;  3N9J A;  3IXR A;  3FZ9 A;  1ABA A;  4QQ7 A;  1VF3 A;  1MD4 A;  1XCC A;  3QAW A;  4YAV A;  3DKS A;  3FKF A;  1SJZ A;  3UL3 A;  2X4A A;  2HNL A;  3U5R E;  3IPZ A;  4JR6 A;  5JWO B;  2YV7 A;  3FMW A;  2MYG A;  4DSQ A;  2DKH A;  1WE0 A;  2DJ1 A;  4FYC A;  5F07 A;  4K7O A;  4N0V A;  2TRX A;  4J56 E;  1H4O A;  2PMT A;  3KM6 A;  1DE1 A;  4O92 A;  3GX8 A;  2EIR A;  2DJJ A;  1Z3E A;  14GS A;  3CYN A;  3HZ4 A;  4MA9 A;  4G9H A;  3ZFL A;  3VUR A;  3DIE A;  5DAL B;  1QUW A;  4GQC A;  2P31 A;  3TKS C;  1OC8 A;  1GTB A;  3ERF A;  5CRE A;  5HFG A;  4K0N A;  3VI7 A;  4ML1 A;  3KCM A;  4ID0 A;  1LJR A;  1ZYN A;  5A4U A;  3CSH A;  2H72 A;  1DBY A;  2V1M A;  5IPH A;  3ZZX A;  3O6T A;  1QMV A;  4ILF A;  2YN1 A;  5D73 A;  3HDC A;  3TKS E;  3DML A;  4JZQ A;  4Z2R A;  5AIV A;  2R0C A;  2IPA A;  4EDY A;  3KMN A;  2HSM A;  3ZL5 A;  3R2Q A;  1Q98 A;  4OFN A;  4KCA A;  2XHF A;  3RBT A;  2LJK A;  2RUE A;  4HQS A;  1XXU A;  4ECC A;  2FUG 2;  1ZL9 A;  5BRT A;  1QXH A;  2HYX A;  4XS1 A;  3ZYW A;  3DWV A;  2HRN A;  4HJM A;  1FB6 A;  4PQH A;  2HSH A;  2OE1 A;  1JZD A;  2IWT A;  2H30 A;  1G6Y A;  1EOG A;  1JLV A;  18GS A;  4MCU A;  4WF5 A;  1XWG A;  3GKX A;  1OE7 A;  4MDC A;  5ELG A;  5D9W A;  5ELA A;  1BG5 A;  3EIN A;  5BMU A;  2R3X A;  3FYG A;  1N2A A;  5ID2 A;  4X4J A;  1SK2 A;  2K6V A;  5DAK B;  3EU4 A;  5CYY A;  4ULX A;  2CQ9 A;  3A2V A;  1FVK A;  2XPE A;  1JZO A;  3TRX A;  5B6N A;  4HQZ A;  2VLU A;  3TJJ A;  4ZL9 A;  4MPF A;  1GNE A;  1GSD A;  2YP6 A;  5C00 A;  4HS1 A;  3HHV A;  2GST A;  2P5Q A;  4DSS B;  3NIV A;  4PQ1 A;  4ZXG A;  5KOW A;  5EY6 A;  2BTO T;  5AN1 A;  2ALB A;  4IQ1 A;  2IL3 A;  4AF2 A;  3J7Y b;  1Z5Y E;  4BVY A;  2CX3 A;  1IYH A;  4ML6 A;  1W89 A;  4K1F A;  4MAB A;  13GS A;  2C0G A;  2YPM A;  1YDK A;  2QSI A;  2F8A A;  5IMA A;  3C1S A;  5DDL A;  3L9S A;  2A4H A;  2H19 A;  5H5Q A;  1JLW A;  1PKZ A;  4CDO A;  1XG8 A;  5F06 A;  2VL9 A;  4XS4 A;  5CRD A;  2QA2 A;  1OVN A;  2L59 A;  4P3Y B;  5ECI B;  3IBH A;  2LRT A;  2TIR A;  5CP1 A;  3L4N A;  4ZBB A;  1E6B A;  5GAP D;  5DCH A;  3BJ5 A;  1AW9 A;  2HXK A;  5D9X A;  4HU9 A;  4F03 A;  4TW5 A;  5IMZ A;  2IMD A;  1CQH A;  1B8X A;  1K3O A;  3D4M A;  5FWG A;  2JZT A;  4Q5Q A;  1MDI A;  2D2Z A;  2ZCT A;  4LL1 B;  1YJ6 A;  1NM3 A;  1Y6E A;  1A0R P;  2CAI A;  2O87 A;  3MAK A;  3L9V A;  4DVC A;  4G10 A;  1QK8 A;  4Z7X A;  4ZB6 A;  1K0D A;  5J5N A;  4BVX A;  1WPI A;  1LBK A;  2H1G A;  2V32 A;  4V2M A;  2FWE A;  1HYU A;  3LEF A;  4IW9 A;  1PRX A;  3KTB A;  1AQX A;  2VM2 A;  1AAZ A;  2YWM A;  1PX7 A;  3EU3 A;  1A2L A;  1O7U A;  2YNX A;  4J57 E;  1A2M A;  4X43 A;  4ZIL A;  3OR5 A;  1JZR A;  1RW1 A;  4ECJ A;  5KN3 A;  2A2P A;  3TRP A;  4XIH A;  2K8V A;  4ZB8 A;  2G0F A;  2P5R A;  4N30 A;  2H66 A;  4I2U A;  3IK7 A;  1ERV A;  1QGV A;  3C71 A;  4GWR A;  4JED A;  4TR1 B;  2CVD A;  4IKH A;  4GSN A;  2JL4 A;  2KP2 A;  3LWA A;  4TRX A;  1PKW A;  3J7Y k;  2I9H A;  1M0U A;  4AJ8 A;  3CTG A;  3SBC A;  2HLS A;  1O8X A;  3IDV A;  3UMA A;  4HDE A;  3HZ8 A;  4XTS A;  2YWO A;  5INY A;  2WFC A;  3FEU A;  4YKF A;  3KP9 A;  2FA4 A;  4ISD A;  5ECH B;  5LD0 A;  1X9S B;  3GUS A;  1I9D A;  5EPF A;  4EF0 A;  2R5G A;  5HR2 A;  1URM A;  5ENU A;  3W8J A;  1ML6 A;  1R7H A;  4MP4 A;  1EGO A;  3IHQ A;  4JBB A;  4K7N A;  3RDW A;  2JZS A;  1V57 A;  2C3Q A;  6GSY A;  3ZLP A;  4O5R A;  2L6C A;  3GTU A;  1EEJ A;  5JCW A;  1YY7 A;  3D6I A;  3P2A A;  4IHU A;  4POM A;  5CRG A;  4LMV A;  3APQ A;  3GFK A;  1XPV A;  3UBK A;  1G6W A;  4QL7 A;  3VWU A;  4G2E A;  2O89 A;  1OE8 A;  5KOX A;  3DVX A;  2PER A;  1K3L A;  4E8H A;  1GSQ A;  2R4V A;  4XHM A;  1R26 A;  3I43 A;  1XFL A;  4MNN A;  5H5S A;  6GSX A;  4ZBA A;  2KOK A;  2VOC A;  2P0G A;  4ECB A;  2MMO A;  3IV4 A;  5F0G A;  3F4S A;  1Z9H A;  1GSU A;  3MYD A;  1KNG A;  5G1L A;  3ZTL A;  3FHK A;  1SKR B;  4ACS A;  3FR9 A;  1YEX A;  3GRX A;  4EXJ A;  1GUH A;  2YZH A;  5J41 A;  2N5A A;  2C0F A;  1VF4 A;  3TOT A;  1B9Y C;  3ZIT A;  3QPM A;  2BMX A;  4YAP A;  3F4R A;  3GL3 A;  1S3D A;  2AV4 A;  2OKA A;  2E0Q A;  1M2B A;  2IN3 A;  1GLQ A;  2DIY A;  2VD1 A;  1FOV A;  5HFI A;  3H4K A;  2K9F A;  3QR6 A;  1AQW A;  4KDX A;  11GS A;  2GVP A;  1ERW A;  3HVX A;  2X8H A;  5GST A;  1M9B A;  4BWS A;  4I8B A;  3QCP A;  16GS A;  1R5P A;  4FQU A;  4D73 A;  4IQA A;  2OAD A;  4WBJ A;  2X49 A;  4OMV A;  4GRF A;  2C1Y A;  4IP1 A;  2AB6 A;  3PH9 A;  4PUA A;  3IK9 A;  3BOA A;  1OYJ A;  1S3C A;  4NHW A;  2A2S A;  1FAA A;  2X8C A;  3PPU A;  1T00 A;  1T4Z A;  2KUC A;  2WGR A;  4A5P A;  3FR3 A;  1S3R A;  1HNA A;  2L4Q A;  1JHB A;  3HYP A;  3HD5 A;  2VCX A;  3LXT A;  4L8E A;  4POB A;  3F8U A;  4F2I A;  5G5E A;  5D9T A;  1GUK A;  2LEG A;  1U3A A;  4KH7 A;  4BWQ A;  2CVK A;  5ECO B;  3TGZ A;  3MWH A;  1NSW A;  2VLV A;  3ZRD A;  2F8F A;  2WZ9 A;  1DUG A;  4K2X A;  1QFN A;  1ILO A;  1WOU A;  2J23 A;  5F05 A;  2XC2 A;  3GKK A;  3TCO A;  1OC3 A;  2YJ7 A;  1A23 A;  1TXX A;  3D0Z A;  2R2J A;  1X0R A;  1GWC A;  2NTO A;  4KX4 A;  4ZL7 A;  5DJM A;  3TJG A;  3G9B A;  3Q74 A;  2DLX A;  3ZVJ A;  3E9J B;  4E8E A;  5ECK B;  1GL8 A;  3HVS A;  4MPG A;  5CRW A;  2IFQ B;  5DAL A;  4KND A;  1J08 A;  1GP1 A;  2IMK A;  5A5K A;  2VL2 A;  6GST A;  4PQI A;  1RQM A;  3ZFB A;  1GSY A;  2GLR A;  2PVQ A;  2FWH A;  1M9A A;  2RII A;  4WBR D;  5IOX A;  3F6F A;  2DML A;  2DC5 A;  5CNW A;  4EC0 A;  4GXZ A;  2LTK A;  3WGD A;  1YKA A;  3HY2 A;  1A2J A;  4ZIJ A;  5J3R A;  4LA1 A;  1AC1 A;  2WCI A;  4K9Z A;  2H6Y A;  1NHY A;  2GZY A;  2FWF A;  4TVE A;  4IP6 A;  5JWR B;  3I9V 2;  2AUV A;  1Z6N A;  4FYB A;  1ERT A;  1ZCP A;  1M3I A;  2H74 A;  3NOF A;  3VWV A;  2C3N A;  4USS A;  3TKP A;  1GSF A;  2J9H A;  2LRN A;  5IPG A;  3ZML A;  2DSA A;  3LJR A;  3VK9 A;  1VF2 A;  2X8G A;  2LQO A;  5GZZ B;  1RK4 A;  5LNK e;  3H8Q A;  5ECP B;  1UVZ A;  2M72 A;  4O5Q A;  3F6D A;  1HD2 A;  3PGT A;  1XWC A;  3C7M A;  2C80 A;  4G0L A;  2WB9 A;  5DAK A;  2PU9 C;  5AIX A;  2ZNM A;  2R0P A;  3I6A A;  3D4T A;  2HRK A;  3E3E A;  2XBI A;  2YOI A;  1WJK A;  1F6M C;  1EP7 A;  2B6M A;  3SWL A;  4PNG A;  3RPN A;  3RHB A;  2H0G A;  2VCQ A;  1H75 A;  4DSS A;  3TJB A;  2C4J A;  3DEX A;  2AYT A;  4BPY A;  4ZL8 A;  4IVF A;  1SYX A;  1ERU A;  3GA4 A;  2WUL A;  3APO A;  4EE0 A;  5DVB A;  1XZO A;  1TU7 A;  3HJO A;  5C04 A;  2JSZ A;  10GS A;  2DKI A;  5DBQ A;  1TDI A;  1V40 A;  2FNO A;  2FCH A;  2EIQ A;  5IQY A;  4K5S A;  3K8N A;  3ZMK A;  1KBN A;  1B9X C;  4L5L A;  1TW9 A;  1Y25 A;  5HR0 A;  3KD0 A;  4GF0 A;  1AQV A;  3E0U A;  4JE1 A;  4IS0 A;  2RM5 A;  4OCF A;  5IO2 A;  3UVH A;  3ZIJ A;  2N5B A;  2I81 A;  1YEP A;  4X1U A;  2H73 A;  3M8N A;  4MJC A;  2CZ3 A;  3GN3 A;  1WP0 A;  5DCG A;  5F8B A;  3Q19 A;  3EMP A;  4ZBD A;  1PA3 A;  2GQK A;  3IHG A;  1TRU A;  2V2G A;  4I6X A;  5EVO A;  4MJA A;  3VWX A;  3Q6O A;  2H01 A;  4KSO A;  4G19 A;  3DXB A;  3JCM L;  3PR8 A;  2GSS A;  4KCE A;  1PL1 A;  3GL5 A;  4NHZ A;  2FD3 A;  2YAN A;  2CZ2 A;  2CAQ A;  1THO A;  5FT3 A;  4Z2U A;  4IBP A;  1G7E A;  1GTU A;  3P90 A;  3M3M A;  1WWJ A;  4OO5 A;  1N8J A;  1TKD B;  3IR4 A;  4RQR A;  2HRF A;  5E4W A;  2E2G A;  2WDU A;  1ZZY A;  1BAY A;  1THX A;  3GKN A;  1ZOF A;  2HZF A;  4NV2 A;  5GAN D;  2VD0 A;  2B7K A;  2MBS A;  3TKS A;  2XPD A;  3BCI A;  2V6O A;  2I1U A;  4KDU A;  5IMV A;  1PL2 A;  4I97 A;  4EIP A;  1FO5 A;  2VL3 A;  1UC7 A;  4KE3 A;  3WYW A;  2V41 A;  1EZK A;  4FIW A;  3F3Q A;  2VM1 A;  2DJK A;  3WGX A;  2GZP A;  1PD2 1;  4GLT A;  1Z6M A;  3CBU A;  3U6V A;  4K8M A;  1K0O A;  4TR1 A;  4WET A;  4IGJ A;  1GNW A;  4MJB A;  5G31 A;  3TJF A;  3P7X A;  5ECN B;  3O76 A;  5IM9 A;  3H1N A;  4PUR A;  2FWG A;  2DJ3 A;  4WR5 A;  3LW9 A;  2IIY A;  3F3R A;  3VLN A;  4PXO A;  1F9M A;  4TR3 A;  3GH9 A;  3QFB C;  3TB2 A;  1MDJ A;  3CSI A;  3EVI A;  1VRS D;  1DSB A;  3CMI A;  3V1W A;  2R6K A;  1B4P A;  3CRT A;  3M0F A;  2QC7 A;  1JFU A;  3GSS A;  4V2L A;  2R37 A;  2PUK C;  20GS A;  3QFA C;  5ECM B;  3G7I A;  4FYU A;  1WRY A;  1R5A A;  2IMF A;  3FZ4 A;  4GSS A;  3L9U A;  1U88 A;  2YWN A;  1PSQ A;  1M2D A;  1T4Y A;  1W4V A;  4RI7 A;  5D8I A;  1HNB A;  3DVW A;  1LU4 A;  1M3J A;  1GSE A;  1EGR A;  3CQF A;  1O85 A;  4MH2 A;  4IJ3 A;  3F63 A;  1O81 A;  3FZ5 A;  1TI1 A;  4JU5 A;  4I5Q A;  1U6T A;  2GS3 A;  2A4V A;  4BA7 A;  3HA9 A;  1K0N A;  4X0X A;  1XW5 A;  3RHC A;  1C72 A;  4PUF C;  4KGI A;  1SU9 A;  2GQM A;  4AGS A;  1X9M B;  3GKM A;  5GSS A;  4BL7 B;  4L5O A;  4F0B A;  1VF1 A;  2BJX A;  2VUP A;  4TKY A;  1J9B A;  2UZ8 A;  1EEM A;  1F3A A;  4TXO A;  3ZRE A;  3KH9 A;  1OC9 B;  1BJX A;  3F0I A;  4RI6 A;  5J4U A;  3UEM A;  4HUA A;  4HEA 2;  3KP8 A;  4Q5N A;  3UOM A;  2JU5 A;  1TU8 A;  2DJ0 A;  4XS6 A;  4TXO B;  2NDO A;  2AJQ B;  1KTE A;  1TK5 B;  2LS5 A;  2REM A;  3A2W A;  3A5I A;  2C0E A;  3EPT A;  4OFM A;  1NW2 A;  3UBL A;  5KEJ A;  1F3B A;  4OD7 A;  1SJ6 A;  5FHI A;  1R4W A;  4BIK A;  5HQP A;  2QA1 A;  4N0Z A;  4PNF A;  1TI3 A;  5AIS A;  3A3T A;  1FVJ A;  1XOA A;  1ON4 A;  2PWJ A;  2YWI A;  3IOS A;  1FOH A;  4MK3 A;  1GTA A;  5JWQ B;  2NPB A;  5A4V A;  3UAP A;  3W6G A;  2QGV A;  5D93 A;  4KW6 A;  4ECI A;  2FA8 A;  5ECR B;  3KTL A;  1G0T A;  4EDZ A;  4IJI A;  4AJ6 A;  1FHE A;  2MZC A;  2RUF A;  4K6X A;  2PVO C;  2M80 A;  4WR4 A;  4F0C A;  2PN8 A;  4TR4 A;  5CAX A;  3RAZ A;  2G2Q A;  4F9Z A;  3S9F A;  2PBJ A;  4MJE A;  1ZYQ B;  4KF9 A;  1QQ2 A;  3G7Y A;  2LJR A;  2JZR A;  4TXV A;  1JZW A;  1OKD A;  2HT9 A;  4LMW A;  1MTC A;  1EV9 A;  3LYK A;  1M7T A;  5A4W A;  3DRN A;  2H6X A;  5H5R A;  1TJD A;  4K0G A;  2X64 A;  4JR4 A;  4NAX A;  3FZA A;  4V2N A;  2H71 A;  6GSV A;  2VAF A;  2H1D A;  3CTF A;  1PN0 A;  4MLY A;  3TKQ A;  1X5D A;  4MZC A;  4O32 A;  1U87 A;  1VGL A;  2YZU A;  1XVW A;  3MSZ A;  3PIN A;  7GSS A;  2A2R A;  3FRC A;  3HJM A;  2H0I A;  2GDR A;  2VLT A;  2IFQ A;  3KJY A;  3QOU A;  1X5C A;  1F2E A;  1GRX A;  1TTZ A;  3LG6 A;  5IMD A;  1SL2 B;  3HJP A;  2H75 A;  1PQN A;  2O7K A;  1AUC A;  4KUN A;  5D9V A;  4XRA A;  4KAE A;  4GCI A;  2NVL A;  2O8V B;  2H1B A;  3HXS A;  2K8S A;  3FY7 A;  1BX9 A;  4HJ2 A;  2OE0 A;  4H86 A;  3TKR A;  3KXO A;  2C8U A;  19GS A;  2IME A;  3C8E A;  3KMO A;  2LJA A;  3ERW A;  5D96 A;  3M1G A;  1HQO A;  3LXZ A;  4HZ2 A;  2GSQ A;  3IC4 A;  4ICY A;  4KSM A;  3M9J A;  3IRA A;  5CO3 A;  2X99 A;  3C73 A;  4POL A;  4G0K A;  2VCV A;  2NBS A;  3WT2 A;  4TN8 A;  3LQ7 A;  2YJH A;  2L57 A;  4CHS A;  4PGT A;  5B7C A;  3TDG A;  3FK8 A;  3MDK A;  5LCZ A;  5G30 A;  2HFD A;  1B48 A;  3L0H A;  2B7J A;  1I5G A;  2GGT A;  1OAZ A;  1ZYE A;  3CXG A;  3KEB A;  2FLS A;  3LFL A;  2RM6 A;  4WXT A;  1GUL A;  3AY8 A;  4TR0 A;  1X5E A;  4I2T A;  4K5R A;  3L78 A;  4HI7 A;  4L0U A;  1CQG A;  2MBT A;  2VCT A;  1A0F A;  2GSR A;  2L6D A;  3FW2 A;  1Z7P A;  2L5O A;  2L4C A;  3CRU A;  22GS A;  3BD2 A;  1HNC A;  1K0M A;  3TJK A;  1PGT A;  5EL8 A;  1EWX A;  4GTU A;  5KN1 A;  4KA0 A;  4HOJ A;  2B1L A;  3G7J A;  2FHE A;  2MMN A;  1F37 A;  2FGX A;  3ZVJ D;  3UJ1 A;  1GSS A;  2KHP A;  2VCW A;  4OFT A;  2HE3 A;  2L5L A;  5CRH A;  1TOF A;  4EO3 A;  1O73 A;  2HRA A;  1MDK A;  2EC4 A;  5KN0 A;  1EP8 A;  4ZB9 A;  1YF1 A;  1SKS B;  1XBS A;  4MH3 A;  3A2X A;  4OCE A;  2QKE A;  3M9K A;  1SK0 A;  6GSW A;  2VO4 A;  3Q18 A;  1IYI A;  9GSS A;  1M2A A;  1XWA A;  5AGY A;  1BYE A;  1V58 A;  2ES7 A;  4OWY A;  2CV4 A;  3NZN A;  1GUM A;  3VI5 A;  1ZYP A;  4XCS A;  1KEB A;  3D5J A;  1ACV A;  3D22 A;  2AHE A;  2MMA A;  5JCU A;  4CY8 A;  2WS2 A;  2OBK A;  4TOP A;  4HZ4 A;  5IOW A;  1FG4 A;  5ID2 B;  4QL9 A;  4OO4 A;  1SEN A;  2GQL A;  2OE3 A;  1XW6 A;  1XWK A;  2F3M A;  2KP1 A;  2HZE A;  3ISO A;  3GV1 A;  2VIM A;  2C3T A;  1AIU A;  1U3I A;  4Q5F A;  2B3S A;  2PPT A;  4EUY A;  2B5X A;  2JAD A;  3HKR A;  2B5E A;  3VFI A;  2ON7 A;  2WRT A;  1Q4J A;  1SD9 A;  3O3T A;  1M99 A;  3US3 A;  2CA8 A;  4MZW A;  2H6Z A;  2HZE B;  1PMT A;  1XWB A;  2R0G A;  3BCK A;  1WMJ A;  3GYK A;  1A8Y A;  4MF6 A;  4O5U A;  1E2Y A;  3QDN A;  4MF7 A;  2V6K A;  2RLI A;  4N11 A;  2KLX A;  4BVY B;  5IMC A;  3HVV A;  5E59 A;  1TK0 B;  2C0D A;  3EWL A;  3C1R A;  4EVM A;  3KGK A;  6GSS A;  1FB0 A;  1DE2 A;  2DIZ A;  4MZB A;  5HR3 A;  1GLP A;  2TRC P;  3BBY A;  3FR6 A;  4EL1 A;  1PN9 A;  5JCG A;  4XS4 B;  2YCD A;  4G0I A;  4NV5 A;  4FH8 A;  5DQY A;  5G2Z A;  3TUE A;  5DQS A;  3EE2 A;  2GT5 A;  1ST9 A;  2K18 A;  4O7H A;  3IC8 A;  4XRD A;  2O85 A;  2F9S A;  4V1A g;  2H8L A;  4GST A;  1TRS A;  4MMM A;  3EMX A;  3R3E A;  3KIJ A;  1YQ1 A;  3DYR A;  5J9B A;  4MF5 A;  2H0H A;  4AJ7 A;  3GX0 A;  5HFK A;  1PX6 A;  4WKW A;  2VCZ A;  3GMF A;  3MNG A;  3GUR A;  3ME7 A;  4DEJ A;  4KDY A;  1SJI A;  1B4Q A;  2OJL A;  3IAM 2;  2E2M A;  4YQM A;  2EIO A;  4BVX B;  2I4A A;  5IO0 A;  3ERG A;  4IEL A;  2GT6 A;  2E7P A;  3WGE A;  1OKT A;  3P8W A;  2H70 A;  1UN2 A;  3MIX A;  4PTS A;  3VPQ A;  4FO5 A;  2LQQ A;  5ECL B;  2Z9S A;  2WJU A;  3TRQ A;  3VPT A;  1SL0 B;  1UA5 A;  4YH2 A;  3I69 A;  2IMI A;  3QAV A;  1NHO A;  3H79 A;  2ON5 A;  4LLR A;  3D21 A;  1O6J A;  3EC3 A;  1A24 A;  2ZUP A;  1SD8 A;  2HSY A;  1TRW A;  1PFO A;  2VL2 C;  1V2A A;  4Q5R A;  3KZQ A;  1WIK A;  6GSU A;  3UVT A;  3IE3 A;  4HSC X;  4EIQ A;  1EV4 A;  3GIX A;  5DJL A;  2AAW A;  3IA1 A;  4BL7 A;  4NMU A;  3W8S A;  4NPB A;  1BED A;  2LRC A;  2LV3 A;  4CW9 A;  5IIZ A;  1K3Y A;  2FY6 A;  3H93 A;  1OC9 A;  1MEK A;  5G5F A;  1GH2 A;  3LSZ A;  4JRR A;  2CX4 A;  2JSY A;  3CSJ A;  4HU7 A;  4WF4 A;  4LL4 B;  3APS A;  3LGC A;  1USB A;  1A8L A;  5B8B A;  4CY6 A;  4DSR A;  3ZIV A;  2CT6 A;  1SYR A;  1BQ7 A;  3GTU B;  1FW1 A;  2HI7 A;  3QD9 A;  4PX1 A;  5L71 A;  1SL1 B;  2H1A A; 
#chains in the Genus database with same CATH homology
 1MD3 A;  1AXD A;  1O8W A;  2CVB A;  17GS A;  3F4T A;  4RQX A;  3F9U A;  1YF0 A;  3UAR A;  3DGQ A;  3TOU A;  4GQF A;  5COH A;  5KN2 A;  1SKW B;  1TP9 A;  3EUR A;  1XW9 A;  4EKZ A;  3ME8 A;  2I3Y A;  1K0B A;  1XVQ A;  3GNJ A;  2GTU A;  1T3B A;  3UIW A;  1K0A A;  3LYP A;  4K7I A;  1J0F A;  3ED3 A;  1T7P B;  2DMM A;  1V98 A;  3DD3 A;  1K0C A;  5HR1 A;  3A5W A;  2YV9 A;  2DJ2 A;  5B8A A;  2LNS A;  2PGT A;  1TRV A;  12GS A;  4J2F A;  2LKU A;  3WD6 A;  3IAS 2;  2XBQ A;  5ECQ B;  1X9W B;  2B1K A;  4RUV A;  2DBC A;  4YQV A;  3EYT A;  1ZMA A;  5G1K A;  5B6M A;  1G7O A;  4IN0 A;  2H76 A;  4Z2T A;  1GTI A;  2LST A;  3KH7 A;  2OA7 A;  4YQU A;  2JAC A;  1T8E B;  3LOR A;  4K2D A;  1SK1 A;  1XOB A;  1XIY A;  4L0W A;  5ECS A;  4POK A;  3N5O A;  1EOH A;  3VWW A;  4D73 B;  1ZGN A;  2GZZ A;  4WEY A;  3QAG A;  4NXI A;  1Z7R A;  5ABR A;  5IMF A;  4YKG A;  1TK8 B;  4KB3 A;  3WT1 A;  1YZX A;  2N5F A;  8GSS A;  2MMZ A;  2M46 A;  4F82 A;  1V9W A;  3GH6 A;  4NWY A;  3GHA A;  2F51 A;  3GST A;  2IJY A;  2OBI A;  1T1V A;  3HCZ A;  1S3A A;  2B5Y A;  2LNT A;  3QMX A;  4N10 A;  5J9C A;  1YKC A;  3RPP A;  4V1A p;  2LUS A;  2OAC A;  3N9J A;  3IXR A;  3FZ9 A;  1ABA A;  4QQ7 A;  1VF3 A;  1MD4 A;  1XCC A;  3QAW A;  4YAV A;  3DKS A;  3FKF A;  1SJZ A;  3UL3 A;  2X4A A;  2HNL A;  3U5R E;  3IPZ A;  4JR6 A;  5JWO B;  2YV7 A;  3FMW A;  2MYG A;  4DSQ A;  2DKH A;  1WE0 A;  2DJ1 A;  4FYC A;  5F07 A;  4K7O A;  4N0V A;  2TRX A;  4J56 E;  1H4O A;  2PMT A;  3KM6 A;  1DE1 A;  4O92 A;  3GX8 A;  2EIR A;  2DJJ A;  1Z3E A;  14GS A;  3CYN A;  3HZ4 A;  4MA9 A;  4G9H A;  3ZFL A;  3VUR A;  3DIE A;  5DAL B;  1QUW A;  4GQC A;  2P31 A;  3TKS C;  1OC8 A;  1GTB A;  3ERF A;  5CRE A;  5HFG A;  4K0N A;  3VI7 A;  4ML1 A;  3KCM A;  4ID0 A;  1LJR A;  1ZYN A;  5A4U A;  3CSH A;  2H72 A;  1DBY A;  2V1M A;  5IPH A;  3ZZX A;  3O6T A;  1QMV A;  4ILF A;  2YN1 A;  5D73 A;  3HDC A;  3TKS E;  3DML A;  4JZQ A;  4Z2R A;  5AIV A;  2R0C A;  2IPA A;  4EDY A;  3KMN A;  2HSM A;  3ZL5 A;  3R2Q A;  1Q98 A;  4OFN A;  4KCA A;  2XHF A;  3RBT A;  2LJK A;  2RUE A;  4HQS A;  1XXU A;  4ECC A;  2FUG 2;  1ZL9 A;  5BRT A;  1QXH A;  2HYX A;  4XS1 A;  3ZYW A;  3DWV A;  2HRN A;  4HJM A;  1FB6 A;  4PQH A;  2HSH A;  2OE1 A;  1JZD A;  2IWT A;  2H30 A;  1G6Y A;  1EOG A;  1JLV A;  18GS A;  4MCU A;  4WF5 A;  1XWG A;  3GKX A;  1OE7 A;  4MDC A;  5ELG A;  5D9W A;  5ELA A;  1BG5 A;  3EIN A;  5BMU A;  2R3X A;  3FYG A;  1N2A A;  5ID2 A;  4X4J A;  1SK2 A;  2K6V A;  5DAK B;  3EU4 A;  5CYY A;  4ULX A;  2CQ9 A;  3A2V A;  1FVK A;  2XPE A;  1JZO A;  3TRX A;  5B6N A;  4HQZ A;  2VLU A;  3TJJ A;  4ZL9 A;  4MPF A;  1GNE A;  1GSD A;  2YP6 A;  5C00 A;  4HS1 A;  3HHV A;  2GST A;  2P5Q A;  4DSS B;  3NIV A;  4PQ1 A;  4ZXG A;  5KOW A;  5EY6 A;  2BTO T;  5AN1 A;  2ALB A;  4IQ1 A;  2IL3 A;  4AF2 A;  3J7Y b;  1Z5Y E;  4BVY A;  2CX3 A;  1IYH A;  4ML6 A;  1W89 A;  4K1F A;  4MAB A;  13GS A;  2C0G A;  2YPM A;  1YDK A;  2QSI A;  2F8A A;  5IMA A;  3C1S A;  5DDL A;  3L9S A;  2A4H A;  2H19 A;  5H5Q A;  1JLW A;  1PKZ A;  4CDO A;  5F06 A;  2VL9 A;  4XS4 A;  5CRD A;  2QA2 A;  1OVN A;  2L59 A;  4P3Y B;  5ECI B;  3IBH A;  2LRT A;  2TIR A;  5CP1 A;  3L4N A;  4ZBB A;  1E6B A;  5GAP D;  5DCH A;  3BJ5 A;  1AW9 A;  2HXK A;  5D9X A;  4HU9 A;  4F03 A;  4TW5 A;  5IMZ A;  2IMD A;  1CQH A;  1B8X A;  1K3O A;  3D4M A;  5FWG A;  2JZT A;  4Q5Q A;  1MDI A;  2D2Z A;  2ZCT A;  4LL1 B;  1YJ6 A;  1NM3 A;  1Y6E A;  1A0R P;  2CAI A;  2O87 A;  3MAK A;  3L9V A;  4DVC A;  4G10 A;  1QK8 A;  4Z7X A;  4ZB6 A;  1K0D A;  5J5N A;  4BVX A;  1WPI A;  1LBK A;  2H1G A;  2V32 A;  4V2M A;  2FWE A;  1HYU A;  3LEF A;  4IW9 A;  1PRX A;  3KTB A;  1AQX A;  2VM2 A;  1AAZ A;  2YWM A;  1PX7 A;  3EU3 A;  1A2L A;  1O7U A;  2YNX A;  4J57 E;  1A2M A;  4X43 A;  4ZIL A;  3OR5 A;  1JZR A;  1RW1 A;  4ECJ A;  5KN3 A;  2A2P A;  3TRP A;  4XIH A;  2K8V A;  4ZB8 A;  2G0F A;  2P5R A;  4N30 A;  2H66 A;  4I2U A;  3IK7 A;  1ERV A;  1QGV A;  3C71 A;  4GWR A;  4JED A;  4TR1 B;  2CVD A;  4IKH A;  4GSN A;  2JL4 A;  2KP2 A;  3LWA A;  4TRX A;  1PKW A;  3J7Y k;  2I9H A;  1M0U A;  4AJ8 A;  3CTG A;  3SBC A;  2HLS A;  1O8X A;  3IDV A;  3UMA A;  4HDE A;  3HZ8 A;  4XTS A;  2YWO A;  5INY A;  2WFC A;  3FEU A;  4YKF A;  3KP9 A;  2FA4 A;  4ISD A;  5ECH B;  5LD0 A;  1X9S B;  3GUS A;  1I9D A;  5EPF A;  4EF0 A;  2R5G A;  5HR2 A;  1URM A;  5ENU A;  3W8J A;  1ML6 A;  1R7H A;  4MP4 A;  1EGO A;  3IHQ A;  4JBB A;  4K7N A;  3RDW A;  2JZS A;  1V57 A;  2C3Q A;  6GSY A;  3ZLP A;  4O5R A;  2L6C A;  3GTU A;  1EEJ A;  5JCW A;  1YY7 A;  3D6I A;  3P2A A;  4IHU A;  4POM A;  5CRG A;  4LMV A;  3APQ A;  3GFK A;  1XPV A;  3UBK A;  1G6W A;  4QL7 A;  3VWU A;  4G2E A;  2O89 A;  1OE8 A;  5KOX A;  3DVX A;  2PER A;  1K3L A;  4E8H A;  1GSQ A;  2R4V A;  4XHM A;  1R26 A;  3I43 A;  1XFL A;  4MNN A;  5H5S A;  6GSX A;  4ZBA A;  2KOK A;  2VOC A;  2P0G A;  4ECB A;  2MMO A;  3IV4 A;  5F0G A;  3F4S A;  1Z9H A;  1GSU A;  3MYD A;  1KNG A;  5G1L A;  3ZTL A;  3FHK A;  1SKR B;  4ACS A;  3FR9 A;  1YEX A;  3GRX A;  4EXJ A;  1GUH A;  2YZH A;  5J41 A;  2N5A A;  2C0F A;  1VF4 A;  3TOT A;  1B9Y C;  3ZIT A;  3QPM A;  2BMX A;  4YAP A;  3F4R A;  3GL3 A;  1S3D A;  2AV4 A;  2OKA A;  2E0Q A;  1M2B A;  2IN3 A;  1GLQ A;  2DIY A;  2VD1 A;  1FOV A;  5HFI A;  3H4K A;  2K9F A;  3QR6 A;  1AQW A;  4KDX A;  11GS A;  2GVP A;  1ERW A;  3HVX A;  2X8H A;  5GST A;  1M9B A;  4BWS A;  4I8B A;  3QCP A;  16GS A;  1R5P A;  4FQU A;  4D73 A;  4IQA A;  2OAD A;  4WBJ A;  2X49 A;  4OMV A;  4GRF A;  2C1Y A;  4IP1 A;  2AB6 A;  3PH9 A;  4PUA A;  3IK9 A;  3BOA A;  1OYJ A;  1S3C A;  4NHW A;  2A2S A;  1FAA A;  2X8C A;  3PPU A;  1T00 A;  1T4Z A;  2KUC A;  2WGR A;  4A5P A;  3FR3 A;  1HNA A;  2L4Q A;  1JHB A;  3HYP A;  3HD5 A;  2VCX A;  3LXT A;  4L8E A;  4POB A;  3F8U A;  4F2I A;  5G5E A;  5D9T A;  1GUK A;  2LEG A;  1U3A A;  4KH7 A;  4BWQ A;  2CVK A;  5ECO B;  3TGZ A;  3MWH A;  1NSW A;  2VLV A;  3ZRD A;  2F8F A;  2WZ9 A;  1DUG A;  4K2X A;  1QFN A;  1ILO A;  1WOU A;  2J23 A;  5F05 A;  2XC2 A;  3GKK A;  3TCO A;  1OC3 A;  2YJ7 A;  1A23 A;  1TXX A;  3D0Z A;  2R2J A;  1X0R A;  1GWC A;  2NTO A;  4KX4 A;  4ZL7 A;  5DJM A;  3TJG A;  3G9B A;  3Q74 A;  2DLX A;  3ZVJ A;  3E9J B;  4E8E A;  5ECK B;  1GL8 A;  3HVS A;  4MPG A;  5CRW A;  2IFQ B;  5DAL A;  4KND A;  1J08 A;  1GP1 A;  2IMK A;  5A5K A;  2VL2 A;  6GST A;  4PQI A;  1RQM A;  3ZFB A;  1GSY A;  2GLR A;  2PVQ A;  2FWH A;  1M9A A;  2RII A;  4WBR D;  5IOX A;  3F6F A;  2DML A;  2DC5 A;  5CNW A;  4EC0 A;  4GXZ A;  2LTK A;  3WGD A;  1YKA A;  3HY2 A;  1A2J A;  4ZIJ A;  5J3R A;  4LA1 A;  1AC1 A;  2WCI A;  4K9Z A;  2H6Y A;  1NHY A;  2GZY A;  2FWF A;  4TVE A;  4IP6 A;  5JWR B;  3I9V 2;  2AUV A;  1Z6N A;  4FYB A;  1ERT A;  1ZCP A;  2H74 A;  3NOF A;  3VWV A;  2C3N A;  4USS A;  3TKP A;  1GSF A;  2J9H A;  2LRN A;  5IPG A;  3ZML A;  2DSA A;  3LJR A;  3VK9 A;  1VF2 A;  2X8G A;  2LQO A;  5GZZ B;  1RK4 A;  5LNK e;  3H8Q A;  5ECP B;  1UVZ A;  2M72 A;  4O5Q A;  3F6D A;  1HD2 A;  3PGT A;  1XWC A;  3C7M A;  2C80 A;  4G0L A;  2WB9 A;  5DAK A;  2PU9 C;  5AIX A;  2ZNM A;  2R0P A;  3I6A A;  3D4T A;  2HRK A;  3E3E A;  2XBI A;  2YOI A;  1WJK A;  1F6M C;  1EP7 A;  2B6M A;  3SWL A;  4PNG A;  3RPN A;  3RHB A;  2H0G A;  2VCQ A;  1H75 A;  4DSS A;  3TJB A;  2C4J A;  3DEX A;  2AYT A;  4BPY A;  4ZL8 A;  4IVF A;  1SYX A;  1ERU A;  3GA4 A;  2WUL A;  3APO A;  4EE0 A;  5DVB A;  1XZO A;  1TU7 A;  3HJO A;  5C04 A;  2JSZ A;  10GS A;  2DKI A;  5DBQ A;  1TDI A;  1V40 A;  2FNO A;  2FCH A;  2EIQ A;  5IQY A;  4K5S A;  3K8N A;  3ZMK A;  1KBN A;  1B9X C;  4L5L A;  1TW9 A;  1Y25 A;  5HR0 A;  3KD0 A;  4GF0 A;  1AQV A;  3E0U A;  4JE1 A;  4IS0 A;  2RM5 A;  4OCF A;  5IO2 A;  3UVH A;  3ZIJ A;  2N5B A;  2I81 A;  1YEP A;  4X1U A;  2H73 A;  3M8N A;  4MJC A;  2CZ3 A;  3GN3 A;  1WP0 A;  5DCG A;  5F8B A;  3Q19 A;  3EMP A;  4ZBD A;  1PA3 A;  2GQK A;  3IHG A;  1TRU A;  2V2G A;  4I6X A;  5EVO A;  4MJA A;  3VWX A;  3Q6O A;  2H01 A;  4KSO A;  4G19 A;  3DXB A;  3JCM L;  3PR8 A;  2GSS A;  4KCE A;  1PL1 A;  3GL5 A;  4NHZ A;  2FD3 A;  2YAN A;  2CZ2 A;  2CAQ A;  1THO A;  5FT3 A;  4Z2U A;  4IBP A;  1G7E A;  1GTU A;  3P90 A;  3M3M A;  1WWJ A;  4OO5 A;  1N8J A;  1TKD B;  3IR4 A;  4RQR A;  2HRF A;  5E4W A;  2E2G A;  2WDU A;  1ZZY A;  1BAY A;  1THX A;  3GKN A;  1ZOF A;  2HZF A;  4NV2 A;  5GAN D;  2VD0 A;  2B7K A;  2MBS A;  3TKS A;  2XPD A;  3BCI A;  2V6O A;  2I1U A;  4KDU A;  5IMV A;  1PL2 A;  4I97 A;  4EIP A;  1FO5 A;  2VL3 A;  1UC7 A;  4KE3 A;  3WYW A;  2V41 A;  1EZK A;  4FIW A;  3F3Q A;  2VM1 A;  2DJK A;  3WGX A;  2GZP A;  1PD2 1;  4GLT A;  1Z6M A;  3CBU A;  3U6V A;  4K8M A;  1K0O A;  4TR1 A;  4WET A;  4IGJ A;  1GNW A;  4MJB A;  5G31 A;  3TJF A;  3P7X A;  5ECN B;  3O76 A;  5IM9 A;  3H1N A;  4PUR A;  2FWG A;  2DJ3 A;  4WR5 A;  3LW9 A;  2IIY A;  3F3R A;  3VLN A;  4PXO A;  1F9M A;  4TR3 A;  3GH9 A;  3QFB C;  3TB2 A;  1MDJ A;  3CSI A;  3EVI A;  1VRS D;  1DSB A;  3CMI A;  3V1W A;  2R6K A;  1B4P A;  3CRT A;  3M0F A;  2QC7 A;  1JFU A;  3GSS A;  4V2L A;  2R37 A;  2PUK C;  20GS A;  3QFA C;  5ECM B;  3G7I A;  4FYU A;  1WRY A;  1R5A A;  2IMF A;  3FZ4 A;  4GSS A;  3L9U A;  1U88 A;  2YWN A;  1PSQ A;  1M2D A;  1T4Y A;  1W4V A;  4RI7 A;  5D8I A;  1HNB A;  3DVW A;  1LU4 A;  1GSE A;  1EGR A;  1O85 A;  4MH2 A;  4IJ3 A;  3F63 A;  1O81 A;  3FZ5 A;  1TI1 A;  4JU5 A;  4I5Q A;  1U6T A;  2GS3 A;  2A4V A;  4BA7 A;  3HA9 A;  1K0N A;  4X0X A;  1XW5 A;  3RHC A;  1C72 A;  4PUF C;  4KGI A;  1SU9 A;  2GQM A;  4AGS A;  1X9M B;  3GKM A;  5GSS A;  4BL7 B;  4L5O A;  4F0B A;  1VF1 A;  2BJX A;  2VUP A;  4TKY A;  1J9B A;  2UZ8 A;  1EEM A;  1F3A A;  4TXO A;  3ZRE A;  3KH9 A;  1OC9 B;  1BJX A;  3F0I A;  4RI6 A;  5J4U A;  3UEM A;  4HUA A;  4HEA 2;  3KP8 A;  4Q5N A;  3UOM A;  2JU5 A;  1TU8 A;  2DJ0 A;  4XS6 A;  4TXO B;  2NDO A;  2AJQ B;  1KTE A;  1TK5 B;  2LS5 A;  2REM A;  3A2W A;  3A5I A;  2C0E A;  3EPT A;  4OFM A;  1NW2 A;  3UBL A;  5KEJ A;  1F3B A;  4OD7 A;  1SJ6 A;  5FHI A;  1R4W A;  5HQP A;  2QA1 A;  4N0Z A;  4PNF A;  1TI3 A;  5AIS A;  3A3T A;  1FVJ A;  1XOA A;  1ON4 A;  2PWJ A;  2YWI A;  3IOS A;  1FOH A;  4MK3 A;  1GTA A;  5JWQ B;  2NPB A;  5A4V A;  3UAP A;  3W6G A;  2QGV A;  5D93 A;  4KW6 A;  4ECI A;  2FA8 A;  5ECR B;  3KTL A;  1G0T A;  4EDZ A;  4IJI A;  4AJ6 A;  1FHE A;  2MZC A;  2RUF A;  4K6X A;  2PVO C;  2M80 A;  4WR4 A;  4F0C A;  2PN8 A;  4TR4 A;  5CAX A;  3RAZ A;  2G2Q A;  4F9Z A;  3S9F A;  2PBJ A;  4MJE A;  1ZYQ B;  4KF9 A;  1QQ2 A;  3G7Y A;  2LJR A;  2JZR A;  4TXV A;  1JZW A;  1OKD A;  2HT9 A;  4LMW A;  1MTC A;  1EV9 A;  3LYK A;  1M7T A;  5A4W A;  3DRN A;  2H6X A;  5H5R A;  1TJD A;  4K0G A;  2X64 A;  4JR4 A;  4NAX A;  3FZA A;  4V2N A;  2H71 A;  6GSV A;  2VAF A;  2H1D A;  3CTF A;  1PN0 A;  4MLY A;  3TKQ A;  1X5D A;  4MZC A;  4O32 A;  1U87 A;  1VGL A;  2YZU A;  1XVW A;  3MSZ A;  3PIN A;  7GSS A;  2A2R A;  3FRC A;  3HJM A;  2H0I A;  2GDR A;  2VLT A;  2IFQ A;  3KJY A;  3QOU A;  1X5C A;  1F2E A;  1GRX A;  1TTZ A;  3LG6 A;  5IMD A;  1SL2 B;  3HJP A;  2H75 A;  1PQN A;  2O7K A;  1AUC A;  4KUN A;  5D9V A;  4XRA A;  4KAE A;  4GCI A;  2NVL A;  2O8V B;  2H1B A;  3HXS A;  2K8S A;  3FY7 A;  1BX9 A;  4HJ2 A;  2OE0 A;  4H86 A;  3TKR A;  3KXO A;  2C8U A;  19GS A;  2IME A;  3C8E A;  3KMO A;  2LJA A;  3ERW A;  5D96 A;  3M1G A;  1HQO A;  3LXZ A;  4HZ2 A;  2GSQ A;  3IC4 A;  4ICY A;  4KSM A;  3M9J A;  3IRA A;  5CO3 A;  2X99 A;  3C73 A;  4POL A;  4G0K A;  2VCV A;  2NBS A;  3WT2 A;  4TN8 A;  3LQ7 A;  2YJH A;  2L57 A;  4CHS A;  4PGT A;  5B7C A;  3TDG A;  3FK8 A;  3MDK A;  5LCZ A;  5G30 A;  2HFD A;  1B48 A;  3L0H A;  2B7J A;  1I5G A;  2GGT A;  1OAZ A;  1ZYE A;  3CXG A;  3KEB A;  2FLS A;  3LFL A;  2RM6 A;  4WXT A;  1GUL A;  3AY8 A;  4TR0 A;  1X5E A;  4I2T A;  4K5R A;  3L78 A;  4HI7 A;  4L0U A;  1CQG A;  2MBT A;  2VCT A;  1A0F A;  2GSR A;  2L6D A;  3FW2 A;  1Z7P A;  2L5O A;  2L4C A;  3CRU A;  22GS A;  3BD2 A;  1HNC A;  1K0M A;  3TJK A;  1PGT A;  5EL8 A;  1EWX A;  4GTU A;  5KN1 A;  4KA0 A;  4HOJ A;  2B1L A;  3G7J A;  2FHE A;  2MMN A;  1F37 A;  2FGX A;  3ZVJ D;  3UJ1 A;  1GSS A;  2KHP A;  2VCW A;  4OFT A;  2HE3 A;  2L5L A;  5CRH A;  1TOF A;  4EO3 A;  1O73 A;  2HRA A;  1MDK A;  2EC4 A;  5KN0 A;  1EP8 A;  4ZB9 A;  1YF1 A;  1SKS B;  1XBS A;  4MH3 A;  3A2X A;  4OCE A;  2QKE A;  3M9K A;  1SK0 A;  6GSW A;  2VO4 A;  3Q18 A;  1IYI A;  9GSS A;  1M2A A;  1XWA A;  5AGY A;  1BYE A;  1V58 A;  2ES7 A;  4OWY A;  2CV4 A;  3NZN A;  1GUM A;  3VI5 A;  1ZYP A;  4XCS A;  1KEB A;  3D5J A;  1ACV A;  3D22 A;  2AHE A;  2MMA A;  5JCU A;  4CY8 A;  2WS2 A;  2OBK A;  4TOP A;  4HZ4 A;  5IOW A;  1FG4 A;  5ID2 B;  4QL9 A;  4OO4 A;  1SEN A;  2GQL A;  2OE3 A;  1XW6 A;  1XWK A;  2F3M A;  2KP1 A;  2HZE A;  3ISO A;  3GV1 A;  2VIM A;  2C3T A;  1AIU A;  1U3I A;  4Q5F A;  2B3S A;  2PPT A;  4EUY A;  2B5X A;  2JAD A;  3HKR A;  2B5E A;  3VFI A;  2ON7 A;  2WRT A;  1Q4J A;  1SD9 A;  3O3T A;  1M99 A;  3US3 A;  2CA8 A;  4MZW A;  2H6Z A;  2HZE B;  1PMT A;  1XWB A;  2R0G A;  3BCK A;  1WMJ A;  3GYK A;  1A8Y A;  4MF6 A;  4O5U A;  1E2Y A;  3QDN A;  4MF7 A;  2V6K A;  2RLI A;  4N11 A;  2KLX A;  4BVY B;  5IMC A;  3HVV A;  5E59 A;  1TK0 B;  2C0D A;  3EWL A;  3C1R A;  4EVM A;  3KGK A;  6GSS A;  1FB0 A;  1DE2 A;  2DIZ A;  4MZB A;  5HR3 A;  1GLP A;  2TRC P;  3BBY A;  3FR6 A;  4EL1 A;  1PN9 A;  5JCG A;  4XS4 B;  2YCD A;  4G0I A;  4NV5 A;  4FH8 A;  5DQY A;  5G2Z A;  3TUE A;  5DQS A;  3EE2 A;  2GT5 A;  1ST9 A;  2K18 A;  4O7H A;  3IC8 A;  4XRD A;  2O85 A;  2F9S A;  4V1A g;  2H8L A;  4GST A;  1TRS A;  4MMM A;  3EMX A;  3R3E A;  3KIJ A;  1YQ1 A;  3DYR A;  5J9B A;  4MF5 A;  2H0H A;  4AJ7 A;  3GX0 A;  5HFK A;  1PX6 A;  4WKW A;  2VCZ A;  3GMF A;  3MNG A;  3GUR A;  3ME7 A;  4DEJ A;  4KDY A;  1SJI A;  1B4Q A;  2OJL A;  3IAM 2;  2E2M A;  4YQM A;  2EIO A;  4BVX B;  2I4A A;  5IO0 A;  3ERG A;  4IEL A;  2GT6 A;  2E7P A;  3WGE A;  1OKT A;  3P8W A;  2H70 A;  1UN2 A;  3MIX A;  4PTS A;  3VPQ A;  4FO5 A;  2LQQ A;  5ECL B;  2Z9S A;  2WJU A;  3TRQ A;  3VPT A;  1SL0 B;  1UA5 A;  4YH2 A;  3I69 A;  2IMI A;  3QAV A;  1NHO A;  3H79 A;  2ON5 A;  4LLR A;  3D21 A;  1O6J A;  3EC3 A;  1A24 A;  2ZUP A;  1SD8 A;  2HSY A;  1TRW A;  2VL2 C;  1V2A A;  4Q5R A;  3KZQ A;  1WIK A;  6GSU A;  3UVT A;  3IE3 A;  4EIQ A;  1EV4 A;  3GIX A;  5DJL A;  2AAW A;  3IA1 A;  4BL7 A;  4NMU A;  3W8S A;  4NPB A;  1BED A;  2LRC A;  2LV3 A;  4CW9 A;  5IIZ A;  1K3Y A;  2FY6 A;  3H93 A;  1OC9 A;  1MEK A;  5G5F A;  1GH2 A;  3LSZ A;  4JRR A;  2CX4 A;  2JSY A;  3CSJ A;  4HU7 A;  4WF4 A;  4LL4 B;  3APS A;  3LGC A;  1USB A;  1A8L A;  5B8B A;  4CY6 A;  4DSR A;  3ZIV A;  2CT6 A;  1SYR A;  1BQ7 A;  3GTU B;  1FW1 A;  2HI7 A;  3QD9 A;  4PX1 A;  5L71 A;  1SL1 B;  2H1A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...