4NMXB

Pcsk9(deltacrd) in complex with phage-derived inhibitory peptide 2-8
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
294
structure length
278
Chain Sequence
SIPWNLERITPGGSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDGTRFSKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLIHFSAKDVINEAWFPEDQRVLTPNLVAALPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proprotein convertase subtilisin/kexin type 9
publication title Identification of a Small Peptide That Inhibits PCSK9 Protein Binding to the Low Density Lipoprotein Receptor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 100
structure length 278
sequence length 294
ec nomenclature ec 3.4.21.-:
pdb deposition date 2013-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 4nmxB00
1C9JA 2W2OA 1YU6A 1PEKE 2WUVA 1NDQA 4I0WB 3EDYA 1AH2A 3EE6A 1T1EA 4AKTA 1SCNE 1SBHA 3A3PA 1AV7A 3DE2X 1UBNA 1TM7E 1PFGA 1IAVA 3P5BA 1GNVA 1Y48E 1OT5A 2X8JA 3WIVA 5JXHA 1Y9ZA 4ZOQI 3QFHA 3T41A 3DE6X 1SUAA 1PTKA 1IC6A 3DE4X 1SBTA 4BWGA 1HT3A 2ZWPA 1ZVKA 3DE7X 3D43A 1JEAA 3AJ9A 4WOCA 2HPZA 3TECE 1TM3E 2DUJA 4WOBA 2ZWOA 3DVQX 4KB5A 4AKSA 1NLUA 3VV2A 1WVMA 2SECE 3DE1X 5JXIA 1BE6A 1SCDA 3TI7A 1SIBE 4M1ZA 2PQ2A 3A3NA 1SBNE 3CO0S 2Z58A 4B5LA 1Y33E 1SN7A 4FONA 5FFNA 1WMFA 3LPDA 1VSBA 1Q5PA 1TECE 1MPTA 5JMOA 1LW6E 3A3OA 3VHQA 2XTJA 2SICE 1TO2E 5JXGA 1OYVA 1PJ8A 2ST1A 1WMEA 2Z57A 1Y34E 1S2NA 3DDZX 1SIOA 3I37X 1SBIA 4HX2A 2Z2ZA 3F49S 1MEEA 1KE1A 4KPGA 1YJAA 1WMDA 3I2YX 3BX1A 3WHIA 4NE9A 3H42B 4NE7A 2XRMA 1SELA 1DBIA 1V5IA 4OMDA 3L1KA 3DVSX 1TM4E 1S01A 2W2MA 1DUIA 2WUWE 3F7MA 1KE2A 3AFGA 4KG7A 1Y4AE 1KDZA 3ZXXA 4J94A 5SICE 4RYDA 4H6VA 3SQOA 1NDUA 1SUEA 1OYOA 5ARBA 1C9MA 1BE8A 1GT91 1Y3DE 4K8RB 1ST2A 4OV6B 3QTLA 2PKCA 2Z56A 1SUBA 1SUCA 4LVOA 1YJCA 3LPCA 3VV3A 4CFYA 3GCXA 1TO1E 1EGQA 2PRKA 4C3UA 1ZVJA 1S02A 4OMCA 2DQKA 1C9NA 2Z2YA 2G4VA 3D9QX 1TM5E 3Q5GA 3SICE 3Q40A 3F7OA 4ZARA 1BFKA 2X8JB 1V6CA 1T1GA 1P7WA 2PWBA 1P7VA 1C3LA 5AVKA 3GCWA 1GTL1 4MZDA 1TM1E 2PWAA 1P8JA 1Y3FE 1GA6A 2DP4E 1BH6A 2W2NA 3DWEX 3DYBA 1SIUA 2ID4A 3BGOS 3GT3A 1Y4DE 1Y3CE 3PTLA 4DJ5X 1BFUA 2ZRQA 3HJRA 3WIUA 1TMGE 2ID8A 5AVJA 1XF1A 3DW1X 4DWWA 2GKOA 3I30X 5AQEA 2IY9A 4H6WA 2E1PA 1SUDA 1SUPA 1GCIA 4DZTA 1YJBA 2WWTA 1EA7A 4JP8A 3DE0X 5B1DA 2B6NA 3VTAA 1GTG1 2HD4A 2PMWB 1T1IA 1Y3BE 3DE3X 1SCBA 1Y1KE 1AU9A 5I9SA 3VSBA 4CFZA 1ST3A 5FBZA 3DE5X 5ARCA 3TI9A 1SBCA 2IXTA 2W2PA 1AQNA 3VYVA 5AMXA 1KDVA 3UNXA 2SBTA 1CNMA 1SVNA 3OSZA 3LXUX 1GTJ1 2W2QA 4HVLA 1TK2A 2QTWB 1SH7A 3LPAA 1WSDA 1R6VA 3DVRX 4NMXB 1THMA 3AJ8A 3EIFA 3GT4A 3PRKE 4CG0A 1SCAA 4Z2AA 1BJRE 2P4EA 4H6XA 3QMPA 4C3VA 1GA4A 1AK9A 1GA1A 2Z2XA 2WV7A 1R0RE 1A2QA 5B1EA 3I34X 4YN3A 2SNIE 2Z30A 1KDYA 1GNSA 3CNQS 3DW3X 3ZXYA 2V8BA 1AVTA 3BPSA 1AF4A 2PYZA 1CSEE 1SCJA 4LVNA 2TECE 1R64A 1SPBS 4GI3A 3WQBA 5CW1A 5FAXA 5K7SA 5ARDA 5JXJA
chains in the Genus database with same CATH superfamily
2YWGA 4QEZA 1D5WA 1YRBA 4G23A 2B1RA 4YMVA 1Q92A 4W9NA 1TTPB 1ZD2P 2EGUA 5F21A 4WLVA 5KNCD 1MO4A 2XZOA 3BTUA 4JYBA 5LMCA 5J2TA 1W4CA 1TJ5A 4NCBA 3TB4A 1LI5A 2FW8A 4F1WA 2CYBA 2DJIA 2XEDA 4RESA 1ONBA 3ZCTA 2Y71A 4LZPA 1P4JA 2PZ8A 3P94A 4TZTA 2EP8A 4LGYA 2IYRA 4PCVA 3OFSA 3DP7A 2YMLA 1XEXA 1KJYA 2F17A 3BA6A 4TV9B 1J97A 3HJGA 1VP3A 3I8OA 3WWOA 2PKEA 2YYAA 2JHGA 3IAS1 4LQDA 4AP6A 3QY0A 1FPQA 1DTSA 2GN2A 3JV7A 4A8JC 5AW7A 4CV0A 3Q8XB 5HMLA 2HLNA 2HUPA 5FWYA 4XCQA 4PHCA 5EWJA 1GNVA 1Y48E 1YZHA 1BWSA 2X8JA 3HGTA 3MWDA 3OEWA 5KDOA 2GA9A 4R81A 3GRPA 5LB4A 1R4MB 3EDCA 4M60A 4MI3A 4AN4A 1FJ2A 1XMOB 4M8LA 3DE6X 1G7TA 3GLTA 4LC1A 3ODPA 3N39C 1XBTA 4LJAA 4GOND 1J7JA 2A7XA 3B1VA 4Q21A 1OAOC 2ACKA 3GEBA 4ROTA 1PQUA 4BWGA 4KSBA 5HJ7A 1BOOA 2O3RA 1G1MA 3I53A 3LWNA 5IPFA 5IXJA 3KZKA 1NUUA 4Y30A 2L17A 3PWZA 4IMPA 5IUNC 2P9EA 2HYIC 3HA5A 1KZHA 4TS3A 2XAAA 2E5FA 1KS9A 2EF1A 3E8MA 4U7PB 1L5WA 1M3SA 1RRFA 2EIXA 1SPXA 2BTOA 2WM2A 3DS8A 4PLPA 2YCBA 1XHLA 4ERXA 2ZS7A 4ZEWA 3VR6D 1NVFA 1T4CA 4W1RA 4FFSA 3VZPA 2QYOA 3HDHA 4C6HA 2IH4A 3OTIA 1Z8DA 1T5SA 2ZRMA 3R1IA 1JE0A 4GKVA 5KOJB 1SD5A 3TXXA 5KYWA 2E4XA 3TECE 1DTWA 4GLLA 1M6WA 1DPFA 3G2LA 1YE5A 3IDAA 3DZGA 3OT5A 1FFSA 2ZRLA 3JSXA 3LRXA 4LYGA 4Z9FA 3BFVA 3BB3A 4M4SA 2Y1XA 2DEUA 1JHQA 3ZV3A 4DCPA 3WIDA 4Q03A 3CONA 4X1IB 4GEGA 3I39X 5KX5F 3U3OA 3HGMA 1XL0A 4I2VA 1GUFA 4FDLA 1R0CA 5EJ5A 1LLQA 3N2KB 4A2CA 1T5DX 4BMNA 1HE2A 1GAJA 3KUKA 5JADA 4E51A 4KQEA 3IR6A 3WHLA 3ZWPA 3T34A 3UAXA 3RSZA 4OHKA 4UCXA 1NT2A 221PA 2ZJ0A 4U7TB 1FA9A 2DPLA 3IX7A 2OLEA 3R7SA 3ABIA 3V80A 4CODB 4ZVQA 1LQTA 3TNYA 2F1JA 3NI2A 2YMQA 4D82A 1SCQA 3R44A 1MRZA 1K2WA 2D5LA 3QEAZ 1PZGA 4BN5A 4CKEB 3PXGA 5C51B 3TDMA 3EBLA 3QKRA 5ALGA 4ZHQA 5AW2A 4DDTA 2KW5A 3B8EA 3PZRA 4I4TF 5ICSA 1UM9A 4CXMA 2Q45A 3IIEA 1BEUB 1L1QA 1RI2A 3TGWA 3W5AA 5G0WA 2FMFA 2BPOA 3U0BA 3Q0EA 3WRXC 2PX3A 2D3TA 3FMFA 4RD4A 2V7QD 5DB4A 5KI6A 3ZHOA 4PGGA 3ZQJA 3ICCA 3KQKA 2GWRA 3RS3A 2I65A 4IHJF 4IIGA 4UE6A 5CJPA 2NO5A 4MCJA 3R6WA 2OKCA 5K0CA 3MSCA 3JWIA 2AUNA 3TSYA 4FB4A 1RWOA 2P77A 4S2EA 3AR2A 5KYVA 3REGA 1LSOA 1RWQA 4JUFA 2I99A 4M0KA 4ZOLF 2IHVA 2WJYA 1PYDA 5T4BA 3WB9A 1C1YA 3EW9A 4C0AC 4DV1B 2AQKA 1WDMA 3M6AA 521PA 1UJ4A 2NU9A 2QRVB 2WFLA 3JQCA 4UE3S 4Q4AA 1ZBDA 2NV0A 1D4FA 4HUJA 3VHQA 2FW6A 1OFGA 3OE7A 1JSZA 2XD9A 2QX7A 2SICE 2XWPA 4KXFB 5FNZA 4G8CA 5JS8A 2VXOA 3NS7A 2CMFA 5CJJA 2PT6A 2GLXA 1EUCB 1VYHA 1NI3A 3W6PA 2B82A 3IAM6 3NB0A 2B2NA 4GPEA 5AVQA 3TL6A 4L85A 2HXSA 4ETWA 2VVTA 1SBIA 4HRYA 1H2BA 2B9EA 4OOFA 1V16A 3QVVA 3KDPA 1BU8A 4WOJA 4MGKR 2SCUA 5JSKA 4DRYA 4UQLA 1A77A 3PFGA 4YROA 5K9ZA 5I6DA 1GSAA 2BGTA 4F72A 4JSTA 1VKHA 4XOUA 4IL5A 2NPFA 5IF3A 2AUMA 1XNJA 1JLLA 2FPXA 2JCXA 1PAUA 4C4AA 1XA0A 3OZUA 4L5IA 1FRNA 4CLEA 1W2WB 4RFSB 2HV8A 3HH8A 4MIEA 4A36A 4L3OA 1TEXA 2GEKA 2XB9A 3FSGD 4HDMB 4KRXA 2OFOA 4MW1A 1ZXBA 5HM8A 5A5DA 2GESA 4ZREA 4OXIA 3LHSA 1N2IA 2OV3A 4D6XA 5FBVB 1JHAA 2RD2A 4AMYA 3NX4A 2FJ0A 4POAA 4C7MA 1X86B 2WWRA 3OPYA 4KH0A 1EB8A 2ATCA 4PZCA 3E2IA 1E3LA 1JLHA 4GZ5A 4Q19A 5CIWA 4DANA 4INAA 1MG5A 1FFBA 4JC5A 3L1KA 4QREA 4KL8S 1FC0A 3V8RA 4IXWA 2EHJA 1ILWA 2EP7A 3AFMA 1ZC4A 2BFEB 3EVDA 2OK7A 3CG0A 3SXUA 3ZC3A 4JA0A 4K46A 4HBZA 2OQIA 3QU2A 3VU9A 3ZCVA 1X7XA 4QOIA 4OSOA 5JTUA 3L6EA 3TW6A 3AM4A 3WL3A 4ED9A 4F3YA 3H1GA 4MR7A 1EGVB 3DBHA 5FL3A 5AW6A 2QQEA 1FOEB 2H3HA 2IIVA 3C98A 1CUGA 1RAIA 3NAQA 1NBAA 1ZH2A 5CA0A 1Y4AE 2ZR7A 3M70A 4QGGA 4WFIA 4EY4A 4OK6A 1RKXA 1WO8A 3GGCA 1IZ7A 4CIDA 4QU0A 3S81A 1CYEA 2WD7B 2VRBA 2NW6A 3FOEC 4EJSA 5G0SA 4BLVA 3TLAA 4MUEA 3JQDA 4HN2A 3LQ2A 1U8XX 3GFVA 2IYUA 4PC3A 5FUVA 1KQNA 1SHZA 4LYFA 5BOSB 5D3MA 2E89A 4J4BA 5AD1A 2AYZA 4EHAA 1NQVA 1NURA 4EHJA 3A11A 3KKNA 4RADA 4WXRA 5K0ZA 3S68A 4UCQA 2O2XA 4Z0TA 2WTEA 5LQJA 3AEQA 1U0NA 2Y2UA 3DQQA 3L2OB 2BCEA 1L7NA 2E6KA 2FN8A 3Q3GE 4KU4A 5LU9A 1SUEA 3DF9A 3QVJA 4XFKA 4KN6A 4NY1A 1JG4A 2HRDA 1BKYA 3I8SA 3GUHA 1UBRS 3A1VA 2I2AA 3DAFA 3HL4A 1UBFA 1N6IA 2QD1A 5ALXA 1FB5A 2MYPA 3DBLB 4K6FA 4OV6B 1ZESA 3LYUA 5F77A 5KJEA 9LDBA 1I2AA 5EP1A 3PC6A 5SY9A 5ADVA 4AS2A 4N40A 1YDWA 4O4JB 4OAPA 3NUQA 1UOEA 2IOQA 3N2YA 3STVA 3CVYA 3F73A 1RQXA 1SUBA 4HNUA 1L7MA 1DPGA 2C9BA 1QE3A 2CDBA 3N8KA 3U7HB 3C3PA 2A9KA 2OP0A 2XJ4A 3LHKA 4FFBB 4Q9HA 3TPFA 2JGNA 2QGZA 3PCRB 5K20A 3QBVA 4DLBA 2Q5QA 2AZXA 1R0BA 3UK0A 4MLPA 5CXSA 3VYRB 1M33A 2GJKA 2ZRCA 1I3KA 1Y1TA 5FEMA 3SDSA 4L28A 2G7MC 3VR1A 4YMUA 4URZR 2Z95A 1PJZA 5COBA 4ATNA 3O21A 4Z99A 5F2EA 5DISB 3EXHA 4DSTA 2ZU0C 4CTJA 1R66A 4K9QA 3EGDB 4Q66C 2DQKA 2N3ZA 1KSHA 3WYEA 3PC8A 3N6VA 3NORA 3GVPA 4AO8A 4II2A 4V03A 2RIRA 5LD2B 4W7SA 1OA0A 2ZULA 5G3YA 1K5DA 3OO0A 3F4BA 1YF3A 3A2KA 3I6IA 4L4XA 4WEQA 5BYAA 1CUVA 3HP4A 4I5IA 1HF3A 3FAKA 2H16A 5D6OA 5FHQA 2AYXA 5KCMA 3WLSA 2WTUA 4KDEA 4RKRA 3ZE0B 4I50B 3L1UA 1PJAA 1J99A 2X7XA 3DNFA 4H4DA 4B3HA 1F3LA 4KIFA 2YVUA 2P6PA 4YRIA 2WJ4A 1XEFA 4NULA 2ZJ4A 3TEFA 1VSUA 5DO9A 1VE7A 1OI7A 2JFXA 3FXAA 2O9JA 2ZBPA 4P3OA 4GE0A 1V6SA 1Y1LA 3ZIDA 1VIAA 1QO7A 1PGQA 4TZKA 4PHFA 1ZI9A 3OLCX 2DT8A 4UQPA 5LZ4A 3O3OB 4WTOA 4BU0A 3KEQA 1C7FA 3WDMA 4I3GA 3HXOA 4JVNA 5GAJA 4FYPA 3L0OA 3GNLA 4X85A 5AJTA 3TQFA 1PF7E 3IAXA 4HOYA 2X1VA 1MJGA 5GY7A 3I9JA 2W2NA 2NU8B 3EGXB 2IW1A 2RB5A 2SKCA 4P80A 3HJCA 1SD2A 2YJ6A 3MT7A 1SIUA 2PYIA 2B35A 3EFEA 3PDIA 1LNQA 1Y4DE 3SEZA 1N5RA 2JH3A 3U3MA 2W8ZA 6PFKA 2PU5A 5DSXA 5ENZA 1IXYA 2WZQA 2LRHA 4RKQA 1KFBB 4J16A 5C3MA 4UEQA 1BNCA 1TYEB 2AOUA 1BFUA 5FUYA 4AK9A 2J5QA 4GE3A 3NHBA 1T8YA 2XGGA 5CFRA 4RTNA 1KA9H 4K9MA 3FYUA 5U9CA 4DR5B 4KHPB 2EC5A 1XF1A 2PG3A 1XD2A 3ZD7A 1DWPA 2FZ5A 2AMJA 2OCXA 2PL9A 2W2KA 2XHZA 1M9NA 4KJXA 3H65A 3ZWMA 1NAHA 2JEOA 2Y0EA 2IY9A 4PG4A 2C4NA 3QH4A 4PX5A 3AMVA 4EUFA 2IF0A 1SUPA 4IDEA 4DMKA 1C8KA 4U3JA 4MICA 2QTCA 3KCQA 1PLLA 3E18A 3IBGA 2XCUA 1QKJA 1I32A 4HATA 1U1EA 4QQKA 3CUTA 5BV0A 1SM4A 5JVDA 5HQ3B 3LNCA 4Z0NA 2WTAA 1QLWA 2AB0A 2EATA 3A6DA 5C5IA 5LPNA 5J23A 1NV9A 4EABA 1C4KA 3LBNA 1B8PA 1H4TA 2D2EA 2XAUA 2O1SA 1IPEA 3DHNA 3DUWA 3IDZA 3KJXA 2R8BA 5H9VA 5IDXA 5BSFA 3C15C 1LJLA 3RF7A 1K08A 1RC1A 4YWJA 2NZ2A 2HQSA 2QTRA 3LIIA 1IONA 4DA0A 1SQ5A 2PT7A 4GL4A 4BQIA 2CXTA 2Q3FA 3BEOA 4ZQIA 3UHJA 1EQAA 5KTNA 4NAVA 4M1OA 1NJFA 3SQWA 2ZRNA 1NRJB 4GX2A 4K28A 1JE1A 2ZW9A 3BCRA 3VVCA 4MDFA 1KBQA 5J9FA 2X5NA 3CRW1 3MJEA 1RW4A 1EWRA 2VXCA 3DWFA 5BP7A 5BMVB 2AX3A 3L0SA 4MWEA 3ZLBA 4TUYB 5BQ5A 1K4MA 3IVXA 3KKMA 4ENVA 1AZLA 3V1NA 1E2UA 3VOTA 1AN9A 5FL7A 4DA9A 1PEYA 4HY3A 3EA5A 3MD0A 1Z2PX 4JLPA 5IKPA 4Y18A 2FQYA 4NONA 2A94A 3V6LA 1AKQA 5EZ6B 3E9YA 4CCWA 1WJGA 3SEAA 4BBAA 1OGJA 3ZWVA 5T4EA 5JQGA 3GCDA 2W98A 3ESDA 3DL0A 4NDNE 4HX5A 2XVMA 4D80A 1ZJ4A 2JIBA 1J5PA 1D4AA 1DQRA 1HMYA 1DG3A 4BBPA 1Q17A 2KHZA 1WXIA 3OUZA 3DZ8A 4H3KB 3NPMA 2CLHB 3DMTC 4FGLA 2H4JA 1EFTA 4GBED 4R54A 4XWKA 1OXSC 3GLFB 1G6OA 1NYLA 2WDPA 2GXAA 1ABFA 4PCLA 4UZFA 1OFVA 4NBLA 2NUPA 3S5UA 4MULA 2PGOA 1VPWA 5GM1A 1IHOA 3DCYA 3II6X 8ABPA 1NLYA 2B8JA 3OCCA 5EMMA 3TLBA 3W8EA 1IZ9A 4EPTA 1ZSNA 4U7JA 5JARA 3LT4A 2GCPA 2AD5A 3CW2A 4B79A 1U3FA 2B5VA 4R9RA 4GP6A 3RADC 2ZDQA 4KR0A 1IG0A 3O8OB 1YE3A 4EGCB 3CEAA 3HO6A 4LBVA 3QE3A 3BB1A 4M0UA 3N2ZB 4M0LA 2Z30A 1LC0A 2H92A 2IEZA 4PRYA 3CU5A 4X5OA 3WY9A 4E30A 3UJ9A 2E0IA 3DT8A 5EJ9A 2Y77A 1ZH0A 2QIOA 4P4GA 4DYDA 3T7AA 1VIDA 5THXA 3ZXYA 2Q1YA 1JHXA 2BOVA 1H1TA 2FX5A 2HRQA 3PCXA 1AVTA 3BPSA 3HUUA 4XB2A 4TLCA 4XD7A 5L3RA 5MHTA 4BTEA 4P7GA 4BCCA 4MLCA 5AVSA 1Q1EA 5CDTA 2JATA 2VI5A 3KKKA 3KXDA 1UWCA 4BKOA 2AEEA 3EEYA 5EY5B 3N58A 4ZZ2A 3ZX5A 2OZLB 2V9ZA 2XGMA 3OM0A 4HFJA 1EK2A 3VAAA 3V1KA 4QD3A 3F1KA 1P29A 5HZMA 4B8WA 2I66A 4GPD1 2C61A 4KAAA 4YJ2B 3TBHA 4B35A 3MFYA 2WIJA 1OX4A 3HKBB 4C0BA 4PQFA 3I28A 1QFXA 2XUZA 4MCIA 2QW0X 1KWKA 3G9QA 3MS4A 3ZCPA 1SG6A 3B5IA 4M86A 3GHYA 4WGFA 2IHBA 4NVRA 3IXLA 3VJRA 4LOHA 4I0WB 4QARA 4TKLA 2G88A 3RS8A 4RSRA 1G5PA 2P6NA 1JQJC 5DTMA 1SVKA 3RS7A 3ZWNA 4ZEMA 3HN6A 3OJCA 4LMRA 4KOAA 3D0OA 1WY5A 4RZ2A 3DLHA 1J49A 1MO2A 3AL2A 4QYWA 4EVQA 3HFRA 2KJQA 2O7SA 4OLHA 4UPVA 2W58A 4WZ6A 2ZBFA 1IY2A 5LU8A 5E1OA 3ET4A 1KMCA 5L40A 4UM9B 1TM7E 4OM7A 4CQMB 1OVGA 3ZJTA 1FS4A 4A5SA 4D8YA 2ZJ5A 1W4LA 1XZHA 3ZDCA 2XZTA 2COUA 1ACMA 3DB1A 2O23A 1GNTA 2RGWA 3F2IA 3M2TA 3OIFA 4IH4A 4OMUA 4WK0B 3TWOA 4K9LA 4H59A 1M2KA 1YRYE 4MARA 4BN4A 3EH1A 4Z1MA 1PR4A 1VLLA 5AVRA 3FPHA 3PX7A 4BIMA 2GN0A 4FGWA 4RMIA 4ZOQI 3MXTA 5KSYA 3QLUC 4PPYA 2PCJA 3O84A 4G09A 3TOVA 4E2ZA 1MVOA 2PRZA 1NT4A 3G6WA 2YWDA 3AP1A 1QS0B 4ZALA 1LVGA 3KQPA 1A9YA 1JHUA 3CF4A 1JH8A 2BUAA 1W49A 3IPYA 2AC2A 4JLMA 3DM9B 4UUQA 4F6RB 1WD5A 4YPVA 4RIFA 4YASA 3HHPA 1B0PA 1YUNA 2Q07A 2YICA 4TM8A 2NYRA 3WGIA 3VDNB 2XW6A 1VSQA 3LO5A 3L7LA 5IYZA 4DR2B 3NRBA 2VPXA 2ISQA 4RD2A 1IRXA 1SA0A 1TW2A 1J9EA 3EZLA 2GMWA 1F2UB 1Y5LA 1ZJ6A 2QROA 3OT4A 4BVFA 3UENA 2QWXA 2B1JA 1VGVA 3PQ3A 2ODBA 2J6IA 2JCBA 3KPUA 1S2LA 1KJQA 4DIUA 5FI5A 4JITA 1GPMA 3UBTA 1P17A 2O3TA 1MVNA 1QX3A 2H1HA 4Y7CA 3ZD8A 1C0KA 3OKPA 3IOEA 1G3RA 3P9CA 3EUEA 5DGCA 3VH2A 8MHTA 4P93A 2BM9A 1RACA 1U0OC 2FLVA 1AO3A 1KZGB 3AF5A 1HM5A 4FMDB 1E1QA 1N0UA 1M1NA 4V0ME 4WE3A 3W9BA 1AQYA 3Q98A 4JSYA 1LSJA 3TCKA 4BMSA 3D8SA 4XDHA 5I3CA 1TZ2A 1SCDA 3VR2D 2W6CX 3AV3A 3PQCA 4HQFA 3SYKA 3W1VA 3WNQA 2G1PA 1FDRA 2OVFA 4G6ZA 4KMRA 4OAQA 3FCUB 1TPZA 1N8SA 1Z5UA 2WPNA 5DHFA 2IWHA 3FI9A 3U4DA 2XF8A 3VNRA 5HFAA 3AGPA 4LHXA 4BFCA 2XB8A 1U0EA 4DDUA 2CLFB 1ZIOA 1GFWA 3KJGA 4GIBA 4IVNA 3R3JA 4MV0A 3ZI7A 3HACA 4BKUA 4EUHA 2EFCB 5FTLA 3RWOA 4B7AA 3REQA 2CLKB 1FSSA 3CX7A 4LNUA 4TTAA 2PBFA 3ZNNA 1TEZA 4DLWA 1GTZA 4BX2A 4I1YA 3W5HA 4YV2A 2PO7A 3UYKA 1CJCA 1TF5A 3DV9A 2VH1A 2A86A 2FK8A 2Q28A 3O4FA 3AJRA 2HQBA 4FINA 3T1NA 3VO2A 4AWXA 5CFLA 1PUXA 2F43B 3KT0A 1XKQA 1UPCA 4QPCA 4ZVUA 1U3WA 4KGXA 4XWGA 4YCBA 5CAEB 4M9QA 1ZL0A 3O8QA 4YP0A 1IUNA 1KORA 2IELA 1RXYA 2VP6A 2XBLA 1ZOSA 2YHIB 4PLYA 1E1YA 1NC1A 1U8YA 1WD7A 2XX3A 4OPMA 3BYZA 5KB3A 2CFRA 3KXKA 3GLGE 1GZDA 3U44A 2KS6A 4PWYA 2VTBB 1EFRD 4DMHA 3SIXA 4A0GA 4HNAB 1YJXA 1SC6A 1S8NA 1QVVA 1V3VA 3O3CA 3VKVA 1FK8A 2WF7A 2J0EA 4YJHB 1MG0A 1CBUA 2FPGB 3FY4A 3QX7A 1IIRA 4N03A 1K5PA 4A9AA 5C4MA 2C4KA 2VIIA 1NF8A 1D2AA 1UEJA 1U0TA 1GNPA 3ESZA 2ZR0A 1RM5A 2PUVA 4ZVRA 1HUQA 3G8BA 4EMUA 4WW0A 5BR8B 4KQ2A 3UMBA 1T6ZA 1UBEA 2NUTB 4F3CA 3C2QA 3F49S 3O83A 3GV0A 2C9OA 5IBPA 3LP5A 3TAUA 1AZWA 2EF0A 1R9NA 4YI3A 5BNZA 3IHKA 2J6BA 5E38A 2KLHA 1OV4A 1E59A 1T1RA 4LDJA 3F3KA 5CVUA 3SC6A 4CEJB 2X41A 4HTAA 1KC1A 1Q7GA 2E4AA 1VCHA 3KZVA 2X3UA 3RUPA 1E2DA 3OOHA 1EJ2A 1Y6FA 1G55A 1FXWF 2WOJA 3HR7A 4C6SA 3S2UA 4YPOA 3DBOB 5H83A 3DHVA 1FVXA 1E32A 1FRZA 1ZOLA 2G3YA 2IBSA 1O4WA 4RF2A 2Q49A 3GEMA 2ZPAA 2AXQA 4F1KA 5C1DA 3FAZA 4D5EA 2J3QA 3NCTA 4A2QA 4C87A 3HVRA 5MF6A 4IG4A 4HDKA 4XSVA 4AYXA 3COYA 4RC9A 1C9EA 3NYWA 5D51S 3D3WB 4CTOA 3L01A 1CDZA 1ZN7A 1NW9B 1S01A 2LIPA 1QGUB 3C1TA 3RS0A 4YRSA 1DG1G 1KOGA 2LGJA 4YEDA 2GA8A 4ITUA 3W77A 4PQGA 5CBKA 1UFVA 2BRUC 4JEUA 4R1UA 2W48A 3V42A 1A2OA 2I1QA 1E2EA 1WHTA 4J0IA 4QXMA 4RO0A 5ALNA 1DEXA 3LT2A 2H1FA 3OAAA 4YIHA 1JFSA 2MDTA 1COWA 3ND9A 2HEIA 2H9IA 4RS3A 1QBGA 3UOAB 3K09A 4RH3A 1UR5A 3AP2A 3KXPA 5TQVA 2W0MA 2OYSA 5DOVA 4F3KA 3WIEA 5LQMA 3RYFB 4ICIA 1V6AA 4MW6A 2HMWA 3R3XA 3WLQA 1DG9A 1ZS9A 1CF9A 4IBOA 2W00A 2WSMA 4D98A 2GZMA 3WL4A 1G5FA 2MWMA 3W5SA 4DLPA 2DCMA 4RJIA 1CEXA 1NUQA 3K35A 1FU8A 4F9GA 3NUZA 4DDVA 1W2GA 2GZHA 2CFIA 3LCUA 3ROXA 3UAWA 2M98A 2PS9A 3M9WA 1O5IA 2W7TA 3MB8A 3RIEA 1OZHA 5DM0A 1C9MA 1GSIA 2DBYA 2Y1GA 3FB1A 2FQQA 4NECA 4WKPA 3PTZA 2RK3A 2Z43A 3G0CA 3PWSA 4X7MA 4JGIA 2WINI 2QTVA 2FP4B 2VYVA 3ZWKA 2GB4A 4RK5A 2OWEA 3LUGA 1XZFA 2IUFA 4HZIA 1JVSA 4G9EA 4CQLA 4AQ7A 1EBUA 2QXTA 3NYQA 2XXBA 2AN3A 1CY4A 3UGQA 1RABA 2GUWA 3HB9A 2ZIEA 1GAEO 3IEIA 2A78A 2GF0A 3PD7A 4ARUA 2VOJA 3T3EA 4UMDA 4D0LB 3VAYA 3WB2A 3TF5A 3ETNA 5FNVF 1LFDB 3RC1A 1IFXA 3ISTA 5CT8A 1MX5A 4BTLA 3CF0A 3OF2A 1NQXA 3TZLA 1WW3A 2QI9C 3R0VA 5IAKA 5FV4A 2B25A 3R4CA 2R8EA 1JDPA 3GFPA 4UAJA 1WNFA 1XDSA 1QK4A 1KI3A 5ERGB 5BORA 1WXFA 4X1KB 4FLEA 1B00A 1T36A 3PA8A 1GKKA 3C85A 1RYEA 3F4KA 3WQQA 5TV2A 3DAYA 1W5SA 4OHBA 2XMRA 1IDOA 5KSPA 1HFWA 3N3BC 1I24A 9ATCA 1TM5E 3EUWA 3LFHA 2J9RA 2WHPA 1W19A 3KSZO 1N0IA 1HOXA 4M37A 2PUAA 5LWQA 3K9HA 1MB3A 4YAKA 2C7VA 3JASB 4JT2A 3JD2A 2FFQA 5D84A 3RVKA 3KD3A 1MO3A 2O7QA 1BDHA 1L4LA 3AHIA 3ZXUB 1ACLA 4OB8A 1NLZA 2WUFA 4OQXA 1XU9A 4RJJA 1MO6A 2DH6A 2H9AA 2E5LB 1MH1A 1AKUA 1U6KA 4DLVA 3HNRA 2VSNA 1UOQA 1XRNA 2II6A 3CRNA 3ADBA 3D6MA 1JVNA 4REMA 2FZKA 5FA6A 3VJMA 3ROMA 4P31A 2B61A 1RJGA 5BYKA 1BQ3A 4HVAA 3GJ4A 4NMWA 2AC7A 1G0OA 2ZPUA 1BIFA 3GCZA 4PVCA 4Q4HB 1DMSA 4YXWA 3L4KA 5EIXA 1NAIA 3L5OA 4NEQA 4YMTA 3EEOA 2CZQA 2WUDA 4FN4A 4JL6A 2GR9A 1ODJA 2FR8A 3AYXB 3A3KA 1UL1X 5F5XA 3FB4A 4DCJA 4CN8A 1YONA 4E5MA 4FD3A 2DP4E 3W3AD 3JU3A 4FYYA 3A10A 4ZRDA 3G1WA 8OHMA 1W4ZA 2PQMA 1AXEA 2H29A 2JAPA 1JKMA 2CV1A 3GPLA 5EE5B 3HU3A 2VK1A 1ESCA 1F8UA 2MYNA 1XV5A 2I8LA 4BQOA 4BLQA 1TF7A 4YMHA 1E8NA 3BMQA 3RU3A 1T8WA 4F21A 4EY8A 1LV8A 4XVCA 5JW6A 5DNVA 1J8QA 4OI0A 1SOAA 1QB7A 4KWCA 3O4JA 1GLGA 1A7UA 1D5CA 3HZHA 4RK4A 1M2VA 4US0R 1E3WB 1IE3A 5I51A 5KTTA 2RGRA 2VRNA 4QEKA 1JA1A 2VZ0A 2HJWA 3NC0C 4IM7A 4P7JA 4MRPA 2I4OA 2ZVDA 4JMLA 1W0JA 1ZA2A 5IK2A 3MINB 1UAYA 3DZIA 5ITZA 1Z7BA 2CY0A 2NQ2C 2YUIA 3Q7IA 3I1YA 1OH6A 3C3AA 3WV4A 3HQ4O 1MFZA 1Q91A 1YS1X 5KVVA 4I4TA 1N34B 5IABA 1JWBB 1ZJZA 1OWNA 3ABSB 3QA9A 4Y6LA 1W4BA 1CQZA 4CF5A 4BKRA 2H0QA 1IU9A 1EEXB 2WKQA 2ZQYA 4FCVA 2J3DA 3NTRA 1DRKA 3M3PA 3PPXA 3ZGYA 2I3ZA 2FPIA 2P2YA 2BHNA 2CF5A 2BBOA 2J0UA 2PWYA 3D7LA 3EZ6A 4IHJA 4YCNA 1L4MA 3L18A 3HTXA 4UBOA 1U0RA 5IJ0A 1CXZA 1MOZA 3OT1A 4ISCA 3P2YA 1YUBA 4CIXA 4AY2A 3BULA 3BCHA 4EHLA 5DN6D 4KQ9A 5LD2C 2HM7A 2XCLA 3E58A 3LX6A 1V11A 4X6YA 4ZOLA 5AW4A 3MB5A 5L3QB 5KQLA 1H8ED 3CW9A 1X9HA 2G5PA 4GVPA 1ISMA 1ICEA 3KQLA 1RQGA 1TYBE 1W29A 3EGVA 3ECCA 3Q6NA 4MRRA 2ZGVA 3QLTA 4OGWA 1G1AA 1W34A 3MMXA 5JDCC 4MVJI 4NDAA 1U5BB 3DO8A 3VZSA 1YQWA 1M67A 1QHFA 5AMXA 4DC1A 2QN1A 4HNGA 3JQFA 2I7TA 2A0YA 4DUZB 5L3SA 5B6IA 1MNQA 4PX3A 4IV0A 1KQOA 4NBUA 1HL3A 5JJCA 2CXNA 3LLCA 4KNYA 2QY9A 1DXYA 4A2PA 1NFFA 1IN6A 4L95C 5ANRB 3ZVMA 1FS6A 4YRPA 4L4UA 2IYYA 4A0HA 1HEUA 4XPIA 2OQ2A 2W2QA 3ABOB 4N0DA 3T3IA 2OV6A 5THQA 2ZI6A 2HSGA 1P0FA 2D4AA 3HDJA 1P44A 1T3LA 1AM4D 1LBHA 3FTPA 3MRXA 1MOSA 3MAAC 3GARA 4Y6PA 5HF6A 4IXMA 5CLHA 7REQA 4FTWA 1THMA 2C57A 4LRWA 2Y27A 2ZSUA 1E6WA 1ZN9A 3AKYA 3NHUA 4F2HA 1U2GA 4B3FX 3OA0A 4K81B 3ZV7A 1YI0A 1BSVA 2Y6UA 5ALYA 2PSDA 3GRVA 3P0RA 2F9MA 2PS0A 3GRZA 4R0NA 3ENZA 5K3SA 2D06A 1ZW6A 1WBJB 1D04A 1K7YA 3P9YA 4HGRA 5FEUA 3WLMA 4G56A 4B6JA 3D4BA 1QDUA 3CX6A 3NIFB 4QIHA 1XEXB 4AUKA 3G2PA 1E6CA 2OHJA 1B76A 5B3AA 4DRZA 3FPCA 1P1JA 3MJCA 2QXYA 1CP3A 3TMAA 3HDYA 4CMKA 5TE9A 1T4DA 5B6PA 5HW0A 5KAMA 4MB2A 3AT1A 3F6BX 5FWYB 5EWJB 3FYCA 4M1KA 2RHTA 1Z73A 3B70A 2C96A 3MWDB 1J5EB 5JRZA 3IHWA 2QUAA 1YFZA 1E64A 2NO9A 3B3AA 4ZCQA 4BY9E 4JU8A 2FCAA 1IXSB 2LDXA 5ALRA 2VR1A 1K6MA 1SHLA 1USWA 3DEJA 3PPYA 3PR1A 3H4IA 3C1AA 1AKTA 1X8XA 1ZJWA 4IMIB 4YB8A 1PJCA 3S44A 2HIAA 1NZJA 4PINA 2XBMA 5AJXA 3RK1A 3V2HA 3SEQA 3KPJA 5CX4A 2TECE 3A6FA 3PICA 5JPCA 2HR1A 3PJGA 4BQQA 1Z29A 5BW4A 3NIGB 1O3YA 3WLIA 3IELA 1I6LA 3I64A 1T4CB 5TMBA 3CLSD 1TYAE 4ESOA 2ONCA 1KAQA 3VMFA 1CX9B 2L19A 5FAXA 1E1CA 4MQ4A 3ROQA 3CZ9A 1NW3A 1XZAA 4KWEA 5KYWB 2VJCA 1DTWB 4PYMA 1U3GA 3F0TA 2I3DA 1C9JA 4KQJA 4QOSA 5FR2A 3VVMA 2RGAA 4J0CA 2UUOA 4M9RA 1V37A 1YIAA 4RPIA 2HWKA 3WGJA 4WXEA 2R8XA 1QIEA 3JQ6A 1FP6A 2NSYA 2XKJE 5ALOA 1B0AA 1FDVA 2EBHX 3BXZA 2RKBA 5H1YA 4X84A 3HK2A 4LFAB 1SBHA 2HY7A 2OK8A 4B76A 4BV9A 1Z68A 2RGGA 2R68A 4ZYVA 1UBNA 2YWBA 1KJWA 2WD8A 2GKSA 3BRQA 4ZK2A 3X1KA 1YZFA 4JJ6A 3DOUA 4Q0MA 2GKGA 5HZHA 1P61B 3GNQA 2FOLA 4R2IA 2PUJA 4RM3A 4EO4A 4K8OA 1KSFX 1ZSVA 2O0KA 1JHMA 3CNEA 5E2BA 1SXHA 1YC2A 2I80A 3W5VA 3QKRB 2YL2A 4GNKA 1NPYA 3IKLA 1PT9A 3AY6A 4IILA 1UM9B 1T2CA 3NWBA 4HNRA 1R15A 1R5BA 3AH8A 5K01A 1H9AA 2VQSA 1PR2A 1EP2B 5ICFA 3WKEA 1WKVA 3GLHA 1TCVA 5KKNB 1IC6A 3GXBA 4N4AA 4D43A 3L7CA 4OJKA 2NU7A 2QN7A 3D2BA 1B7GO 4DR4B 4G0PA 5JHHB 2ZTSA 3A1CA 4BRUA 1AB5A 1H6DA 1J22A 1VL0A 1NMXA 4L8FA 4CYMA 4BB5A 2YWJA 1LPPA 1GPKA 2OMKA 1UADA 4PGAA 3N86A 4Y0VA 4YAGA 4E6EA 5FBWB 2WFLB 2NU9B 2LW7A 3UKJA 4Z51A 1S9HA 1WZUA 2BHTA 1NNUA 3L7NA 4M99A 2AD1A 4K88A 4ZI3A 1LKZA 1NASA 4MRMA 1KYWA 1Q6ZA 4WV3A 5LQAA 1SVIA 1E18A 1SGWA 2V7GA 4TTVA 4XWTA 1X80A 4XM1A 5FI1B 4AJOA 1K6XA 2XKKA 2WWYA 1F4LA 5HP4A 3TLCA 3EVAA 3SZ3A 5FFFA 1R10A 5CK4A 5TPZA 5CD9A 4PC7A 4AB1A 1R3DA 3FVQA 1I4TD 4TKZA 3VSEA 2KPOA 2XB2A 2CSUA 3U3JA 4HEHA 3ZI0A 2AT1A 1PWZA 2IPNA 2Z83A 3GLVA 4MA5A 5JLJA 3U17A 4TYMA 4X3PA 3TVDA 2QDXA 3IAFA 5TEVA 1SB8A 1A9OA 4RTMA 3F96A 1QX4A 3D2LA 3EMVA 1Y4SA 1JLLB 3ENVA 4FNOA 3DDWA 4RETA 5AKXA 2HA5A 4K1LA 4TQ9A 1KY2A 2K2WA 3DMRA 1VI5A 1SRRA 2PQ2A 4TRRA 2GXSA 1N3LA 3JALA 1JA9A 3MWFA 2V5UA 4M0MA 3RUFA 3OTOB 1TVEA 3ICWA 3FCCA 1XK7A 3HCWA 3CO0S 3PXUA 3RHSA 5J43A 1M2FA 2G5TA 3R2JA 4X00A 2ZRDA 3IKVA 2WPDA 3O0TA 3UG7A 5AI8A 4DIMA 5IC4A 1MAVA 2WJAA 1TW3A 1C1XA 3IB3A 4ISBA 2IHYA 3T0GA 4B82A 4K0KB 4ON9A 5AKGA 2V6MA 4ZU6X 2BAGA 1QP7A 2HJ9A 2JDID 1J06A 2IP4A 3LDHA 3NDIA 2WNIA 4CIBA 3OPYB 2GERA 4TMYA 5IT5A 2B37A 4PW0A 1A7AA 4B71A 2IRWA 3NG1A 1WMFA 4FC7A 1GGVA 2IOYA 2BKAA 5BO5A 2QM7A 1FP1D 3H5VA 3JQAA 4LI3X 5ECWA 4NBSA 5IMBA 1KEZA 1ZCBA 3UKDA 1VBNA 3OD1A 4MA4A 1KEVA 5A6SA 2WYWA 1DC3A 2PMKA 3KVNA 4EW2A 2COKA 2P0YA 2R1TA 1C7EA 4MR7B 1TECE 5DTJA 2RAFA 3P2JA 5CA0B 1FFXA 3GLUA 3JYLA 4P1ZA 1XTQA 2F7SA 2R5WA 3KKQA 1VJGA 2O7NA 2H4FA 4TXMA 3CR8A 2AK2A 1Y63A 4HEA1 1HZJA 1QK5A 3RSLA 2OPHA 1D2HA 4EJSB 2DC1A 1DKMA 4MHOA 3S3TA 2R6CA 3ORRA 3RTGA 4B6PA 1N4DA 3ZY6A 1Y1QA 4GRAA 4HS9A 5D3MB 3T15A 1MDBA 2HO5A 2NXNA 2GF2A 2PMDA 3E48A 4M76B 5K0LA 4ZMRA 4X62B 2JLVA 1EVYA 1XRLA 2XUKA 3AEQB 4DM7A 4EHFA 2Z2ZA 3PVSA 2OEPA 2WM3A 1ZYUA 4O3FA 4LC0A 1GL7A 1DCTA 1G0NA 4J0FA 1O54A 4Q6WA 5BSGA 1V26A 4KBGA 3TINA 4QXPA 4PPNA 3EIUA 1E94E 1T10A 3E15A 1ZGJA 1E8MA 2QYHA 3KEOA 4YBZA 4YUZA 3C7TA 4UREA 1EFKA 4OQ4A 4N65A 3PX2A 3CX8A 3LC7O 5DXFA 3H04A 2CE7A 4FFRA 3W04A 3I2YX 1QANA 1YMVA 2QE6A 4GMGA 1Z6ZA 4P5DA 3MT9A 2F67A 3IHTA 1HX7A 1IQRA 2B0JA 2IPXA 5ALDA 1LBQA 1VQ1A 1XLTA 2RI0A 1JU9A 4TSRA 3OQIB 3QNUA 4K5QA 3IDOA 4PIVA 3GCGA 1UP6A 2P8JA 3K9FC 1JEYA 3BK1A 3OCWA 3FOWA 2G9NA 2VCHA 4ZJYA 4WRRA 2NOAA 4IQ8A 1DE0A 4NU5A 4TMZA 4BP3A 1QVZA 4YLEA 2BZ1A 4GOLD 3L7BA 2P3QA 2Q1WA 2YDYA 1TT5B 3EXHB 2QSUA 4MW0A 1D6NA 2JGMA 4GPZA 4BB6A 5JR3A 2W42A 4MR8A 3SC2B 3C3BA 3QJ5A 1XD8A 1OXXK 1D07A 2FMIA 1AQLA 1T0JB 2ZWAA 3AIKA 3D8BA 3DAOA 3EAFA 5CTAA 4C7VA 2UUCB 1ZIXA 5KVSA 3WQSB 2R48A 4M7OA 3Q1KA 4HNTA 3W9YA 1V3UA 4ZQFA 4PSKA 1I01A 1V3QE 3E3AA 3QA3E 3FMPB 4ZU1X 4W5JA 2YC2C 3T7TA 5K05A 2JNWA 4GU5A 4MQ5A 1DDGA 3U4MA 5DHUA 2AW3A 1L3IA 3SQOA 1PWYE 3G9ZA 1CZHA 3E8XA 1KEPA 4BRZA 4AP9A 1R4ZA 3M34A 3L0DA 3SF8A 1XMSA 5LL6P 2ZBEA 1LLDA 2REXB 1EDDA 5KMGA 1G20E 3WL6A 5T6MA 2FF5A 1TAQA 1M2GA 2B98A 4JIMA 2D2FA 1O9GA 3BF7A 2VZLA 3T4PA 3FTEA 3QTLA 3U7QA 3ULKA 3N2LA 3WLTA 4AAYA 1EUDA 1MQSA 2BEWA 2VTVA 1XN4A 3L8YA 3LA8A 4QOGA 2C07A 4HC4A 4RVOA 3CVXA 1Y3HA 4JH0A 3KFLA 4PLCA 2O2EA 2BM8A 3K6KA 4L76A 1CDDA 3KHTA 4PC1A 4PC6A 4ZMBA 5A9RA 4N3GA 3OE1A 1DEKA 2WAOA 4MJ3A 1GZ6A 3VBEA 1PI3A 5EEHA 4LRTB 5JWOA 1VJTA 3OU2A 2QZPA 4G5YA 2UKDA 4HTFA 4NOKA 3RU7A 4KSYA 3VV3A 4FOOA 3LDUA 1K63A 2CVQA 1TO1E 4K9RA 4B81A 3RYCB 4BLTA 4DY4A 3FMGA 2H8KA 3RTEA 3DDNA 2RI6A 4M0FA 4L75A 4DS3A 5JAMA 5KS2A 2Z98A 1A8IA 5A9TA 4HAOA 1XD2B 2P35A 1GGFA 1XQWA 2LBPA 1POXA 2V7PA 2W4MA 3FW1A 1KZ9A 2W2KB 2O52A 3GAAA 4IOMA 4N3BA 5J40A 4CRWB 4TWZA 5EIAA 1Z7YA 4I5EA 2UZ4A 1R4NA 3UMCA 4QG3A 2WF5A 4ZXFA 2QU8A 3B1WA 3O74A 1CUZA 2ZSFA 4N8SA 4U3JB 3RANA 5K8VA 3U4QA 1VSVA 1I7DA 3E9EA 3BWMA 1JHYA 1SHJA 1UJ2A 4ARAA 4KR3A 1PR5A 4D45A 5JVDB 5I45A 2O2SA 3MQ2A 3U1VA 1UZAA 3DZCA 1DEHA 3Q8LA 4OQMA 1ZK0A 1L7OA 5EE0A 1ADJA 3ZPXA 2B69A 4G65A 1FX0A 4X8MA 4C07A 3MJ4A 5KHAA 1PD0A 1RU3A 4TL9A 1QKKA 4YCAA 1NC3A 3P97A 4NCIA 4TZ0A 4L74A 4KE8A 1H8HA 4O2LA 4BWVA 3U6BA 1P7WA 3MCZA 1OBHA 4DIBA 2FRXA 4C2BA 3FF4A 4TMWA 1XX6A 2FZCA 5JBNA 4OI1A 3T52A 4LCEA 2XADA 4PYNA 3ELDA 2AN5A 3O82A 5CVJA 1NBWB 4NYIQ 4R1QA 1FMLA 2IBMA 1JQAA 4ZHSA 4E2FA 3FTQA 3QVMA 2O1XA 3ZUPA 1H5UA 1LBIA 5JFTA 4C4YA 1O0CA 4Y6GB 3TOXA 5EP3A 1R9GA 2O3UA 4F0JA 1RAEA 1KQGA 3L0CA 5F3WB 1C3XA 1YL7A 4JWKA 2FUKA 2VF8A 3AM3A 1D6JA 2ROQA 1OHHA 1SBYA 3LECA 1ZY2A 3AKCA 1CQJB 2MMCA 3O1JC 4JT9A 4EQ6A 3R9XB 4IIJF 3A4YA 3HSKA 1ZM3A 4AY6A 3BRWD 4CQJA 3JVVA 2Z3VA 2FSVC 3QQPA 3JZIA 5JQGB 5G02A 2Q7OE 1PYGA 3WRVA 1MMFB 4B3RB 1ZICA 3IP5A 1XZLA 4UXHA 3VR0A 2QMHA 4LHYA 1PD1A 4G26A 4Q18A 1K8XB 1MOPA 1TUEA 1DVRA 2I9PA 3FA2A 4W8HA 3UWDA 4BDTA 1M2WA 1OBFO 3CZAA 4DLUA 1JQDA 4XJXA 4ZPJA 3B9QA 1RI3A 4HAUA 4PXAA 2WAAA 5CVCA 5IJXA 1RBMA 2K87A 4JP8A 1TC1A 2RKWA 2NUPB 3O9MA 7MDHA 1GZVA 1Y1PA 3DDSA 2L42A 1YAJA 4OHFA 2IHZA 3A0RB 1NKTA 1KPGA 5AJZA 2GX6A 4XRRA 1KO1A 3MGGA 2YUTA 4MV4A 4UASA 3PDWA 5CGZA 3KBOA 3TZEA 7YASA 3FRJA 1MTOA 3DCNA 1DT5A 2WSYB 3IQXA 4H0NA 1QO0A 3H0CA 5EINA 4LGCA 5AW0A 1L2TA 3MA0A 3ZLJA 3PYMA 3WB1A 1BWRA 3A28A 4JB2A 4YGXB 5E7IA 3IC5A 3HR4A 3DL2A 4U2KA 3T3HA 4PAGA 3W5IA 4BO3A 3JD0A 4BNLA 1QKIA 5HBGA 3K0FA 1TUIA 3TW8B 3AVUA 1NV8A 3GEGA 3ZQKA 3PITA 1O5OA 2V7BA 4G86A 3IT1A 2ZRHA 4UHDA 4Z9YA 1OC2A 4RGQA 3T1HB 2BWJA 3FGNA 5D01A 5D3QA 1HKUA 2ERXA 1KMHB 1ELOA 3EXIA 2D6FA 1H2AS 3TUIC 4KPFC 2Q6KA 2P2CA 2LE0A 4GECA 3T38A 1D0VA 3VC1A 3OURA 3EPKA 5HWSA 2JI7A 1P4RA 2CK3D 4Y6RA 2C4HA 4ENSA 4ID9A 5JIBA 4GW3A 2XYQA 3H9GA 2BDEA 3TLEA 1N2BA 2QX4A 1HT0A 4IS2A 2WIAA 4C22A 1E2QA 4N0EA 3KQNA 4EEXA 1ULAA 1Z25A 1OX4B 1UK8A 3KB8A 4HBGA 4JVOA 3MS7A 2C4VA 4NICA 4TKVA 1WUJS 4C6RA 1EDZA 3LPAA 1I7SB 4MZXA 5HOEA 1JU3A 1UDRA 1X0XA 2Y0CA 4OHRA 5AJUA 4EO9A 4ZK6A 2MOKA 1IUKA 3ZY4A 5K6AC 2P4HX 3F8WA 1Z4JA 3KXLA 1FXWA 1LBTA 1FL9A 3FX2A 3U9SA 1KO5A 3AP3A 2JLAA 1QIJA 1HDEA 2B34A 4FD2A 5IT9A 4H6XA 1IK4A 1U5CA 3LT0A 4PAOA 1AS3A 4BNDA 4X65B 5EUMA 2G0AA 4GYYA 1ID1A 1JHPA 1N0VC 1YBVA 2DH5A 3DKKA 2P4UA 2UYQA 1Z6QA 2C54A 3JWPA 4L9SA 4NPHA 1YJ5A 1T43A 3IAS6 1CERA 1TYDE 1ZMBA 2GBPA 3MM4A 5ES4B 4ES6A 1HE3A 1A8UA 3P9IA 3HCRA 3ACBA 4WKOA 1G41A 1NP6A 1ZU5A 3BVPA 3Q3JB 4FK8A 4GLJA 2JJMA 1R6XA 4E5DA 3R7AA 5DM60 1HETA 2ACVA 1IJKA 2QVYX 2UYYA 1QF6A 2BCGY 1Q1NA 1NJGA 1XA4A 4RHFA 4ZT2A 2PZMA 2AE1A 3PHCA 4CU2A 4C1NA 3T5DA 4WZBE 5FCDA 1NG9A 2MSCB 2I2DA 2QRGA 1TZMA 4UKDA 4XCVA 1LDEA 2J0VA 2PUHA 4PV7A 4X24A 2PA0A 3EVTA 5GIPE 1V4NA 4NG4A 4LJYA 1ZEJA 4BNVA 5JFGA 3JVEA 1DIOB 3RFCA 2OENG 4R3UC 1RFLA 3A4NA 2WVGA 1Z7GA 2GBCA 4EPXA 3E0XA 4XVUA 1KEEA 5HYVA 4KFUA 2QZZA 4JIGA 4ECEA 4EKNB 4NV1A 2FUEA 1HE1C 1PHPA 2JAXA 3QOFA 1XQXA 3KX2A 1OYWA 1P2BA 1SA0B 4I2NA 2Q5LA 3A06A 1U2SA 1U2PA 1Z63A 1K88A 5P21A 4MYUA 2GM3A 5FA8A 5EPEA 3UCEA 1PW7A 2EZ4A 5AJVB 5EJ7A 2J3LA 1SVWA 1N2HA 2FDCA 3F97A 4E2XA 1SK8A 4AG5A 3FNEA 1F8FA 2JFQA 2ZJ7A 2PV0A 1QG2A 3TDNA 3KALA 5ALKA 5EIBD 1GTVA 5G0VA 2XCIA 4GMXA 4Y9TA 5HXAA 2QY6A 4XFJA 4YECA 3VNAA 2KB0A 2G28A 2C31A 1WV0A 2IIBA 1T34A 3I2IA 4JD5A 1ZX1A 3O91A 4HWOA 5ALLA 3E82A 5BSVA 5LLDA 2H2FA 1D0IA 2C7RA 2HJRA 1M1NB 2CBXA 4YT2A 1II8B 5FNVA 5DHQA 2IY8A 3W2GA 2O48X 4F6LA 1GCUA 4PEVA 1S4QA 1U8ZA 4DKXA 3K2EA 1Q3KA 4HZGA 3WK7A 1GEGA 3UPUA 2RHGB 2IYWA 4EI2A 2Q5FA 1NF9A 5JV5A 4G5OA 1JHZA 4X95A 5I7OA 2FUNB 1DAOA 3L1VA 1JPNA 1TIKA 1U6IA 3ZVLA 2VQ3A 3ACDA 4DQDA 5EHZA 2FSFA 5IFLA 4GX5A 3BD8A 3Q87B 4W9NC 2AXEA 2PMCA 3GJSA 3UM9A 5DXJA 5BQXA 1Z0DA 3JARA 3CTPA 3NDJA 3OJ0A 5TF0A 5ICMA 4J0GA 4LNUB 3S27A 1CR2A 1E2JA 2J3MA 1ZH6A 2G1KA 3FCAA 1PTKA 1XJQA 3SKYA 1DQYA 3KR0A 1O6CA 3QUAA 1Z35A 3PS9A 4G67A 5LDGA 4IIBA 1GG5A 1PR3A 2P79A 4D02A 2PH3A 3U5TA 3N2GA 4CZ2A 3MBOA 3CNLA 1B1CA 2RAVA 5ERYA 5HM6A 2BH2A 1H2WA 4UHCA 3FDZA 1E3EA 3BH7A 1RE1A 1N1GA 3EWSA 4HQRA 1WQ4A 3D43A 3DE7X 1G17A 2O0LA 3U44B 5D2CA 3QVKA 6REQA 5FOTA 1HA3A 2NTJA 1QQ6A 3F5MA 2KM1A 4Z4QA 4ARIA 3MWEB 3H4MA 1KZ7B 4FS3A 3BA1A 3TCXB 5AQ1A 5G1PA 1PX0A 1WUIS 4O5AA 1CEQA 1JWAB 2DUJA 3B6KA 3GRKA 4RPHA 1U1DA 1BZYA 4EB3A 2ZKLA 2NSLA 1RE0A 1Z83A 1NBMD 2O8VA 4KODA 4WOBA 4DV0B 2HX1A 3IBYA 4EKEA 4LDZA 4E4RA 1BO6A 1DLIA 1LDBA 1WVGA 2Z2IA 4URVR 1I4WA 4OQEA 3FN4A 2GPJA 3PE3A 2NAFA 3SBXA 1U3DA 1UT5A 1KNQA 2A0UA 2ZIXA 3K94A 3MJFA 4M8KA 4YFYA 1G7RA 4H9GA 2A2ZA 4CI0B 5JD6A 3W1WA 1C7JA 2J09A 5K3AA 3FTCA 1CJUC 1M0WA 1JDNA 5TS3A 3BHIA 2BGJA 1KIMA 3A3NA 3R0XA 5B2EA 3DUFA 4KK4A 1GL9B 2N75A 4RKEA 3ZV6A 5L51A 2JKVA 1D8TA 1A8PA 2JZNA 4YDRA 1MOQA 2F1HA 4UBIA 3RT7A 2VSFA 5H4HA 4J49A 4RS4A 5DWQA 5AVXA 4X71A 5JANA 1AV6A 1J0BA 5CIYA 3ZTYA 2XIQA 4CCYB 4HLCA 4IGEA 4W5NA 2BFDA 4HDKB 2JLRA 5AW9A 5COAA 1X2EA 2OT3B 3DHEA 1RJFA 4OGLA 1DAFA 1YQTA 1RRMA 2G67A 3LIPA 4QRDA 2ECPA 2GAOA 2J07A 3HABA 3KYCA 4LE1A 1JP7A 2X5JO 4XQGA 5KNCA 4NJMA 2O07A 2R3SA 1B3BA 2R00C 4UNRA 1MW9X 2JLYA 3LY5A 1JZTA 5JMOA 3K73O 2TMDA 1W2HA 3QWHA 2P5SA 3GGSA 2IGTA 4YP5A 5ER6A 1AHPA 1KK3A 1VTKA 2DFNA 1QWOA 3AESA 4DJDC 3TD6A 4UNPA 1QGZA 1LS6A 3UA4A 1KKMA 3E70C 2OXTA 1P18A 3SZRA 4F2GA 1PL6A 2C8KA 3I5AA 4FJ1A 3UHAA 3SD7A 1DQPA 1PGJA 1PJ8A 1G3MA 3VPAA 4Q93A 2O2ZA 1ZGHA 1PFYA 3KVRA 1LWNA 2YFYA 1CDEA 3HFJA 1XFAA 1W9MA 3DV0A 5CUQA 1C0LA 1NWCA 3LUHA 4B1FA 3Q7PA 3WBBA 3PDUA 3BD7A 1P77A 4H6PA 3TTWA 4F4UA 4C4XA 3EF0A 1F2TA 1U8TA 1TUGA 1D03A 3I5MA 3ZH2A 4N01A 2H5IA 3D1LA 4CI9A 5IU6A 1F0PA 4FSDA 4TXHA 4OQFA 1HSZA 2C9DA 2FA9A 4LJKA 5ESDA 2GZSA 4V24A 4Z9XA 1WCIA 2QTVB 4OGKA 2C98A 5A1TA 4BCDA 2Y76A 1KO8A 4GZMA 3W6OA 1L5OA 1Q84A 3IBSA 3ZJYA 4CQLB 1GUZA 3PVCA 4DDKA 1E92A 1T6BY 1N5MA 1P4GA 3OPVA 3QRWA 4MS1A 4IWNA 4B9AA 5JUWA 1L7EA 2QUBA 2WE7A 3VR6A 4OQNA 1RZRD 3F4LA 1Q2XA 4YJFA 4Z5XA 4CR6A 1Y6RA 1GPDG 2JFZA 2WMOB 1OXUA 3H9CA 3V4FA 5JH7B 5EGNA 1CNEA 4AZTA 2ZUFA 2EDAA 4A15A 1KK1A 4F5DA 2ZJFA 4KRGA 1QZZA 4IZ6A 2A9FA 2JJ1D 2R97A 2XLCA 3T5TA 4J7AA 2GD0A 2JFPA 4DA8A 1LPMA 4DCSA 5C5CA 1UBMS 4LYHA 5TQJA 1K4YA 5LUBA 3TSCA 4QXQA 1L5YA 4MO2A 1I94B 2VJDA 2RDMA 1TVKA 3DP9A 4J43A 4YJ3B 4K1XA 4G5SA 4TXLA 5JHGB 3BE4A 2FEAA 1L5LA 2BGRA 2HB6A 2JGDB 4BB9A 1WBBA 1KE2A 1KEUA 4C4TA 2PM8A 1BTOA 3ETGA 5DBHX 3GGDA 3HVIA 4N54A 3ETDA 1NR1A 3PWKA 4H27A 3WGNA 2WHPB 1QXSA 2J9XB 1RZUA 4D0NA 3E35A 2VJAA 3K9WA 1QCZA 3TRKA 2A5JA 1TCUA 2YFQA 1Q1AA 1K86A 3T1VA 4ZCTA 3MTDA 2VBGA 1LX7A 4YHBA 2UYOA 4P2GA 3VHLB 1QFYA 2J87A 2FX2A 1XZJA 3A9WA 3IEUA 2OCLA 4X45A 4FX2A 1W94A 2CD7A 4AY3A 5ILQA 4B4KA 1A27A 3EFBA 1PJ3A 3AYZB 2HSZA 3EIQA 4YMIA 1QAMA 1CC1S 4L07A 4R40A 4CN9A 1ZOOA 2PD4A 4MWTA 1B6GA 4KUEA 1U9IA 5G1OA 2V7QA 2QAJA 3JVIA 4GZ3A 2AXPA 3BSWA 3P8ZA 4N7RA 1MENA 2JLSA 2ZUCA 2RE8A 2QA5A 2Y6VA 3ITKA 4LY3A 1XZQA 1SXJE 3IP9A 1NA5A 4ZYTA 1ZMXA 1ZCAA 1E9EA 1MUUA 5HG0A 1RYFA 3HDVA 4AP5A 5HGXA 5C32A 4ZZ0A 3JWJA 4EJSC 4F6CA 1SUWA 4B48A 2DKOA 3H2JA 1J9ZA 3M5PA 2YJNA 2XITA 1VHDA 3GI1A 4I14A 1G20B 1L5ZA 3QPWA 4R2WA 2YRWA 1DRJA 1RCTE 3O3NB 3MJTA 2VG8A 4LJLA 4TMFA 5H80A 5M3BA 2VDVE 3ZK7A 4AZVA 1TEHA 2V6GA 5IT0A 5FWXB 2IYFA 5I48A 4MUYA 4BNHA 5K8IA 3PXAA 1J24A 4G5GA 1HT2E 5F9FA 2JARA 2ZRGA 3BMQB 1QYDA 1Q0UA 3D6TB 1YR9A 5DYGA 2WYIA 2X9QA 3K4QA 4A4DA 1VL6A 3OFJA 3HL0A 2CHVA 3UAVA 3N28A 1M2VB 4B3MB 2BI7A 3UWOA 3LVQE 3HM9A 1UDAA 4JOSA 5IN4A 1ZO8A 4S3MA 1ECLA 4CLOA 2XOKD 1G9SA 4U7GA 1Z4PX 2RG7A 5TDHA 4IDNA 4G5HA 2IJGX 3DAGA 4DUGD 1MO5A 5ITZB 4O4IB 3WFJA 2ZXEA 1ZJJA 2FSUA 1KC3A 2Q5EA 4FFDA 2PIDA 5JBQA 4I4TB 3ICEA 1TT7A 2MSWA 3URKA 4EDHA 2HWWA 2GXQA 3Q40A 4PIPA 5ES3A 2IS6A 3F7OA 3FSGA 3LOUA 4L57A 4QNMA 2GBLC 2PUEA 3RBAA 3UMYA 2G6TA 4OQPA 2ISCA 1RYYA 1T2AA 2FPIB 1WLYA 2J0UB 3M2PA 1X7DA 3DKIA 1PT7A 3EXHC 5IJ0B 2YJZA 3UJPA 1VOTA 3NBXX 3P9NA 2PMFA 1UINA 1MJFA 1ZM2A 2FGJA 3AF0A 1OQAA 3CW8X 4LA4A 1QJCA 4OGFA 5FKJA 1GSHA 5BW5A 2CFCA 3ORHA 1V11B 1I5RA 3CRVA 3JR7A 4OVKA 4CMIA 1GTL1 3JWEA 2WT8A 5ECDA 1HQKA 1WQ1R 3CKKA 4WAUA 2V9PA 1OAAA 1X1SA 1FVHA 2C2BA 5ENVA 4MHSA 4HJXA 1YZLA 4BFTA 4DUYB 5BQFA 1LPSA 4DQVA 3ELUA 3RABA 1SU8A 5L3SB 2QVLA 4GXTA 1IEWA 1BGXT 1GPLA 2ID4A 2PL1A 3BGOS 2HA2A 4PPGA 5ELMA 4BWFB 1PVDA 1L5NA 1HTTA 1N78A 1IL0A 3F6CA 1M54A 3HBLA 4FOTA 4RDHA 3OEYA 1MV8A 3PFKA 4Y2JA 4B6OA 4XPIB 4BC0A 3W5BA 5JAQA 3HJRA 1PQPA 1YAHA 2BHSA 1O9HA 1L5FA 2J30A 3M4JA 1P2UA 2P9GA 4ZI7F 4FNMA 1EFUA 3EDOA 4Z3KA 3AF6A 1G64A 1VKRA 1E9SA 2CXOA 4K0RA 1U4SA 1JAHA 2IXBA 2XWJI 3VTZA 3ND7A 2H1LA 2F9FA 4CT5A 5KC8A 5F1YA 4JI7B 1UKAA 3ZCQA 3O8LA 2JI4A 3N7TA 5CYFA 2IZ0A 4IQ0A 1AMUA 4MLZA 3UUWA 5BRAA 5JSZB 4FT2A 4JQZA 4DIKA 1A7KA 2P4QA 1NUHA 2C5LA 3FUCA 4EF4A 3H3XA 1GITA 3C3WA 5DW0A 4J16C 4XYGA 3L8CA 3K9GA 2ZVPX 2BEVA 1T4BA 3LQYA 2VWPA 4DB2A 4HH3C 1DDIA 5C0OE 2KMLA 2UUBB 1MNAA 4ZOBA 1I4LD 1XTZA 3ID6C 4LYYA 2CNWD 2H17A 3HRIA 3HVHA 4U0KA 4CM5A 2VQEB 1JR6A 4MVXA 3T3NA 3CB4A 3MWJA 1ULSA 1Z47A 3VGJA 3A27A 2DUUA 2XEXA 3TPCA 3N7UA 1S8OA 3E22B 4R9NA 3GLGA 3K15A 1JBKA 1MC5A 4F38A 1Y98A 4NYIR 2QGNA 4HNHA 1ZNWA 3U9TA 2F1KA 2O5EA 3BREA 3SJ7A 1H1LA 5HIMA 4DSZA 3UGTA 3R24A 4QPNA 3TKAA 4RY2A 3SJAA 2QMQA 2AX4A 2ZYWX 1MB4A 3FWYA 3K9CA 1TJYA 3KOOA 4JX9A 1RXSA 4OIMA 2ZU6A 4RF3A 3R7NA 2E55A 2YASA 2LV8A 1Y5MA 2XZPA 3JXEA 3UMMA 3MBKA 4GR9A 1ZHHA 5DGXA 4ZAWA 2VKQA 3DC2A 4B31A 3CZPA 5FUMA 4B4UA 3LW7A 4OF4A 4E2YA 4YC7A 3OY2A 5JOQA 4D9NA 1RHJA 3FROA 2H52A 4NMXB 3LPMA 5TQ0B 1DTEA 5C5EA 1XCGB 5CNJA 4FUQA 3QP9A 4DC0A 5FYDA 4RE6A 5DVZA 1JFVA 1DXQA 1OA1A 3AR6A 5BT9A 1W93A 1VYUA 4AXXA 4ZGGA 1CUHA 1GAWA 3HXKA 3KV1A 5LBTA 4C6TA 2WVAA 2YIDA 3D4LA 4Z2AA 3TNFA 1BJRE 4ILKA 4TM7A 3Q4GA 3GLIE 3CVWA 3OJWA 3RAJA 2VHEA 3A4MA 3WGLA 3SVZA 2DHRA 2HA3A 2DGDA 4UDNA 5T41A 3HSSA 4BP8A 1MQ9A 4A8TA 1R0RE 2GHTA 5C8ZA 4O4HB 1DRVA 3UAZA 3KTDA 4KACA 2OL4A 3RB8A 1OROA 4OQQA 1OVMA 4ZVLA 5IZ4A 2P4SA 2MYUA 3I1FA 4N0QA 4Z1OA 1PG2A 2B3TA 3BFKA 2IHNA 5SZJA 1I6WA 1XWWA 3TS1A 3I34X 3IAHA 1TOAA 2R9VA 4OI4A 1RSZA 5AVTA 2C3UA 4IGIA 4MRNA 3SR0A 1VHQA 2QM3A 3CKYA 4DW8A 4OJTA 3NWOA 3C70A 2Y8EA 2HNAA 4HWGA 1AGYA 3TQOA 1ENYA 3X2FA 4ETMA 5KJFA 1XMVA 2C4UA 2NACA 4EB0A 2B9VA 2RAUA 2OTCA 1R0ZA 2XR1A 2TMGA 3NRCA 1KYXA 2OA0A 2JVKA 1KXJA 2NU7B 2B94A 3E05A 3L8GA 3I6QA 3QBDA 4MXDA 2VHVA 5E3JA 1QHIA 4AWBA 1DV2A 2BN4A 2VTDA 2A88A 2WB2A 2PX2A 1XVLA 3L41A 1X87A 3WGVA 3K9BA 3FG9A 2FOIA 3MJSA 5IBRA 3JTMA 1YS9A 4KO8A 5HKBA 4LE0A 4WZBB 4PGHA 3DMFA 2DYKA 1PNRA 1DRWA 3L6BA 3MUFA 5FORA 4CIAA 2O0HA 3B1XA 2F4VB 1U7XA 1SPBS 1IULA 2B2CA 2JFUA 3KQMA 1V96A 4IYJA 4BUZA 2I7XA 4FYHA 2VUSA 1VDZA 2GHIA 3OFND 3G68A 2EBFX 3P0EA 3QEJA 4INOA 4US2R 5LOVF 2ZI4A 5AXAA 4IEFB 2PLAA 4YT4A 5EL0A 1UBHS 1X80B 4E11A 2CZCA 2ZRBA 2RHLA 3H5OA 1FEZA 2WSSD 1ZI8A 3MYRA 4JLUA 4KC0A 1EX9A 5FJJA 3ADOA 2R25B 5BV7A 1AGPA 3TQRA 1RYDA 1KJ8A 2B5WA 4B3CA 3KJEA 1P5FA 4V38A 1W6UA 3FWKA 4JR1A 3KK0A 1M1ZA 1SQ6A 4X6LA 4LYJA 3DFUA 4TRNA 3A9CA 1QG0A 1WMSA 1LZLA 4YS6A 2V54A 1AV7A 3KSMA 2B30A 3B3GA 2E4VA 2IA5A 3VYSB 1M0EA 4I4CA 1KR2A 5TQ2A 5C8YF 3JD4A 2RHBA 4OBBA 4CGZA 4X93A 4P0TA 4BLUA 1XC7A 5B4VA 4F56A 2C92A 1E5VA 3MRTA 1V8OA 5JJKA 3NHPA 3KJHA 3OQ1A 2FSHA 4HL6A 5DYYA 2YN4A 3HCAA 2AG6A 3LGAA 1QLJA 2O3JA 3A6GA 1DAGA 4KI0A 3I62A 2BHRA 1C1XB 2P8SA 3N7AA 3OEHD 2Z6QA 5I9TA 4POOA 2DXIA 2YQ4A 2HL6A 3A14A 1M5UA 3IJEB 3HU2A 1GV1A 3MOIA 1H6AA 2X3YA 2VA9A 5KVAA 1Z4NA 1GPBA 1UPXA 2V3WA 3OOSA 4KQWA 4RX1A 2NUAB 3WJ1A 1G3UA 1HNNA 1WDWB 2R8ZA 4KXMA 1XCJA 3FJOA 4JYMA 4DLXA 5EFOA 3KLNA 4R83A 4ZIRB 1GKYA 2Q41A 5BSTA 3VPCA 4BGUA 4CIYA 1H4QA 3KR1A 3O2SB 4MI1A 3TTXA 3V2GA 5L7WA 4RTOA 2O59A 1ADYA 1SUSA 4NJEB 2YWEA 4HYEA 5A6SB 2C4TA 2IYNA 2R1TB 5LQCA 5FOSA 1DC4A 4OHXA 2PGNA 4N12A 4WN3A 3D4PA 4W6QA 1S6YA 2P7HA 4LXQA 1FFXB 5CHEA 5K3BA 3UXHA 2J3HA 4JGGA 1JEAA 4UUBA 5EESA 2IEBA 4ARZA 1J2YA 3NV7A 5AFSA 4LZOA 2JI8A 4J1NA 4KAJA 5HFJA 2ZYVX 3ZYCA 4D9BA 4EHIA 5BV2P 1KSGA 1WU8A 2VDMB 4TRMA 3F5FA 4HQ6A 5HA5A 2JANA 1NXOA 3AONB 1S2MA 1G42A 1Y7PA 4WZAA 1FE8A 2ZQZA 3QF4A 3R5HA 3SJUA 2CB0A 4AKSA 4EBFA 3ZE8A 5CB0A 3T1YB 5TIIA 2Y1WA 3CO5A 4I1PA 2DWQA 3TLKA 3EDMA 3QX8A 4RH1A 3FCSB 4NMMA 4A16A 4DC9A 3ETJA 3PUIA 4FYIA 3VZBA 2B83A 1EXNA 3RBXA 3UPTA 1M66A 4ALKA 3P9PA 1MD9A 3LRPA 1EYZA 3H2GA 3IVRA 4ZC1A 3RS4A 2A1UA 4JEMA 5A6VA 1Z3IX 4M1ZA 4KXQA 4IIJA 2C2GA 4RIEA 3W8FA 2FR1A 1C7IA 4DIDA 4TN1A 4BQRA 2HLDD 4H0CA 1GZ3A 1HE4A 3JQ9A 4OHCA 1PJBA 4M3NA 4QWMA 2I62A 3LLMA 4ZV9A 3PE6A 2HRCA 2BKLA 1R16A 2J7KA 3UAYA 3CR7A 4YFVA 4NK4A 2H5LA 2O8EA 1QDEA 2H6EA 1WVIA 5DPMA 3SR4A 1S4MA 4R7TA 2XDAA 4WHMA 2DE0X 3DNMA 3D4IA 1NULA 2UVPA 3DMYA 4GM4A 4YAOA 3TDKA 4DKJA 4PSUA 3IMEA 3VOBA 1E2MA 4L5BA 4Z3DA 4NZ9A 3QOXA 1YDMA 2EQ5A 3EJWA 3G59A 2I6TA 3NHSA 4RMHA 1DBVO 2R7MA 1YULA 3GBVA 1FNCA 2B0CA 4K3UA 1ZRNA 4EY7A 2YW2A 1NBHA 2MR6A 4IUYA 3BKXA 1JLKA 1V4VA 5DW3A 3ZR4B 4KTVE 3PUJA 2WU4A 5F73A 1NVXQ 3H1PA 4UBNA 2YHBA 3LOQA 3SNKA 4DDHA 3TTVA 4CHGA 2VQFB 4OUDA 2P2GA 3QPVA 2JVJA 1SC1A 5EXSA 5JT1A 1Z3CA 4G37A 1E1RD 1Q0QA 2XUOA 2XDQA 3K8ZA 5KTMA 5JXGA 5IZCA 2FV8A 1PWHA 3Q85A 4XB6B 5GJBA 2I0FA 4E07A 1J00A 1XZCA 2AKEA 1FUEA 1RXIA 3D5TA 4DUPA 1NHWA 3DB2A 2AN9A 5DK6A 1OR8A 4JQSA 5AHOA 2O6LA 13PKA 2B3DA 1OIWA 1X3LA 1GFIA 1XTPA 2DWPA 2Q0QA 5EZSA 1DELA 3SF8B 1A4IA 4KE9A 5DHTA 1OX5A 1YGPA 4ZZ3A 4RUKA 3B89A 4U9HS 5I8ZA 5HF5A 3WLFA 4BMPB 3OWXA 2JVIA 2CXHA 3FSRA 4ILEA 5DBFA 2IYPA 1HTWA 4ZQHA 3SQLA 3TJMA 3AHHA 1YH3A 4ZJPA 1TB4A 2FYTA 2OORA 3U7QB 3HYNA 1FFDA 1EUDB 1NHGA 2YS7A 3MMSA 2BEWB 3MTAA 4ZEXA 1VZ2A 1BHO1 1UOPA 1YNOA 3ENQA 2HFKA 3EYAA 1C0IA 5T5QA 4MPJA 2I6FA 2OLJA 2VUHB 2NO0A 1ZSYA 3PWTA 1WP9A 5COQA 1Z5OA 1GGHA 1I7PA 3B60A 3HJBA 2FQWA 3ET5A 2HLHA 1O97C 2HGSA 3HY6A 3OHMA 3WQRA 2VF4X 3H11A 4GMHA 1PBTA 4HTFB 4N1AA 4PXYA 3IBTA 5E8RA 4H7IA 5MDHA 2V5VA 3WZMA 3CT4A 1MIOA 4NKRA 4FYJA 5AI6A 4G9BA 1OB2A 3X2EA 2YV3A 4KVGA 3VDRA 4LXYA 3SLRA 3BWVA 3GLSA 2WAYA 5EZYA 4AROA 2G63A 3OM1A 1GRQA 2C2WA 3LUAA 4DSOA 2QBYA 3U7EB 3NJRA 3KU1A 1H6CA 2UXBB 1GQRA 4FVTA 1KRXA 1BC5A 5H7XA 4YCLA 3I9V1 5H3LA 1K06A 3ETEA 4HS4A 1IVNA 1N57A 5ICEA 4FGSA 4I19A 2DR2A 2NP6A 3CZCA 4Q7MB 2X22A 3EXFA 4KYUA 4GOJA 2IQIA 4CG2A 4RKFA 1QF7A 4BPBA 4O1HA 3VR2A 1I8TA 2V45A 4NYJQ 3ZXXA 1QQBA 4TTQA 4BC1A 3QW4B 4P0PB 4ZCSA 4CM7A 2H06A 4XWOA 1CUJA 1PFKA 5BPHA 2H1WA 1IHXA 3E81A 4PM4A 2J5KA 3QNMA 2ZRFA 5HTKA 3ASZA 1RJ9B 1HY3A 1A98A 1W6RA 2D0OB 4IAOA 3C8ZA 3WNBA 4OOEA 4YA6A 4EECA 2JLXA 1FX0B 1VG8A 1A7JA 1CJVC 3JZAA 3RVJA 3N05A 3WYBA 1GL3A 1XCBA 1UDWA 1Y8RA 1S3SA 4TMXA 3NTLA 4EZEA 1KH2A 2P9YA 3FCYA 5F35A 3KEMA 2ZM6B 4G8JA 2BM1A 4BJ5A 3C6KA 3LKDA 3IAAA 1J5XA 4GX1A 4DREA 4GX0A 5KAPA 2R85A 4LDNA 3TSZA 4TSFD 1M8PA 3W34A 3K09C 2G1UA 4PLGA 4N6OA 1P9NA 4ENTA 4KQGA 1Y4ZA 4FBLA 3Q8KA 2HN9A 3T9AA 3HXLA 4ZAYA 2P91A 4OATA 4RPKA 4ZZIA 1DQSA 2YXEA 1KSJA 4JUAA 3P4YA 1TK3A 3N70A 4EJFA 1XF9A 2OYCA 4F7WA 4E3ZA 1MB9A 2GO1A 3D6JA 2XVXA 2YWRA 1EZ1A 1O96A 2WSBA 2XYPA 1H2HA 2CWWA 4G0QA 2QK4A 4JYPA 4PBSA 1SXJB 3LQRA 1RFGE 5AOCA 4M49A 2FPPA 4QDOA 3R9WA 2G83A 4EQ6B 1L5HA 1JRLA 1WS6A 2D0DA 2GFQA 3OOEA 1WW8A 4MVJG 3HZOA 3BC1A 4EMSA 2AMLA 2GBGA 2F1IA 3SBOA 4GKKB 1XP5A 4IRUB 4G1EB 4RVUA 4TWJA 4HMQA 3TEJA 2G4VA 2WZBA 2V6JA 3V4SA 5IW8A 1LSUA 4UXIA 4C7JA 5FPYA 1DIBA 2PH1A 1OH7A 4RA6A 2XRFA 3I73A 1UJ6A 5ED4A 1JIJA 2CHUA 2WJHA 3UFBA 4ND3A 3VFDA 2ZREA 1NNSA 4C76A 1QGAA 3FD8A 2JFBA 3CISA 4XLTA 5BOVA 2V7XA 3LW8A 4D9MA 1DKRA 5JMWA 1C3OA 5A5VA 1HLFA 4HYTA 3EMDA 4Q12A 5LC1A 1P0CA 1OCEA 1V6CA 3ITEA 4R8RA 4RPJA 3RRZA 1L8LA 4KUHA 1G2QA 1L4NA 2BV3A 2AN4A 3HSYA 3JATA 5ALFA 3M3DA 2ZE5A 1YKSA 3CN9A 2QTTA 3NC4A 3OEED 2WYHA 4OB7A 1UF9A 2P69A 1QP4A 3RC2A 3Q5EA 2WLSA 4CBVA 3LG2A 1FYEA 4EG0A 1LDYA 1AC5A 2JD2A 2OILA 1OTYA 2PLFA 1E2GA 3K0FB 4FKZA 4KIGA 1ZUNA 5CT6A 3SYTA 1SVLA 1E7RA 1P8JA 2Z9DA 4KLCA 2WU8A 3S2ZA 3WGQA 4H7KA 4BNYA 4DNOA 3KM0A 4TMTA 2GPYA 5HKKA 1TQDA 4G5FA 3GQBA 3I76A 3EXIB 4UMFA 1IJEA 5FLKA 4A27A 4F4FA 4YP7A 2WWIA 3V1YA 1YSCA 2FRDC 2QAGA 2ZZKA 5DGTA 1R6DA 4BB0A 4EHKA 3RRBA 2XZDA 3IH5A 1L7PA 1V48A 4R8KA 5HE8A 3WKAA 3X1WA 1EIZA 3AEYA 5BVGB 3G49A 4AS1A 1QG6A 2VP3A 3KL4A 2FQXA 4JLJA 2XUJA 4X97A 3RQSA 2PR2A 5JAOA 1CUSA 1TPYA 1VMKA 1WR8A 2YZ7A 2XBUA 4TKVB 4KR9A 2RKOA 2ORIA 1IOVA 2PD6A 3UT5A 4PLWA 3ZIAA 5GJCA 1R1DA 2FR8C 2ONYA 4WCVA 121PA 2WICA 4JCOA 4KXVA 2PJRA 1X38A 2F90A 4QOHA 3QOYA 4RCVA 3ZY2A 3WOHA 4BNDB 2ATVA 3LVFO 4GMDA 5TMDA 4ESEA 1ZR2A 3VGPA 2D1YA 4U39A 3R3YA 3W2HA 4AZ0A 4OJQA 5KJ6A 4URFA 5CFPA 1N2GA 5JG7A 2I8CA 4JP3A 4D4JA 3O1LA 4I8XA 1ACJA 1GTG1 1L6RA 2HD4A 1TKRA 2PMWB 4GWGA 4EFNA 5HVNA 3ADCA 3CRZA 1ZKMA 3AI1A 4HGYA 3RDPA 2P9CA 4KMMA 4LSMA 2ICAA 5JS6A 1JG2A 5GOZA 1JLMA 3WJ2A 3HHEA 4OHYA 3GOHA 3HLKA 1G16A 2HRZA 1ORHA 2C3PA 2YNMC 5ED0A 5I9SA 1EMDA 4R2MA 4DABA 2L18A 3SJBA 1AUQA 3F3YA 4ZEVA 5CG1A 3VNBA 3AKEA 2G08A 4DDWA 3ZWQA 4P82A 4CV2A 3EZNA 2VPTA 3T7JA 2IT1A 1S8FA 2SBTA 3HXPA 1GT6A 5E8JA 3LC1O 3C8MA 2IH5A 2C2ZA 2J8ZA 1DCMA 1EDEA 2QTGA 3QHQA 3RAGA 3DBIA 4GXNA 1KEEB 2XYHA 4HN4B 3R7WB 4IDFA 4B45A 4HDSB 1Z33A 4MUIA 2F1RA 3O7WA 4AYTA 2ZSIA 4NBRA 3BF8A 5HZKA 3Q9UA 4MX8A 1NQAO 4XQCA 5EVCA 3IO3A 5BNTA 3NAMA 3HV2A 2BZSA 1G19A 3CKLA 3L4SO 3NETA 1GGNA 1EX7A 2E82A 3OPYI 4TSKA 4JI1B 4DJFC 1R0SA 5AW8A 1NFQA 1W35A 2X9LA 5BMOA 3EIFA 2B8NA 3I6BA 1RLTA 5A7FA 3NHJA 4X91A 1ISSA 4EKYA 3NIBA 3MF4A 3GX1A 3ZGNA 4LBZA 1USUA 4MMZB 3T4XA 4A0FA 3PRKE 4TVSA 2JLZA 2JIQA 3JQBC 5IN5A 2HSWA 2P4EA 3NM6B 4L16A 2Q7XA 1QHXA 4L6AA 1OI4A 4DOMA 1RM3A 3P71T 5FNVB 1ZG3A 2WV7A 4OBEA 2NP7A 4JXKA 3W3AA 4NDZA 2B4RO 2UZAA 5AKHA 3WO0A 4IS3A 1UZUA 4GGOA 5EI5A 3CS3A 3IS3A 2Y9MB 2ZS9A 2JIZD 5DU2A 3UZUA 4XAQA 4QECA 3DZBA 2F4NA 3D6NB 3CGGA 4J0QA 4DHEA 2WWHA 4DSNA 2EJTA 2C77A 3ZVNA 4U0JA 2IGBA 3WISA 2QYTA 3KSRA 5AW1A 1L7BA 3X1JA 2ZR9A 3M6WA 2W2VA 1X6VA 2QSZA 4FCCA 3ZK9A 3JARB 1Q77A 3PXXA 2GM4A 1X3SA 3E1KA 1WEKA 1XNHA 5A03A 2W93A 1Z08A 4IP0A 1QOZA 3N8HA 1X14A 3INTA 5DGIA 4GM0A 1KF0A 3COSA 4R5MA 1AF4A 3FDFA 1JSRA 4M83A 3S55A 3N2GB 2BSAA 2ZTLA 1FNNA 2PEYA 2XKAA 3G0BA 5EKUA 3FDZB 3H2HA 1H5QA 4PONA 4BLOA 1BXZA 4CDRA 1NN0A 1UMCA 3BSSA 1JI3A 2JS7A 2I3BA 3DA8A 6REQB 4FZ5A 3HJNA 3H18A 2ZTUA 5HHTA 3BWEA 2ZAOA 1Z2NX 3PC4A 3G17A 1O57A 4J4TA 4RZXA 4DTCA 5K7SA 3CT6A 3PGKA 3L1JA 4PPQA 3TQIA 4ZOAA 3BJEA 3HR8A 2ZKIA 3VR6H 2ZIVB 4I7EA 4XDZA 4IW3B 5FWNA 3N75A 3P0FA 2ZDHA 4KREA 3TM5A 1FNBA 1Z15A 2QRKA 4NI5A 4E2WA 1CY0A 1EK5A 1N92A 4CF3A 2Q3BA 1H8EA 2LKCA 4Q00A 5CDHA 1T1EA 1E4YA 2ZSBA 4I08A 2Z09A 3VKHA 4BNWA 5AI4A 4AKTA 5JZBA 1SCNE 4Z7OB 2RIPA 3E03A 2AOTB 3DXYA 2K6GA 1I3NA 2O2IA 1IXKA 1T1JA 1IJBA 2F3TA 4J3FA 3ZGOA 1QCDA 2GTPA 2O7VA 5I9BA 4GUAA 5DIFA 4JDUA 4DJTA 3BORA 3IUMA 3NTQA <