4NNRA

Fkbp13-fk506 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
b'HCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP2
publication title Atomic structure of the Immunophilin FKBP13-FK506 Complex: Insights into the Composite Binding Surface for Calcineurin
doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 18
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4nnrA00
2UZ5A 3IKDA 3O5LA 3UF8A 4N19A 1PBKA 4GIVA 2RQSA 2Q5AA 3O5EA 1JNSA 3UQAA 1KT0A 4QT2A 5HUAA 1P5QA 1JNTA 3MDYB 2DG3A 1NSGA 2VN1A 2XP3A 2ZR5A 1ZK6A 2MLYA 4J4NA 5HTGA 5HWCA 1D6OA 3ODKA 1D7HA 1R9HA 1B6CA 2KO7A 2XP7A 3O5OA 3O5RA 3KACA 4IQ2A 4MGVA 3RGCA 4LAWA 2PPOA 4JYSA 4W9OA 2PV2A 5HW7A 1T11A 2MNTA 4LAXA 4DRHA 1C9HA 2MLZA 2PPPA 3KZ7A 2KFWA 1U79A 2XP5A 2KI3A 2XPAA 1ROTA 2RUDA 1FKBA 2MF9A 2DG9A 3KAGA 3O5DA 1ROUA 3KABA 4JFJA 4LAVA 2LKNA 2VCDA 5J6EA 2OFNA 3KAFA 4R0XA 2ZQUA 3O5GA 4U85A 4ODOA 3JYMA 4DRKA 3O5QA 4J4OA 1J4HA 3IHZA 1FKGA 3FAPA 4O2TA 1YW5A 3JXVA 3O5FA 4NNRA 1ZCNA 1BKFA 1J6YA 4TX0A 1D7IA 2AWGA 2LJ4A 4ODQA 2PV1A 5BXJA 2DG4A 4DRMA 1JVWA 4FN2A 4QIBA 2KE0A 3KAHA 4GGQA 3LUOA 4W9PA 4DRPA 5B8IC 1EQ3A 2RURA 1FKHA 1N1AA 1D7JA 3VAWA 4IQCA 2XPBA 2MPHA 1J4IA 4ODMA 4TW8A 4BF8A 2L2SA 1KT1A 4DROA 2FKEA 2F4EA 3UQIA 3EY6A 3CGMA 1M5YA 2ZQTA 1W26A 1PINA 2XP9A 4ODKA 3PRDA 3GPKA 3KADA 4ITZA 3UI6A 1Q6UA 4DRNA 3O5MA 4DZ3A 5DITA 2JZVA 2XP8A 3B7XA 1FKKA 2Y78A 2FAPA 5DIUA 3WH0A 3I6CA 4DRJA 1FJDA 3TDBA 4DIPA 2M1IA 3OOBA 4TW7A 3O5KA 4QT3A 2PV3A 2LGOA 1FKFA 2RSEA 3RFWA 4ODPA 1FKRA 3TCZA 4W9QA 2ZQVA 2N87A 3H9RB 1F40A 1J4RA 3UQBA 2D9FA 4C02B 3NTPA 3O5IA 3TC5A 2RUQA 4DRIA 1A7XA 1FAPA 1Q6IA 4FAPA 4TW6A 3JYJA 3UI5A 4JFKA 4JFIA 1FKIA 4LAYA 4MSPA 3NI6A 3CGNA 1QPLA 4U84A 5D75A 2KR7A 2MLXA 1QPFA 5HKGA 1FKJA 1QZ2A 1EYMA 2F2DA 3KAIA 3KCEA 1FKLA 1TCOC 4JFLA 4U86A 4DRQA 4DT4A 1L1PA 1Q1CA 3NRKA 1YATA 2F21A 4TYOA 1FKDA 3UI4A 4DH0A 2M08A 2LPVA 2RUCA 4ODLA 1BL4A 4DZ2A 2K8IA 2XP4A 1FKTA 2ZQSA 2ZR6A 2IF4A 4G50A 4IPXA 5HW6A 3IK8A 5HWBA 2KGJA 1HXVA 3O5PA 3PA7A 4TNSA 1FD9A 3IKGA 1NMVA 1NMWA 2ITKA 3PRBA 5HT1A 1Y0OA 4JFMA 1F8AB 2ZR4A 4ODNA 2PBCA 5DIVA 1FKSA 5GPGA 5I98A 2PPNA 2XP6A 3O5JA 4G2PA 2M2AA 5HW8A 1Q6HA 4ODRA
chains in the Genus database with same CATH superfamily
1EDQA 2UZ5A 1SR0A 1OWQA 3PRAA 4N19A 3O5EA 2Q5AA 1KT0A 3MDYB 2VN1A 1NSGA 2XP3A 2ZR5A 3G6MA 4MSPA 1R9HA 1B6CA 2XP7A 4DWSB 4IT4A 4PTMA 1T11A 2FDMA 4HBOA 1C9HA 2G41A 4KR0B 2XPAA 1ROTA 2IUZA 1ROUA 2LKNA 2VCDA 1OGGA 2OFNA 4R0XA 3O5GA 1LJYA 3O5QA 1O6IA 3IHZA 4O2TA 1YW5A 4WK9A 3O5FA 2ETNA 1ZCNA 3RMEA 4KQZA 4XAKA 2LJ4A 3BMBA 5BXJA 1LL4A 3CHEA 4QIBA 2KE0A 3KAHA 2EULA 1JNDA 1LL6A 2RURA 4QZVB 1LG1A 2MPHA 1J4IA 2XPBA 4TW8A 3GTYX 2L2SA 1LG2A 4Z2GA 1M5YA 1UR8A 2DSVA 3ARXA 2YBTA 4DRNA 4DZ3A 1NWUA 2JZVA 2Y78A 4DWSD 4DRJA 1FFQA 4TW7A 3ARVA 4Q7NA 1GOIA 2LGOA 4MNMA 4ODPA 1FKRA 3ALGA 2ZQVA 4Q22A 1H0IA 3AS2A 3WD2A 1UR9A 3TC5A 3O5IA 4MTVA 5DF0A 2OLHA 3PR9A 4U84A 2F2DA 4JFLA 3KAIA 1Q1CA 2P4VA 1XRVA 4TYOA 2DT3A 4DH0A 2M08A 2RUCA 4ODLA 1W1VA 1BL4A 3WD4A 2XP4A 4IPXA 3RM4A 5JH8A 5HW6A 1D2KA 4MNJA 3O5PA 4L3NA 3IKGA 1NMVA 4S3KA 4WKAA 4JFMA 1WB0A 4NZCA 4DIPA 3O5JA 3IKDA 3CH9A 2DT0A 1NWRA 1PBKA 2PN0A 5HUAA 1P5QA 1JNTA 3WQVA 2DG3A 3ARYA 1ZL1A 2MLYA 5HWCA 2F23A 3ODKA 1HKMA 3O5OA 4ZS6A 3KACA 1EIBA 4LAXA 2PPPA 1NWTA 1ZBCA 2KI3A 1X6LA 2RUDA 3KAGA 3O5DA 3CZ8A 5DEZA 5GPRA 1NH6A 5J6EA 2O9OA 2B31A 2ZQUA 4DRKA 2O92A 1FKGA 3FAPA 4NNRA 2DPEA 1K9TA 1TFVA 1H0GA 1RD6A 3WKZA 4ODQA 2PV1A 1ITXA 2WLZA 4WJXA 4DRPA 1OGBA 1W1TA 1N1AA 4DROA 1HKIA 4ML4A 3CGMA 1PINA 1NWSA 1ZBVA 3GPKA 3UI6A 3O5MA 4R5EA 4MNKA 2XP8A 1FKKA 3I6CA 4DWSA 2N87A 3H9RB 4ZPWR 1J4RA 4Z2IA 2D9FA 4C02B 3AROA 1HJVA 1Q6IA 1FAPA 1ZBWA 3WIJA 4TW6A 3ARTA 3JYJA 2DT1A 3ARPA 3CGNA 3NI6A 2MLXA 4DWSC 1QPFA 1E6NA 1QZ2A 3KCEA 4U86A 4DRQA 3ARRA 1L1PA 3NRKA 4S3JA 1EHNA 3ARSA 1GPFA 1W1PA 2K8IA 2ZQSA 5HWBA 2KGJA 1HXVA 5HT1A 4TNSA 1FD9A 3QOKA 4IT6A 3PRBA 1ZB5A 1Y0OA 4ODNA 1FKSA 2PPNA 2XP6A 5HW8A 2RSEA 3O5LA 3UF8A 2A3BA 4GIVA 1JNSA 2RQSA 3UQAA 4QT2A 4ZPVR 1E15A 3ARWA 3B9EA 1ZK6A 4J4NA 2AOSA 1D7HA 3O5RA 4IQ2A 4LAWA 4JYSA 4W9OA 2PV2A 5HW7A 3FY1A 2MNTA 4DRHA 3OA5A 3KZ7A 1HJWA 2KFWA 1U79A 3RM9A 1FKBA 2DG9A 2G8ZA 3KABA 4JFJA 3ALFA 4LAVA 3AS1A 2QF8A 4J4OA 1J4HA 4UDMA 2YBUA 4URIA 2ESCA 1VF8A 1BKFA 4Z2HA 1J6YA 4TX0A 2DSZA 2DT2A 3WQWA 1HJXA 1JVWA 4DRMA 4FN2A 5B8IC 3WD0A 1ZBKA 1WNOA 1D7JA 4BF8A 1IX5A 3UQIA 3WD3A 2WM0A 1W26A 2XP9A 4ODKA 3PRDA 3KADA 4WKFA 1Q6UA 1SYTA 1W9PA 5DITA 3B7XA 1X6NA 1E44A 5DIUA 2FAPA 3WH0A 1LL7A 1FJDA 4MPKA 4QT3A 2PV3A 3AQUA 3RFWA 3TCZA 1E6ZA 4W9QA 3B9AA 1F40A 3NTPA 2RUQA 1XHGA 4FAPA 1W9VA 4JFKA 4JFIA 1FKIA 4LAYA 3W4RA 1QPLA 2DSWA 2KR7A 4DT4A 2WLYA 3WL1A 4Z2LA 2LPVA 4DZ2A 3ARZA 1E6PA 2IF4A 4LGXA 1LQ0A 4Z2KA 1FFRA 4L72B 4P8WA 3PA7A 4W5UA 1GRJA 1ZU8A 1F8AB 4ZPTR 5DIVA 5GPGA 3BXWA 2A3EA 1W9UA 1HKJA 5HTGA 1D6OA 2KO7A 4MGVA 4P8VA 3RGCA 4WIWA 2PPOA 5HBFA 4HBEA 4NSBA 2MLZA 3CHCA 2XP5A 3AS3A 1HKKA 1CTNA 2MF9A 2B5UB 3KAFA 3EIPA 2DSUA 4U85A 4ODOA 3JYMA 3JXVA 3FXYA 1D7IA 2AWGA 2DG4A 5GQBA 4GGQA 3LUOA 4W9PA 2WK2A 1EQ3A 1FKHA 3B8SA 3VAWA 4IQCA 4ODMA 1WAWA 1KT1A 2FKEA 2F4EA 3EY6A 1JCHB 2PI6A 2ZQTA 3ARUA 3GU0A 1KFWA 4ITZA 1GUVA 4HARA 4MNLA 4MAVA 3CHDA 4WKHA 3TDBA 1E6RA 2M1IA 3OOBA 4AY1A 3O5KA 4P8XA 1FKFA 3B9DA 3G6LA 3UQBA 3ARQA 4DRIA 1A7XA 3UI5A 2A3AA 1W1YA 5D75A 5HKGA 1FKJA 1EYMA 1FKLA 1TCOC 1E9LA 4P8UA 1YATA 2F21A 1FKDA 3UI4A 3CHFA 1FKTA 1JNEA 4Z2JA 2ZR6A 4G50A 3WD1A 3IK8A 1NMWA 2ITKA 2A3CA 3AS0A 2ZR4A 2PBCA 3WL0A 5I98A 3RM8A 4G2PA 2M2AA 1Q6HA 5DO2A 4ODRA
chains in the Genus database with same CATH topology
1EDQA 2UZ5A 1SR0A 1OWQA 3PRAA 4N19A 3O5EA 2Q5AA 1KT0A 3MDYB 2VN1A 1NSGA 2XP3A 2ZR5A 3G6MA 4MSPA 1R9HA 1B6CA 2XP7A 4DWSB 4IT4A 4PTMA 1T11A 2FDMA 4HBOA 1C9HA 2G41A 4KR0B 2XPAA 1ROTA 2IUZA 1ROUA 2LKNA 2VCDA 1OGGA 2OFNA 4R0XA 3O5GA 1LJYA 3O5QA 1O6IA 3IHZA 4O2TA 1YW5A 4WK9A 3O5FA 1ZCNA 3RMEA 4KQZA 4XAKA 2LJ4A 5BXJA 1LL4A 3CHEA 4QIBA 2KE0A 3KAHA 1JNDA 1LL6A 2RURA 4QZVB 1LG1A 2MPHA 1J4IA 2XPBA 4TW8A 2L2SA 1LG2A 4Z2GA 1M5YA 1UR8A 2DSVA 3ARXA 2YBTA 4DRNA 4DZ3A 1NWUA 2JZVA 2Y78A 4DWSD 4DRJA 1FFQA 4TW7A 3ARVA 4Q7NA 1GOIA 2LGOA 4MNMA 4ODPA 1FKRA 3ALGA 2ZQVA 4Q22A 1H0IA 3AS2A 3WD2A 1UR9A 3TC5A 3O5IA 4MTVA 5DF0A 2OLHA 3PR9A 4U84A 2F2DA 4JFLA 3KAIA 1Q1CA 1XRVA 4TYOA 2DT3A 4DH0A 2M08A 2RUCA 4ODLA 1W1VA 1BL4A 3WD4A 2XP4A 4IPXA 3RM4A 5JH8A 5HW6A 1D2KA 4MNJA 3O5PA 4L3NA 3IKGA 1NMVA 4S3KA 4WKAA 4JFMA 1WB0A 4NZCA 4DIPA 3O5JA 3IKDA 3CH9A 2DT0A 1NWRA 1PBKA 5HUAA 1P5QA 1JNTA 3WQVA 2DG3A 3ARYA 1ZL1A 2MLYA 5HWCA 3ODKA 1HKMA 3O5OA 4ZS6A 3KACA 1EIBA 4LAXA 2PPPA 1NWTA 1ZBCA 2KI3A 1X6LA 2RUDA 3KAGA 3O5DA 3CZ8A 5DEZA 5GPRA 1NH6A 5J6EA 2O9OA 2B31A 2ZQUA 4DRKA 2O92A 1FKGA 3FAPA 4NNRA 2DPEA 1K9TA 1TFVA 1H0GA 1RD6A 3WKZA 4ODQA 2PV1A 1ITXA 2WLZA 4WJXA 4DRPA 1OGBA 1W1TA 1N1AA 4DROA 1HKIA 4ML4A 3CGMA 1PINA 1NWSA 1ZBVA 3GPKA 3UI6A 3O5MA 4R5EA 4MNKA 2XP8A 1FKKA 3I6CA 4DWSA 2N87A 3H9RB 4ZPWR 1J4RA 4Z2IA 2D9FA 4C02B 3AROA 1HJVA 1Q6IA 1FAPA 1ZBWA 3WIJA 4TW6A 3ARTA 3JYJA 2DT1A 3ARPA 3CGNA 3NI6A 2MLXA 4DWSC 1QPFA 1E6NA 1QZ2A 3KCEA 4U86A 4DRQA 3ARRA 1L1PA 3NRKA 4S3JA 1EHNA 3ARSA 1GPFA 1W1PA 2K8IA 2ZQSA 5HWBA 2KGJA 1HXVA 5HT1A 4TNSA 1FD9A 3QOKA 4IT6A 3PRBA 1ZB5A 1Y0OA 4ODNA 1FKSA 2PPNA 2XP6A 5HW8A 2RSEA 3O5LA 3UF8A 2A3BA 4GIVA 1JNSA 2RQSA 3UQAA 4QT2A 4ZPVR 1E15A 3ARWA 3B9EA 1ZK6A 4J4NA 2AOSA 1D7HA 3O5RA 4IQ2A 4LAWA 4JYSA 4W9OA 2PV2A 5HW7A 3FY1A 2MNTA 4DRHA 3OA5A 3KZ7A 1HJWA 2KFWA 1U79A 3RM9A 1FKBA 2DG9A 2G8ZA 3KABA 4JFJA 3ALFA 4LAVA 3AS1A 2QF8A 4J4OA 1J4HA 2YBUA 4URIA 2ESCA 1VF8A 1BKFA 4Z2HA 1J6YA 4TX0A 2DSZA 2DT2A 3WQWA 1HJXA 1JVWA 4DRMA 4FN2A 5B8IC 3WD0A 1ZBKA 1WNOA 1D7JA 4BF8A 1IX5A 3UQIA 3WD3A 2WM0A 1W26A 2XP9A 4ODKA 3PRDA 3KADA 4WKFA 1Q6UA 1SYTA 1W9PA 5DITA 3B7XA 1X6NA 5DIUA 2FAPA 3WH0A 1LL7A 1FJDA 4MPKA 4QT3A 2PV3A 3AQUA 3RFWA 3TCZA 1E6ZA 4W9QA 3B9AA 1F40A 3NTPA 2RUQA 1XHGA 4FAPA 1W9VA 4JFKA 4JFIA 1FKIA 4LAYA 3W4RA 1QPLA 2DSWA 2KR7A 4DT4A 2WLYA 3WL1A 4Z2LA 2LPVA 4DZ2A 3ARZA 1E6PA 2IF4A 4LGXA 1LQ0A 4Z2KA 1FFRA 4L72B 4P8WA 3PA7A 4W5UA 1ZU8A 1F8AB 4ZPTR 5DIVA 5GPGA 3BXWA 2A3EA 1W9UA 1HKJA 5HTGA 1D6OA 2KO7A 4MGVA 4P8VA 3RGCA 4WIWA 2PPOA 5HBFA 4HBEA 4NSBA 2MLZA 3CHCA 2XP5A 3AS3A 1HKKA 1CTNA 2MF9A 3KAFA 2DSUA 4U85A 4ODOA 3JYMA 3JXVA 3FXYA 1D7IA 2AWGA 2DG4A 5GQBA 4GGQA 3LUOA 4W9PA 2WK2A 1EQ3A 1FKHA 3B8SA 3VAWA 4IQCA 4ODMA 1WAWA 1KT1A 2FKEA 2F4EA 3EY6A 2PI6A 3ARUA 2ZQTA 1KFWA 4ITZA 1GUVA 4HARA 4MNLA 4MAVA 3CHDA 4WKHA 3TDBA 1E6RA 2M1IA 3OOBA 4AY1A 3O5KA 4P8XA 1FKFA 3B9DA 3G6LA 3UQBA 3ARQA 4DRIA 1A7XA 3UI5A 2A3AA 1W1YA 5D75A 5HKGA 1FKJA 1EYMA 1FKLA 1TCOC 1E9LA 4P8UA 1YATA 2F21A 1FKDA 3UI4A 3CHFA 1FKTA 1JNEA 4Z2JA 2ZR6A 4G50A 3WD1A 3IK8A 1NMWA 2ITKA 2A3CA 3AS0A 2ZR4A 2PBCA 3WL0A 5I98A 3RM8A 4G2PA 2M2AA 1Q6HA 5DO2A 4ODRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UZ5 A;  3IKD A;  3O5L A;  3UF8 A;  4N19 A;  1PBK A;  4GIV A;  2RQS A;  2Q5A A;  3O5E A;  1JNS A;  3UQA A;  1KT0 A;  4QT2 A;  5HUA A;  1P5Q A;  1JNT A;  3MDY B;  2DG3 A;  1NSG A;  2VN1 A;  2XP3 A;  2ZR5 A;  1ZK6 A;  2MLY A;  4J4N A;  5HTG A;  5HWC A;  1D6O A;  3ODK A;  1D7H A;  1R9H A;  1B6C A;  2KO7 A;  2XP7 A;  3O5O A;  3O5R A;  3KAC A;  4IQ2 A;  4MGV A;  3RGC A;  4LAW A;  2PPO A;  4JYS A;  4W9O A;  2PV2 A;  5HW7 A;  1T11 A;  2MNT A;  4LAX A;  4DRH A;  1C9H A;  2MLZ A;  2PPP A;  3KZ7 A;  2KFW A;  1U79 A;  2XP5 A;  2KI3 A;  2XPA A;  1ROT A;  2RUD A;  1FKB A;  2MF9 A;  2DG9 A;  3KAG A;  3O5D A;  1ROU A;  3KAB A;  4JFJ A;  4LAV A;  2LKN A;  2VCD A;  5J6E A;  2OFN A;  3KAF A;  4R0X A;  2ZQU A;  3O5G A;  4U85 A;  4ODO A;  3JYM A;  4DRK A;  3O5Q A;  4J4O A;  1J4H A;  3IHZ A;  1FKG A;  3FAP A;  4O2T A;  1YW5 A;  3JXV A;  3O5F A;  4NNR A;  1ZCN A;  1BKF A;  1J6Y A;  4TX0 A;  1D7I A;  2AWG A;  2LJ4 A;  4ODQ A;  2PV1 A;  5BXJ A;  2DG4 A;  4DRM A;  1JVW A;  4FN2 A;  4QIB A;  2KE0 A;  3KAH A;  4GGQ A;  3LUO A;  4W9P A;  4DRP A;  5B8I C;  1EQ3 A;  2RUR A;  1FKH A;  1N1A A;  1D7J A;  3VAW A;  4IQC A;  2XPB A;  2MPH A;  1J4I A;  4ODM A;  4TW8 A;  4BF8 A;  2L2S A;  1KT1 A;  4DRO A;  2FKE A;  2F4E A;  3UQI A;  3EY6 A;  3CGM A;  1M5Y A;  2ZQT A;  1W26 A;  1PIN A;  2XP9 A;  4ODK A;  3PRD A;  3GPK A;  3KAD A;  4ITZ A;  3UI6 A;  1Q6U A;  4DRN A;  3O5M A;  4DZ3 A;  5DIT A;  2JZV A;  2XP8 A;  3B7X A;  1FKK A;  2Y78 A;  2FAP A;  5DIU A;  3WH0 A;  3I6C A;  4DRJ A;  1FJD A;  3TDB A;  4DIP A;  2M1I A;  3OOB A;  4TW7 A;  3O5K A;  4QT3 A;  2PV3 A;  2LGO A;  1FKF A;  2RSE A;  3RFW A;  4ODP A;  1FKR A;  3TCZ A;  4W9Q A;  2ZQV A;  2N87 A;  3H9R B;  1F40 A;  1J4R A;  3UQB A;  2D9F A;  4C02 B;  3NTP A;  3O5I A;  3TC5 A;  2RUQ A;  4DRI A;  1A7X A;  1FAP A;  1Q6I A;  4FAP A;  4TW6 A;  3JYJ A;  3UI5 A;  4JFK A;  4JFI A;  1FKI A;  4LAY A;  4MSP A;  3NI6 A;  3CGN A;  1QPL A;  4U84 A;  5D75 A;  2KR7 A;  2MLX A;  1QPF A;  5HKG A;  1FKJ A;  1QZ2 A;  1EYM A;  2F2D A;  3KAI A;  3KCE A;  1FKL A;  1TCO C;  4JFL A;  4U86 A;  4DRQ A;  4DT4 A;  1L1P A;  1Q1C A;  3NRK A;  1YAT A;  2F21 A;  4TYO A;  1FKD A;  3UI4 A;  4DH0 A;  2M08 A;  2LPV A;  2RUC A;  4ODL A;  1BL4 A;  4DZ2 A;  2K8I A;  2XP4 A;  1FKT A;  2ZQS A;  2ZR6 A;  2IF4 A;  4G50 A;  4IPX A;  5HW6 A;  3IK8 A;  5HWB A;  2KGJ A;  1HXV A;  3O5P A;  3PA7 A;  4TNS A;  1FD9 A;  3IKG A;  1NMV A;  1NMW A;  2ITK A;  3PRB A;  5HT1 A;  1Y0O A;  4JFM A;  1F8A B;  2ZR4 A;  4ODN A;  2PBC A;  5DIV A;  1FKS A;  5GPG A;  5I98 A;  2PPN A;  2XP6 A;  3O5J A;  4G2P A;  2M2A A;  5HW8 A;  1Q6H A;  4ODR A; 
#chains in the Genus database with same CATH topology
 1EDQ A;  2UZ5 A;  1SR0 A;  1OWQ A;  3PRA A;  4N19 A;  3O5E A;  2Q5A A;  1KT0 A;  3MDY B;  2VN1 A;  1NSG A;  2XP3 A;  2ZR5 A;  3G6M A;  4MSP A;  1R9H A;  1B6C A;  2XP7 A;  4DWS B;  4IT4 A;  4PTM A;  1T11 A;  2FDM A;  4HBO A;  1C9H A;  2G41 A;  4KR0 B;  2XPA A;  1ROT A;  2IUZ A;  1ROU A;  2LKN A;  2VCD A;  1OGG A;  2OFN A;  4R0X A;  3O5G A;  1LJY A;  3O5Q A;  1O6I A;  3IHZ A;  4O2T A;  1YW5 A;  4WK9 A;  3O5F A;  2ETN A;  1ZCN A;  3RME A;  4KQZ A;  4XAK A;  2LJ4 A;  3BMB A;  5BXJ A;  1LL4 A;  3CHE A;  4QIB A;  2KE0 A;  3KAH A;  2EUL A;  1JND A;  1LL6 A;  2RUR A;  4QZV B;  1LG1 A;  2MPH A;  1J4I A;  2XPB A;  4TW8 A;  3GTY X;  2L2S A;  1LG2 A;  4Z2G A;  1M5Y A;  1UR8 A;  2DSV A;  3ARX A;  2YBT A;  4DRN A;  4DZ3 A;  1NWU A;  2JZV A;  2Y78 A;  4DWS D;  4DRJ A;  1FFQ A;  4TW7 A;  3ARV A;  4Q7N A;  1GOI A;  2LGO A;  4MNM A;  4ODP A;  1FKR A;  3ALG A;  2ZQV A;  4Q22 A;  1H0I A;  3AS2 A;  3WD2 A;  1UR9 A;  3TC5 A;  3O5I A;  4MTV A;  5DF0 A;  2OLH A;  3PR9 A;  4U84 A;  2F2D A;  4JFL A;  3KAI A;  1Q1C A;  2P4V A;  1XRV A;  4TYO A;  2DT3 A;  4DH0 A;  2M08 A;  2RUC A;  4ODL A;  1W1V A;  1BL4 A;  3WD4 A;  2XP4 A;  4IPX A;  3RM4 A;  5JH8 A;  5HW6 A;  1D2K A;  4MNJ A;  3O5P A;  4L3N A;  3IKG A;  1NMV A;  4S3K A;  4WKA A;  4JFM A;  1WB0 A;  4NZC A;  4DIP A;  3O5J A;  3IKD A;  3CH9 A;  2DT0 A;  1NWR A;  1PBK A;  2PN0 A;  5HUA A;  1P5Q A;  1JNT A;  3WQV A;  2DG3 A;  3ARY A;  1ZL1 A;  2MLY A;  5HWC A;  2F23 A;  3ODK A;  1HKM A;  3O5O A;  4ZS6 A;  3KAC A;  1EIB A;  4LAX A;  2PPP A;  1NWT A;  1ZBC A;  2KI3 A;  1X6L A;  2RUD A;  3KAG A;  3O5D A;  3CZ8 A;  5DEZ A;  5GPR A;  1NH6 A;  5J6E A;  2O9O A;  2B31 A;  2ZQU A;  4DRK A;  2O92 A;  1FKG A;  3FAP A;  4NNR A;  2DPE A;  1K9T A;  1TFV A;  1H0G A;  1RD6 A;  3WKZ A;  4ODQ A;  2PV1 A;  1ITX A;  2WLZ A;  4WJX A;  4DRP A;  1OGB A;  1W1T A;  1N1A A;  4DRO A;  1HKI A;  4ML4 A;  3CGM A;  1PIN A;  1NWS A;  1ZBV A;  3GPK A;  3UI6 A;  3O5M A;  4R5E A;  4MNK A;  2XP8 A;  1FKK A;  3I6C A;  4DWS A;  2N87 A;  3H9R B;  4ZPW R;  1J4R A;  4Z2I A;  2D9F A;  4C02 B;  3ARO A;  1HJV A;  1Q6I A;  1FAP A;  1ZBW A;  3WIJ A;  4TW6 A;  3ART A;  3JYJ A;  2DT1 A;  3ARP A;  3CGN A;  3NI6 A;  2MLX A;  4DWS C;  1QPF A;  1E6N A;  1QZ2 A;  3KCE A;  4U86 A;  4DRQ A;  3ARR A;  1L1P A;  3NRK A;  4S3J A;  1EHN A;  3ARS A;  1GPF A;  1W1P A;  2K8I A;  2ZQS A;  5HWB A;  2KGJ A;  1HXV A;  5HT1 A;  4TNS A;  1FD9 A;  3QOK A;  4IT6 A;  3PRB A;  1ZB5 A;  1Y0O A;  4ODN A;  1FKS A;  2PPN A;  2XP6 A;  5HW8 A;  2RSE A;  3O5L A;  3UF8 A;  2A3B A;  4GIV A;  1JNS A;  2RQS A;  3UQA A;  4QT2 A;  4ZPV R;  1E15 A;  3ARW A;  3B9E A;  1ZK6 A;  4J4N A;  2AOS A;  1D7H A;  3O5R A;  4IQ2 A;  4LAW A;  4JYS A;  4W9O A;  2PV2 A;  5HW7 A;  3FY1 A;  2MNT A;  4DRH A;  3OA5 A;  3KZ7 A;  1HJW A;  2KFW A;  1U79 A;  3RM9 A;  1FKB A;  2DG9 A;  2G8Z A;  3KAB A;  4JFJ A;  3ALF A;  4LAV A;  3AS1 A;  2QF8 A;  4J4O A;  1J4H A;  4UDM A;  2YBU A;  4URI A;  2ESC A;  1VF8 A;  1BKF A;  4Z2H A;  1J6Y A;  4TX0 A;  2DSZ A;  2DT2 A;  3WQW A;  1HJX A;  1JVW A;  4DRM A;  4FN2 A;  5B8I C;  3WD0 A;  1ZBK A;  1WNO A;  1D7J A;  4BF8 A;  1IX5 A;  3UQI A;  3WD3 A;  2WM0 A;  1W26 A;  2XP9 A;  4ODK A;  3PRD A;  3KAD A;  4WKF A;  1Q6U A;  1SYT A;  1W9P A;  5DIT A;  3B7X A;  1X6N A;  1E44 A;  5DIU A;  2FAP A;  3WH0 A;  1LL7 A;  1FJD A;  4MPK A;  4QT3 A;  2PV3 A;  3AQU A;  3RFW A;  3TCZ A;  1E6Z A;  4W9Q A;  3B9A A;  1F40 A;  3NTP A;  2RUQ A;  1XHG A;  4FAP A;  1W9V A;  4JFK A;  4JFI A;  1FKI A;  4LAY A;  3W4R A;  1QPL A;  2DSW A;  2KR7 A;  4DT4 A;  2WLY A;  3WL1 A;  4Z2L A;  2LPV A;  4DZ2 A;  3ARZ A;  1E6P A;  2IF4 A;  4LGX A;  1LQ0 A;  4Z2K A;  1FFR A;  4L72 B;  4P8W A;  3PA7 A;  4W5U A;  1GRJ A;  1ZU8 A;  1F8A B;  4ZPT R;  5DIV A;  5GPG A;  3BXW A;  2A3E A;  1W9U A;  1HKJ A;  5HTG A;  1D6O A;  2KO7 A;  4MGV A;  4P8V A;  3RGC A;  4WIW A;  2PPO A;  5HBF A;  4HBE A;  4NSB A;  2MLZ A;  3CHC A;  2XP5 A;  3AS3 A;  1HKK A;  1CTN A;  2MF9 A;  2B5U B;  3KAF A;  3EIP A;  2DSU A;  4U85 A;  4ODO A;  3JYM A;  3JXV A;  3FXY A;  1D7I A;  2AWG A;  2DG4 A;  5GQB A;  4GGQ A;  3LUO A;  4W9P A;  2WK2 A;  1EQ3 A;  1FKH A;  3B8S A;  3VAW A;  4IQC A;  4ODM A;  1WAW A;  1KT1 A;  2FKE A;  2F4E A;  3EY6 A;  1JCH B;  2PI6 A;  2ZQT A;  3ARU A;  3GU0 A;  1KFW A;  4ITZ A;  1GUV A;  4HAR A;  4MNL A;  4MAV A;  3CHD A;  4WKH A;  3TDB A;  1E6R A;  2M1I A;  3OOB A;  4AY1 A;  3O5K A;  4P8X A;  1FKF A;  3B9D A;  3G6L A;  3UQB A;  3ARQ A;  4DRI A;  1A7X A;  3UI5 A;  2A3A A;  1W1Y A;  5D75 A;  5HKG A;  1FKJ A;  1EYM A;  1FKL A;  1TCO C;  1E9L A;  4P8U A;  1YAT A;  2F21 A;  1FKD A;  3UI4 A;  3CHF A;  1FKT A;  1JNE A;  4Z2J A;  2ZR6 A;  4G50 A;  3WD1 A;  3IK8 A;  1NMW A;  2ITK A;  2A3C A;  3AS0 A;  2ZR4 A;  2PBC A;  3WL0 A;  5I98 A;  3RM8 A;  4G2P A;  2M2A A;  1Q6H A;  5DO2 A;  4ODR A; 
#chains in the Genus database with same CATH homology
 1EDQ A;  2UZ5 A;  1SR0 A;  1OWQ A;  3PRA A;  4N19 A;  3O5E A;  2Q5A A;  1KT0 A;  3MDY B;  2VN1 A;  1NSG A;  2XP3 A;  2ZR5 A;  3G6M A;  4MSP A;  1R9H A;  1B6C A;  2XP7 A;  4DWS B;  4IT4 A;  4PTM A;  1T11 A;  2FDM A;  4HBO A;  1C9H A;  2G41 A;  4KR0 B;  2XPA A;  1ROT A;  2IUZ A;  1ROU A;  2LKN A;  2VCD A;  1OGG A;  2OFN A;  4R0X A;  3O5G A;  1LJY A;  3O5Q A;  1O6I A;  3IHZ A;  4O2T A;  1YW5 A;  4WK9 A;  3O5F A;  1ZCN A;  3RME A;  4KQZ A;  4XAK A;  2LJ4 A;  5BXJ A;  1LL4 A;  3CHE A;  4QIB A;  2KE0 A;  3KAH A;  1JND A;  1LL6 A;  2RUR A;  4QZV B;  1LG1 A;  2MPH A;  1J4I A;  2XPB A;  4TW8 A;  2L2S A;  1LG2 A;  4Z2G A;  1M5Y A;  1UR8 A;  2DSV A;  3ARX A;  2YBT A;  4DRN A;  4DZ3 A;  1NWU A;  2JZV A;  2Y78 A;  4DWS D;  4DRJ A;  1FFQ A;  4TW7 A;  3ARV A;  4Q7N A;  1GOI A;  2LGO A;  4MNM A;  4ODP A;  1FKR A;  3ALG A;  2ZQV A;  4Q22 A;  1H0I A;  3AS2 A;  3WD2 A;  1UR9 A;  3TC5 A;  3O5I A;  4MTV A;  5DF0 A;  2OLH A;  3PR9 A;  4U84 A;  2F2D A;  4JFL A;  3KAI A;  1Q1C A;  1XRV A;  4TYO A;  2DT3 A;  4DH0 A;  2M08 A;  2RUC A;  4ODL A;  1W1V A;  1BL4 A;  3WD4 A;  2XP4 A;  4IPX A;  3RM4 A;  5JH8 A;  5HW6 A;  1D2K A;  4MNJ A;  3O5P A;  4L3N A;  3IKG A;  1NMV A;  4S3K A;  4WKA A;  4JFM A;  1WB0 A;  4NZC A;  4DIP A;  3O5J A;  3IKD A;  3CH9 A;  2DT0 A;  1NWR A;  1PBK A;  5HUA A;  1P5Q A;  1JNT A;  3WQV A;  2DG3 A;  3ARY A;  1ZL1 A;  2MLY A;  5HWC A;  3ODK A;  1HKM A;  3O5O A;  4ZS6 A;  3KAC A;  1EIB A;  4LAX A;  2PPP A;  1NWT A;  1ZBC A;  2KI3 A;  1X6L A;  2RUD A;  3KAG A;  3O5D A;  3CZ8 A;  5DEZ A;  5GPR A;  1NH6 A;  5J6E A;  2O9O A;  2B31 A;  2ZQU A;  4DRK A;  2O92 A;  1FKG A;  3FAP A;  4NNR A;  2DPE A;  1K9T A;  1TFV A;  1H0G A;  1RD6 A;  3WKZ A;  4ODQ A;  2PV1 A;  1ITX A;  2WLZ A;  4WJX A;  4DRP A;  1OGB A;  1W1T A;  1N1A A;  4DRO A;  1HKI A;  4ML4 A;  3CGM A;  1PIN A;  1NWS A;  1ZBV A;  3GPK A;  3UI6 A;  3O5M A;  4R5E A;  4MNK A;  2XP8 A;  1FKK A;  3I6C A;  4DWS A;  2N87 A;  3H9R B;  4ZPW R;  1J4R A;  4Z2I A;  2D9F A;  4C02 B;  3ARO A;  1HJV A;  1Q6I A;  1FAP A;  1ZBW A;  3WIJ A;  4TW6 A;  3ART A;  3JYJ A;  2DT1 A;  3ARP A;  3CGN A;  3NI6 A;  2MLX A;  4DWS C;  1QPF A;  1E6N A;  1QZ2 A;  3KCE A;  4U86 A;  4DRQ A;  3ARR A;  1L1P A;  3NRK A;  4S3J A;  1EHN A;  3ARS A;  1GPF A;  1W1P A;  2K8I A;  2ZQS A;  5HWB A;  2KGJ A;  1HXV A;  5HT1 A;  4TNS A;  1FD9 A;  3QOK A;  4IT6 A;  3PRB A;  1ZB5 A;  1Y0O A;  4ODN A;  1FKS A;  2PPN A;  2XP6 A;  5HW8 A;  2RSE A;  3O5L A;  3UF8 A;  2A3B A;  4GIV A;  1JNS A;  2RQS A;  3UQA A;  4QT2 A;  4ZPV R;  1E15 A;  3ARW A;  3B9E A;  1ZK6 A;  4J4N A;  2AOS A;  1D7H A;  3O5R A;  4IQ2 A;  4LAW A;  4JYS A;  4W9O A;  2PV2 A;  5HW7 A;  3FY1 A;  2MNT A;  4DRH A;  3OA5 A;  3KZ7 A;  1HJW A;  2KFW A;  1U79 A;  3RM9 A;  1FKB A;  2DG9 A;  2G8Z A;  3KAB A;  4JFJ A;  3ALF A;  4LAV A;  3AS1 A;  2QF8 A;  4J4O A;  1J4H A;  2YBU A;  4URI A;  2ESC A;  1VF8 A;  1BKF A;  4Z2H A;  1J6Y A;  4TX0 A;  2DSZ A;  2DT2 A;  3WQW A;  1HJX A;  1JVW A;  4DRM A;  4FN2 A;  5B8I C;  3WD0 A;  1ZBK A;  1WNO A;  1D7J A;  4BF8 A;  1IX5 A;  3UQI A;  3WD3 A;  2WM0 A;  1W26 A;  2XP9 A;  4ODK A;  3PRD A;  3KAD A;  4WKF A;  1Q6U A;  1SYT A;  1W9P A;  5DIT A;  3B7X A;  1X6N A;  5DIU A;  2FAP A;  3WH0 A;  1LL7 A;  1FJD A;  4MPK A;  4QT3 A;  2PV3 A;  3AQU A;  3RFW A;  3TCZ A;  1E6Z A;  4W9Q A;  3B9A A;  1F40 A;  3NTP A;  2RUQ A;  1XHG A;  4FAP A;  1W9V A;  4JFK A;  4JFI A;  1FKI A;  4LAY A;  3W4R A;  1QPL A;  2DSW A;  2KR7 A;  4DT4 A;  2WLY A;  3WL1 A;  4Z2L A;  2LPV A;  4DZ2 A;  3ARZ A;  1E6P A;  2IF4 A;  4LGX A;  1LQ0 A;  4Z2K A;  1FFR A;  4L72 B;  4P8W A;  3PA7 A;  4W5U A;  1ZU8 A;  1F8A B;  4ZPT R;  5DIV A;  5GPG A;  3BXW A;  2A3E A;  1W9U A;  1HKJ A;  5HTG A;  1D6O A;  2KO7 A;  4MGV A;  4P8V A;  3RGC A;  4WIW A;  2PPO A;  5HBF A;  4HBE A;  4NSB A;  2MLZ A;  3CHC A;  2XP5 A;  3AS3 A;  1HKK A;  1CTN A;  2MF9 A;  3KAF A;  2DSU A;  4U85 A;  4ODO A;  3JYM A;  3JXV A;  3FXY A;  1D7I A;  2AWG A;  2DG4 A;  5GQB A;  4GGQ A;  3LUO A;  4W9P A;  2WK2 A;  1EQ3 A;  1FKH A;  3B8S A;  3VAW A;  4IQC A;  4ODM A;  1WAW A;  1KT1 A;  2FKE A;  2F4E A;  3EY6 A;  2PI6 A;  3ARU A;  2ZQT A;  1KFW A;  4ITZ A;  1GUV A;  4HAR A;  4MNL A;  4MAV A;  3CHD A;  4WKH A;  3TDB A;  1E6R A;  2M1I A;  3OOB A;  4AY1 A;  3O5K A;  4P8X A;  1FKF A;  3B9D A;  3G6L A;  3UQB A;  3ARQ A;  4DRI A;  1A7X A;  3UI5 A;  2A3A A;  1W1Y A;  5D75 A;  5HKG A;  1FKJ A;  1EYM A;  1FKL A;  1TCO C;  1E9L A;  4P8U A;  1YAT A;  2F21 A;  1FKD A;  3UI4 A;  3CHF A;  1FKT A;  1JNE A;  4Z2J A;  2ZR6 A;  4G50 A;  3WD1 A;  3IK8 A;  1NMW A;  2ITK A;  2A3C A;  3AS0 A;  2ZR4 A;  2PBC A;  3WL0 A;  5I98 A;  3RM8 A;  4G2P A;  2M2A A;  1Q6H A;  5DO2 A;  4ODR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...