4NNRA

Fkbp13-fk506 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
HCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of the Immunophilin FKBP13-FK506 Complex: Insights into the Composite Binding Surface for Calcineurin
doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP2
total genus 18
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4nnrA00
2LJ4A 4LAYA 4U85A 3O5PA 1Y0OA 3I6CA 2RUCA 2FAPA 1EQ3A 1FKBA 1Q6UA 2XPAA 5D75A 1FAPA 1P5QA 5B8IC 2PPPA 3EY6A 2D9FA 4QT3A 4DROA 2MPHA 2RQSA 4GIVA 4DRMA 2MF9A 1FD9A 1QPFA 1TCOC 3GPKA 3JYJA 2RUDA 4G50A 4JFLA 3KZ7A 3O5JA 3TDBA 2LPVA 1KT1A 4JYSA 2RURA 3TC5A 1FKSA 3ODKA 4IPXA 3CGNA 1JNSA 2PBCA 2FKEA 2F2DA 1D7HA 4DRQA 4DZ3A 5HWCA 2LKNA 1YATA 2ZR4A 1W26A 3TCZA 2XP6A 1D7JA 2ZR5A 4MGVA 4ODPA 3RFWA 2ITKA 5HT1A 4DRIA 2KI3A 1BKFA 4ODLA 3IHZA 3O5RA 1ROUA 3UI6A 4DRNA 1BL4A 2K8IA 1FKHA 3NI6A 2MLYA 3VAWA 3FAPA 2IF4A 1FKTA 2PV1A 4LAXA 5DITA 5I98A 2UZ5A 2XP3A 4U86A 2KGJA 2JZVA 1KT0A 3KACA 3MDYB 4QIBA 3KAHA 1F40A 3CGMA 1EYMA 3UI5A 3O5EA 2PV2A 1L1PA 3O5DA 2XP5A 2AWGA 5HUAA 4JFIA 2ZQVA 4NNRA 1J4IA 1D6OA 2Q5AA 2VCDA 4JFKA 4ODRA 4ODKA 4JFJA 4BF8A 4LAWA 5BXJA 1R9HA 2OFNA 2XP4A 2Y78A 4ODMA 5HW6A 3O5QA 2PV3A 3KAGA 4TNSA 4G2PA 4FAPA 2ZQSA 1FKJA 1ROTA 3O5LA 4GGQA 4FN2A 2VN1A 4ODQA 4MSPA 1FJDA 3NRKA 1ZK6A 3O5FA 1JVWA 2PPOA 3O5IA 1HXVA 4DZ2A 2MLXA 1JNTA 2DG3A 2DG9A 4J4OA 2PPNA 4TX0A 2KR7A 2M08A 3JYMA 5HW7A 1J4HA 1FKKA 4W9QA 3JXVA 1FKIA 3KAIA 4J4NA 1FKFA 4ODOA 2KE0A 1T11A 5HKGA 3UQAA 1ZCNA 2M2AA 3KCEA 2L2SA 1QPLA 1FKDA 1PBKA 3O5GA 2RSEA 3IKDA 3KABA 3IKGA 5HWBA 1QZ2A 2XP7A 5HTGA 3PA7A 1Q6IA 1YW5A 3UI4A 2M1IA 3UF8A 4JFMA 4TW6A 3IK8A 3OOBA 4DRKA 3RGCA 3UQIA 4QT2A 4DRPA 5J6EA 4LAVA 2F21A 1FKGA 1J4RA 4DRHA 3UQBA 4TW7A 4TYOA 5DIVA 2ZQUA 1NMVA 2LGOA 2RUQA 1PINA 2XP8A 1FKLA 5HW8A 1A7XA 1M5YA 3O5MA 2KFWA 3PRDA 3KADA 3O5OA 4O2TA 1B6CA 1Q1CA 3O5KA 4DH0A 2ZQTA 4ITZA 2DG4A 2XP9A 2MLZA 2N87A 3LUOA 3NTPA 2XPBA 5GPGA 1F8AB 4IQ2A 3WH0A 4DIPA 1D7IA 2MNTA 4TW8A 4DT4A 4W9PA 4ODNA 4W9OA 2ZR6A 1NMWA 1FKRA 1C9HA 3KAFA 1U79A 3B7XA 4IQCA 4DRJA 1NSGA 4R0XA 4U84A 1J6YA 2KO7A 3PRBA 3H9RB 1N1AA 4C02B 5DIUA 1Q6HA 4N19A 2F4EA
chains in the Genus database with same CATH superfamily
1E9LA 1HKJA 3O5PA 1Y0OA 2WLZA 1FAPA 3ARXA 5B8IC 3WKZA 2DT0A 1QPFA 1TCOC 2WM0A 2ESCA 1E15A 2LPVA 1FKSA 1JNSA 5HWCA 2LKNA 1H0GA 2ZR4A 1W26A 4XAKA 2XP6A 1D7JA 1NWRA 1GOIA 2KI3A 4ODLA 3O5RA 1ROUA 1BL4A 4DWSB 3FY1A 3RM8A 2KGJA 2DT3A 3KACA 1F40A 3UI5A 1HKIA 4JFIA 4NNRA 1D6OA 1GRJA 1IX5A 4ODRA 1R9HA 2B31A 5HW6A 4FAPA 2VN1A 4ODQA 3NRKA 3O5FA 1HJXA 1JVWA 5JH8A 4DH0A 1JNTA 2DG9A 3WD4A 2PPNA 4ZS6A 3JYMA 1J4HA 3ARYA 4P8XA 1CTNA 3WIJA 4W9QA 1FKIA 1ZB5A 4MPKA 4ODOA 2KE0A 1ZCNA 3KCEA 1ZBCA 2P4VA 3O5GA 2RSEA 1E6PA 3PA7A 1LJYA 1OWQA 1E6RA 4TW6A 4DRKA 3UQIA 3AQUA 1WAWA 1HJWA 4ZPTR 4LAVA 4TW7A 4TYOA 3FXYA 4Z2GA 5HW8A 2DSZA 2QF8A 1O6IA 1Q1CA 3O5KA 4O2TA 4IQ2A 1JNDA 3WH0A 3PR9A 2DT2A 2MNTA 3AS0A 3ARWA 4DWSC 4LGXA 1FKRA 1NSGA 4R5EA 2KO7A 1J6YA 4HBEA 5DIUA 2F4EA 2LJ4A 1NH6A 3BMBA 2FAPA 1Q6UA 3RMEA 4P8UA 4WKFA 3ARZA 2G41A 2RQSA 4GIVA 1E44A 4DWSD 1FFQA 3GPKA 1W9VA 3GTYX 1E6NA 3ARTA 3TDBA 1W1YA 1OGBA 4JYSA 3TC5A 1HKMA 3OA5A 2FKEA 4DZ3A 5DEZA 1YATA 2ZR5A 4ODPA 5HT1A 1ZL1A 3IHZA 3VAWA 4LAXA 2IF4A 4Z2JA 5DITA 5I98A 2EULA 1HKKA 2UZ5A 2XP3A 3G6MA 4L3NA 4U86A 1EYMA 3O5EA 2PV2A 2YBUA 2AWGA 4HARA 1J4IA 3ALGA 3RM9A 2WK2A 4LAWA 2XP4A 3ARSA 4ODMA 2DSWA 3O5QA 4TNSA 4G2PA 2ZQSA 1FKJA 4GGQA 4FN2A 1ZK6A 4WKHA 2MLXA 2DG3A 4MNJA 2M08A 1NWTA 2DSUA 1FKFA 4IT4A 1T11A 3KABA 3IKGA 5HWBA 1QZ2A 1YW5A 3WD0A 4ML4A 3IK8A 3OOBA 1D2KA 1J4RA 4DRHA 1WB0A 2LGOA 1LG2A 3B8SA 1PINA 3WD3A 2KFWA 5DF0A 2ZQTA 2DG4A 2XP9A 3NTPA 5GPGA 2XPBA 1F8AB 4WIWA 1W9UA 1FFRA 4W9PA 1LL4A 4W9OA 1NMWA 2ETNA 4ZPVR 1C9HA 3KAFA 3B7XA 4U84A 3AS2A 2PN0A 3GU0A 1JCHB 1Q6HA 3RM4A 2A3EA 4LAYA 2RUCA 1P5QA 2PPPA 2D9FA 4KQZA 4DROA 2MPHA 3CHFA 2MF9A 3CHDA 3KZ7A 2RURA 1LG1A 2PI6A 3ODKA 4IPXA 3ARVA 3CGNA 1GUVA 3CZ8A 2PBCA 2F2DA 1D7HA 4DRQA 1W1VA 3TCZA 4MGVA 1BKFA 4DWSA 3UI6A 4DRNA 2A3CA 1X6LA 1OGGA 1FKHA 1ZBWA 2PV1A 3WD2A 3MDYB 4QIBA 4MTVA 3KAHA 3CGMA 1L1PA 3ARPA 2ZQVA 2Q5AA 4Z2LA 5BXJA 4BF8A 5GPRA 2OFNA 2Y78A 2PV3A 1NWSA 3O5LA 1FJDA 2PPOA 1HXVA 4DZ2A 4J4OA 5HW7A 4TX0A 2KR7A 2A3AA 1FKKA 1NWUA 2B5UB 1K9TA 3KAIA 4QZVB 4J4NA 2F23A 4MNMA 5HKGA 3UQAA 1LL6A 4L72B 4S3JA 1FKDA 2XP7A 2O92A 2M1IA 4JFMA 1ZU8A 3RGCA 1KFWA 3WD1A 3EIPA 4Z2KA 2F21A 3UQBA 1ZBVA 5DIVA 4MAVA 1NMVA 2AOSA 1W1PA 2RUQA 1FKLA 1A7XA 4NZCA 2O9OA 5DO2A 3WQWA 1B6CA 4Z2IA 3AS1A 1GPFA 1E6ZA 2N87A 3LUOA 4PTMA 1XRVA 4DIPA 1WNOA 4DT4A 4IT6A 2G8ZA 4NSBA 2ZR6A 4Q7NA 1SYTA 4S3KA 4R0XA 3H9RB 1ZBKA 1RD6A 1TFVA 3AS3A 1XHGA 4HBOA 4U85A 3I6CA 1EQ3A 1FKBA 2XPAA 3ARQA 5D75A 2IUZA 3EY6A 4QT3A 3W4RA 5GQBA 2DT1A 4DRMA 5HBFA 1FD9A 2FDMA 3JYJA 2RUDA 4G50A 4JFLA 3O5JA 4Z2HA 1KT1A 1VF8A 1H0IA 4WJXA 1EDQA 3QOKA 1EHNA 1UR8A 2YBTA 1SR0A 3RFWA 2ITKA 4DRIA 3WL0A 3G6LA 2K8IA 3NI6A 1LQ0A 2MLYA 3FAPA 1FKTA 3ARUA 2JZVA 1KT0A 1UR9A 3CHEA 3CH9A 2OLHA 4AY1A 3B9DA 3O5DA 2XP5A 5HUAA 3AROA 1JNEA 2VCDA 4JFKA 4ODKA 2WLYA 4JFJA 3KAGA 1ROTA 4MSPA 3O5IA 4W5UA 3ALFA 1W1TA 3JXVA 3BXWA 3PRAA 3B9AA 4Q22A 2M2AA 1W9PA 2L2SA 1EIBA 1QPLA 1PBKA 4MNKA 3IKDA 2DPEA 4MNLA 4P8WA 5HTGA 1Q6IA 3WL1A 3UI4A 3UF8A 4UDMA 1ITXA 4KR0B 4QT2A 4DRPA 5J6EA 1FKGA 3B9EA 4P8VA 2ZQUA 4URIA 3CHCA 2XP8A 1M5YA 3O5MA 3WQVA 3PRDA 3KADA 3O5OA 4WK9A 4ITZA 2MLZA 2DSVA 1LL7A 1D7IA 2A3BA 4TW8A 4ODNA 4ZPWR 1X6NA 1U79A 4IQCA 4DRJA 4WKAA 3PRBA 1HJVA 3ARRA 1N1AA 4C02B 4N19A
chains in the Genus database with same CATH topology
1E9LA 1HKJA 3O5PA 1Y0OA 2WLZA 1FAPA 3ARXA 5B8IC 3WKZA 2DT0A 1QPFA 1TCOC 2WM0A 2ESCA 1E15A 2LPVA 1FKSA 1JNSA 5HWCA 2LKNA 1H0GA 2ZR4A 1W26A 4XAKA 2XP6A 1D7JA 1NWRA 1GOIA 2KI3A 4ODLA 3O5RA 1ROUA 1BL4A 4DWSB 3FY1A 3RM8A 2KGJA 2DT3A 3KACA 1F40A 3UI5A 1HKIA 4JFIA 4NNRA 1D6OA 1IX5A 4ODRA 1R9HA 2B31A 5HW6A 4FAPA 2VN1A 4ODQA 3NRKA 3O5FA 1HJXA 1JVWA 5JH8A 4DH0A 1JNTA 2DG9A 3WD4A 2PPNA 4ZS6A 3JYMA 1J4HA 3ARYA 4P8XA 1CTNA 3WIJA 4W9QA 1FKIA 1ZB5A 4MPKA 4ODOA 2KE0A 1ZCNA 3KCEA 1ZBCA 3O5GA 2RSEA 1E6PA 3PA7A 1LJYA 1OWQA 1E6RA 4TW6A 4DRKA 3UQIA 3AQUA 1WAWA 1HJWA 4ZPTR 4LAVA 4TW7A 4TYOA 3FXYA 4Z2GA 5HW8A 2DSZA 2QF8A 1O6IA 1Q1CA 3O5KA 4O2TA 4IQ2A 1JNDA 3WH0A 3PR9A 2DT2A 2MNTA 3AS0A 3ARWA 4DWSC 4LGXA 1FKRA 1NSGA 4R5EA 2KO7A 1J6YA 4HBEA 5DIUA 2F4EA 2LJ4A 1NH6A 2FAPA 1Q6UA 3RMEA 4P8UA 4WKFA 3ARZA 2G41A 2RQSA 4GIVA 4DWSD 1FFQA 3GPKA 1W9VA 3TDBA 1E6NA 3ARTA 3TC5A 1W1YA 1OGBA 4JYSA 1HKMA 3OA5A 2FKEA 4DZ3A 5DEZA 1YATA 2ZR5A 4ODPA 5HT1A 1ZL1A 3IHZA 3VAWA 4LAXA 2IF4A 4Z2JA 5DITA 5I98A 1HKKA 2UZ5A 2XP3A 3G6MA 4L3NA 4U86A 1EYMA 3O5EA 2PV2A 2YBUA 2AWGA 4HARA 1J4IA 3ALGA 3RM9A 2WK2A 4LAWA 2XP4A 3ARSA 4ODMA 2DSWA 3O5QA 4TNSA 4G2PA 2ZQSA 1FKJA 4GGQA 4FN2A 1ZK6A 4WKHA 2MLXA 2DG3A 4MNJA 2M08A 1NWTA 2DSUA 1FKFA 4IT4A 1T11A 3KABA 3IKGA 5HWBA 1QZ2A 1YW5A 3WD0A 4ML4A 3IK8A 3OOBA 1D2KA 1J4RA 4DRHA 1WB0A 2LGOA 1LG2A 3B8SA 1PINA 3WD3A 2KFWA 5DF0A 2ZQTA 2DG4A 2XP9A 3NTPA 5GPGA 2XPBA 1F8AB 4WIWA 1W9UA 1FFRA 4W9PA 1LL4A 4W9OA 1NMWA 4ZPVR 1C9HA 3KAFA 3B7XA 4U84A 3AS2A 1Q6HA 3RM4A 2A3EA 4LAYA 2RUCA 1P5QA 2PPPA 2D9FA 4KQZA 4DROA 2MPHA 3CHFA 2MF9A 3CHDA 3KZ7A 2RURA 1LG1A 2PI6A 3ODKA 4IPXA 3ARVA 3CGNA 1GUVA 3CZ8A 2PBCA 2F2DA 1D7HA 4DRQA 1W1VA 3TCZA 4MGVA 1BKFA 4DWSA 3UI6A 4DRNA 2A3CA 1X6LA 1OGGA 1FKHA 1ZBWA 2PV1A 3WD2A 3MDYB 4QIBA 4MTVA 3KAHA 3CGMA 1L1PA 3ARPA 2ZQVA 2Q5AA 4Z2LA 5BXJA 4BF8A 5GPRA 2OFNA 2Y78A 2PV3A 1NWSA 3O5LA 1FJDA 2PPOA 1HXVA 4DZ2A 4J4OA 5HW7A 4TX0A 2KR7A 2A3AA 1FKKA 1NWUA 1K9TA 3KAIA 4QZVB 4J4NA 4MNMA 5HKGA 3UQAA 1LL6A 4L72B 4S3JA 1FKDA 2XP7A 2O92A 2M1IA 4JFMA 1ZU8A 3RGCA 1KFWA 3WD1A 4Z2KA 2F21A 3UQBA 1ZBVA 5DIVA 4MAVA 1NMVA 2AOSA 1W1PA 2RUQA 1FKLA 1A7XA 4NZCA 2O9OA 5DO2A 3WQWA 1B6CA 4Z2IA 3AS1A 1GPFA 1E6ZA 2N87A 3LUOA 4PTMA 1XRVA 4DIPA 1WNOA 4DT4A 4IT6A 2G8ZA 4NSBA 2ZR6A 4Q7NA 1SYTA 4S3KA 4R0XA 3H9RB 1ZBKA 1TFVA 1RD6A 3AS3A 1XHGA 4HBOA 4U85A 3I6CA 1EQ3A 1FKBA 2XPAA 3ARQA 5D75A 2IUZA 3EY6A 4QT3A 3W4RA 5GQBA 2DT1A 4DRMA 5HBFA 1FD9A 2FDMA 3JYJA 2RUDA 4G50A 4JFLA 3O5JA 4Z2HA 1KT1A 1VF8A 1H0IA 4WJXA 1EDQA 3QOKA 1EHNA 1UR8A 2YBTA 1SR0A 3RFWA 2ITKA 4DRIA 3WL0A 3G6LA 2K8IA 3NI6A 1LQ0A 2MLYA 3FAPA 1FKTA 3ARUA 2JZVA 1KT0A 1UR9A 3CHEA 3CH9A 2OLHA 4AY1A 3B9DA 3O5DA 2XP5A 5HUAA 3AROA 1JNEA 2VCDA 4JFKA 4ODKA 2WLYA 4JFJA 3KAGA 1ROTA 4MSPA 3O5IA 4W5UA 3ALFA 1W1TA 3JXVA 3BXWA 3PRAA 3B9AA 4Q22A 2M2AA 1W9PA 2L2SA 1EIBA 1QPLA 1PBKA 4MNKA 3IKDA 2DPEA 4MNLA 4P8WA 5HTGA 1Q6IA 3WL1A 3UI4A 3UF8A 1ITXA 4KR0B 4QT2A 4DRPA 5J6EA 1FKGA 3B9EA 4P8VA 2ZQUA 4URIA 3CHCA 2XP8A 1M5YA 3O5MA 3WQVA 3PRDA 3KADA 3O5OA 4WK9A 4ITZA 2MLZA 2DSVA 1LL7A 1D7IA 2A3BA 4TW8A 4ODNA 4ZPWR 1X6NA 1U79A 4IQCA 4DRJA 4WKAA 1HJVA 3PRBA 3ARRA 1N1AA 4C02B 4N19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ4 A;  4LAY A;  4U85 A;  3O5P A;  1Y0O A;  3I6C A;  2RUC A;  2FAP A;  1EQ3 A;  1FKB A;  1Q6U A;  2XPA A;  5D75 A;  1FAP A;  1P5Q A;  5B8I C;  2PPP A;  3EY6 A;  2D9F A;  4QT3 A;  4DRO A;  2MPH A;  2RQS A;  4GIV A;  4DRM A;  2MF9 A;  1FD9 A;  1QPF A;  1TCO C;  3GPK A;  3JYJ A;  2RUD A;  4G50 A;  4JFL A;  3KZ7 A;  3O5J A;  3TDB A;  2LPV A;  1KT1 A;  4JYS A;  2RUR A;  3TC5 A;  1FKS A;  3ODK A;  4IPX A;  3CGN A;  1JNS A;  2PBC A;  2FKE A;  2F2D A;  1D7H A;  4DRQ A;  4DZ3 A;  5HWC A;  2LKN A;  1YAT A;  2ZR4 A;  1W26 A;  3TCZ A;  2XP6 A;  1D7J A;  2ZR5 A;  4MGV A;  4ODP A;  3RFW A;  2ITK A;  5HT1 A;  4DRI A;  2KI3 A;  1BKF A;  4ODL A;  3IHZ A;  3O5R A;  1ROU A;  3UI6 A;  4DRN A;  1BL4 A;  2K8I A;  1FKH A;  3NI6 A;  2MLY A;  3VAW A;  3FAP A;  2IF4 A;  1FKT A;  2PV1 A;  4LAX A;  5DIT A;  5I98 A;  2UZ5 A;  2XP3 A;  4U86 A;  2KGJ A;  2JZV A;  1KT0 A;  3KAC A;  3MDY B;  4QIB A;  3KAH A;  1F40 A;  3CGM A;  1EYM A;  3UI5 A;  3O5E A;  2PV2 A;  1L1P A;  3O5D A;  2XP5 A;  2AWG A;  5HUA A;  4JFI A;  2ZQV A;  4NNR A;  1J4I A;  1D6O A;  2Q5A A;  2VCD A;  4JFK A;  4ODR A;  4ODK A;  4JFJ A;  4BF8 A;  4LAW A;  5BXJ A;  1R9H A;  2OFN A;  2XP4 A;  2Y78 A;  4ODM A;  5HW6 A;  3O5Q A;  2PV3 A;  3KAG A;  4TNS A;  4G2P A;  4FAP A;  2ZQS A;  1FKJ A;  1ROT A;  3O5L A;  4GGQ A;  4FN2 A;  2VN1 A;  4ODQ A;  4MSP A;  1FJD A;  3NRK A;  1ZK6 A;  3O5F A;  1JVW A;  2PPO A;  3O5I A;  1HXV A;  4DZ2 A;  2MLX A;  1JNT A;  2DG3 A;  2DG9 A;  4J4O A;  2PPN A;  4TX0 A;  2KR7 A;  2M08 A;  3JYM A;  5HW7 A;  1J4H A;  1FKK A;  4W9Q A;  3JXV A;  1FKI A;  3KAI A;  4J4N A;  1FKF A;  4ODO A;  2KE0 A;  1T11 A;  5HKG A;  3UQA A;  1ZCN A;  2M2A A;  3KCE A;  2L2S A;  1QPL A;  1FKD A;  1PBK A;  3O5G A;  2RSE A;  3IKD A;  3KAB A;  3IKG A;  5HWB A;  1QZ2 A;  2XP7 A;  5HTG A;  3PA7 A;  1Q6I A;  1YW5 A;  3UI4 A;  2M1I A;  3UF8 A;  4JFM A;  4TW6 A;  3IK8 A;  3OOB A;  4DRK A;  3RGC A;  3UQI A;  4QT2 A;  4DRP A;  5J6E A;  4LAV A;  2F21 A;  1FKG A;  1J4R A;  4DRH A;  3UQB A;  4TW7 A;  4TYO A;  5DIV A;  2ZQU A;  1NMV A;  2LGO A;  2RUQ A;  1PIN A;  2XP8 A;  1FKL A;  5HW8 A;  1A7X A;  1M5Y A;  3O5M A;  2KFW A;  3PRD A;  3KAD A;  3O5O A;  4O2T A;  1B6C A;  1Q1C A;  3O5K A;  4DH0 A;  2ZQT A;  4ITZ A;  2DG4 A;  2XP9 A;  2MLZ A;  2N87 A;  3LUO A;  3NTP A;  2XPB A;  5GPG A;  1F8A B;  4IQ2 A;  3WH0 A;  4DIP A;  1D7I A;  2MNT A;  4TW8 A;  4DT4 A;  4W9P A;  4ODN A;  4W9O A;  2ZR6 A;  1NMW A;  1FKR A;  1C9H A;  3KAF A;  1U79 A;  3B7X A;  4IQC A;  4DRJ A;  1NSG A;  4R0X A;  4U84 A;  1J6Y A;  2KO7 A;  3PRB A;  3H9R B;  1N1A A;  4C02 B;  5DIU A;  1Q6H A;  4N19 A;  2F4E A; 
#chains in the Genus database with same CATH topology
 1E9L A;  1HKJ A;  3O5P A;  1Y0O A;  2WLZ A;  1FAP A;  3ARX A;  5B8I C;  3WKZ A;  2DT0 A;  1QPF A;  1TCO C;  2WM0 A;  2ESC A;  1E15 A;  2LPV A;  1FKS A;  1JNS A;  5HWC A;  2LKN A;  1H0G A;  2ZR4 A;  1W26 A;  4XAK A;  2XP6 A;  1D7J A;  1NWR A;  1GOI A;  2KI3 A;  4ODL A;  3O5R A;  1ROU A;  1BL4 A;  4DWS B;  3FY1 A;  3RM8 A;  2KGJ A;  2DT3 A;  3KAC A;  1F40 A;  3UI5 A;  1HKI A;  4JFI A;  4NNR A;  1D6O A;  1GRJ A;  1IX5 A;  4ODR A;  1R9H A;  2B31 A;  5HW6 A;  4FAP A;  2VN1 A;  4ODQ A;  3NRK A;  3O5F A;  1HJX A;  1JVW A;  5JH8 A;  4DH0 A;  1JNT A;  2DG9 A;  3WD4 A;  2PPN A;  4ZS6 A;  3JYM A;  1J4H A;  3ARY A;  4P8X A;  1CTN A;  3WIJ A;  4W9Q A;  1FKI A;  1ZB5 A;  4MPK A;  4ODO A;  2KE0 A;  1ZCN A;  3KCE A;  1ZBC A;  2P4V A;  3O5G A;  2RSE A;  1E6P A;  3PA7 A;  1LJY A;  1OWQ A;  1E6R A;  4TW6 A;  4DRK A;  3UQI A;  3AQU A;  1WAW A;  1HJW A;  4ZPT R;  4LAV A;  4TW7 A;  4TYO A;  3FXY A;  4Z2G A;  5HW8 A;  2DSZ A;  2QF8 A;  1O6I A;  1Q1C A;  3O5K A;  4O2T A;  4IQ2 A;  1JND A;  3WH0 A;  3PR9 A;  2DT2 A;  2MNT A;  3AS0 A;  3ARW A;  4DWS C;  4LGX A;  1FKR A;  1NSG A;  4R5E A;  2KO7 A;  1J6Y A;  4HBE A;  5DIU A;  2F4E A;  2LJ4 A;  1NH6 A;  3BMB A;  2FAP A;  1Q6U A;  3RME A;  4P8U A;  4WKF A;  3ARZ A;  2G41 A;  2RQS A;  4GIV A;  1E44 A;  4DWS D;  1FFQ A;  3GPK A;  1W9V A;  3GTY X;  1E6N A;  3ART A;  3TDB A;  1W1Y A;  1OGB A;  4JYS A;  3TC5 A;  1HKM A;  3OA5 A;  2FKE A;  4DZ3 A;  5DEZ A;  1YAT A;  2ZR5 A;  4ODP A;  5HT1 A;  1ZL1 A;  3IHZ A;  3VAW A;  4LAX A;  2IF4 A;  4Z2J A;  5DIT A;  5I98 A;  2EUL A;  1HKK A;  2UZ5 A;  2XP3 A;  3G6M A;  4L3N A;  4U86 A;  1EYM A;  3O5E A;  2PV2 A;  2YBU A;  2AWG A;  4HAR A;  1J4I A;  3ALG A;  3RM9 A;  2WK2 A;  4LAW A;  2XP4 A;  3ARS A;  4ODM A;  2DSW A;  3O5Q A;  4TNS A;  4G2P A;  2ZQS A;  1FKJ A;  4GGQ A;  4FN2 A;  1ZK6 A;  4WKH A;  2MLX A;  2DG3 A;  4MNJ A;  2M08 A;  1NWT A;  2DSU A;  1FKF A;  4IT4 A;  1T11 A;  3KAB A;  3IKG A;  5HWB A;  1QZ2 A;  1YW5 A;  3WD0 A;  4ML4 A;  3IK8 A;  3OOB A;  1D2K A;  1J4R A;  4DRH A;  1WB0 A;  2LGO A;  1LG2 A;  3B8S A;  1PIN A;  3WD3 A;  2KFW A;  5DF0 A;  2ZQT A;  2DG4 A;  2XP9 A;  3NTP A;  5GPG A;  2XPB A;  1F8A B;  4WIW A;  1W9U A;  1FFR A;  4W9P A;  1LL4 A;  4W9O A;  1NMW A;  2ETN A;  4ZPV R;  1C9H A;  3KAF A;  3B7X A;  4U84 A;  3AS2 A;  2PN0 A;  3GU0 A;  1JCH B;  1Q6H A;  3RM4 A;  2A3E A;  4LAY A;  2RUC A;  1P5Q A;  2PPP A;  2D9F A;  4KQZ A;  4DRO A;  2MPH A;  3CHF A;  2MF9 A;  3CHD A;  3KZ7 A;  2RUR A;  1LG1 A;  2PI6 A;  3ODK A;  4IPX A;  3ARV A;  3CGN A;  1GUV A;  3CZ8 A;  2PBC A;  2F2D A;  1D7H A;  4DRQ A;  1W1V A;  3TCZ A;  4MGV A;  1BKF A;  4DWS A;  3UI6 A;  4DRN A;  2A3C A;  1X6L A;  1OGG A;  1FKH A;  1ZBW A;  2PV1 A;  3WD2 A;  3MDY B;  4QIB A;  4MTV A;  3KAH A;  3CGM A;  1L1P A;  3ARP A;  2ZQV A;  2Q5A A;  4Z2L A;  5BXJ A;  4BF8 A;  5GPR A;  2OFN A;  2Y78 A;  2PV3 A;  1NWS A;  3O5L A;  1FJD A;  2PPO A;  1HXV A;  4DZ2 A;  4J4O A;  5HW7 A;  4TX0 A;  2KR7 A;  2A3A A;  1FKK A;  1NWU A;  2B5U B;  1K9T A;  3KAI A;  4QZV B;  4J4N A;  2F23 A;  4MNM A;  5HKG A;  3UQA A;  1LL6 A;  4L72 B;  4S3J A;  1FKD A;  2XP7 A;  2O92 A;  2M1I A;  4JFM A;  1ZU8 A;  3RGC A;  1KFW A;  3WD1 A;  3EIP A;  4Z2K A;  2F21 A;  3UQB A;  1ZBV A;  5DIV A;  4MAV A;  1NMV A;  2AOS A;  1W1P A;  2RUQ A;  1FKL A;  1A7X A;  4NZC A;  2O9O A;  5DO2 A;  3WQW A;  1B6C A;  4Z2I A;  3AS1 A;  1GPF A;  1E6Z A;  2N87 A;  3LUO A;  4PTM A;  1XRV A;  4DIP A;  1WNO A;  4DT4 A;  4IT6 A;  2G8Z A;  4NSB A;  2ZR6 A;  4Q7N A;  1SYT A;  4S3K A;  4R0X A;  3H9R B;  1ZBK A;  1RD6 A;  1TFV A;  3AS3 A;  1XHG A;  4HBO A;  4U85 A;  3I6C A;  1EQ3 A;  1FKB A;  2XPA A;  3ARQ A;  5D75 A;  2IUZ A;  3EY6 A;  4QT3 A;  3W4R A;  5GQB A;  2DT1 A;  4DRM A;  5HBF A;  1FD9 A;  2FDM A;  3JYJ A;  2RUD A;  4G50 A;  4JFL A;  3O5J A;  4Z2H A;  1KT1 A;  1VF8 A;  1H0I A;  4WJX A;  1EDQ A;  3QOK A;  1EHN A;  1UR8 A;  2YBT A;  1SR0 A;  3RFW A;  2ITK A;  4DRI A;  3WL0 A;  3G6L A;  2K8I A;  3NI6 A;  1LQ0 A;  2MLY A;  3FAP A;  1FKT A;  3ARU A;  2JZV A;  1KT0 A;  1UR9 A;  3CHE A;  3CH9 A;  2OLH A;  4AY1 A;  3B9D A;  3O5D A;  2XP5 A;  5HUA A;  3ARO A;  1JNE A;  2VCD A;  4JFK A;  4ODK A;  2WLY A;  4JFJ A;  3KAG A;  1ROT A;  4MSP A;  3O5I A;  4W5U A;  3ALF A;  1W1T A;  3JXV A;  3BXW A;  3PRA A;  3B9A A;  4Q22 A;  2M2A A;  1W9P A;  2L2S A;  1EIB A;  1QPL A;  1PBK A;  4MNK A;  3IKD A;  2DPE A;  4MNL A;  4P8W A;  5HTG A;  1Q6I A;  3WL1 A;  3UI4 A;  3UF8 A;  4UDM A;  1ITX A;  4KR0 B;  4QT2 A;  4DRP A;  5J6E A;  1FKG A;  3B9E A;  4P8V A;  2ZQU A;  4URI A;  3CHC A;  2XP8 A;  1M5Y A;  3O5M A;  3WQV A;  3PRD A;  3KAD A;  3O5O A;  4WK9 A;  4ITZ A;  2MLZ A;  2DSV A;  1LL7 A;  1D7I A;  2A3B A;  4TW8 A;  4ODN A;  4ZPW R;  1X6N A;  1U79 A;  4IQC A;  4DRJ A;  4WKA A;  3PRB A;  1HJV A;  3ARR A;  1N1A A;  4C02 B;  4N19 A; 
#chains in the Genus database with same CATH homology
 1E9L A;  1HKJ A;  3O5P A;  1Y0O A;  2WLZ A;  1FAP A;  3ARX A;  5B8I C;  3WKZ A;  2DT0 A;  1QPF A;  1TCO C;  2WM0 A;  2ESC A;  1E15 A;  2LPV A;  1FKS A;  1JNS A;  5HWC A;  2LKN A;  1H0G A;  2ZR4 A;  1W26 A;  4XAK A;  2XP6 A;  1D7J A;  1NWR A;  1GOI A;  2KI3 A;  4ODL A;  3O5R A;  1ROU A;  1BL4 A;  4DWS B;  3FY1 A;  3RM8 A;  2KGJ A;  2DT3 A;  3KAC A;  1F40 A;  3UI5 A;  1HKI A;  4JFI A;  4NNR A;  1D6O A;  1IX5 A;  4ODR A;  1R9H A;  2B31 A;  5HW6 A;  4FAP A;  2VN1 A;  4ODQ A;  3NRK A;  3O5F A;  1HJX A;  1JVW A;  5JH8 A;  4DH0 A;  1JNT A;  2DG9 A;  3WD4 A;  2PPN A;  4ZS6 A;  3JYM A;  1J4H A;  3ARY A;  4P8X A;  1CTN A;  3WIJ A;  4W9Q A;  1FKI A;  1ZB5 A;  4MPK A;  4ODO A;  2KE0 A;  1ZCN A;  3KCE A;  1ZBC A;  3O5G A;  2RSE A;  1E6P A;  3PA7 A;  1LJY A;  1OWQ A;  1E6R A;  4TW6 A;  4DRK A;  3UQI A;  3AQU A;  1WAW A;  1HJW A;  4ZPT R;  4LAV A;  4TW7 A;  4TYO A;  3FXY A;  4Z2G A;  5HW8 A;  2DSZ A;  2QF8 A;  1O6I A;  1Q1C A;  3O5K A;  4O2T A;  4IQ2 A;  1JND A;  3WH0 A;  3PR9 A;  2DT2 A;  2MNT A;  3AS0 A;  3ARW A;  4DWS C;  4LGX A;  1FKR A;  1NSG A;  4R5E A;  2KO7 A;  1J6Y A;  4HBE A;  5DIU A;  2F4E A;  2LJ4 A;  1NH6 A;  2FAP A;  1Q6U A;  3RME A;  4P8U A;  4WKF A;  3ARZ A;  2G41 A;  2RQS A;  4GIV A;  4DWS D;  1FFQ A;  3GPK A;  1W9V A;  3TDB A;  1E6N A;  3ART A;  3TC5 A;  1W1Y A;  1OGB A;  4JYS A;  1HKM A;  3OA5 A;  2FKE A;  4DZ3 A;  5DEZ A;  1YAT A;  2ZR5 A;  4ODP A;  5HT1 A;  1ZL1 A;  3IHZ A;  3VAW A;  4LAX A;  2IF4 A;  4Z2J A;  5DIT A;  5I98 A;  1HKK A;  2UZ5 A;  2XP3 A;  3G6M A;  4L3N A;  4U86 A;  1EYM A;  3O5E A;  2PV2 A;  2YBU A;  2AWG A;  4HAR A;  1J4I A;  3ALG A;  3RM9 A;  2WK2 A;  4LAW A;  2XP4 A;  3ARS A;  4ODM A;  2DSW A;  3O5Q A;  4TNS A;  4G2P A;  2ZQS A;  1FKJ A;  4GGQ A;  4FN2 A;  1ZK6 A;  4WKH A;  2MLX A;  2DG3 A;  4MNJ A;  2M08 A;  1NWT A;  2DSU A;  1FKF A;  4IT4 A;  1T11 A;  3KAB A;  3IKG A;  5HWB A;  1QZ2 A;  1YW5 A;  3WD0 A;  4ML4 A;  3IK8 A;  3OOB A;  1D2K A;  1J4R A;  4DRH A;  1WB0 A;  2LGO A;  1LG2 A;  3B8S A;  1PIN A;  3WD3 A;  2KFW A;  5DF0 A;  2ZQT A;  2DG4 A;  2XP9 A;  3NTP A;  5GPG A;  2XPB A;  1F8A B;  4WIW A;  1W9U A;  1FFR A;  4W9P A;  1LL4 A;  4W9O A;  1NMW A;  4ZPV R;  1C9H A;  3KAF A;  3B7X A;  4U84 A;  3AS2 A;  1Q6H A;  3RM4 A;  2A3E A;  4LAY A;  2RUC A;  1P5Q A;  2PPP A;  2D9F A;  4KQZ A;  4DRO A;  2MPH A;  3CHF A;  2MF9 A;  3CHD A;  3KZ7 A;  2RUR A;  1LG1 A;  2PI6 A;  3ODK A;  4IPX A;  3ARV A;  3CGN A;  1GUV A;  3CZ8 A;  2PBC A;  2F2D A;  1D7H A;  4DRQ A;  1W1V A;  3TCZ A;  4MGV A;  1BKF A;  4DWS A;  3UI6 A;  4DRN A;  2A3C A;  1X6L A;  1OGG A;  1FKH A;  1ZBW A;  2PV1 A;  3WD2 A;  3MDY B;  4QIB A;  4MTV A;  3KAH A;  3CGM A;  1L1P A;  3ARP A;  2ZQV A;  2Q5A A;  4Z2L A;  5BXJ A;  4BF8 A;  5GPR A;  2OFN A;  2Y78 A;  2PV3 A;  1NWS A;  3O5L A;  1FJD A;  2PPO A;  1HXV A;  4DZ2 A;  4J4O A;  5HW7 A;  4TX0 A;  2KR7 A;  2A3A A;  1FKK A;  1NWU A;  1K9T A;  3KAI A;  4QZV B;  4J4N A;  4MNM A;  5HKG A;  3UQA A;  1LL6 A;  4L72 B;  4S3J A;  1FKD A;  2XP7 A;  2O92 A;  2M1I A;  4JFM A;  1ZU8 A;  3RGC A;  1KFW A;  3WD1 A;  4Z2K A;  2F21 A;  3UQB A;  1ZBV A;  5DIV A;  4MAV A;  1NMV A;  2AOS A;  1W1P A;  2RUQ A;  1FKL A;  1A7X A;  4NZC A;  2O9O A;  5DO2 A;  3WQW A;  1B6C A;  4Z2I A;  3AS1 A;  1GPF A;  1E6Z A;  2N87 A;  3LUO A;  4PTM A;  1XRV A;  4DIP A;  1WNO A;  4DT4 A;  4IT6 A;  2G8Z A;  4NSB A;  2ZR6 A;  4Q7N A;  1SYT A;  4S3K A;  4R0X A;  3H9R B;  1ZBK A;  1TFV A;  1RD6 A;  3AS3 A;  1XHG A;  4HBO A;  4U85 A;  3I6C A;  1EQ3 A;  1FKB A;  2XPA A;  3ARQ A;  5D75 A;  2IUZ A;  3EY6 A;  4QT3 A;  3W4R A;  5GQB A;  2DT1 A;  4DRM A;  5HBF A;  1FD9 A;  2FDM A;  3JYJ A;  2RUD A;  4G50 A;  4JFL A;  3O5J A;  4Z2H A;  1KT1 A;  1VF8 A;  1H0I A;  4WJX A;  1EDQ A;  3QOK A;  1EHN A;  1UR8 A;  2YBT A;  1SR0 A;  3RFW A;  2ITK A;  4DRI A;  3WL0 A;  3G6L A;  2K8I A;  3NI6 A;  1LQ0 A;  2MLY A;  3FAP A;  1FKT A;  3ARU A;  2JZV A;  1KT0 A;  1UR9 A;  3CHE A;  3CH9 A;  2OLH A;  4AY1 A;  3B9D A;  3O5D A;  2XP5 A;  5HUA A;  3ARO A;  1JNE A;  2VCD A;  4JFK A;  4ODK A;  2WLY A;  4JFJ A;  3KAG A;  1ROT A;  4MSP A;  3O5I A;  4W5U A;  3ALF A;  1W1T A;  3JXV A;  3BXW A;  3PRA A;  3B9A A;  4Q22 A;  2M2A A;  1W9P A;  2L2S A;  1EIB A;  1QPL A;  1PBK A;  4MNK A;  3IKD A;  2DPE A;  4MNL A;  4P8W A;  5HTG A;  1Q6I A;  3WL1 A;  3UI4 A;  3UF8 A;  1ITX A;  4KR0 B;  4QT2 A;  4DRP A;  5J6E A;  1FKG A;  3B9E A;  4P8V A;  2ZQU A;  4URI A;  3CHC A;  2XP8 A;  1M5Y A;  3O5M A;  3WQV A;  3PRD A;  3KAD A;  3O5O A;  4WK9 A;  4ITZ A;  2MLZ A;  2DSV A;  1LL7 A;  1D7I A;  2A3B A;  4TW8 A;  4ODN A;  4ZPW R;  1X6N A;  1U79 A;  4IQC A;  4DRJ A;  4WKA A;  1HJV A;  3PRB A;  3ARR A;  1N1A A;  4C02 B;  4N19 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...