4NMXB

Pcsk9(deltacrd) in complex with phage-derived inhibitory peptide 2-8
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
294
structure length
278
Chain Sequence
SIPWNLERITPGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFSKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Identification of a Small Peptide That Inhibits PCSK9 Protein Binding to the Low Density Lipoprotein Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 278
sequence length 294
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4nmxB00
1AF4A 1SBCA 1SUBA 1TM4E 3DW3X 3TI9A 4H6VA 3A3NA 1BE8A 1TECE 1MPTA 2Z57A 5AMXA 1AU9A 3QTLA 1Y4AE 5AQEA 3DE7X 2SECE 1UBNA 3DVQX 2V8BA 4WOBA 1SUCA 1YJBA 3LXUX 4DWWA 1C9MA 1SIBE 1TO2E 3DE1X 2ZWPA 1YJCA 1NLUA 1SUEA 1GTJ1 3WQBA 3VTAA 1Y4DE 3VSBA 1SCDA 3EE6A 1BFKA 4KB5A 1TM7E 1GTG1 3WIUA 3P5BA 1NDQA 1SCJA 2ID8A 3GCWA 2WV7A 3I34X 1DUIA 5JXJA 5JMOA 1SUAA 1ZVKA 2HPZA 4JP8A 2W2PA 4RYDA 2Z2YA 5CW1A 5AVJA 1TMGE 3GT3A 1AH2A 1S02A 5K7SA 3DE3X 3GT4A 1TM5E 1LW6E 2G4VA 4AKSA 1BH6A 1KE2A 2DP4E 1KDVA 1AV7A 1VSBA 1SUPA 4LVNA 3F7OA 2SNIE 2B6NA 2WUWE 1T1IA 5SICE 1SH7A 3SQOA 4Z2AA 1T1EA 1GNSA 2SICE 4DZTA 4GI3A 1CSEE 4CG0A 3LPDA 1C9NA 3DE5X 1V6CA 4CFYA 2ZRQA 3BX1A 1BJRE 2Z2XA 3DE6X 3I30X 2Z58A 1KDYA 2QTWB 1C9JA 2Z2ZA 2PKCA 4OV6B 1WMEA 2PMWB 2HD4A 1CNMA 5JXIA 3A3PA 4ZOQI 2W2QA 1MEEA 2PQ2A 1GNVA 1HT3A 3DDZX 4MZDA 4C3UA 1THMA 5ARCA 1R64A 2GKOA 1ZVJA 1TM1E 4M1ZA 1SIUA 2ZWOA 3OSZA 3F7MA 1JEAA 5JXGA 1OT5A 1Y34E 2PRKA 1SBTA 2IXTA 1SELA 3H42B 2Z56A 3VYVA 3VV2A 3DE2X 4BWGA 1SBIA 1GA1A 1ST2A 4NE9A 3BPSA 1WVMA 1EA7A 1SBNE 1EGQA 1Y3CE 1SPBS 4J94A 1NDUA 2DQKA 2SBTA 3A3OA 1GA6A 4DJ5X 1Y33E 2X8JB 2E1PA 3F49S 1V5IA 3T41A 2WUVA 4KPGA 5AVKA 5I9SA 3DW1X 3GCXA 5FFNA 3Q40A 2TECE 1TO1E 4C3VA 1AVTA 2PWBA 1AQNA 4NMXB 1TK2A 2PYZA 1Y9ZA 1IC6A 1KDZA 4KG7A 5ARDA 4YN3A 1AK9A 1Y48E 1P7VA 1PJ8A 1WMDA 1DBIA 1WMFA 1P7WA 1C3LA 3ZXYA 3LPCA 2XTJA 4I0WB 2W2MA 1SCBA 3DYBA 1SBHA 4ZARA 1S2NA 1Y3FE 1BFUA 3EIFA 2ST1A 4OMCA 3SICE 4H6WA 3TI7A 2Z30A 1S01A 1R0RE 1GTL1 3BGOS 3DWEX 5B1DA 2PWAA 3UNXA 1GCIA 3TECE 5JXHA 1KE1A 3WIVA 3VV3A 4AKTA 1WSDA 1Y1KE 2DUJA 4CFZA 2IY9A 1Y3BE 1PFGA 5FAXA 5B1EA 1SCAA 1SUDA 3CNQS 3D43A 3QFHA 1YU6A 1SIOA 3D9QX 3LPAA 1SVNA 1GT91 3I37X 1ST3A 1SCNE 3PTLA 3I2YX 3ZXXA 4WOCA 2ID4A 3CO0S 2P4EA 1OYVA 1P8JA 1IAVA 1PTKA 2W2OA 3DVRX 3DE0X 1YJAA 4HX2A 1R6VA 1SN7A 3EDYA 3DE4X 3AJ9A 1OYOA 1XF1A 4OMDA 1GA4A 1Q5PA 3DVSX 1TM3E 5FBZA 3HJRA 5ARBA 3QMPA 3AFGA 2W2NA 4NE7A 3WHIA 4H6XA 1A2QA 4K8RB 2XRMA 3AJ8A 4HVLA 4B5LA 3Q5GA 4LVOA 2WWTA 3VHQA 1BE6A 1T1GA 4FONA 3PRKE 1PEKE 3L1KA 1Y3DE 2X8JA
chains in the Genus database with same CATH superfamily
1JX6A 4K03A 5J59A 3A4IA 1WD5A 3VC3A 1E7QA 1WB5A 4LTMA 1EDDA 4OO3A 3PEWA 1PVDA 2IYNA 2QD2A 3KWFA 4D8XA 5K09A 3RVBA 2PLRA 5TVGA 1JR2A 5FKJA 2OMKA 1Z0KA 1J0DA 2GSDA 3TI9A 3BULA 2QTTA 2IGTA 5CURA 3D3QA 2CXUA 2NUTA 2Q7XA 1KAEA 4I1PA 3IKMB 3QTLA 3FMPB 3K0KA 3H84A 2DHDA 4MROA 2JH9A 4B3BA 4PONA 3B1KA 1S8FA 1YHZA 3AERB 4ZVLA 4EJ6A 3H4VA 2FRDA 1VBKA 2IUTA 2IXEA 1CDEA 3IAS6 2FFRA 2JGMA 4DLAA 5IJ0B 3KJEA 1C7ZA 3UGKA 2FZGA 2R1ZA 4D0SA 1NP6A 3ROFA 4E08A 3CLHA 4MUFA 2E4AA 4BCCA 3UYKA 3RM3A 3CX3A 3JARA 4F7WA 2A84A 2YXNA 3I3OA 3JS5A 1V71A 4ZGBA 5JRZA 4RTSA 1DT3A 3SYKA 2R00A 3ETCA 1ZJZA 3A6EA 2JLZA 2UKDA 3LV8A 1M73E 2NVUA 2E6UX 3G9XA 4JB8A 3BCRA 4MQ5A 2JRLA 2FU5C 1TMKA 2YHSA 4HLDA 3TEFA 1W36D 3RSFA 4IOMA 3P96A 1JDVA 3GDOA 5IDYA 3KBBA 1T24A 1TVEA 3QJYA 3HR7A 1N2GA 3H97A 3L0CA 4JGBA 3R7BA 4EAAA 3KU4A 3AZPA 4PC3A 3EXG1 3L1JA 3PYMA 2C83A 4YQFA 3EEOA 1MV8A 3SSOA 4HAWA 4GKAA 2ZIGA 3Q8LA 2IZZA 2CF6A 1X94A 1OI4A 4GNRA 3W34A 3CF2A 2XITA 3VXKA 1AMNA 2HC9A 3MPUA 4Z49A 3DWIA 2B1QA 3IBYA 3K31A 1QRUA 3IPRA 1EGHA 5ED0A 3UAVA 3CZ9A 1C7JA 3FB1A 1WP4A 1XRPA 4IYRA 3RODA 5BW8A 3BGDA 5B1SA 5DRYA 4D82A 3VPHA 4F97A 3P5BA 2UVDA 2OZLB 3D7NA 4P4SA 2F43A 4I3HA 2P69A 4YHBA 4WKGA 2YZ7A 3QVGA 3SLRA 1LFDB 2OLKA 3HXOA 3ZKWA 2Q5EA 3T38A 3PFNA 3MD9A 2OHIA 5T57A 4DPMA 3PJEA 5IRCD 2P5YA 4RETA 2Q99A 4QGGA 3WYBA 1LLDA 1KWGA 4KVAA 1MJHA 2N1BA 3ZR4B 1A2OA 1RLMA 4OEHA 4TN1A 3KYBA 3IUPA 3BOSA 3FVVA 4DKXA 4LGVA 1O5TA 1VHWA 2J0UB 5AK5A 1E2HA 2XUPA 3DHYA 4HXGA 3RVPA 4E3ZA 4E7OA 4DF3A 2O07A 1AMOA 2VKQA 4RVUA 4YJFB 2HV9A 1GGMA 2OGZA 4V0QA 3CB4A 3EDCA 4L9WA 4TT8A 1B2LA 2QD5A 2A1UB 5IEJA 4O25A 4KO3S 5IT9A 1E4YA 1HC7A 5HTKA 3OEED 3HKCB 4D6XA 3NCTA 3JQFA 3JYQA 4TKVB 4DXAA 3AEUB 5IVDA 1A7UA 4J7CA 4X1IB 2FRVA 5BN4A 3ND9A 2Q27A 4JBIA 4LQCA 4ZN6A 1JFFA 4NYIQ 3UK0A 3BS4A 1YMQA 1UJ2A 1FVHA 1WUKS 3ABOB 3FPCA 4GX5A 4KRYA 4LOHA 4M98A 4TKLA 1HL7A 4BNVA 2DB3A 4DLKA 4K3UA 2NNWB 2Z3ZA 4TSFD 3ONWA 4RIEA 4BNTA 3FPEA 4A03A 2FSVA 5JLAA 2NU9B 3VU9B 4OXIA 2BFFA 2FDRA 3HP1A 1BRTA 1GL9B 1DQYA 1QS0B 3OFKA 2H5IA 4IFTA 4YECA 4CBVA 5IT4A 1V4NA 2JLWA 2PT5A 5IXJA 4U7WA 3TGPA 3R6GA 3FMVA 2P8JA 4J4TA 5B4TA 1WMBA 4FYHA 1SVUA 3MILA 5GGXA 4IDFA 5FBQB 3CZAA 4GVXA 2RGNA 4ML3A 4AZTA 3GAMA 3OT4A 1RCFA 4BO5A 5BNIA 1DRKA 5KYYB 1MCZA 2GYVA 2EAUA 2Y9MB 1XTBA 4FD3A 4KOAA 1C4WA 5JVDA 1UMDB 3ZCRA 1EHYA 4FKZA 2CHUA 2FZEA 2UVQA 1LSOA 3BTVA 3COYA 3NOXA 4WZAA 4M37A 3OZEA 2FGKA 3KR0A 4FCTA 4QXPA 4D4KA 2P8SA 2Q4EA 2FOLA 3UV7A 1TYBE 4L5YA 1EVIA 3HVKA 1IM2A 4RIIA 2Y0CA 4Q9DA 2CYCA 1W4BA 4OBEA 4IJQA 5FWYB 3H5VA 1U0EA 3CRZA 2ZITA 3A6ZA 3MN1A 3FETA 1V9LA 3H4MA 1Q92A 1D0SA 4NOJA 2WD7B 3IQEA 4IR7A 3HRIA 4GBJA 3QM1A 2I2WA 1UBSB 4M0KA 3E3AA 4LF7B 1IATA 4LNHA 4E5VA 2J5XA 3VR5A 5B7QA 3FNFA 5LDHA 1PCXA 5IC6A 4EY6A 2UZAA 3G5UA 2ZM6B 1TAUA 3E5NA 2IPNA 1I24A 4HZUB 3WGKA 5ER6A 1MFZA 3B6MA 3GHHA 3N2KB 4MUHA 4AXXA 2QRNA 4R7TA 2G5GX 2Q1YA 1BXGB 2AE2A 3ZVKA 1FDOA 2X0FA 4D02A 1U3WA 1NLYA 3RSOA 3OD5A 5JXIA 1LBHA 1C3OB 1HOXA 2ZQZA 1N2ZA 4FNGA 1X1QA 4X64B 1HUQA 4UW9A 4WNYA 4ZOQI 5IF3A 5KNCH 1R5BA 1PQYA 5SYNA 3NHUA 2CNLA 2VTKA 1V3TA 2ORED 3K5HA 3V55A 3ESYA 3DTVB 2X42A 3KPUA 3L49A 4IIYA 4LMBA 3UFBA 3A9WA 2PXHA 2SKCA 3BB3A 1KAHA 5E0OA 3VBEA 3ADCA 1EFHA 2BY4A 3QIVA 1XGKA 1KJZA 1OTXA 4D8UA 5C3MA 3CE9A 3ZWNA 4C3UA 1VKZA 1XRNA 4YXFA 1JPVA 4JROA 3CLVA 3V2HA 4YS6A 3R75A 2AMFA 3QWIA 1F17A 1JE1A 4PHFA 3FR8A 2FZVA 2OOSA 2OHGA 3IBFA 4QIHA 4RPJA 4EYQA 2VNAA 1HKHA 4MAAA 5DNAA 2FP3A 2NZUG 3S40A 2AFVA 3L8ZA 1I1QB 2X6TA 4O5OA 1M8GA 1MO3A 3ASUA 4UAVA 5C46F 2VQEB 1I0LA 1IN8A 1CVIA 1Z0JA 3GEIA 5HQTA 5ALGA 2CEAA 1M34A 1O58A 4X7PA 3ZK9A 4CT5A 3DZ8A 4P5EA 4WK0B 3NBKA 4YUYA 2J6IA 1DLJA 3JQCA 4M1ZA 3PL5A 4W1PA 3QUQA 3RASA 1LLCA 5DHPA 1UJ5A 4FS8A 2E21A 1H2ZA 3BQNB 1ANKA 1FVOA 5DI3A 2FPKA 2JGKA 4YALA 5E1OA 3NUQA 3QUAA 2BZ1A 5HQ3B 2GJ9A 2ZJYA 2NZXA 4YJKA 1BDBA 2FWRA 3L01A 4W99A 5EKUA 5EJ9A 3DUFB 1RYFA 1LPAB 3QVXA 3KXDA 4CM8B 5K05A 1MOQA 2GWRA 4DW8A 4GYJA 4Z9AA 3SMVA 2DFVA 2ZETA 1CY8A 1F5SA 4CQLA 3VYVA 4JHLA 5HKAA 1Q0PA 3X1XA 4OHUA 1KARA 4LNUB 4RVDA 3ZTTA 4GT1A 2OO5A 2J09A 1N36B 1XVVA 1YI1A 4C4OA 3VBCA 1VHTA 1IIBA 1CIJA 1L3IA 4PLTA 1L7BA 3UFXA 4JOSA 2ZYSA 1NE7A 1U8EA 3I6BA 3AHGA 4AW9A 2PGNA 4CKWA 1OE0A 3QUSA 3T3IA 1Z2DA 1PLLA 4LEIA 5AM1A 4WH0A 2XB2A 3LHSA 3MRTA 2QENA 1Q1EA 2VYFA 3IXQA 5HF8A 3BSWA 1BGVA 1JBEA 3MIIA 1Z6XA 4P35A 3LRXA 5CX1A 3ZCTA 1RPZA 3PTZA 1P73A 3AESB 1NW3A 2XCIA 5AT1A 3WFZA 1SVIA 3AF5A 4WBNA 1Z6TA 4QBFA 4CR7A 3OWOA 1YBHA 2YJGA 3HKEA 3KLBA 1NF9A 3FRHA 1ZO8A 1KERA 3GJ0A 4J94A 1RPAA 1IK6A 1KIFA 1NBMD 3E0XA 2BEWB 4EG3A 4GXTA 3SHWA 1CUSA 3H8WA 1NAIA 1SC3A 4JDPA 1JSLA 3KKLA 4R4JA 4PG4A 4L4ZA 2Q4TA 3TLKA 3NNDA 1NDHA 4R41A 1NVWQ 2WF8A 3IQXA 2DBRA 5A0TA 2BKEA 4GGOA 4MGYR 4NEHB 5M7EA 3L46A 5AVRA 1WDKA 4KMSA 4KR6A 3D64A 4Z6KA 1IPFA 1EWQA 4MVJM 1OTYA 1U9JA 1FIUA 3QU9A 1T9KA 2I6UA 3QH4A 4J16A 5A4MS 2JARA 1UDAA 2NO5A 3B6ZA 2LZ0A 4ENUA 1TUIA 4Q39A 1RHRA 1NXXA 3GRZA 3IR6A 3VUFA 4ETWA 1O94C 2EF1A 4LYDA 4K6GA 1PEDA 1FPMA 2YOHA 1E98A 3O73A 3AUXA 3E5MA 5CIQA 5EZYB 3LD9A 3RHFA 5JMPA 3B82A 2WTMA 1U4OA 4KPYA 3LBFA 4LRSB 5ALJA 1KA9H 5BQXA 1AV6A 3RJ5A 3UPTA 3OCWA 1LZKA 2I7CA 5J2UA 4YROA 4Y1FA 2H2WA 4N3AA 3M1LA 4RMNA 5DDIP 1DRVA 1JSRA 4TTIA 1UMBA 1CY6A 3PQ6A 1KO1A 2OAP1 1RRKA 1SHUX 5THQA 4D3FA 4PZEA 1JUDA 1E9BA 1YJ5A 4R8MA 4XX0A 4ZVTA 5D3MB 3TOVA 1LTHR 1TJPB 1LLQA 4GXNA 1ONNA 3D3WB 4HBZA 2BONA 4LZPA 4MW1A 3W9SA 4BNMA 2ZJ1A 4PQGA 2NV2B 3ZGOA 1WMFA 2CL5A 1E2GA 1C3LA 1GIAA 1Q7EA 3Q7TA 3ELBA 3IV9A 3NEPX 3R7FA 2I3DA 4AY5A 3ME5A 1ENYA 2O7SA 4K9RA 3H5TA 3MLAA 1L4YA 2VTVA 5KQGA 4IMRA 1SCBA 1C0EA 2HO5A 1OPRA 2MHCA 10MHA 5CD9A 4KXLA 4ZARA 3UMYA 2H3HA 2VRWA 3HVUA 4JITA 3X1YA 3TE6A 3RH0A 1W4CA 4EPVA 2B8EA 4HJXA 3SICE 2JAPA 2XGMA 2GBGA 1YBVA 5FWNA 4OI0A 1EG2A 1XZPA 2V4MA 2YQ5A 4XUDA 1ODFA 1P4SA 2WICA 3VVCA 3UMGA 3KQMA 4KDEA 3L79A 3NNSA 1TA4A 4X93A 5SYMA 1SUWA 4DR3B 4XM2A 2CV0A 1KEZA 2XWQA 2ZI9A 5KNCD 2FVXA 3RK0A 5DK6A 3EF3A 2WG1A 3B9QA 4HL6A 5E8JA 4CKXA 1ZIPA 2NAPA 1NVDA 2GCIA 4FWIB 4BGIA 3U09A 2C82A 5K3AA 2FW8A 1DHRA 3CVJA 3QBJA 2YBDA 1WRBA 2V7GA 1E79D 2VN8A 3TAXA 1U28C 1V45E 3WYEA 1WW8A 5EJIA 4Z4QA 4C04A 1R1DA 4JAVC 3EC1A 4WZBE 2MYTA 2ZIFA 3H04A 4DTIA 1UC5B 4N7BA 5JYBA 4QDKA 4HSGA 1EHIA 2X2OA 5EZ5A 1TAHA 4PIMA 5LQDA 2WYOA 4F71A 2J48A 1QAQA 4D9KA 5F23A 2FYTA 3EK2A 4YLGA 3TGLA 2BYTA 1S3SA 1U5BA 3ZE7A 1V7ZA 3CUKA 4JJEA 4MS1B 2HJRA 2QTVA 2B7CA 2QYSA 1ESEA 4FBLA 5U1PA 2F64A 2ZUWA 4NU6A 3H83A 4G0PA 5DV9A 2IU0A 5LMNB 2VPXA 2ZPUA 3NZEA 4TWRA 3UPDA 4UTZA 2A1TS 1Q22A 3AM4A 3MTQA 1KL7A 1VHJA 3PWTA 1A9ZA 4W5WA 2M98A 1ZAKA 3TVTA 3KZVA 3KEFA 1R7RA 4WWHA 3KO8A 3K8OE 1TC1A 4C05A 1NQAO 4EB0A 1I4WA 1KO5A 1JJFA 1QE5A 2OAQ1 2R6GA 4MWOA 1V7PC 1G21B 1KY5A 4WCFA 5BR1A 3DD5A 2YYSA 2V3WA 3FFBA 3PQCA 2VAPA 3DVRX 1HI9A 4EQ6A 2JGFA 5AM2A 1QRRA 1ZEMA 1VECA 1GL7A 3A2LA 4DSNA 2H2GA 2W2KB 4TX1A 5DEIA 5BW4A 1HTWA 1LBIA 1QHHB 3I83A 3LHKA 4B79A 2YCLA 5EERA 3D8TA 4WEOA 3E61A 2MYPA 1JQBA 5FNVF 3WLRA 1E5VA 3ZBTA 2E37A 4DAEA 3ZYCA 1LI4A 1ZICA 4LJ8A 1N0UA 1JLLB 1R0YA 3E1GA 1EP2B 1DAPA 2GKSA 3AGPA 3TD6A 5AVZA 1G41A 4U5QA 4LF6B 3V9PA 2DQZA 3H2SA 3TX2A 3DAOA 4H1TA 1ZR2A 4A7PA 1VPEA 3BDIA 5GONB 1ZAYA 3BVPA 2O3RA 4BEBA 1EBUA 5EEGA 4K8RB 4PWYA 3DOHA 4QG7A 2PUGA 2D0OB 1G42A 1D8AA 2RONA 4FYJA 5H0IA 1L4LA 1U4SA 1H23A 3HB9A 3PPVA 4W1RA 4B5LA 5DO9A 3U6BA 3P0JA 1CUDA 1F20A 4PFKA 1NATA 5FBKA 3ZGZA 3AM5A 4D9MA 5CBKA 2EFYA 3T5MA 1LPMA 4CQMB 5JSUA 2CSUA 5ERGB 2ADMA 1UJ4A 2GCNA 2MYNA 4H0NA 2IZ5A 4PYOA 4ZQEA 1HDXA 4KQJA 1YE8A 3WL5A 2ZSEA 1JXOA 2Z9BA 4J29A 1GV0A 4LA4A 5K4GA 3EAFA 3R4CA 3LT5A 1SBCA 2EC5A 1QK4A 2Z8XA 3NYQA 3U3MA 5K8TA 2HA5A 3OPVA 1NOJA 1SUBA 4MQ6A 3U1VA 1T9CA 5C7YA 4BCBA 1X70A 1LWNA 4Q1BA 4DANA 1G20E 2DFTA 4WZBB 2P2DA 1SXJE 4DRYA 5BSKA 4R5HA 2JJ2A 2X41A 5AVVA 5IJWA 1TEZA 1YDHA 2O2JA 1V16A 4DG9A 2H59A 3EC2A 4EB3A 2OBBA 1RIIA 5IMSA 2VEDA 3H18A 2VQDA 4P31A 3QW4B 5BNTA 4GPZA 1C81A 4J0JA 4HV4A 4WPGA 2PXAA 5DULA 2HBZA 2BL4A 4Y8VA 3R7LA 2EGHA 4ASUA 5DE3A 3U4QB 4EMTA 3RYCA 3O4FA 1MZVA 4FFMA 1QHYA 5KAMA 2R5WA 2DLDA 4OP1A 2KHZA 3BGSA 4LHSA 2RHRA 2WFAA 4HNRA 3AUUA 4L6CA 4XUCA 1O94D 2H5LA 5K3DA 1N3LA 2CXNA 1KRXA 4GXQA 3ZLUA 3IODA 3HZRA 1DX9A 3DV0B 1XPOA 3JYOA 3T7KA 2QP4A 4U9IS 4B3MB 1ZD1A 3WWOA 1WHTB 1NU6A 4LSZA 1YE5A 4PRYA 1JJVA 1U0OC 3EUEA 3HXMA 2QUIA 3AIKA 3P4YA 1ZMBA 1SHZA 2QD3A 1PT6A 4D80A 2J0QA 1G8AA 1QCZA 2EKZA 4ERNA 4D92A 3SS9X 3IDAA 1C3JA 1T5DX 2YXLA 5EE1A 2ZWPA 2GB4A 2UUCB 2OCXA 2CFCA 3FZNA 3NH9A 3NONA 4HAOA 4OSEA 3CURA 4L8FA 1KJWA 2G7MC 1GAQA 2ORVA 4FJ2A 3W5UA 1XCJA 1O2DA 4QFBA 1QHSA 1SCDA 1UPAA 4UTXA 1WP9A 4Y2VA 1CNEA 1WV0A 4M8SA 5DX1A 1E69A 2AUTA 4CEJB 1E5TA 1XVUA 3EOAI 3IBSA 4M8KA 1BFKA 2NO9A 2QIOA 3M33A 3V4OA 1PL6A 3A9TA 4KB5A 2G7ZA 3N2GB 3WDMA 1XFDA 1UC9A 4ZCSA 4FMCF 4YCSA 1Q7RA 4UM5A 1LK5A 2EZ4A 4REMA 2BM9A 1N2CE 4ZIRB 2CJYA 4RW0A 2HU2A 3M9LA 1A88A 3VOBA 3AR4A 3ZY5A 1VLQA 1V1RA 1HETA 3OX3A 2VBGA 1JR3A 4C4YA 5TGZA 4AROA 4FBGA 4MQMA 4NU5A 4TL6A 3I2IA 4DG8A 1H4SA 1RAHA 2IPMA 4IQ0A 4UUBA 4AP6A 3ZY6A 4EUEA 3K2EA 1KYWA 3TQTA 2W2PA 2K2QB 3VR2D 3FPKA 4G5SA 3HBAA 4R69A 4C2AA 1ZOPA 2BOVA 4M88A 1JIVA 5D87A 5CDSA 1B00A 4G0OA 1KKMA 5ECDA 4KVFA 2ECKA 5D8DA 1CUFA 1JLMA 1JQAA 1TZ2A 2FNAA 3BM5A 5HIIA 1I6KA 3FNGA 3OURA 2Z2JA 3T34A 1YVRA 2IU3A 1YVUA 2LUOA 2J3MA 3GPDG 4HP8A 1KY4A 1GFIA 4IY1A 1C7FA 2R8RA 2CNKA 3M6VA 3STWA 2O5EA 3DFIA 3ETEA 5JLJA 2EKBA 2C4MA 3T3GA 1D2MA 2ZKLA 4HWGA 1SZCA 1R6TA 5DLDA 1KDVA 4BVAA 3CCFA 3KDSE 4FSHA 4I81A 5A4DA 1VSBA 1N5KA 4RV4A 3WI7A 4OU5A 1E99A 2QL5A 1RI5A 3GAAA 3OFNA 4HI0E 4YV2A 4URXR 5ALNA 4MR9A 2SNIE 3I1YA 2H17A 3VSCA 2R2AA 4P08A 3ZX4A 1ZMRA 1L5KA 4E1VA 1GDHA 1NVEA 5L45A 1TVKB 2XY4A 1NQOA 2YH2A 3GGOA 4NF2A 4QYMA 1JA9A 3KT6A 1NWCA 1EQAA 1YI0A 2QTCA 4B7UA 3DCJA 3F5SA 4EO7A 5I4IA 1GSIA 3P5SA 4LJ6A 5J1SB 5I7WA 1TQDA 3G2MA 4YP0A 4BP8A 1R37A 3HZHA 4QM7A 1UK8A 2IHJA 3QEMA 1RVV1 1L2TA 2DF8A 4I9FA 4NZMA 4Z7QB 1XTZA 2AB0A 2XNDA 1G7RA 2GN9A 5FLXA 3B3AA 5FXMA 2WD9A 3UW3A 1UJNA 2HA4A 1WNFA 3INRA 3JQ8B 2PCJA 3L8YA 2AS0A 3UCEA 4B73A 1T1SA 1V11A 2A0XA 1CETA 4BZPA 5KMGB 5KPJA 4X00A 4OSPA 3CW9A 2QY6A 5IAEA 3OBIA 1W0JA 3EIQA 4G41A 3VI4B 3OEWA 1QH1B 1CDOA 2PZJA 4IPTA 3CMCO 1BU5A 4GH5A 4QU8A 5DBFA 5KSOA 1XLTA 2BBWA 5BXQC 1XA4A 3EDQA 1HDEA 2P0YA 4OGLA 3U80A 3UW1A 2ENUA 2X0JA 3MUFA 4CPDA 1I80A 4I66A 3U9SA 4RFVA 1U63A 1X77A 1K6IA 3KV3O 2C9CA 1APBA 2VT6A 1FW6A 3WGNA 3TYXA 1L8QA 4RHXA 4KSYA 4MIYA 3TCNA 2AMVA 3CLUC 4Q4LA 5CT5A 4ZV9A 1NI4A 2YQ4A 3R5XA 4GECA 5DU2A 4CU2A 3QPDA 4KXFB 2HV8A 4R2MA 2QX9A 4RHUA 4ER6A 3EXHB 1CWUA 3VPDA 1OKKA 1X14A 4V38A 5TJHA 3E9YA 2FUG1 1KHHA 3ZDAA 2GEBA 1J0BA 1I2BA 2ZAMA 4B9EA 2J67A 3LOPA 4PR3A 4BJ6A 4RTNA 2R751 4URHA 1G5IA 2ZBUA 3H2HA 2Q46A 1WZ2A 3IBGA 2PGLA 2OWEA 5JAPA 2GPJA 2O2XA 5F64A 2OG2A 1NA5A 5L3QB 2RKOA 5DT9A 3U1BA 2YYZA 3JPYA 3TQSA 5TMBA 1J0EA 2R6HA 1FSSA 1TB4A 1UPFA 1Z2NX 2WU3A 4G0QA 4IDBA 3W5VA 4HQLA 2QL9A 4HG2A 3NIGB 5IK2A 3VR0A 2E48A 1HA3A 3K73O 1TF5A 3WGLA 4EA8A 1VIMA 2FN7A 3GRCA 1UK6A 4XR9A 2RGYA 5C53B 1T3GA 2PZBA 1T3HA 1Q3TA 1MB2A 2YICA 1WCXA 4ERXA 5HZMA 4W8OA 4PW0A 1TM1E 1UZLA 1G8HA 1FNMA 3TLYA 1PTJA 3ISVA 3PJFA 1NW8A 1DOZA 1P0MA 2FLWA 3I8OA 4IH9A 1JT2A 4E70A 3KR2A 2GSWA 3PTAA 1N0WA 1GY8A 5JSZB 3BREA 4M8LA 3AUKA 4BC0A 4UFNA 1M6VA 2WNIA 4O1IA 3FLMA 4HPXB 4B83A 2QVLA 1TMOA 3HLYA 4RBNA 5FTMA 3H87A 1ZEJA 4J03A 3GMIA 4HGPA 3R3HA 2ZJOA 4LWPA 4BNXA 1M8PA 4X95A 4DCNA 1Y5LA 3R0QA 1EDEA 1X8JA 2C2XA 2XMCA 4WFQA 4EJ2A 2W6QA 1QH8B 2YZGA 4IG9A 4J0CA 4DZRA 1ZC3A 3ZE1B 4V2UA 3S29A 3BD8A 4X1KA 2VWHA 2HYIC 2ZZNA 1YBAA 2I29A 1ZD2P 4CV1A 4UAJA 3JQEA 1CU1A 1G19A 5JSYA 3TOXA 4BFVA 2PXCA 2WIAA 1GA1A 1GPDG 3R5JA 5ESRA 3X1DA 1ILWA 1JU9A 1L5FA 3PNSA 3PPIA 2PT9A 2FFBA 1CUZA 1DUSA 3AF0A 1G38A 2Q5JA 5IT5A 1PV4A 2ZRHA 3C7AA 3KCQA 4P83A 4F56A 4Q9IA 4ZEOA 5J4YA 2WJ6A 2Z0MA 1BVRA 2GARA 1JIUA 4M1YA 3GB9A 2J6BA 3W5AA 1WETA 1NX6A 5EMMA 2OXEA 1JHYA 3SU8A 2BFDA 3E35A 3K16A 4KMMA 4F96A 3AM1A 2WVHA 4J1QA 3TZKA 4BE7B 2D3WA 1U2GC 3QFTA 1MVOA 2FPPB 2P6UA 3A2MA 1GA6A 1QC5A 1NP3A 2AZTA 3QOWA 4C7JA 5ALTA 1JILA 3QTTA 3N6VA 4MVJH 1TYEB 4P82A 2GAOA 5IJ9A 5F2KA 2GRJA 3WNQA 4BMCA 1HNXB 3OF3A 3GA7A 3JWIA 1QRAA 4L4UA 3RG2A 2WUVA 2GUWA 3RC1A 5D3KA 2IU4A 1ZESA 3DWFA 1QMPA 5FFNA 4OFBA 4BKUA 2ZEJA 3BSSA 3GRFA 3FFAA 5TIIA 1RXSA 2HHJA 4LCBA 1E32A 2B83A 4MUBA 3TLGA 4QULA 1OWNA 1X13A 3FBWA 1EFRD 4PIVA 3LPLA 4TWZA 2EL9A 3QVVA 4BGEA 2NUTB 1UKYA 3I52A 4O02B 1S5PA 4LHVA 3N7AA 4TKUA 1E6EA 1S4MA 5FTKA 2X0DA 3FTDA 4BV8A 4DEYA 4L85A 4JVNA 3U7EB 3JZMA 3MWEB 3E9MA 4A1FA 3OTHA 1E1LA 3G68A 4N3CA 4RVOA 4EYGA 1FW8A 5FNVA 3IXLA 3MEQA 4G2TA 3PD0A 2C3MA 1PBTA 3OIVA 3KFXA 4RK4A 5D51S 3RC2A 3O5AA 4LY0A 4EUSA 5KBYA 1GPYA 3JARB 4KRXA 2JFXA 2ONYA 1USGA 3I8SA 5A71A 3EF0A 3H4IA 1FU7A 3SHFA 1UPXA 1PGOA 3WQQA 2X5NA 4DLZA 1UBUS 4R6XA 4Y9UA 3ET4A 4YA6A 3V5NA 4Q4HB 1Z3IX 4H18A 2JIBA 4OI2A 2C5HA 3C7TA 3ROXA 3ZXYA 3S8MA 4OAQA 4ETNA 2OFPA 2L42A 4OXQA 4R40A 3OO0A 2AFIA 2I7TA 5CK5A 4C4AA 3BKWA 3A4TA 2X0KA 4UD2A 4MW2A 3P20A 5DJ5A 4JJ8A 1X0VA 4JKOA 3DZBA 1QTIA 4WZAE 3H17A 4JCCA 4R8SA 2JCYA 3PFFA 1S2NA 4UBJA 5JNRA 4U7TB 4I50B 4XAQA 4EZIA 2Y0BA 3PEYA 3TXYA 1GGHA 3RT1A 3V4ZA 3UUWA 1KY3A 4AKEA 1J8MF 2ZPAA 4B6SA 4ARIA 1AOXA 2LE0A 3BAZA 2RHOA 2ZTMA 5U4XA 2W7TA 1DKMA 3MTGA 4Z9BA 5KSYA 1GZUA 2QXUA 3SCZA 1JAHA 5DK4A 5TV2A 5ITZB 3R3XA 4I1IA 1QE0A 4RTOA 3OUZA 2ZXUA 1Y6RA 3JWHA 3T7JA 3FF4A 2XXAA 1GWNA 5ISMA 1Z83A 1DIHA 2QM8A 3GJYA 4P4SB 1B6RA 3L04A 2AJDA 4XUGB 2DUJA 5AI4A 5E7JA 5FORA 3E9RA 2FUCA 4UCFA 3VDRA 3IX7A 1PFGA 1IXZA 3T9EA 1NLFA 2XDQA 2QX6A 3I9JA 2IXFA 3N05A 4NBRA 3RRNA 3G0OA 2MSNA 1LDYA 4BIIA 4TYYA 3PFKA 5AXCA 3KYJB 4B3IA 3CEMA 1W93A 4CLHA 4AN4A 3F6YA 3HCFA 4R54A 1UBOS 4ZGGA 4YUWA 2H1VA 2PH7A 3JAWA 1RU3A 1Q0LA 1OUMA 3A1UA 2X58A 2O3SA 4Q6BA 3F3MA 4ZDKA 1X7YB 2QEQA 3KVOA 3ZE2B 4G5OA 1QYRA 2KBFA 1G8MA 1VI5A 1GCAA 2KQUA 4OH7A 3HGMA 3I2YX 4E07A 3CUEF 3VKHA 2AUMA 4D8TA 1OXMA 1P3JA 5EKTA 1UXOA 2C31A 2NV0A 3ON5A 1R6DA 4DLNA 5TMPA 4RXTA 2ADOA 2C4UA 1QOZA 1RRVA 1FUIA 1JFFB 1MP0A 4ONEA 1ACJA 3OU7A 1SJ9A 1MD9A 3BZWA 2W4QA 5GIOE 4R9RA 3DEAA 4ISCA 3IPXA 4ZDIA 2QAGA 2OAEA 3AG6A 4MVJP 3SKVA 1KJQA 1XTJA 2P9JA 2WSMA 1FRNA 2BFFB 1PTKA 2FQ1A 2KBEA 4X91A 1HLGA 3O03A 1E3TA 4XVQA 3DE0X 4ZYLA 4IUBS 3IHKA 1GKLA 3R9XA 5ALFA 5EXPA 1HTTA 2JAHA 3EMBA 3B5JA 1W59A 2CXQA 5FPTA 4BLVA 4D98A 3W6NA 3O95A 4Q82A 2VRCD 5ECWA 1MF7A 2RHWA 2VSFA 3EVAA 2F17A 3WK5A 3F67A 4U3JB 3V4PB 4WZAB 4DDMA 3SC2B 2WIKA 3VR3D 3BBLA 3IUMA 3UB4A 4D0LB 5BRNA 1FYWA 4BO6A 4QQFA 4LAFA 2W2NA 3PC3A 1PNTA 4A9AA 3RYFA 2XUGA 2NYUA 2HX1A 5ALXA 5LM3A 5IC4A 5E9AA 5C1OA 2H06A 2EL7A 3MTAA 3ZWYA 5IN4A 1MOPA 2CXTA 3FHJA 1LPNA 1M2EA 1YRAA 5FTNA 1PN3A 1X2BA 3GW8A 1MOZA 1BE6A 1I01A 1XWIA 1WG8A 4G63A 5T67A 3LKVA 4BLUA 4F4HA 4X6LA 1E1QA 4ER5A 1ZQ9A 4W5NA 1K2VN 2WHRA 3A36A 2R66A 2OYCA 5FPPA 5LLSA 3JQPA 4MVWA 1U98A 2PX5A 1SXGA 4G56A 4HH0A 3ZTYA 1RBYA 3IB6A 5FI5A 3L77A 4RDHA 1YA4A 3FUTA 5J63A 3VR4D 5IDWA 4EBBA 2WU0A 2VH5R 3DV2A 4DY4A 4D45A 2VJNA 5D7BA 1DKQA 5ERXA 3ZUPA 3A1TA 4ZTUB 3NKFA 4KGDA 3K6KA 2I6TA 3DW3X 3ICCA 3Q3JB 1CDZA 3CIFA 2H9AA 3H3JA 4X6YA 8GPBA 5LYJF 5B55A 3GQVA 2OFWA 3L0DA 3QPVA 4GR5A 1USUA 2JS7A 2J0VA 3EH2A 4WVFA 3FD8A 4DDHA 4EG5A 1AU9A 3O1IC 4NIMA 4X1YB 5JNVA 1CS0A 4OJMX 3PZBA 1H1LA 3CRNA 3CEAA 3M4NA 4LSGA 5TARA 3S6JA 4A73A 4DCPA 1FDIA 1ZINA 2XV1A 1KJNA 3D6MA 3DBOB 3HL4A 4QHSA 4C7VA 2BKLA 2SECE 8ATCA 4YAUA 3VR6H 3PENA 4DCJA 1T4CB 4B3DA 1G7TA 3QK7A 3IMGA 3GH1A 2D5LA 3GZTB 4PYMA 1RYZA 4ALNA 4B3SB 3Q7SA 4PINA 3II6X 1YJBA 4KQEA 4TLMB 1ORVA 4KDFA 3QPAA 2ZIVB 4ON9A 4RZ2A 4YJHA 3WMGA 3UPUA 3BN3A 4L3OA 1D6NA 1KOFA 3VYWA 3QJGA 3T3NA 1Z4QA 2YHIA 1ZN9A 1BX0A 2HEGA 1OXTA 3H9GA 1LW7A 2JA1A 2M2IA 4TV9F 1P45A 2QMYA 3UB3A 2PRYA 5BY2A 4A0RA 3LHFA 3G0HA 2FSIA 3PC6A 3C97A 2QLMA 2WDZA 2IF2A 2BFPA 1XAJA 3QWBA 4I14A 4QTUB 1KTIA 3IVAA 1V7QA 1C9MA 1H2WA 1LVGA 3BK1A 3CZRA 3LDHA 2J3DA 4W6QA 3IMEA 1E63A 3F9IA 2QTRA 3S5JA 5KOIA 1SIBE 3W9UA 3ODPA 2QM0A 4XARA 3UWMA 4OQDA 3KHSA 1KZ9A 3P52A 4B3CA 5C8XA 3CG4A 2I6SA 1UQUA 3KSDO 3WQBA 4ZCMA 2NPFA 1VLHA 1IFXA 1JAYA 2MT9A 1TTQB 4B7CA 2Z83A 1HT1E 4I5FA 3MLBA 1G5TA 3HJBA 4F0JA 4GPAA 1OAOC 5G1OA 1M6NA 3VPAA 2PU5A 3RAPR 3UFXB 3I5UA 5IJZA 2I9KA 3FTCA 1GEEA 1X74A 2GAIA 1TM7E 2IPXA 2YJ4A 3FYUC 3OPNA 2XGJA 1W4RA 1P4HA 1I9CA 4NCBA 4GQAA 4TMXA 3Q3IA 2XQGA 3JAMA 1L3CA 1BAPA 3U2QA 5LQKA 4B7ZA 4AL4A 1NDQA 4AJ1A 4CM1A 1HK7A 4WBNB 3SE0A 4C14A 9LDBA 5EHXA 2ZRFA 4FC7A 3PA6A 3HKEB 1LPOA 1II0A 2XYPA 5IKEA 3QFRA 4DQXA 1AS0A 2B0JA 4B45A 4XYGA 5EMLA 1NXWA 1YXMA 4MPTA 1ZVKA 5JMOA 1CY7A 2C7PA 1EEXB 4OKSA 3P2OA 3TTVA 4IIEA 4WEQA 5BSFA 1ZISA 3OA2A 2OT3B 2ZYDA 3PDUA 1XU4A 2VJDA 3L7LA 4J49A 5K6AA 1QYIA 3KYDB 3A4NA 1QVWA 1Y7IA 2WVJA 4MYDA 4N8SA 4JSRA 1N92A 3F5DA 1NFRA 4ZOAA 3CUVA 5CW1A 1D4AA 5DOZA 4ZWNA 4CV2A 4NQRA 3QU4A 1FSFA 1YVEI 1T9ZA 3ISTA 3RBVA 1NW9B 1PT7A 2XUIA 3SR0A 1NN3A 1E20A 2VAWA 3A14A 1X7WA 1WF6A 1IL0A 3M4ZA 2ZUBA 1YQTA 3L4SO 4TLAA 2IUFA 3A1EA 1U0RA 3R76A 3GZ4A 1CERA 3TQIA 1RTKA 1QONA 1KE2A 2DERA 4DLLA 2ZRGA 1AV7A 3WYDA 4JLWA 1HRDA 5CHEA 5E7QA 2IYXA 1QLHA 1LBEA 2CK3A 5CT9A 3VPFA 2G1KA 5COAA 3KJIA 3OU2A 5E9JA 5J2UB 3DFKA 2PL3A 4LVNA 5K3EA 2VQFB 3W3AH 2LD4A 2RB5A 3QEAZ 4L4SA 1OB5A 2W71A 3P9ZA 3DMHA 2LKCA 1E1CB 5JJBA 5K6RA 2BM8A 5H4GA 4JI4B 2SICE 4AECA 1LBTA 4P3NA 4GI3A 2JI4A 3WL3A 3DR5A 3RRZA 1CSEE 1E1RA 1NR5A 1RM4A 2EEPA 2X13A 2FX3A 2HCRA 4L08A 3VKVA 1I30A 2KI5A 5B2EA 4NCAA 1G3QA 4RA6B 1KMQA 4YCLA 3MYYA 4H3SA 2PD4A 3LCCA 2A94A 5H1YA 1IPHA 4ID3A 5DIFA 4F3NA 2DJIA 4BTEA 2FOXA 2DECA 3QP9A 1JFTA 1ZNYA 1G18A 1HYGA 3RS5A 2P91A 5HSGA 2ZWVA 1NJ1A 5DNYB 4WK2B 3U62A 3KXPA 2YUIA 1TIKA 3K32A 1FP7A 3NG1A 4JK3A 4CFYA 4BKMA 5K8UA 2E2WA 2HWWA 2QWXA 5B3AA 3TUJC 2IX9A 2RKBA 2D1SA 2VDMB 1D2EA 2RDMA 4ZZIA 3KJNA 1QOPB 2Q28A 3LW7A 1IWBB 2Z2XA 3QOXA 4DABA 1NQXA 1QR6A 1V41E 1WY5A 3DE6X 3W6PA 5JS1A 4D6YA 4MPRA 2Z2ZA 5KOJB 3U4CA 3LOUA 1K98A 1W96A 1TGYA 2VPYA 5E2AA 3TUIC 1YRWA 2K7ZA 4AS2A 2BFAA 5HQJA 4FZ5A 5P8WA 2VIIA 4D8YA 2CCKA 4DREA 2X1LA 1HEIA 1UBJS 3NW9A 3T95A 2MSKA 4QUEA 4ATNA 2PHZA 4Y2SA 2A30A 2QN6A 3MTDA 4GAEA 1X1DA 5HOEA 1J5PA 1YZHA 5C7IO 4BB5A 1N8NA 4KHZA 3ONFA 4JQCA 1LCIA 2YXBA 2EDCA 1JMKC 4KWIA 4QASA 2GNOA 3O7WA 3ZWCA 5HWSA 2YMQA 2R8PA 5AJWA 1C0PA 1FYVA 2EHDA 3H65A 5EFOA 1N9GB 2PKWA 3ZJTA 1TIPA 2VDVE 2FDCA 2Q1XA 3BGWA 4YEDA 2WVGA 3AVUA 4R9UC 4KMRA 3CV3A 2E5FA 4XJSA 2FHSA 3HSYA 2R8ZA 4PQRA 4I4LA 1PSDA 3H2GA 1LJ8A 1OW3B 1GQYA 1UF9A 1TCCA 3CKKA 3C3BA 2HRDA 1CV2A 2QTVB 3O91A 4LE0A 1Z5NA 4X63A 2B2CA 1P19A 2GKOA 2IZOA 4Z3KA 4O4HF 1YU9A 1ZMXA 4EGFA 1Z63A 2C2OA 3RSQA 5K8JB 1LX7A 3CH4B 4AO6A 1EFLA 2HSZA 3C87A 4ND7A 1U7WA 2ZWOA 1G60A 4YUAA 4RV5A 3NP7A 4WCFB 3WGUA 5B4UA 3F6EX 4BO9A 4HATA 1BXRA 3H86A 3L8FA 5A03A 4OJKA 4PSAA 1GG8A 1UM9A 3INYA 5B12A 2JGRA 4EX6A 5CFOA 2XUQA 4POAA 2PUAA 1CJBA 2NTJA 3THSA 4R3UC 3AF3A 2D54A 1QP7A 3OQ6A 4P81A 5KO2A 1BMQA 1IWOA 2MSEB 3QFFA 4KKVA 4DYVA 3K05A 3GJRA 4YR9A 1SOAA 1PZXA 2EBHX 2OQRA 3G0IA 4KKXB 3I9OA 3ZLTA 5C8ZA 4B7XA 4YJ3B 5JDCA 3PHHA 5TDHA 2NN3C 4F93B 1J00A 4K1LA 1MKYA 3FKSA 4FI3C 4DA7A 4N7MA 5KUTA 5L6MB 4A0SA 1A8HA 1MG0A 5CT4A 5G40A 1N6NA 5L8VA 1T6YA 1GJRA 4M0CA 4MARA 2OWDA 3R7WA 3UHFA 5ALYA 1E7RA 2CVZA 4UCXA 4Q4JB 5AFSA 5BVHB 1JHXA 2HEIA 5EKXA 4AZWA 1I7SB 2RHBA 1US8B 4ZJZA 2O8NA 3FCUB 2J33A 4PLHA 1SPBS 2QAJA 3U3DA 4JR1A 5FP0A 2OD2A 4L4YA 1NDUA 1USVA 1SG9A 2PV7A 4OBWA 2X40A 1KQPA 1ESZA 3LX5A 1JR3E 3SJCA 2DHEA 3HJGA 1FE8A 1G64A 3M9WA 3Q0EA 4J6FA 2Z8YM 3WQHA 4HHEA 2IYOA 1U0NA 4YAWA 2Q5CA 5CXQA 4TYWA 2ZBDA 4EKIA 2CL6X 2AIRA 2ZXFA 2MOKA 3F49S 3R6DA 5G53C 4GDFA 2I3GA 3EUFA 1L4MA 4FD2A 2YV5A 2O2SA 5CP8A 3BFXA 3IQFA 1YQWA 3LBIA 2C8VA 1BH2A 2W70A 3HDGA 1GDDA 1R8XA 3M3HA 2RGXA 2ZUEA 4CYMA 2HNKA 1O4VA 3ENWA 4V24A 1N2BA 1V16B 2CDCA 3BAFA 4F6RB 4MRRA 4MDHA 2F1OA 2PH1A 3U37A 4ZHQB 4QUGA 3W3AD 1JBKA 1LJUA 4NBKA 3THWB 1I94B 4EYKA 3MG9A 4ITRC 1XPUA 1WCYA 1ONOA 2QZZA 5JR3A 4JR2A 3URKA 5ARDA 3WHPA 2WYVA 2IW3A 3LA8A 3OY7A 4FLFA 4XWKA 5SY4A 5JBNA 4AG5A 3RYCB 3MXTA 2G07A 2IELA 1Y8RA 1F7VA 3ICVA 1C2YA 4PSUA 1P60A 2PKQP 2IEIA 4EI9A 4KVGA 2BUAA 1DWPA 2BCJQ 4FJ1A 4MVJG 2FZCA 5CBPA 1KSGA 2F55A 3KVRA 4X7MA 3HKDA 4GEKA 3T3HA 5FUWA 4IDAA 2EGGA 3FOFC 3FZQA 3G79A 4RHFA 3CYFA 4S1PA 1EA5A 1EFPB 3DLBA 1HMPA 3ANTA 1IOZA 1HXHA 3LVRE 3DDCA 2BEUA 2C00A 2ZTVA 5C8YF 1V8PA 2CB0A 2E7ZA 5ALMA 5ECYA 3ADKA 2QR3A 1NZDA 1P4JA 4PAQA 3RAEC 1XRMA 3PI6A 4G84A 4MRMA 2NUBA 4I55F 1UOEA 3KUXA 3U48A 2FETA 2QE7A 4O2AB 4Q3NA 4UUQA 3UXYA 4E5SA 2I8LA 3NQ41 4WACA 3N5CA 2WR8A 3LNCA 4GKBA 4QXMA 4MVJI 1VP9A 4M9SA 3KG2A 4QTXA 4YDRA 4CE6A 4TTSA 3DBVO 4CM9D 5BSMA 1W73A 3THYA 1A0OA 1W8IA 1YI8A 3DWEX 4PXAA 1Q12A 1L8OA 1DJPA 2IXAA 2IUUA 1BD3A 1UEXC 3LK6A 2IITA 3GF4A 2O57A 3B1YA 3KUCA 5D6NA 1B1AA 5E8RA 1IZYA 4WN3A 4FHZA 3WDKA 2DY1A 3EWAA 3T3EA 4YMUA 3DZGA 3Q6IA 3VR1A 1ZL0A 3K9HA 3Q0IA 5MDHA 4UEWA 5LYJA 2GBIA 1JS1X 2OQVA 4BO1A 1NONA 4DDUA 1OLSA 1V1RB 4PAWA 2UZIR 5FL7D 1L4NA 2HHCA 1WLSA 1OIVA 2WHYA 4BJ5A 3OQNA 1FXSA 5IKOA 5ALWA 1T15A 5TEVA 3WNDA 1NXSA 2IKSA 3A27A 1BXKA 2AI1A 1QPBA 3SY8A 5GADl 3CNQS 3SJUA 4IS2A 2C5LA 2I80A 3R23A 4DNXA 4Z9YA 4E21A 1SIOA 3NC0C 4Y7CA 1U7HA 2ID7A 4R3WA 2N9UA 3HUFA 4OJTA 2OKCA 5EIAA 4LW8A 2WT4A 5ES4B 2O48X 3DMDA 5I5GA 2EIHA 2VP6A 1PV2A 3C6BA 2JH3A 3KU1A 4TV9A 2HSWA 5DN6D 4P5DA 3TG2A 2KLHA 4U4AA 3AXSA 4ZOBA 3WK7A 2FMTA 2B5VA 4MDYA 4RU1A 1MDFA 1IZ7A 1GZ4A 4ZQFA 5BPHA 5K3CA 3PEUA 2AHOA 5BW6B 1RBZA 2WF9A 2OGSA 4QREA 3P7MA 3UT0A 2GLTA 3I32A 3OTIA 3CZCA 4HH4A 3WK9A 1O6FA 3SYMA 1T2FA 4ENRA 2BF4A 2JZOA 2ZRIA 5HUQA 2WJIA 3BRSA 3W5SA 3H99A 1PR0A 2YJNA 4PX5A 3TLAA 3ZDCA 1M7BA 1C1DA 1KGSA 2JLRA 2X86A 4AQYB 2RGCA 3H5WA 4Q3EA 4EQZA 5BURA 3IEKA 1XMOB 4MJ7A 4WLUA 3WLLA 4K9MA 3QKRA 5B1HA 1QK5A 1VKJA 3L0SA 4YCJA 4D9GA 5KU1A 4O1MA 2O3JA 2H1WA 3HEAA 2WFLB 3QX9A 4Q16A 1GZ3A 4HRYA 1LX6A 1TLTA 4TS3A 3FTPA 1REQB 1IMOA 3NB0A 4NPAA 3EOBI 1QDEA 4G8DA 1SKMA 2JI6A 2DYKA 1F3OA 3G2HA 4XSHA 1UR5A 1GZVA 4MWSA 1TC2A 1F38A 3C4QA 1SXJD 3CKYA 3HV0A 4H7HA 4KQ9A 1GUDA 1W94A 5EEHA 4D4IA 3UAWA 3TBHA 1IXYA 3C4VA 2WWVD 4IF4A 3E05A 1GD1O 1OLXA 1TUBA 1XJQA 2X8BA 4WERA 3EIXA 3SQMA 1C2TA 2WE8A 1WEKA 2XRMA 4BC1A 4FCWA 2WSBA 3NBMA 4LXXA 3B1JA 3GNTA 3PKIA 3HDJA 3JAKA 3I2GA 4ITUA 2HA3A 2YZ2A 3U44A 1JKXA 3VHQA 2Y0PA 1S89A 2J6HA 3HR8A 2JHGA 3PJGA 4R7ZA 3GVPA 3TLCA 4MVYA 5ADWA 1Z29A 3USCS 1P39A 1N2HA 1I7DA 2CWWA 3C8UA 3IP9A 3NOQA 2VUIB 2Y0EA 2PL9A 1VMIA 2WJWA 4BRWA 1XN1A 4M36A 1M0WA 1DIRA 3D4IA 4M46A 3DBHA 4O4LF 16PKA 3IKJA 4AJKA 4UM9B 2V1UA 1WX1A 4NHEA 3KQHA 4PBSA 4TS1A 4PAMA 4TTJA 4PEVA 2XE8A 5LU9A 3SWWA 3NLLA 5CM8B 4UHEA 2FHPA 3MFYA 2Q0XA 3B5EA 5LNK1 4BBAA 4WHMA 3ZC3A 4R6WA 1BKYA 2DWUA 3MAAC 5IAJA 5TQ2A 9GPBA 1MPTA 3KAJA 1JAZA 1Q7CA 4IGEA 2WUGA 1BSVA 4RIFA 3GFGA 5D86A 3RYHA 4ZU1X 3NNNA 1YR1A 5BSWA 1SU6A 1U6JA 3I9MA 3PLRA 3FOAA 4N40A 3TTXA 5K8CA 3PHLA 4BY9E 3C6ZA 2IEBA 1X19A 3AILA 1MC5A 4Q24A 1KOGA 1BOOA 3IOMA 2JVJA 3K9LA 4CLRB 3IAFA 1CCWA 2F48A 3GP3A 1D7AA 4WN9A 3U9TA 5AW2A 2AJTA 5REQB 2D1QA 2WJGA 3FIUA 4L5CA 4BX2A 2WFZA 1SKBA 3X43A 4V0OA 4JODA 3AJRA 4U2KA 5BR4A 5JW6A 3JY6A 1G8KA 1GGNA 1RWNA 4ZV7A 1CFZA 4ZVMA 5AKIA 1ADGA 2JIZD 3NU1A 3RUAA 1S1CA 1TT5B 5EN4A 2ESRA 4F06A 1W7AA 1H69A 3KJZA 4L5AA 3ZVRA 4EPWA 2JLSA 2VC2B 2PUFA 1ZZEA 1M6VB 5D01A 1KAOA 1WXHA 1GZ5A 2AFIE 1URPA 1AKQA 3QFCA 3EGXB 4DPKA 1I3OA 2J9XB 2AEFA 1J5EB 3RHZA 1JQLB 3KETA 2ZYIA 4GRAA 3SQXA 4J91A 4UVGA 2J3EA 3RRFA 5I3CA 3BL6A 5CYFA 4JDUA 3MWFA 1JAXA 4KLNA 5DWDA 4BWFB 5LZ2A 2W6JD 3RIYA 5HFJA 3VX3A 4GC9A 3TLBA 2IS4A 2G5PA 3F5MA 4YHHB 4F6CA 1L5RA 2LP4Y 5G4KA 1SKQA 3FDXA 2CMKA 3L0YA 1NGSA 2ODWA 5HW0A 2LCIA 1YB5A 1WPXA 2BGUA 5HG0A 5I7AA 5JAIA 4ZI2A 4HCJA 2VNSA 1BMFA 5DWVA 2O1XA 1B43A 3W6OA 2ZAYA 4GSKA 1MRNA 1SUAA 5H7XA 1DG3A 2Z4SA 3SC4A 2DFDA 3OUTA 4IIGA 4ZAGA 4JI7B 1NHGA 1ZUWA 3OQ1A 4LC1A 3WP0A 2RHCA 1NRJB 4RPHA 2OV3A 1EE9A 5F76A 5J4KA 1DWUA 1MABA 4RY2A 3UJHA 4RXMA 2YWEA 3VOSA 2IBTA 3ZI7A 3KD2A 5IJ9B 4KQHA 4NZZA 3N0WA 3C5CA 3OM1A 4FYKA 4JZYA 4HVTA 1ILEA 2QPOA 3IMKA 1XTRA 3IAM6 3ROKA 4O4HA 3S1AA 3UB2A 4CL2A 1DKPA 4DRXA 1MDBA 1XU9A 2VF4X 3NETA 3ABRB 3BMOB 1LA2A 1WSAA 4XA8A 2QAIA 5AHOA 3N0TA 4IZ6A 3TQCA 4C0LA 3I9V6 3MF4A 4Y6PA 4CLOB 4A91A 2V3CC 5F1YA 3RAFC 4MMXB 1WXGA 3E53A 3KTOA 1SU4A 2X0IA 4MR7B 5FQNA 4EO4A 2J9FA 3L9WA 3OP4A 4ZYUA 4OJYA 1BHJA 2GA8A 4TSKA 1XKXA 3L18A 4M76B 4TKUB 3PJRA 1PHPA 1O89A 3W5DA 4G8JA 1ODKA 1YQGA 2XB9A 2QRQA 4LOIA 4OL9A 4XX1A 1CK4A 4YRRA 3JWPA 2JATA 1ULHA 2J4FA 5LOVF 4O4IF 1Z0SA 4DMKA 4L07A 3HA3A 3OSUA 4ZAYA 1M8JA 1U90A 3SBEA 5DI9A 4X0EA 3H9BA 1ZBQA 3HFJA 3OJCA 4FDAA 2FF7A 2WKSA 5BSTA 2PQMA 1KQFA 4KPEC 1YIDA 3OF5A 4C21A 1K8RA 2JFFA 3F1LA 4B6FA 4PSKA 5J43A 4P7JA 4C4ZA 4NBTA 3D6JA 4PO9A 4REQA 1W9MA 1UMKA 3IQIX 1JWAB 4D4HA 1JEEA 2BBOA 2GETA 1M2WA 4US1R 4YC7A 3GPIA 4YGXB 4Z0TA 1GTRA 4ND5A 2O5CA 2BCEA 5FJJA 5TPZA 3DE5X 3E8SA 4C0AC 2O0MA 1JA0A 2IP2A 3UCFA 2RIPA 2HQSA 1OPXA 2GPWA 3AR9A 1WHSA 3GX1A 3KQSA 4Z2YA 1F51E 6ABPA 3EVCA 4GP9A 3FPSA 2BV3A 2RFLA 2HMWA 3OMWA 1DXQA 4MHOA 2O2DA 4JFAA 1VMKA 3WX0A 1FQOA 1V47A 4QO7A 4AMGA 5U9CA 3K9FC 3VO9A 1LGYA 3M4JA 4HS4A 4ZTBA 2NMVA 4P2GA 1JKJA 1XXHB 5H70A 4DUYB 4W9NC 4CKCA 5B5SA 3T4UA 3NKVA 2OYRA 1UDCA 4URFA 3VGPA 5CR9A 5A05A 4YMWA 1EP3B 4AYXA 4EDFA 3FWNA 2OO7A 2Z6AA 3BEOA 1OREA 3DDWA 4GP6A 2ZR8A 5K3FB 3ZEAA 1K88A 4FLMA 2XDQB 4XD7A 3VHXA 5I5EA 1GAWA 1QPGA 3BIOA 1IN1A 5KAPA 4LJAA 4QTTB 4RJ2A 4QU0A 3H16A 5DMXA 4KPUA 3ZDZB 1E77A 2QTLA 2UXDB 4RMHA 5CVVA 1GRRA 2RI0A 3SEFA 2JG3A 1T29A 3T1TA 3KTDA 2A0FA 1J09A 1XDUA 1RJFA 1RKQA 3ZS9A 1GRNA 4S0XA 4EUFA 1PFKA 3FCSB 1NM5C 3OZTA 4N8EA 2GEDA 2A3RA 3HH8A 4HDAA 4ND4A 1KEVA 4TMKA 5H02A 3R7DA 3T15A 5B3KA 4JBLA 8ABPA 4MWZA 1CX9B 2YYYA 2XADA 2WG2A 4MXDA 4CM3A 1YZUA 3W1WA 5HBRA 6PFKA 1KVQA 2Y77A 1T3TA 3D0OA 4CLEA 4PLPA 1R64A 4IUCS 2FWMX 4HWSA 4OSOA 1KWKA 1U0GA 5FADA 2Q7OE 3MZ0A 3OG9A 4PXSA 1XVTA 5C8YA 5C8VA 1PJCA 1XEXB 3MCTA 4CEJA 3GMDA 2FFQA 4LGYA 1U7OA 4DSUA 4YRLA 1M2VA 4I55A 1TVCA 4HN2A 3F7MA 4ODIA 3FE2A 1F60A 3P9PA 1FTQA 3RRMA 4L3VA 4TTRA 1X7GA 1B0PA 1SHKA 2W6OA 1QYVA 3NHFA 2NIPA 2CFIA 1IZ8A 2A5LA 1Y8QB 4LXIA 1VE6A 1U65A 3CQ9A 1Q6ZA 3FYUB 1LTQA 2V97A 1U11A 4MO2A 3HO1A 2VHZA 4PPYA 1A9PA 1C4KA 5HK8A 1SY7A 1JFLA 1DNPA 3KQPA 1U3TA 3IOCA 4MUAA 2WU1A 4FMCB 5C7LO 4Z1MA 3HUEA 1JG7A 3A7DA 2DBYA 4ZQBA 4FOSA 3DE2X 1I3MA 4PBRA 4PSCA 4ND3A 1XMPA 3IEUA 3VPGA 2B98A 1P91A 2IDZA 2VJPA 4TT3A 4U2DA 1DKOA 1TI7A 4LZWA 1AHIA 3E9CA 2CJWB 5CUQA 4BBJA 5BQ5A 3BD7A 3VC1A 4PXYA 4EB6B 5LD2C 2BHTA 1P9RA 1ST2A 3NDIA 4M54A 2BRUA 4ND8B 4E5KA 1H0HA 4ARZA 3G23A 3QLUA 3OKAA 3GRYA 2OPHA 5HS4A 3SJ7A 2ERCA 5H3LA 1GILA 3JX9A 1XMVA 3KKEA 2R65A 2HMAA 3QE3A 1NC1A 4HUQA 4AJPA 2O6HA 1ZM9A 1S6YA 3HCWA 4PICA 2WOOA 4JKYA 2XCOA 3TR6A 1CW2B 5KZMB 3DH0A 3LQKA 2VVTA 2NU8B 3F1KA 4CMKA 2UYHA 4BNZA 2OSVA 2W6IA 4DHWA 8AT1A 5CEFA 1M0EA 1A9OA 3REOA 2GRUA 2DWPA 2NM0A 1IHUA 2QJFA 4D7AA 5AVKA 3Q4GA 3RUEA 1W34A 4W9RA 4J1TA 4HFJA 3LJKA 5FUQA 1GZSA 5IKPA 5J5AA 3Q3VA 4FK8A 4NJEB 1M7HA 4TTAA 1PE0A 4UVEA 4XM0A 1Q95A 2ONKA 3VMFA 2PD6A 2CJXA 4YJ2F 2HB6A 5DGIA 3V3KA 1K9SA 3OZVA 4F9GA 3KQUA 4ZXPA 2QM3A 2PVCA 4BU0A 4B31A 5ALVA 5MN6A 4GWLA 1CS0B 2IS2A 4GBED 1B0UA 1H1LB 1S8NA 2PYIA 5LA6F 4DL9A 3A7EA 3QVJA 5F3RA 4Q21A 5ESWA 1BDIA 4DMUB 3ZCPA 2IHUA 3KKKA 3NDJA 2O8FB 3DDHA 3CSDA 4L75A 3KWLA 4LX0A 2G0NA 1MOSA 1NN1A 4RNDB 5DNEA 4PE5B 5KCZA 1TD1A 4JT2A 2EBWA 5FI0B 3WLTA 3WAGA 2D5AA 5U4QA 3ZXUB 1P7VA 4R1QA 4MPPA 1NNI1 2WJYA 3VR5D 5F73A 2GEUA 3MGGA 4JLMA 4Q00A 5BYJA 3U0VA 4AWBA 2HNBA 4HPWA 1SOMA 1DOAA 2YHIB 1E2FA 5B7PA 2W37A 4G0YA 1L5YA 1YZQA 2JANA 2COUA 2HCBA 1P33A 1TD9A 1NTOA 1CRZA 2JNWA 3TR0A 1OAKA 1QV6A 2CFSA 1J25A 2HGZA 3BFVA 1H3NA 4OHMA 4BL5A 5BWCA 1YAJA 3LX8A 4V0RA 1T4DA 3UJ3X 4DLVA 4UBIA 1MA0A 3T7DA 3UMFA 4EUNA 2GBPA 4PC1A 1O7JA 1KR5A 3IEXA 3A1NA 4ACBA 3OZXA 4DIFA 3ONVA 1G8GA 5BN3A 4IXWA 1I4LD 1FXUA 2JAWA 2XX3A 3JALB 4I9NA 1EXVA 3JR3A 2YWHA 2GERA 4FEYA 4PU0A 1T36A 1XZIA 1E1NA 3LIIA 1OVGA 3TPFA 4BVKA 4BZQA 1Y6GA 1UBMS 4K0RA 4D6PA 1RZUA 3HVJA 3LUJA 3TI7A 4E2WA 1AURA 3EVNA 3I6QA 3KZMA 1ZHOA 2FX2A 4TZ0A 3PXDA 3O1LA 5KTMA 1MG5A 1YCFA 3UANA 5AM0A 3PXXA 4NH4A 3VH4A 3G1TA 4O4LA 4TQAA 4UXJA 2HSEA 4MW6A 3Q5DA 3UNXA 1GCIA 1BEUB 2QLLA 3TECE 3JYLA 2CLEB 4RPLA 2WLSA 4AUEA 4A4DA 1ZWKA 1MW9X 4B3TB 4BUZA 3WIVA 5MGBA 1MHPA 9LDTA 2DVMA 4QDUA 3UGTA 1HGXA 4ILEA 5FTJA 3AUFA 4DJJA 1RC1A 1TTPB 3DC7A 1L1FA 3BFPA 3AUYA 1JT9A 4XVCA 3I4LA 4A8PA 4PG8A 2JDIA 3AY6A 3BXXA 3EW7A 1NJ8A 3F7NA 1W52X 3P9SA 4RH1A 2A9FA 3W90A 4QG3A 2FR8C 3O4JA 1XALA 4UDOA 3L7CA 3RS8A 1M1ZA 1A72A 1DLIA 4HDMA 4BNLA 5JJKA 3EXEB 4FVTA 2H2AA 4NBWA 2I8CA 1YU6A 3OPQA 4N0PA 5JD6A 5KYWB 4DV1B 3QLUC 3OETA 3NDRA 1KVRA 3ABSB 5I8WA 1DGQA 2VHQA 4AU1A 3E9DA 5CCBA 1SVSA 4DDVA 3KRTA 1KFBB 4XCVA 1P4AA 4YPFA 3W4IA 1XVLA 2ZTSA 3OIGA 4YMIA 3DKRA 3SS7X 4BMOB 3OZBA 3HO6A 2YWXA 3N0XA 4ZAFA 1YZFA 1DBVO 1CJTC 1NW6A 2JD2A 2PGAA 3PTLA 4V02A 1NSYA 3ASZA 1QLWA 2ID4A 3UUGA 5HDBB 2ZSIA 4JYCA 4ZO6A 3AX6A 4TLEA 2P7HA 5A62A 5FULA 2D1YA 2UU9B 3WWEA 4FN5A 5JPCA 3ILXA 5LQRA 3BMQA 3UUFA 1NBEA 3KSZO 3D8HA 3T99A 3AZQA 4AP5A 3AHJA 4H4EA 4LPSA 1LTKA 4FGSA 3NCHA 2IHTA 1LBQA 1XLVA 3AEQA 3CXRA 2FGJA 4RK5A 1N4DA 4YMVA 1Z6QA 2INGX 2H7CA 1IHPA 3E7PA 3WRXC 1QQ7A 5LP1A 3GJTA 5D5HA 3WGQA 3ZWMA 3G8BA 1X87A 2RCNA 5KJEA 5AKGA 3AUAA 1YTLA 3NYWA 4M9UA 4O63O 3A10A 2GUGA 3FCXA 2Y1FA 1XZKA 1WPGA 2IPOA 4ECEA 4H3VA 1Q7GA 1SC4A 2C8KA 1YR9A 2FSHA 3OZRA 4H7IA 3LP8A 4CM4B 5KTSA 4K6HA 3EIUA 3VHLB 4PX2A 2VOEA 2WSYB 4MICA 1PBNA 2OZVA 5CDTA 4MYSA 3NOOA 3WNBA 2WJAA 4JJ7A 3NMUF 4HK4A 4RK0A 3QBVA 1KMHA 4ZYTA 3JASA 3F74A 2FP4A 4IO1A 2GMWA 2W2VA 1EBFA 3E2PA 5PGMA 4ZVSA 3TW4A 3A4LA 4U2EA 1IY0A 2F4NA 3S99A 2I1QA 3ZIUA 1RWKA 3ZS8A 4ZI7F 1HZJA 3ZKAA 4A92A 3MOGA 2WIGA 2OCBA 1J1ZA 3WV4A 3ZHXA 5KIAA 4C7OA 1L5ZA 4IVRA 2GZ3A 3OKFA 2I4TA 1IK4A 3AJ8A 2AN4A 3NIWA 5DHRA 4BN5A 1E5DA 3D7MA 4YV7A 4LYFA 4A0GA 2VR1A 2WUFA 2G40A 4J2HA 4IZHA 4BRUA 4QQ8A 4RYLA 1V25A 4V0KA 3AF4A 3QPBA 4GI2A 5M5BA 5LL6P 4JC0A 2Y66A 1R9MA 1QWOA 2PSSA 4LOJA 4MW5A 1MGPA 2YR0A 3THXB 2A8YA 1ZUNA 1N3YA 3AKDA 4HWRA 4MWGA 3CFYA 5BUSA 3S2EA 3IE2A 5C37A 2EG5A 1GZ6A 5I9NA 1SD5A 2OILA 2YHUA 3DXXA 1SO8A 1VKOA 3FIJA 3P4UA 4JBNA 4WY8A 5B58C 5HXAA 3AKZA 1OB2A 1XTQA 5KKNB 3C5EA 3I5AA 2IH5A 4H35A 2FG6C 3L7MA 1AXGA 4P38A 5IYZF 3HCEA 2P77A 1W1IA 4MOWA 2ZPTX 4ZVVA 3THRA 5LOVA 1N78A 3IAS1 4DWVA 2AG8A 2D62A 2WA2A 4P98A 4QBHA 5J4VA 3GAZA 4FGLA 3GJ5A 1P61B 5F2EA 4QD3A 4X65B 5JSHA 3LKDA 2DH5A 2PX0A 4LKRA 1R2QA 3MRVA 3QEJA 4JJKA 4YH1A 5DP2A 3DMYA 1EWYA 1PNQA 3DE7X 1MVLA 5H59A 5CCEA 2F59A 4D41A 5CVDA 3AC0A 2WT8A 3EGEA 2PKRA 1OU0A 3K0FB 3SAJA 4PM4A 2WAOA 5DIZA 2BGRA 4KR2A 3TSAA 2HLHA 4MV5A 2WB2A 1PL0A 5EZSA 1J24A 2JBHA 2DE0X 1AC5A 3R5HA 4MQ4A 1HDIA 4C4XA 3CX6A 3N8NA 3WG9A 2IBMA 2IVZA 1ESCA 1Z0IA 2OR3A 5I01A 3O90A 3NAQA 3VPCA 1ZLYA 3OJOA 2NXCA 4ANFA 2NSJA 3AF1A 1YBMA 1BXRB 4DWWA 1EFVA 1U0SY 1UM9B 2IHVA 4EG8A 3V4RA 1F6WA 1U1DA 2C95A 2X5JO 3LWNA 3L4BA 1EFDN 2Z6VA 3CX7A 5EJGA 4UPEA 1LK0A 3M34A 1EJBA 3PQFA 4N48A 4KWCA 4HWOA 3IQHX 3D4PA 1U8XX 1UXJA 2AX3A 2HRZA 3U4DA 3AEKA 4NEGA 2AD1A 2GVNA 1H2RS 5LDDC 1Y98A 5HIAA 4CEHB 1WUJS 1NUAA 1OH8A 1ZN8A 4C0SA 3MPOA 1FU4A 1LWOA 1Q21A 4HQFA 3KQVA 2BEVA 3ILSA 3IJEB 2O7NA 4HJRA 4OHOA 4PO8A 5AD1A 1IWPB 3DBIA 2N46A 4H27A 3FWHA 5ALEA 4RWEA 3EVTA 4EJMA 1SHJA 2VSOA 2Z08A 3H2JA 4WLOA 2L17A 3M3DA 1H4TA 1O87A 4Z51A 4LYAA 1EX7A 1NASA 1YR3A 3F71A 4F6LA 2QRGA 2XT6A 4QEDA 1ODTC 3LIPA 3H6GA 4EAQA 4TS4A 2BN4A 1DUIA 4YRSA 3O3OB 4UVIA 2Z4TA 3ONEA 4TMTA 1BOFA 2HPZA 3E22A 4TTQA 1V8BA 3FFTA 4KFRA 2C2MA 3O8DA 4QE3A 3D6TB 2EW2A 1MO6A 2PGIA 4QOEA 3DL4A 4QEKA 1IG3A 2PLNA 3G5MA 3H1PA 3M89A 4PN7A 4F04A 2J4DA 2JFHA 2DUNA 1VI6A 3GN2A 5EKSA 1Z35A 1ZPDA 3QKIA 3RF6A 2RK4A 3VX4A 3EZNA 2IV7A 721PA 3MJCA 4TPKA 5JTUA 4NOKA 3VZRA 1HT2E 1UJBA 2PGJA 3LE8A 4DWOA 1M1YE 3PXAA 1IN5A 1LS1A 2BTQA 1FFXA 3P2MA 4HEA6 4KO2S 5CT6A 3SEAA 2C3UA 1RJGA 3L6OO 3QXJA 1SG6A 5DPMA 1XZDA 1TMYA 4FEEA 1ZD4A 2F2TA 3CLRC 2HLDA 4NFHA 1Y80A 4J1NA 2Q6IA 3TDKA 3U3JA 2NVBA 2F3SA 1AB6A 3ICOA 1XF9A 4QBGB 3GXOA 5C52B 5FOTA 1DAGA 4H6PA 2DWOA 1VXOA 2RMKA 3GDWA 4NABA 4LWQA 4R1PA 1Y1QA 4UNNA 5EGSA 5B2ZA 5JY1A 1RRGA 4DV0B 3TTTA 4E94A 1PZNA 1D07A 3G1UA 3OOYA 1P7CA 1R5NA 2H54A 4KI7A 4AJEA 2QRPA 4PCUA 4QDJA 4BIMA 5DYNA 4Z53A 3AL0C 3HY3A 4U8HA 2O8DB 2QX4A 3CUUA 3DULA 3X44A 4G0WA 2O8EB 2PSDA 3GDFA 4S3MA 1OWMA 1HNZB 4DZTA 1CR1A 2P3OA 2Q4RA 3D0RA 1ULTA 4LWZA 1AB5A 3FNRA 4XWTA 1QCCA 6AT1A 3REFA 1QB8A 3ZE0B 2YOFA 1KJJA 1ADFA 2XMPA 2Q8QA 2W8BA 3H75A 4XASA 1I3LA 2JHFA 4Z86A 2WHXA 2M6SA 4Z3DA 3I2JA 4DEXA 4NJMA 1C9NA 1MIOA 1E5LA 2AQKA 2Q6TA 2Q7DA 821PA 2YRXA 4GVPA 4ZTZB 3H2BA 4MVXA 3P9IA 4PFJA 3WBFA 2HTEA 2Q3LA 4OGWA 4OHZA 1WPQA 2X8LA 4GS5A 1XEAA 2Z1MA 4IXMA 5EHNA 2PL1A 3DFMA 1IVNA 1JLHA 2JJ2D 4BXOA 4YXWD 3IA2A 1DOHA 3PWSA 2C2GA 5C5IA 4KTVE 5AI0A 1BO6A 5EIFA 3IEIA 5CGQB 1XZCA 2YCBA 3O94A 1EXMA 1AUOA 4C07A 2A1TR 1UT5A 2JJ1A 3CH6A 4LTDA 4PHGA 3L4BC 2A5YB 4DSOA 2E4UA 2MMCA 4YX9A 3LGSA 1C9JA 4ZRNA 1U3DA 4EJ0A 2DFPA 5KWVA 2VJKA 1V8ZA 2X9GA 2ZJBA 2CNBA 1PZHA 3BA6A 4IJWA 5CW2A 4D3ZA 1E62A 3SXUB 2VBIA 2ZS7A 4H7EA 4D0NA 4YJ2A 1HFEL 1LQUA 4K9QA 1OHHD 3ZX5A 1OLSB 2DSNA 1J33A 4D57A 3MINA 1EHCA 4E6PA 3D8UA 4NKRA 1ZLXA 3LUBA 1IJEA 1EGMB 3NHAA 5LA6A 3P0FA 2QP3A 4M0DA 4NP6A 3WB9A 2WWWA 3OZCA 3AU9A 5DP1A 1RWBA 1FTNA 1CF9A 4HYTA 1FSGA 1R4NA 2J6CA 4IIVA 3T9AA 1KEEA 2NP6A 5DHFA 3WGHA 2G72A 1BU8A 4NAUA 1IBMB 1U02A 4QDTA 1Y7TA 3HM2A 4RZSA 1M1YB 3MAJA 2BGTA 3KTAB 4DMRA 1QRSA 3EVZA 1DXHA 2RHHA 1GQQA 1NP7A 3O31A 2OV4A 4MIKA 1G291 1I3NA 5AHXA 5AOCA 2FMKA 1CR4A 1ML4A 1V1JA 3B6EA 3ORYA 4AZ0B 5IHPA 5IU6A 3WV5A 4RQUA 5AUQA 1AKVA 2X8AA 2HRBA 2ILTA 2VFAA 4KW7A 4X20A 2Z1DA 5DOVA 4DIBA 1A27A 1NVKA 1PNVA 1FRVA 2HK7A 3CF4A 4N65A 1A50B 3ZLJA 4S1OA 1SU7A 1ZVJA 3ID6C 1NNUA 3IDFA 4LBVA 3A9SA 4MITA 4NBNA 1RACA 5A7HA 4PZAA 5B7NA 4U2CA 4BUCA 1AQYA 3M6WA 4MJXA 4F46A 2ODQA 3H5OA 3RO7A 4RIGA 3UJBA 5I4CA 1PK9A 3R44A 2PGXA 2ZAIA 4BB0A 1WCIA 4II7A 1C1DB 2HCFA 4KSCA 3B60A 1Q50A 3F8SA 1CJVC 1BG6A 1B14A 2XUOA 3QU5A 4RORA 1H42A 4XGIA 1JR3D 1GYQA 3HN6A 3AP3A 2XD9A 1T9AA 2HHHB 3KALA 1KU0A 1ND6A 4A5SA 3UQYS 3WL6A 3OO1A 2GAAA 1D7OA 3OP1A 1GXSA 4FHCA 1HF3A 5DN9A 1VL0A 3V4LA 5AW6A 1EYZA 2HQRA 1KJ8A 2D2XA 2QUZA 4JGGA 2HREA 3LWZA 2R1VA 1DI0A 2DPHA 5GM2A 3URMA 3CZ4A 3ZWKA 2Q2NA 4XRGA 1DT5A 1MFPA 1U8FO 3D4NA 4RACA 1DEKA 4D9NA 5JCOC 4GLLA 4IJ5A 3K71B 4RGQA 3ZIAA 5C81A 3FSJX 1SBIA 1XMXA 3C3WA 1T0HB 4RLHA 4RXUA 1NULA 1OLXB 3H3FA 4DBZA 1FJGB 1A8PA 1VL5A 1OX5A 2H4XA 3TQOA 3ENQA 1ORIA 1Z74A 3AYZB 4CMEA 3QYFA 1HDRA 4QGBA 2ZVJA 2J9GA 5CVUA 5AR1A 3JAKB 3G85A 1X9IA 3UMBA 5L95A 3TSYA 4Q7JB 3VVBA 3VU3A 2PPLA 5ALQA 1NY6A 1NOIA 2B99A 5EINA 4DUPA 2BI4A 5JIBA 1DBQA 1RWXA 3QXCA 1AJEA 3OFND 1R88A 3JZIA 2ZYRA 2Y2VA 5LVAA 1XEFA 3HXTA 3NHSA 1KKLA 1QYDA 3LDAA 1E3WA 3BIJA 4KYTA 1PL7A 1DU4A 2JCVA 4WLNA 3K9NA 4BEJA 3DBHB 2E1PA 1K66A 4TV8B 2B1RA 3T41A 4UU7A 3B7PA 4B17A 4EVRA 1EPUA 3DKVA 3PRYA 1LDMA 3DW1X 1YASA 2ZWIA 3DYIA 2A0YA 3Q40A 4OQEA 1TO1E 4R8VA 1U3GA 2H6EA 4KSBA 1UXKA 1AY0A 1K0UA 2FJ0A 4ME6A 3ZHZA 5LR6A 4TXLA 4BHTA 3SQWA 3KOMA 2XNDD 4QVKA 3DQPA 4ZYYA 2GK6A 4HDCA 1P2DA 5FFMA 4KQ1A 4B2IA 3L6EA 3EFHA 4L2IA 4RESA 4DQ0A 3O82A 4XKJA 4B74A 2HTFA 5BUCA 2XWPA 3S2IA 2C78A 3EQ9A 3K0CC 1A96A 3NJ4A 2A35A 4MA0A 5G3YA 3WK6A 3W5HA 4Z3OA 3BILA 3ZDDA 1C30A 4R2HA 3I6ZA 3MMPA 2FWAA 1CE8A 1P1CA 4U0KA 2CV1A 4OUDA 1M54A 1ACLA 1NXVA 2WA1A 1KR2A 3GLVA 3UC9A 2XUHA 2XWBF 4GLJA 2WD8A 2XI4A 3JRWA 3ZIDA 3CPEA 1ZXBA 4LDPA 5CVTA 4U7DA 1ETUA 1FNSA 1RI1A 1X86B 3CPHA 4N12A 1Z7EA 1BWQA 4UASA 1NUTA 1WWKA 4GOND 4ZKDA 1I3CA 4ZI7A 3AVPA 2R8EA 1XJ5A 1NLZA 1AHHA 2PFGA 3ER8A 3RU7A 1UXIA 2XHZA 1MA3A 1OKKD 1CQWA 1UMCA 3I2HA 3GR6A 3JCZA 1ZKMA 2PM8A 2QTMA 4FYWA 4IX9A 4MCAA 4MYRA 1T0PA 3RVLA 3U7QA 1PDWA 5KNBH 1A97A 1ECPA 4FCCA 5C0OE 5JSQA 4Z9FA 3PNKA 2C5AA 1DC6A 1I6LA 3L7JA 1XLWA 4H0FA 2P30A 5CG1A 3KPVA 5I4KA 2F4VB 1VI2A 2FUEA 2PO7A 1RQPA 3IQGX 3BK2A 2QUHA 2CXXA 1Y3IA 3NHMA 5ICEA 4LXUA 3I2FA 3HABA 2AG1A 2X14A 3FMIA 1ABEA 1SCUA 2OLEA 1I5OA 4F4FA 1EK5A 2ORYA 1PDOA 1HWYA 1ZCFA 4JN6B 1VL2A 2NZ8A 2RGAA 1E3QA 3CTPA 3KVYA 3PNYA 3C8DA 3R24A 4MPJA 4MZXA 1V5GA 3AR5A 1EK2A 3HQ4O 3E8XA 5IYZA 2C2ZA 2NZJA 3I6YA 3M6FA 3NEJA 1WW2A 2L18A 5J4HA 4BAGA 1KVUA 1KYIA 5SY6A 4WLFA 1JJBA 3D2CA 4UCWA 1T3SA 2UXCB 3DZJA 4HFMA 4IZOA 4D25A 2GPSA 1VPLA 3HGTA 1VLLA 1PSWA 4X3OA 1SUIA 4IDCA 4MV7A 2VYQA 2R1UA 3T4XA 1F9EA 2VP9A 2WZQA 3E9NA 4LJRA 1HTBA 1OZGA 4FFSA 1CRPA 1W4LA 5PNTA 2HU7A 3ROMA 1MABB 1X80B 4EHIA 4FHDA 1WKVA 1J8FA 1M2NA 5DTQA 2IEGA 2ECOA 1B16A 3IA7A 4HTFA 1VIYA 4G1MB 2GZMA 4IIUA 4LC9A 3GUVA 3CWZA 3PC7A 3UBMA 1RI3A 1CJUC 3KDPA 4OK5A 3PUXA 3VUEA 4E5MA 1SCNE 1DTWB 3AIIA 4DRXB 1W75A 3H0EA 4WOCA 2A9KA 2V3VA 1C9DB 4QYXA 5SY9A 1WZUA 2NYRA 2O1EA 4ZXFA 4FLEA 2H7YA 2FN3A 1LPBB 4H9GA 2C7GA 2WSSD 5DSZA 3EGDA 4MYCA 1GL3A 4QGSA 5JMTA 3L82B 5IH7A 521PA 3F5FA 3AETB 5JSFA 3S27A 5L53A 4E88A 1LVHA 1TT7A 3UWKA 1BX3A 1GKUB 4Q1VA 2ZT5A 1B26A 1CDDA 2ZVQX 3GD5A 2O52A 3V33A 4FJ0A 1N6IA 3DMNA 3DDOA 4I3FA 1C4OA 1L4UA 2JGIA 2WLTA 2DOKA 3FA2A 4QX6A 1IDN1 4D9JA 1HKUA 5DW3A 3KKNA 3DE4X 4PG7A 5LD2B 2BE7A 3H0KA 3GRVA 1ZJWA 4L7QA 3WNZA 5BXYA 4KFSA 2AXPA 3U26A 3RF7A 5D3ZA 1DEOA 2DT5A 2EJWA 2IYFA 4C1NA 4FYYA 4KFCA 4BJ1A 2Y76A 4FYVA 2QU8A 3E7XA 3OHMA 3OVMA 3ZYZA 3GHYA 1VL6A 2JJQA 1GT6A 2E89A 2JFOA 4WXMA 4L4RA 4WFKA 5LLDA 1U9CA 2JI9A 5IAOA 4KK3A 2QVGA 5DF1A 5CJPA 3E8MA 4JELA 5ELXA 4G6ZA 1FLDA 2HUNA 1WHSB 4J8PA 3HI6A 4H6XA 1I2MA 3TL6A 1RPTA 3KSMA 4HNQA 4HGOA 4I1RA 3S2SA 3G5AA 4MUYA 1BA3A 2YIMA 2P4SA 4FGJA 4NY1A 2PWYA 5C80A 2DTDA 1RHMA 2OC4A 2QMUA 1GFSA 1P5FA 1HBJA 1KZ7B 3NXKA 4IIXA 4LJLA 1E3IA 3HJTA 3JQAB 3QMVA 3K53A 1U0HC 2OXFA 4LHYA 4XDYA 2LCQA 1CYDA 1JKJB 4BMXA 2B1JA 2V59A 1Z7GA 3W3ZB 4D74A 4CKCB 3CVYA 2XEDA 3CRRA 1J21A 3DLIA 1T8PA 3ELYA 4U7JA 2H1IA 3IIKA 2QTAA 2JI8A 5F7XA 3HV2A 1A1VA 1DO0A 1DCTA 3NM6B 5FYDA 1BCRA 1FDWA 1JZSA 2VUTA 1CZKA 1H1TA 3VHXB 1G8PA 3R3JA 1E9FA 1KPHA 3D6AA 1QF7A 3WC4A 2EKDA 4C3ZA 4JT8A 3T1OA 2WI8A 3KJHA 5CNJA 4W63A 2O20A 3LLCA 3A3NA 3ANLA 3GLKA 1P7YA 4A1OA 4BWVA 4JP3A 2YC2C 5JYCA 3W1EA 1IRIA 1NOKA 4L4XA 1N6OA 1RM3A 3MWDB 3W9YA 5TGDA 1PKEA 2E4YA 4J0KA 2F8MA 2Q62A 3BDVA 3VDQA <