4NN7A

Cytokine receptor complex - crystal form 2
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
121
structure length
108
Chain Sequence
YNFSNCNFTSITKIYCNIIFHDLTGDLKGAKFEQIEDCESKPACLLKIEYYTLNPIPGCPSLPDKTFARRTREALNDHCPGYPEVQNICLQQTSQILRLWYSFMQSPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the proinflammatory signaling complex mediated by TSLP.
pubmed doi rcsb
molecule keywords Thymic stromal lymphopoietin
molecule tags Cytokine/cytokine receptor
source organism Mus musculus
total genus 39
structure length 108
sequence length 121
ec nomenclature
pdb deposition date 2013-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF15216 TSLP Thymic stromal lymphopoietin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.90 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 4nn7A00
4NN6A 4NN5A 4NN7A
chains in the Genus database with same CATH superfamily
1AU1A 3PIVA 4I77Z 4U4TA 4APSA 3WDOA 4ZF7A 1Y6ML 4LEPA 3S9DA 2E9WC 1BBNA 2ERJD 3UEZE 4YBQA 4LDSA 4X51A 4IKVA 5KNHI 4A3KD 1RFBA 5C4XD 4GBZA 3D48P 3UF5A 3DLQI 4A3ED 5C65A 1PY2A 3SE3B 4W6VA 2R7ZD 3B5KA 4GC0A 3EJJA 1P9MB 4O9HA 1EVSA 5D71A 2XUTA 4BY1D 4IKXA 5IP7D 4GBYA 3NCEA 3QWRB 1F6FA 4NN7A 3EW3A 5EQIA 3QB7A 3HOZD 3NCFA 3BPLA 4Q65A 1BP3A 1CSGA 4A3JD 4TPJA 4NI9A 2B90A 4YB9D 1HWHA 4IKZA 1HIJA 1KF9A 4UVMA 3SE4B 1J7VL 5TS9A 2VUMD 1ITMA 4CNIC 1NBPA 5FUCA 4BXXD 1D9GA 1EKUA 4IU9A 4YUEC 4NEJA 2PSMA 2IL6A 3BESL 2B8XA 1SCFA 5D58A 4IKYA 1F45B 4O6KA 4ZS7A 1VLKA 1BGDA 4A3CD 3HOXD 3PO2D 4GS7A 4D2DA 1EMRA 2B91A 4Z5RD 1INRA 1Y6NL 4D2BA 1WCMD 3INKC 1HIKA 3I4MD 3QAZA 1V7NV 1PGRA 5FLMD 2V8NA 1BGEA 1AX8A 4A93D 1PVHB 2D48A 3HOWD 2Q98A 3DI3A 2GMFA 2O26A 3QB1A 2JA6D 3DGCL 4YDYI 3IRHA 1RHGA 4NN5A 1Z7CA 1FG9A 3H3VE 2L3YA 4DOHA 3BPNA 1ETEA 5A2OA 3TGXB 2XQBA 2L3OA 5D59A 4U4VA 1I1RB 5L6YC 4EXNA 5D6KA 3FKID 1ITIA 3G9VB 1A7MA 4TPHA 1FYHA 3AYHA 5EQGA 5EQHA 2B5IA 2Q14A 3DUHC 1WU3I 4D2CA 1M4CA 5C3ED 2LMSA 1YKBA 1CNT1 4A3MD 4PS4A 3G6DA 5LQBA 4XNIA 1RCBA 1Y1WD 1QVNA 4IKWA 3HHCA 1AXIA 1RW5A 4U4WA 4DKCA 3VA2A 3DI2A 3WCYI 2Y5YA 5GXBA 2KZ1A 1CN4C 4OH3A 1JLIA 5IP9D 2JA5D 1HWGA 3I4ND 2CFQA 1M47A 4FA8E 3LB6A 4GRWA 2HYMB 5D22A 4A3LD 2CFPA 4QIQA 5D70A 4ZW9A 3N06A 3HOUD 2Z3RA 1IRLA 2B8UA 1IK0A 4NEMA 3HMXB 3PIWA 3N0PA 4JA3A 2B63D 1ITLA 1CD9A 4BY7D 4MHLA 1EXZA 1M4BA 1Y1VD 3L5WI 2B8YA 1PW4A 3H0GD 4DKDA 4NKQC 1V7MV 4IU8A 4NN6A 4ZYRA 3D85C 5FHXA 1LQSL 2OQPA 1ILKA 4A3DD 1PV6A 4DKEA 4JR9A 3BPOA 1HULA 2O27A 2JA7D 3MZGA 2R93D 4PYPA 1M4RA 3PO3D 5E4EA 1ALUA 1LKIA 4J05A 3OG6A 3UF2A 5IYBD 4XNJA 2H24A 3NCBA 1LK3A 4YQXA 1M48A 2ILKA 4A3ID 4EXPA 5C7XA 3QT2C 1IJZA 1IL6A 1HUWA 1ITFA 3D87A 1HGUA 1GNCA 1M4AA 3O7QA 4LRLA 5D28B 4WRLB 3NCCA 2Q7NB 2R92D 1PV7A 3LB6B 3HOVD 1GA3A 2Z3QA 1M49A 4DKFA 1D9CA 2LAGA 4BBSD 2JA8D 1BCNA 1CYLA 1B5LA 4NI7A 3OG4A 3NPZA 1IARA 1HZIA 2INTA 4JREA 1BGCA 5IYCD 1EERA 2CYKA 1N1FA 5A2NA 3OQ3A 4A3BD 3HHRA 2C35A 4YPGC 4BBRD 5IYDD 3HOYD 4RS1A 2D9QA 3UX9A 3O7PA 1PW6A 1Y6KL 4A3GD 3Q1SI 5D72A 2B8ZA 4J4LC 4TPGA 4OAAA 5C44D 4A3FD 1BUYA 4ZWCA 1Y14A 3L5XA 1A22A 1Z92A 4ZWBA 2O6IA
chains in the Genus database with same CATH topology
4BXXD 1D9GA 1EKUA 3G6DA 1AU1A 1M4RA 3PIVA 5LQBA 1RCBA 1Y1WD 4YUEC 1QVNA 3PO3D 3HHCA 5E4EA 1AXIA 4NEJA 1ALUA 1RW5A 2IL6A 2PSMA 4I77Z 3BESL 1LKIA 3OG6A 2B8XA 3UF2A 1SCFA 4ZF7A 4DKCA 5IYBD 1F45B 3VA2A 4O6KA 4ZS7A 1Y6ML 1VLKA 2H24A 1BGDA 3DI2A 3NCBA 3HOXD 4A3CD 1LK3A 4YQXA 3WCYI 3PO2D 4GS7A 3S9DA 2KZ1A 1EMRA 2B91A 1CN4C 4Z5RD 1M48A 2E9WC 1INRA 1BBNA 1Y6NL 2ILKA 4A3ID 2ERJD 1JLIA 3UEZE 4EXPA 1WCMD 5IP9D 3INKC 2JA5D 4X51A 5C7XA 1HIKA 1HWGA 3I4MD 5KNHI 3I4ND 3QAZA 1V7NV 3QT2C 1PGRA 4A3KD 1IJZA 1RFBA 5C4XD 5FLMD 1IL6A 1HUWA 1M47A 1ITFA 3D48P 3D87A 4FA8E 3UF5A 1BGEA 3DLQI 1HGUA 4A3ED 1PY2A 3SE3B 3LB6A 4GRWA 2R7ZD 2HYMB 1GNCA 5D22A 4A3LD 1AX8A 4A93D 1PVHB 1M4AA 5D70A 4A3MD 4LRLA 5D28B 2D48A 3N06A 3HOWD 4WRLB 3HOUD 3NCCA 2Z3RA 2Q7NB 2Q98A 3DI3A 3B5KA 1IRLA 2B8UA 2R92D 2GMFA 2O26A 3LB6B 3QB1A 1IK0A 2JA6D 3HOVD 3DGCL 4YDYI 1GA3A 2Z3QA 3EJJA 3IRHA 1M49A 4NEMA 1RHGA 3HMXB 1P9MB 1D9CA 3PIWA 4NN5A 4DKFA 2LAGA 4O9HA 3N0PA 4BBSD 2JA8D 1Z7CA 1BCNA 1EVSA 1FG9A 1B5LA 4NI7A 3OG4A 3H3VE 2L3YA 4DOHA 1CYLA 3BPNA 2B63D 1ITLA 1ETEA 1CD9A 3NPZA 3TGXB 4BY7D 5D71A 4MHLA 1IARA 1HZIA 2XQBA 1EXZA 1M4BA 1Y1VD 3L5WI 2INTA 2L3OA 1BGCA 4BY1D 5IYCD 5IP7D 2B8YA 1EERA 2CYKA 3H0GD 1N1FA 3NCEA 3QWRB 4DKDA 1F6FA 1I1RB 4NN7A 5L6YC 3EW3A 3OQ3A 4A3BD 3QB7A 3HHRA 4NKQC 4EXNA 1V7MV 3HOZD 4NN6A 3FKID 2C35A 3NCFA 3BPLA 1ITIA 3G9VB 1A7MA 4YPGC 4BBRD 5IYDD 3HOYD 4RS1A 1BP3A 3D85C 5FHXA 1CSGA 2D9QA 1LQSL 3UX9A 1PW6A 2OQPA 4A3JD 1FYHA 1ILKA 1Y6KL 4A3GD 3Q1SI 4A3DD 3AYHA 4NI9A 5D72A 2B90A 4DKEA 2B8ZA 1HWHA 4J4LC 2B5IA 1HIJA 1KF9A 3SE4B 2Q14A 1J7VL 3BPOA 5C44D 3DUHC 5TS9A 1HULA 2O27A 1WU3I 2JA7D 1M4CA 2VUMD 4A3FD 5C3ED 1BUYA 2LMSA 1YKBA 3MZGA 1ITMA 1Y14A 1A22A 1Z92A 3L5XA 1NBPA 4CNIC 2R93D 1CNT1 5FUCA 2O6IA 4PS4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NN6 A;  4NN5 A;  4NN7 A; 
#chains in the Genus database with same CATH topology
 1AU1 A;  3PIV A;  4I77 Z;  4U4T A;  4APS A;  3WDO A;  4ZF7 A;  1Y6M L;  4LEP A;  3S9D A;  2E9W C;  1BBN A;  2ERJ D;  3UEZ E;  4YBQ A;  4LDS A;  4X51 A;  4IKV A;  5KNH I;  4A3K D;  1RFB A;  5C4X D;  4GBZ A;  3D48 P;  3UF5 A;  3DLQ I;  4A3E D;  5C65 A;  1PY2 A;  3SE3 B;  4W6V A;  2R7Z D;  3B5K A;  4GC0 A;  3EJJ A;  1P9M B;  4O9H A;  1EVS A;  5D71 A;  2XUT A;  4BY1 D;  4IKX A;  5IP7 D;  4GBY A;  3NCE A;  3QWR B;  1F6F A;  4NN7 A;  3EW3 A;  5EQI A;  3QB7 A;  3HOZ D;  3NCF A;  3BPL A;  4Q65 A;  1BP3 A;  1CSG A;  4A3J D;  4TPJ A;  4NI9 A;  2B90 A;  4YB9 D;  1HWH A;  4IKZ A;  1HIJ A;  1KF9 A;  4UVM A;  3SE4 B;  1J7V L;  5TS9 A;  2VUM D;  1ITM A;  4CNI C;  1NBP A;  5FUC A;  4BXX D;  1D9G A;  1EKU A;  4IU9 A;  4YUE C;  4NEJ A;  2PSM A;  2IL6 A;  3BES L;  2B8X A;  1SCF A;  5D58 A;  4IKY A;  1F45 B;  4O6K A;  4ZS7 A;  1VLK A;  1BGD A;  4A3C D;  3HOX D;  3PO2 D;  4GS7 A;  4D2D A;  1EMR A;  2B91 A;  4Z5R D;  1INR A;  1Y6N L;  4D2B A;  1WCM D;  3INK C;  1HIK A;  3I4M D;  3QAZ A;  1V7N V;  1PGR A;  5FLM D;  2V8N A;  1BGE A;  1AX8 A;  4A93 D;  1PVH B;  2D48 A;  3HOW D;  2Q98 A;  3DI3 A;  2GMF A;  2O26 A;  3QB1 A;  2JA6 D;  3DGC L;  4YDY I;  3IRH A;  1RHG A;  4NN5 A;  1Z7C A;  1FG9 A;  3H3V E;  2L3Y A;  4DOH A;  3BPN A;  1ETE A;  5A2O A;  3TGX B;  2XQB A;  2L3O A;  5D59 A;  4U4V A;  1I1R B;  5L6Y C;  4EXN A;  5D6K A;  3FKI D;  1ITI A;  3G9V B;  1A7M A;  4TPH A;  1FYH A;  3AYH A;  5EQG A;  5EQH A;  2B5I A;  2Q14 A;  3DUH C;  1WU3 I;  4D2C A;  1M4C A;  5C3E D;  2LMS A;  1YKB A;  1CNT 1;  4A3M D;  4PS4 A;  3G6D A;  5LQB A;  4XNI A;  1RCB A;  1Y1W D;  1QVN A;  4IKW A;  3HHC A;  1AXI A;  1RW5 A;  4U4W A;  4DKC A;  3VA2 A;  3DI2 A;  3WCY I;  2Y5Y A;  5GXB A;  2KZ1 A;  1CN4 C;  4OH3 A;  1JLI A;  5IP9 D;  2JA5 D;  1HWG A;  3I4N D;  2CFQ A;  1M47 A;  4FA8 E;  3LB6 A;  4GRW A;  2HYM B;  5D22 A;  4A3L D;  2CFP A;  4QIQ A;  5D70 A;  4ZW9 A;  3N06 A;  3HOU D;  2Z3R A;  1IRL A;  2B8U A;  1IK0 A;  4NEM A;  3HMX B;  3PIW A;  3N0P A;  4JA3 A;  2B63 D;  1ITL A;  1CD9 A;  4BY7 D;  4MHL A;  1EXZ A;  1M4B A;  1Y1V D;  3L5W I;  2B8Y A;  1PW4 A;  3H0G D;  4DKD A;  4NKQ C;  1V7M V;  4IU8 A;  4NN6 A;  4ZYR A;  3D85 C;  5FHX A;  1LQS L;  2OQP A;  1ILK A;  4A3D D;  1PV6 A;  4DKE A;  4JR9 A;  3BPO A;  1HUL A;  2O27 A;  2JA7 D;  3MZG A;  2R93 D;  4PYP A;  1M4R A;  3PO3 D;  5E4E A;  1ALU A;  1LKI A;  4J05 A;  3OG6 A;  3UF2 A;  5IYB D;  4XNJ A;  2H24 A;  3NCB A;  1LK3 A;  4YQX A;  1M48 A;  2ILK A;  4A3I D;  4EXP A;  5C7X A;  3QT2 C;  1IJZ A;  1IL6 A;  1HUW A;  1ITF A;  3D87 A;  1HGU A;  1GNC A;  1M4A A;  3O7Q A;  4LRL A;  5D28 B;  4WRL B;  3NCC A;  2Q7N B;  2R92 D;  1PV7 A;  3LB6 B;  3HOV D;  1GA3 A;  2Z3Q A;  1M49 A;  4DKF A;  1D9C A;  2LAG A;  4BBS D;  2JA8 D;  1BCN A;  1CYL A;  1B5L A;  4NI7 A;  3OG4 A;  3NPZ A;  1IAR A;  1HZI A;  2INT A;  4JRE A;  1BGC A;  5IYC D;  1EER A;  2CYK A;  1N1F A;  5A2N A;  3OQ3 A;  4A3B D;  3HHR A;  2C35 A;  4YPG C;  4BBR D;  5IYD D;  3HOY D;  4RS1 A;  2D9Q A;  3UX9 A;  3O7P A;  1PW6 A;  1Y6K L;  4A3G D;  3Q1S I;  5D72 A;  2B8Z A;  4J4L C;  4TPG A;  4OAA A;  5C44 D;  4A3F D;  1BUY A;  4ZWC A;  1Y14 A;  3L5X A;  1A22 A;  1Z92 A;  4ZWB A;  2O6I A; 
#chains in the Genus database with same CATH homology
 4BXX D;  1D9G A;  1EKU A;  3G6D A;  1AU1 A;  1M4R A;  3PIV A;  5LQB A;  1RCB A;  1Y1W D;  4YUE C;  1QVN A;  3PO3 D;  3HHC A;  5E4E A;  1AXI A;  4NEJ A;  1ALU A;  1RW5 A;  2IL6 A;  2PSM A;  4I77 Z;  3BES L;  1LKI A;  3OG6 A;  2B8X A;  3UF2 A;  1SCF A;  4ZF7 A;  4DKC A;  5IYB D;  1F45 B;  3VA2 A;  4O6K A;  4ZS7 A;  1Y6M L;  1VLK A;  2H24 A;  1BGD A;  3DI2 A;  3NCB A;  3HOX D;  4A3C D;  1LK3 A;  4YQX A;  3WCY I;  3PO2 D;  4GS7 A;  3S9D A;  2KZ1 A;  1EMR A;  2B91 A;  1CN4 C;  4Z5R D;  1M48 A;  2E9W C;  1INR A;  1BBN A;  1Y6N L;  2ILK A;  4A3I D;  2ERJ D;  1JLI A;  3UEZ E;  4EXP A;  1WCM D;  5IP9 D;  3INK C;  2JA5 D;  4X51 A;  5C7X A;  1HIK A;  1HWG A;  3I4M D;  5KNH I;  3I4N D;  3QAZ A;  1V7N V;  3QT2 C;  1PGR A;  4A3K D;  1IJZ A;  1RFB A;  5C4X D;  5FLM D;  1IL6 A;  1HUW A;  1M47 A;  1ITF A;  3D48 P;  3D87 A;  4FA8 E;  3UF5 A;  1BGE A;  3DLQ I;  1HGU A;  4A3E D;  1PY2 A;  3SE3 B;  3LB6 A;  4GRW A;  2R7Z D;  2HYM B;  1GNC A;  5D22 A;  4A3L D;  1AX8 A;  4A93 D;  1PVH B;  1M4A A;  5D70 A;  4A3M D;  4LRL A;  5D28 B;  2D48 A;  3N06 A;  3HOW D;  4WRL B;  3HOU D;  3NCC A;  2Z3R A;  2Q7N B;  2Q98 A;  3DI3 A;  3B5K A;  1IRL A;  2B8U A;  2R92 D;  2GMF A;  2O26 A;  3LB6 B;  3QB1 A;  1IK0 A;  2JA6 D;  3HOV D;  3DGC L;  4YDY I;  1GA3 A;  2Z3Q A;  3EJJ A;  3IRH A;  1M49 A;  4NEM A;  1RHG A;  3HMX B;  1P9M B;  1D9C A;  3PIW A;  4NN5 A;  4DKF A;  2LAG A;  4O9H A;  3N0P A;  4BBS D;  2JA8 D;  1Z7C A;  1BCN A;  1EVS A;  1FG9 A;  1B5L A;  4NI7 A;  3OG4 A;  3H3V E;  2L3Y A;  4DOH A;  1CYL A;  3BPN A;  2B63 D;  1ITL A;  1ETE A;  1CD9 A;  3NPZ A;  3TGX B;  4BY7 D;  5D71 A;  4MHL A;  1IAR A;  1HZI A;  2XQB A;  1EXZ A;  1M4B A;  1Y1V D;  3L5W I;  2INT A;  2L3O A;  1BGC A;  4BY1 D;  5IYC D;  5IP7 D;  2B8Y A;  1EER A;  2CYK A;  3H0G D;  1N1F A;  3NCE A;  3QWR B;  4DKD A;  1F6F A;  1I1R B;  4NN7 A;  5L6Y C;  3EW3 A;  3OQ3 A;  4A3B D;  3QB7 A;  3HHR A;  4NKQ C;  4EXN A;  1V7M V;  3HOZ D;  4NN6 A;  3FKI D;  2C35 A;  3NCF A;  3BPL A;  1ITI A;  3G9V B;  1A7M A;  4YPG C;  4BBR D;  5IYD D;  3HOY D;  4RS1 A;  1BP3 A;  3D85 C;  5FHX A;  1CSG A;  2D9Q A;  1LQS L;  3UX9 A;  1PW6 A;  2OQP A;  4A3J D;  1FYH A;  1ILK A;  1Y6K L;  4A3G D;  3Q1S I;  4A3D D;  3AYH A;  4NI9 A;  5D72 A;  2B90 A;  4DKE A;  2B8Z A;  1HWH A;  4J4L C;  2B5I A;  1HIJ A;  1KF9 A;  3SE4 B;  2Q14 A;  1J7V L;  3BPO A;  5C44 D;  3DUH C;  5TS9 A;  1HUL A;  2O27 A;  1WU3 I;  2JA7 D;  1M4C A;  2VUM D;  4A3F D;  5C3E D;  1BUY A;  2LMS A;  1YKB A;  3MZG A;  1ITM A;  1Y14 A;  1A22 A;  1Z92 A;  3L5X A;  1NBP A;  4CNI C;  2R93 D;  1CNT 1;  5FUC A;  2O6I A;  4PS4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...