4NNRA

Fkbp13-fk506 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
HCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP2
publication title Atomic structure of the Immunophilin FKBP13-FK506 Complex: Insights into the Composite Binding Surface for Calcineurin
doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 18
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4nnrA00
4LAXA 3PRDA 1A7XA 3CGMA 1FKFA 2XP9A 3ODKA 1JNTA 2RUDA 1NSGA 3UQIA 1D7JA 2RQSA 4ODQA 1F8AB 1FKJA 2MLYA 3NI6A 1M5YA 1FKHA 1Q1CA 2Y78A 3JYMA 3PRBA 2L2SA 3NRKA 3UI5A 1EQ3A 2ZQSA 1FAPA 4DIPA 2KGJA 3IK8A 2MPHA 4TW8A 4TW7A 5GPGA 1J4HA 3B7XA 4FN2A 4JFMA 4JYSA 2PPPA 2LGOA 2M2AA 4DRJA 1J6YA 1BKFA 3IKGA 1ZK6A 2KI3A 5B8IC 2ITKA 1ROTA 3LUOA 3WH0A 4DZ2A 5HKGA 1N1AA 2ZR6A 1ZCNA 1F40A 1FKRA 2AWGA 3KCEA 3RGCA 3O5FA 4DRMA 1NMWA 1TCOC 3O5LA 3O5MA 4ODOA 2PPOA 2ZR4A 4DRHA 1FKTA 2MLXA 2RURA 1EYMA 2N87A 5HWBA 4JFJA 2FAPA 4NNRA 2XP7A 3KAFA 4U84A 1JNSA 1FKGA 2ZQUA 2VN1A 2XP8A 1Q6UA 1Q6IA 3JYJA 3O5KA 1HXVA 2PV3A 4TW6A 4TYOA 4LAWA 1FKIA 3TCZA 1JVWA 5J6EA 3O5EA 5HW7A 2DG3A 3TC5A 4QIBA 1YW5A 4G2PA 3O5DA 1W26A 3RFWA 2RSEA 3CGNA 3UF8A 4R0XA 2IF4A 1PBKA 1Y0OA 2F4EA 2OFNA 2FKEA 4DRKA 3KAGA 4DRQA 4DZ3A 3KADA 5HW6A 3KABA 3OOBA 2RUCA 4J4OA 3O5QA 3UI6A 4BF8A 1C9HA 2Q5AA 4G50A 1FKLA 1P5QA 1R9HA 4ODMA 4ITZA 1D7HA 2JZVA 3KAHA 4JFKA 2XP4A 2XPAA 2PV2A 1FD9A 1FKKA 1B6CA 2K8IA 3GPKA 3JXVA 3O5PA 3H9RB 3O5IA 4MGVA 5HW8A 1QPFA 4ODKA 1KT0A 1FKBA 1J4RA 4C02B 1FKDA 2XP5A 4IQ2A 3KZ7A 2F2DA 2F21A 1Q6HA 2KFWA 4J4NA 4LAYA 2ZR5A 2PV1A 3PA7A 2ZQVA 4LAVA 5BXJA 1D6OA 3TDBA 4MSPA 4ODRA 3FAPA 4JFLA 4QT3A 3O5JA 2DG9A 3O5RA 3KAIA 1FJDA 5I98A 4DROA 2MLZA 1QPLA 4O2TA 4QT2A 4DRNA 5HT1A 3O5GA 4TNSA 1D7IA 4W9QA 3EY6A 5DIUA 1U79A 2KE0A 4U86A 5HUAA 2MF9A 4W9OA 3UI4A 4ODNA 3UQBA 4DRIA 2DG4A 2XP3A 1QZ2A 4DH0A 4IPXA 4GGQA 4ODLA 4W9PA 2VCDA 2LPVA 4N19A 1NMVA 5HTGA 5DITA 1T11A 1J4IA 2KO7A 2KR7A 3O5OA 1FKSA 1ROUA 4TX0A 4U85A 3I6CA 4IQCA 4DT4A 5HWCA 2PBCA 4GIVA 2LJ4A 2PPNA 2M1IA 3KACA 1PINA 2M08A 5D75A 4ODPA 3IHZA 3MDYB 1KT1A 1BL4A 4JFIA 1L1PA 1YATA 2RUQA 2UZ5A 2XPBA 2LKNA 2ZQTA 5DIVA 4FAPA 3NTPA 2MNTA 4DRPA 2D9FA 2XP6A 3UQAA 3VAWA 3IKDA
chains in the Genus database with same CATH superfamily
1NWSA 1A7XA 3CGMA 2XP9A 4P8UA 3B9AA 4Z2HA 1NSGA 1EIBA 5HBFA 1FKJA 2MLYA 3ARVA 1LG2A 1M5YA 2L2SA 1SR0A 3UI5A 2ZQSA 3RM4A 2O9OA 2KGJA 4TW7A 3ALGA 1J4HA 1IX5A 1LG1A 4DRJA 1J6YA 5B8IC 3LUOA 3ARSA 1ZCNA 1XHGA 1HJWA 2G41A 4Z2JA 1FKTA 2N87A 1JNSA 2FAPA 3KAFA 1UR8A 3GTYX 3BXWA 1LQ0A 2F23A 1Q6UA 1Q6IA 1HXVA 2DG3A 1YW5A 4G2PA 1W26A 3ARYA 5GPRA 1Y0OA 2F4EA 4AY1A 1W1YA 4IT6A 2RUCA 3O5QA 4BF8A 1WNOA 1X6LA 2Q5AA 3WD0A 1HJXA 1D7HA 2JZVA 3KAHA 4JFKA 2XP4A 2XPAA 4ODOA 2K8IA 1B6CA 1LL4A 4MGVA 4IT4A 1KT0A 4C02B 3ARTA 2XP5A 4W5UA 3KZ7A 2PV1A 2AOSA 4ODRA 1RD6A 3FAPA 1JNDA 3O5JA 1OGBA 3O5RA 2ESCA 3OA5A 3AS2A 3WQWA 3AS3A 1D7IA 4W9QA 1E6RA 5HUAA 1JNEA 5HTGA 4N19A 1GPFA 5DITA 1J4IA 4TX0A 4GIVA 2PPNA 2M1IA 3IHZA 1BL4A 1H0IA 1HKIA 3B8SA 1TFVA 3UQAA 3CHCA 4LAXA 3PRDA 1D7JA 4XAKA 4DWSD 3WIJA 1EQ3A 1FAPA 4DIPA 4HARA 3IK8A 1H0GA 4ZPWR 4FN2A 1W1PA 3PRAA 3PR9A 1GOIA 5DF0A 3CZ8A 3WD1A 1BKFA 2KI3A 2ITKA 3WD3A 2WM0A 3G6LA 4Z2LA 3WH0A 2PI6A 1FKRA 1NMWA 1TCOC 2QF8A 1E6NA 3O5MA 2RURA 1JCHB 2VN1A 2XP8A 3JYJA 3QOKA 4TYOA 4LAWA 1JVWA 5J6EA 3O5EA 5HW7A 1LL7A 1EDQA 3AS0A 2IF4A 1PBKA 4Q22A 3BMBA 5HW6A 3CHDA 1XRVA 2A3AA 1VF8A 1ZBVA 4ODMA 4MPKA 1X6NA 3GPKA 1NWUA 1FD9A 1FKKA 1KFWA 4WK9A 1HKMA 5HW8A 1QPFA 4ODKA 3EIPA 1NH6A 3WD2A 1FKDA 4WKFA 2ZQVA 3WKZA 5DO2A 4Q7NA 2DG9A 3WQVA 3KAIA 3WL0A 3WD4A 4QT2A 4DRNA 3O5GA 3ARXA 3EY6A 2KE0A 2MF9A 3UI4A 4DRIA 3GU0A 4IPXA 4W9PA 2VCDA 4ML4A 2KR7A 1FKSA 1ROUA 4U85A 4DT4A 1FFQA 2WLZA 3ARPA 3RMEA 4Z2IA 3FXYA 2A3BA 4L3NA 3RM9A 4MNKA 1L1PA 2UZ5A 4FAPA 2LKNA 2MNTA 1O6IA 5I98A 1GUVA 1ZBKA 4JFJA 1ZBWA 2IUZA 3TDBA 1FKFA 3ODKA 2A3CA 2WLYA 2RQSA 4ODQA 1Q1CA 2DT2A 2Y78A 4KR0B 3G6MA 4WJXA 2FDMA 4JYSA 2PPPA 2LGOA 2M2AA 1HKKA 2DT0A 4LGXA 1ITXA 3IKGA 1HJVA 1ROTA 2DT1A 4DZ2A 5HKGA 2ZR6A 4MNJA 2AWGA 3KCEA 3RGCA 4Z2GA 4DWSA 1E6ZA 4L72B 4DRHA 2MLXA 1EYMA 4NNRA 2XP7A 2ZQUA 3CHEA 2B31A 3TCZA 4ZPTR 4ZPVR 4ZS6A 4QIBA 1ZL1A 3O5DA 2G8ZA 2RSEA 3CGNA 4R0XA 5GQBA 3RM8A 1WAWA 2DT3A 2FKEA 4DRQA 3AQUA 3OOBA 4J4OA 4Z2KA 4WIWA 3UI6A 1C9HA 4NSBA 1P5QA 1FFRA 2PV2A 1K9TA 3O5IA 3JXVA 3O5PA 3H9RB 2WK2A 1J4RA 1CTNA 1ZU8A 4UDMA 3FY1A 2F2DA 2KFWA 4LAYA 2ZR5A 3PA7A 4LAVA 5BXJA 1NWRA 2OLHA 4JFLA 4PTMA 4QT3A 1EHNA 1SYTA 4DWSB 2B5UB 4S3KA 4O2TA 3B9DA 2EULA 4HBEA 2O92A 5HT1A 4U86A 2DSUA 3UQBA 3W4RA 4DH0A 1T11A 2KO7A 5HWCA 3ALFA 3I6CA 2PBCA 3KACA 4ODPA 1KT1A 2ZQTA 1W9UA 3NTPA 4DRPA 1ZB5A 4MNLA 1W1VA 2YBTA 1JNTA 2RUDA 3UQIA 1F8AB 3NI6A 1W9VA 1FKHA 3JYMA 3PRBA 3NRKA 4NZCA 4WKHA 2MPHA 4TW8A 5GPGA 3B7XA 4JFMA 1LJYA 2P4VA 4P8XA 3ARWA 4MTVA 1ZK6A 4URIA 1N1AA 1OGGA 4MAVA 1HKJA 1W9PA 3O5FA 3ARQA 4DRMA 3O5LA 2PPOA 2ZR4A 5HWBA 2DSVA 4U84A 3B9EA 1FKGA 1E44A 3WL1A 3CH9A 5JH8A 1W1TA 3O5KA 2PV3A 4TW6A 1FKIA 4S3JA 2A3EA 1E15A 3TC5A 4DWSC 3RFWA 3AS1A 3ARZA 5DEZA 3UF8A 2OFNA 4DRKA 3KAGA 4DZ3A 3KADA 3KABA 2YBUA 4R5EA 3ARUA 4G50A 1FKLA 1R9HA 4ITZA 4WKAA 5DIVA 1F40A 2DSZA 4P8VA 1FKBA 1E6PA 3CHFA 3AROA 1UR9A 4IQ2A 4J4NA 2F21A 1Q6HA 2PN0A 1D2KA 1D6OA 4QZVB 3ARRA 1GRJA 4MSPA 4HBOA 1FJDA 4P8WA 4DROA 2MLZA 1QPLA 1E9LA 4TNSA 1NWTA 2ETNA 1WB0A 1OWQA 5DIUA 1U79A 4W9OA 4ODNA 2DG4A 2XP3A 1QZ2A 4GGQA 4ODLA 2LPVA 1NMVA 3O5OA 1LL6A 4IQCA 2LJ4A 1ZBCA 5D75A 1PINA 2DPEA 2M08A 2DSWA 3MDYB 4MNMA 4JFIA 4KQZA 1YATA 2RUQA 2XPBA 2D9FA 2XP6A 3VAWA 3IKDA
chains in the Genus database with same CATH topology
1NWSA 1A7XA 3CGMA 2XP9A 4P8UA 3B9AA 4Z2HA 1NSGA 1EIBA 5HBFA 1FKJA 2MLYA 3ARVA 1LG2A 1M5YA 2L2SA 1SR0A 3UI5A 2ZQSA 3RM4A 2O9OA 2KGJA 4TW7A 3ALGA 1J4HA 1IX5A 1LG1A 4DRJA 1J6YA 5B8IC 3LUOA 3ARSA 1ZCNA 1XHGA 1HJWA 2G41A 4Z2JA 1FKTA 2N87A 1JNSA 2FAPA 3KAFA 1UR8A 3BXWA 1LQ0A 1Q6UA 1Q6IA 1HXVA 2DG3A 1YW5A 4G2PA 1W26A 3ARYA 5GPRA 1Y0OA 2F4EA 4AY1A 1W1YA 4IT6A 2RUCA 3O5QA 4BF8A 1WNOA 1X6LA 2Q5AA 3WD0A 1HJXA 1D7HA 2JZVA 3KAHA 4JFKA 2XP4A 2XPAA 4ODOA 2K8IA 1B6CA 1LL4A 4MGVA 4IT4A 1KT0A 4C02B 3ARTA 2XP5A 4W5UA 3KZ7A 2PV1A 2AOSA 4ODRA 1RD6A 3FAPA 1JNDA 3O5JA 1OGBA 3O5RA 2ESCA 3OA5A 3AS2A 3WQWA 3AS3A 1D7IA 4W9QA 1E6RA 5HUAA 1JNEA 5HTGA 4N19A 1GPFA 5DITA 1J4IA 4TX0A 4GIVA 2PPNA 2M1IA 3IHZA 1BL4A 1H0IA 1HKIA 3B8SA 1TFVA 3UQAA 3CHCA 4LAXA 3PRDA 1D7JA 4XAKA 4DWSD 3WIJA 1EQ3A 1FAPA 4DIPA 4HARA 3IK8A 1H0GA 4ZPWR 4FN2A 1W1PA 3PRAA 3PR9A 1GOIA 5DF0A 3CZ8A 3WD1A 1BKFA 2KI3A 2ITKA 3WD3A 2WM0A 3G6LA 4Z2LA 3WH0A 2PI6A 1FKRA 1NMWA 1TCOC 2QF8A 1E6NA 3O5MA 2RURA 2VN1A 2XP8A 3JYJA 3QOKA 4TYOA 4LAWA 1JVWA 5J6EA 3O5EA 5HW7A 1LL7A 1EDQA 3AS0A 2IF4A 1PBKA 4Q22A 5HW6A 3CHDA 1XRVA 2A3AA 1VF8A 1ZBVA 4ODMA 4MPKA 1X6NA 3GPKA 1NWUA 1FD9A 1FKKA 1KFWA 4WK9A 1HKMA 5HW8A 1QPFA 4ODKA 1NH6A 3WD2A 1FKDA 4WKFA 2ZQVA 3WKZA 5DO2A 4Q7NA 2DG9A 3WQVA 3KAIA 3WL0A 3WD4A 4QT2A 4DRNA 3O5GA 3ARXA 3EY6A 2KE0A 2MF9A 3UI4A 4DRIA 4IPXA 4W9PA 2VCDA 4ML4A 2KR7A 1FKSA 1ROUA 4U85A 4DT4A 1FFQA 2WLZA 3ARPA 3RMEA 4Z2IA 3FXYA 2A3BA 4L3NA 3RM9A 4MNKA 1L1PA 2UZ5A 4FAPA 2LKNA 2MNTA 1O6IA 5I98A 1GUVA 1ZBKA 4JFJA 1ZBWA 2IUZA 3TDBA 1FKFA 3ODKA 2A3CA 2WLYA 2RQSA 4ODQA 1Q1CA 2DT2A 2Y78A 4KR0B 3G6MA 4WJXA 2FDMA 4JYSA 2PPPA 2LGOA 2M2AA 1HKKA 2DT0A 4LGXA 1ITXA 3IKGA 1HJVA 1ROTA 2DT1A 4DZ2A 5HKGA 2ZR6A 4MNJA 2AWGA 3KCEA 3RGCA 4Z2GA 4DWSA 1E6ZA 4L72B 4DRHA 2MLXA 1EYMA 4NNRA 2XP7A 2ZQUA 3CHEA 2B31A 3TCZA 4ZPTR 4ZPVR 4ZS6A 4QIBA 1ZL1A 3O5DA 2G8ZA 2RSEA 3CGNA 4R0XA 5GQBA 3RM8A 1WAWA 2DT3A 2FKEA 4DRQA 3AQUA 3OOBA 4J4OA 4Z2KA 4WIWA 3UI6A 1C9HA 4NSBA 1P5QA 1FFRA 2PV2A 1K9TA 3O5IA 3JXVA 3O5PA 3H9RB 2WK2A 1J4RA 1CTNA 1ZU8A 3FY1A 2F2DA 2KFWA 4LAYA 2ZR5A 3PA7A 4LAVA 5BXJA 1NWRA 2OLHA 4JFLA 4PTMA 4QT3A 1EHNA 1SYTA 4DWSB 4S3KA 4O2TA 3B9DA 4HBEA 2O92A 5HT1A 4U86A 2DSUA 3UQBA 3W4RA 4DH0A 1T11A 2KO7A 5HWCA 3ALFA 3I6CA 2PBCA 3KACA 4ODPA 1KT1A 2ZQTA 1W9UA 3NTPA 4DRPA 1ZB5A 4MNLA 1W1VA 2YBTA 1JNTA 2RUDA 3UQIA 1F8AB 3NI6A 1W9VA 1FKHA 3JYMA 3PRBA 3NRKA 4NZCA 4WKHA 2MPHA 4TW8A 5GPGA 3B7XA 4JFMA 1LJYA 4P8XA 3ARWA 4MTVA 1ZK6A 4URIA 1N1AA 1OGGA 4MAVA 1HKJA 1W9PA 3O5FA 3ARQA 4DRMA 3O5LA 2PPOA 2ZR4A 5HWBA 2DSVA 4U84A 3B9EA 1FKGA 3WL1A 3CH9A 5JH8A 1W1TA 3O5KA 2PV3A 4TW6A 1FKIA 4S3JA 2A3EA 1E15A 3TC5A 4DWSC 3RFWA 3AS1A 3ARZA 5DEZA 3UF8A 2OFNA 4DRKA 3KAGA 4DZ3A 3KADA 3KABA 2YBUA 4R5EA 3ARUA 4G50A 1FKLA 1R9HA 4ITZA 4WKAA 5DIVA 1F40A 2DSZA 4P8VA 1FKBA 1E6PA 3CHFA 3AROA 1UR9A 4IQ2A 4J4NA 2F21A 1Q6HA 1D2KA 1D6OA 4QZVB 3ARRA 4MSPA 4HBOA 1FJDA 4P8WA 4DROA 2MLZA 1QPLA 1E9LA 4TNSA 1NWTA 1WB0A 1OWQA 5DIUA 1U79A 4W9OA 4ODNA 2DG4A 2XP3A 1QZ2A 4GGQA 4ODLA 2LPVA 1NMVA 3O5OA 1LL6A 4IQCA 2LJ4A 1ZBCA 5D75A 1PINA 2DPEA 2M08A 2DSWA 3MDYB 4MNMA 4JFIA 4KQZA 1YATA 2RUQA 2XPBA 2D9FA 2XP6A 3VAWA 3IKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LAX A;  3PRD A;  1A7X A;  3CGM A;  1FKF A;  2XP9 A;  3ODK A;  1JNT A;  2RUD A;  1NSG A;  3UQI A;  1D7J A;  2RQS A;  4ODQ A;  1F8A B;  1FKJ A;  2MLY A;  3NI6 A;  1M5Y A;  1FKH A;  1Q1C A;  2Y78 A;  3JYM A;  3PRB A;  2L2S A;  3NRK A;  3UI5 A;  1EQ3 A;  2ZQS A;  1FAP A;  4DIP A;  2KGJ A;  3IK8 A;  2MPH A;  4TW8 A;  4TW7 A;  5GPG A;  1J4H A;  3B7X A;  4FN2 A;  4JFM A;  4JYS A;  2PPP A;  2LGO A;  2M2A A;  4DRJ A;  1J6Y A;  1BKF A;  3IKG A;  1ZK6 A;  2KI3 A;  5B8I C;  2ITK A;  1ROT A;  3LUO A;  3WH0 A;  4DZ2 A;  5HKG A;  1N1A A;  2ZR6 A;  1ZCN A;  1F40 A;  1FKR A;  2AWG A;  3KCE A;  3RGC A;  3O5F A;  4DRM A;  1NMW A;  1TCO C;  3O5L A;  3O5M A;  4ODO A;  2PPO A;  2ZR4 A;  4DRH A;  1FKT A;  2MLX A;  2RUR A;  1EYM A;  2N87 A;  5HWB A;  4JFJ A;  2FAP A;  4NNR A;  2XP7 A;  3KAF A;  4U84 A;  1JNS A;  1FKG A;  2ZQU A;  2VN1 A;  2XP8 A;  1Q6U A;  1Q6I A;  3JYJ A;  3O5K A;  1HXV A;  2PV3 A;  4TW6 A;  4TYO A;  4LAW A;  1FKI A;  3TCZ A;  1JVW A;  5J6E A;  3O5E A;  5HW7 A;  2DG3 A;  3TC5 A;  4QIB A;  1YW5 A;  4G2P A;  3O5D A;  1W26 A;  3RFW A;  2RSE A;  3CGN A;  3UF8 A;  4R0X A;  2IF4 A;  1PBK A;  1Y0O A;  2F4E A;  2OFN A;  2FKE A;  4DRK A;  3KAG A;  4DRQ A;  4DZ3 A;  3KAD A;  5HW6 A;  3KAB A;  3OOB A;  2RUC A;  4J4O A;  3O5Q A;  3UI6 A;  4BF8 A;  1C9H A;  2Q5A A;  4G50 A;  1FKL A;  1P5Q A;  1R9H A;  4ODM A;  4ITZ A;  1D7H A;  2JZV A;  3KAH A;  4JFK A;  2XP4 A;  2XPA A;  2PV2 A;  1FD9 A;  1FKK A;  1B6C A;  2K8I A;  3GPK A;  3JXV A;  3O5P A;  3H9R B;  3O5I A;  4MGV A;  5HW8 A;  1QPF A;  4ODK A;  1KT0 A;  1FKB A;  1J4R A;  4C02 B;  1FKD A;  2XP5 A;  4IQ2 A;  3KZ7 A;  2F2D A;  2F21 A;  1Q6H A;  2KFW A;  4J4N A;  4LAY A;  2ZR5 A;  2PV1 A;  3PA7 A;  2ZQV A;  4LAV A;  5BXJ A;  1D6O A;  3TDB A;  4MSP A;  4ODR A;  3FAP A;  4JFL A;  4QT3 A;  3O5J A;  2DG9 A;  3O5R A;  3KAI A;  1FJD A;  5I98 A;  4DRO A;  2MLZ A;  1QPL A;  4O2T A;  4QT2 A;  4DRN A;  5HT1 A;  3O5G A;  4TNS A;  1D7I A;  4W9Q A;  3EY6 A;  5DIU A;  1U79 A;  2KE0 A;  4U86 A;  5HUA A;  2MF9 A;  4W9O A;  3UI4 A;  4ODN A;  3UQB A;  4DRI A;  2DG4 A;  2XP3 A;  1QZ2 A;  4DH0 A;  4IPX A;  4GGQ A;  4ODL A;  4W9P A;  2VCD A;  2LPV A;  4N19 A;  1NMV A;  5HTG A;  5DIT A;  1T11 A;  1J4I A;  2KO7 A;  2KR7 A;  3O5O A;  1FKS A;  1ROU A;  4TX0 A;  4U85 A;  3I6C A;  4IQC A;  4DT4 A;  5HWC A;  2PBC A;  4GIV A;  2LJ4 A;  2PPN A;  2M1I A;  3KAC A;  1PIN A;  2M08 A;  5D75 A;  4ODP A;  3IHZ A;  3MDY B;  1KT1 A;  1BL4 A;  4JFI A;  1L1P A;  1YAT A;  2RUQ A;  2UZ5 A;  2XPB A;  2LKN A;  2ZQT A;  5DIV A;  4FAP A;  3NTP A;  2MNT A;  4DRP A;  2D9F A;  2XP6 A;  3UQA A;  3VAW A;  3IKD A; 
#chains in the Genus database with same CATH topology
 1NWS A;  1A7X A;  3CGM A;  2XP9 A;  4P8U A;  3B9A A;  4Z2H A;  1NSG A;  1EIB A;  5HBF A;  1FKJ A;  2MLY A;  3ARV A;  1LG2 A;  1M5Y A;  2L2S A;  1SR0 A;  3UI5 A;  2ZQS A;  3RM4 A;  2O9O A;  2KGJ A;  4TW7 A;  3ALG A;  1J4H A;  1IX5 A;  1LG1 A;  4DRJ A;  1J6Y A;  5B8I C;  3LUO A;  3ARS A;  1ZCN A;  1XHG A;  1HJW A;  2G41 A;  4Z2J A;  1FKT A;  2N87 A;  1JNS A;  2FAP A;  3KAF A;  1UR8 A;  3GTY X;  3BXW A;  1LQ0 A;  2F23 A;  1Q6U A;  1Q6I A;  1HXV A;  2DG3 A;  1YW5 A;  4G2P A;  1W26 A;  3ARY A;  5GPR A;  1Y0O A;  2F4E A;  4AY1 A;  1W1Y A;  4IT6 A;  2RUC A;  3O5Q A;  4BF8 A;  1WNO A;  1X6L A;  2Q5A A;  3WD0 A;  1HJX A;  1D7H A;  2JZV A;  3KAH A;  4JFK A;  2XP4 A;  2XPA A;  4ODO A;  2K8I A;  1B6C A;  1LL4 A;  4MGV A;  4IT4 A;  1KT0 A;  4C02 B;  3ART A;  2XP5 A;  4W5U A;  3KZ7 A;  2PV1 A;  2AOS A;  4ODR A;  1RD6 A;  3FAP A;  1JND A;  3O5J A;  1OGB A;  3O5R A;  2ESC A;  3OA5 A;  3AS2 A;  3WQW A;  3AS3 A;  1D7I A;  4W9Q A;  1E6R A;  5HUA A;  1JNE A;  5HTG A;  4N19 A;  1GPF A;  5DIT A;  1J4I A;  4TX0 A;  4GIV A;  2PPN A;  2M1I A;  3IHZ A;  1BL4 A;  1H0I A;  1HKI A;  3B8S A;  1TFV A;  3UQA A;  3CHC A;  4LAX A;  3PRD A;  1D7J A;  4XAK A;  4DWS D;  3WIJ A;  1EQ3 A;  1FAP A;  4DIP A;  4HAR A;  3IK8 A;  1H0G A;  4ZPW R;  4FN2 A;  1W1P A;  3PRA A;  3PR9 A;  1GOI A;  5DF0 A;  3CZ8 A;  3WD1 A;  1BKF A;  2KI3 A;  2ITK A;  3WD3 A;  2WM0 A;  3G6L A;  4Z2L A;  3WH0 A;  2PI6 A;  1FKR A;  1NMW A;  1TCO C;  2QF8 A;  1E6N A;  3O5M A;  2RUR A;  1JCH B;  2VN1 A;  2XP8 A;  3JYJ A;  3QOK A;  4TYO A;  4LAW A;  1JVW A;  5J6E A;  3O5E A;  5HW7 A;  1LL7 A;  1EDQ A;  3AS0 A;  2IF4 A;  1PBK A;  4Q22 A;  3BMB A;  5HW6 A;  3CHD A;  1XRV A;  2A3A A;  1VF8 A;  1ZBV A;  4ODM A;  4MPK A;  1X6N A;  3GPK A;  1NWU A;  1FD9 A;  1FKK A;  1KFW A;  4WK9 A;  1HKM A;  5HW8 A;  1QPF A;  4ODK A;  3EIP A;  1NH6 A;  3WD2 A;  1FKD A;  4WKF A;  2ZQV A;  3WKZ A;  5DO2 A;  4Q7N A;  2DG9 A;  3WQV A;  3KAI A;  3WL0 A;  3WD4 A;  4QT2 A;  4DRN A;  3O5G A;  3ARX A;  3EY6 A;  2KE0 A;  2MF9 A;  3UI4 A;  4DRI A;  3GU0 A;  4IPX A;  4W9P A;  2VCD A;  4ML4 A;  2KR7 A;  1FKS A;  1ROU A;  4U85 A;  4DT4 A;  1FFQ A;  2WLZ A;  3ARP A;  3RME A;  4Z2I A;  3FXY A;  2A3B A;  4L3N A;  3RM9 A;  4MNK A;  1L1P A;  2UZ5 A;  4FAP A;  2LKN A;  2MNT A;  1O6I A;  5I98 A;  1GUV A;  1ZBK A;  4JFJ A;  1ZBW A;  2IUZ A;  3TDB A;  1FKF A;  3ODK A;  2A3C A;  2WLY A;  2RQS A;  4ODQ A;  1Q1C A;  2DT2 A;  2Y78 A;  4KR0 B;  3G6M A;  4WJX A;  2FDM A;  4JYS A;  2PPP A;  2LGO A;  2M2A A;  1HKK A;  2DT0 A;  4LGX A;  1ITX A;  3IKG A;  1HJV A;  1ROT A;  2DT1 A;  4DZ2 A;  5HKG A;  2ZR6 A;  4MNJ A;  2AWG A;  3KCE A;  3RGC A;  4Z2G A;  4DWS A;  1E6Z A;  4L72 B;  4DRH A;  2MLX A;  1EYM A;  4NNR A;  2XP7 A;  2ZQU A;  3CHE A;  2B31 A;  3TCZ A;  4ZPT R;  4ZPV R;  4ZS6 A;  4QIB A;  1ZL1 A;  3O5D A;  2G8Z A;  2RSE A;  3CGN A;  4R0X A;  5GQB A;  3RM8 A;  1WAW A;  2DT3 A;  2FKE A;  4DRQ A;  3AQU A;  3OOB A;  4J4O A;  4Z2K A;  4WIW A;  3UI6 A;  1C9H A;  4NSB A;  1P5Q A;  1FFR A;  2PV2 A;  1K9T A;  3O5I A;  3JXV A;  3O5P A;  3H9R B;  2WK2 A;  1J4R A;  1CTN A;  1ZU8 A;  4UDM A;  3FY1 A;  2F2D A;  2KFW A;  4LAY A;  2ZR5 A;  3PA7 A;  4LAV A;  5BXJ A;  1NWR A;  2OLH A;  4JFL A;  4PTM A;  4QT3 A;  1EHN A;  1SYT A;  4DWS B;  2B5U B;  4S3K A;  4O2T A;  3B9D A;  2EUL A;  4HBE A;  2O92 A;  5HT1 A;  4U86 A;  2DSU A;  3UQB A;  3W4R A;  4DH0 A;  1T11 A;  2KO7 A;  5HWC A;  3ALF A;  3I6C A;  2PBC A;  3KAC A;  4ODP A;  1KT1 A;  2ZQT A;  1W9U A;  3NTP A;  4DRP A;  1ZB5 A;  4MNL A;  1W1V A;  2YBT A;  1JNT A;  2RUD A;  3UQI A;  1F8A B;  3NI6 A;  1W9V A;  1FKH A;  3JYM A;  3PRB A;  3NRK A;  4NZC A;  4WKH A;  2MPH A;  4TW8 A;  5GPG A;  3B7X A;  4JFM A;  1LJY A;  2P4V A;  4P8X A;  3ARW A;  4MTV A;  1ZK6 A;  4URI A;  1N1A A;  1OGG A;  4MAV A;  1HKJ A;  1W9P A;  3O5F A;  3ARQ A;  4DRM A;  3O5L A;  2PPO A;  2ZR4 A;  5HWB A;  2DSV A;  4U84 A;  3B9E A;  1FKG A;  1E44 A;  3WL1 A;  3CH9 A;  5JH8 A;  1W1T A;  3O5K A;  2PV3 A;  4TW6 A;  1FKI A;  4S3J A;  2A3E A;  1E15 A;  3TC5 A;  4DWS C;  3RFW A;  3AS1 A;  3ARZ A;  5DEZ A;  3UF8 A;  2OFN A;  4DRK A;  3KAG A;  4DZ3 A;  3KAD A;  3KAB A;  2YBU A;  4R5E A;  3ARU A;  4G50 A;  1FKL A;  1R9H A;  4ITZ A;  4WKA A;  5DIV A;  1F40 A;  2DSZ A;  4P8V A;  1FKB A;  1E6P A;  3CHF A;  3ARO A;  1UR9 A;  4IQ2 A;  4J4N A;  2F21 A;  1Q6H A;  2PN0 A;  1D2K A;  1D6O A;  4QZV B;  3ARR A;  1GRJ A;  4MSP A;  4HBO A;  1FJD A;  4P8W A;  4DRO A;  2MLZ A;  1QPL A;  1E9L A;  4TNS A;  1NWT A;  2ETN A;  1WB0 A;  1OWQ A;  5DIU A;  1U79 A;  4W9O A;  4ODN A;  2DG4 A;  2XP3 A;  1QZ2 A;  4GGQ A;  4ODL A;  2LPV A;  1NMV A;  3O5O A;  1LL6 A;  4IQC A;  2LJ4 A;  1ZBC A;  5D75 A;  1PIN A;  2DPE A;  2M08 A;  2DSW A;  3MDY B;  4MNM A;  4JFI A;  4KQZ A;  1YAT A;  2RUQ A;  2XPB A;  2D9F A;  2XP6 A;  3VAW A;  3IKD A; 
#chains in the Genus database with same CATH homology
 1NWS A;  1A7X A;  3CGM A;  2XP9 A;  4P8U A;  3B9A A;  4Z2H A;  1NSG A;  1EIB A;  5HBF A;  1FKJ A;  2MLY A;  3ARV A;  1LG2 A;  1M5Y A;  2L2S A;  1SR0 A;  3UI5 A;  2ZQS A;  3RM4 A;  2O9O A;  2KGJ A;  4TW7 A;  3ALG A;  1J4H A;  1IX5 A;  1LG1 A;  4DRJ A;  1J6Y A;  5B8I C;  3LUO A;  3ARS A;  1ZCN A;  1XHG A;  1HJW A;  2G41 A;  4Z2J A;  1FKT A;  2N87 A;  1JNS A;  2FAP A;  3KAF A;  1UR8 A;  3BXW A;  1LQ0 A;  1Q6U A;  1Q6I A;  1HXV A;  2DG3 A;  1YW5 A;  4G2P A;  1W26 A;  3ARY A;  5GPR A;  1Y0O A;  2F4E A;  4AY1 A;  1W1Y A;  4IT6 A;  2RUC A;  3O5Q A;  4BF8 A;  1WNO A;  1X6L A;  2Q5A A;  3WD0 A;  1HJX A;  1D7H A;  2JZV A;  3KAH A;  4JFK A;  2XP4 A;  2XPA A;  4ODO A;  2K8I A;  1B6C A;  1LL4 A;  4MGV A;  4IT4 A;  1KT0 A;  4C02 B;  3ART A;  2XP5 A;  4W5U A;  3KZ7 A;  2PV1 A;  2AOS A;  4ODR A;  1RD6 A;  3FAP A;  1JND A;  3O5J A;  1OGB A;  3O5R A;  2ESC A;  3OA5 A;  3AS2 A;  3WQW A;  3AS3 A;  1D7I A;  4W9Q A;  1E6R A;  5HUA A;  1JNE A;  5HTG A;  4N19 A;  1GPF A;  5DIT A;  1J4I A;  4TX0 A;  4GIV A;  2PPN A;  2M1I A;  3IHZ A;  1BL4 A;  1H0I A;  1HKI A;  3B8S A;  1TFV A;  3UQA A;  3CHC A;  4LAX A;  3PRD A;  1D7J A;  4XAK A;  4DWS D;  3WIJ A;  1EQ3 A;  1FAP A;  4DIP A;  4HAR A;  3IK8 A;  1H0G A;  4ZPW R;  4FN2 A;  1W1P A;  3PRA A;  3PR9 A;  1GOI A;  5DF0 A;  3CZ8 A;  3WD1 A;  1BKF A;  2KI3 A;  2ITK A;  3WD3 A;  2WM0 A;  3G6L A;  4Z2L A;  3WH0 A;  2PI6 A;  1FKR A;  1NMW A;  1TCO C;  2QF8 A;  1E6N A;  3O5M A;  2RUR A;  2VN1 A;  2XP8 A;  3JYJ A;  3QOK A;  4TYO A;  4LAW A;  1JVW A;  5J6E A;  3O5E A;  5HW7 A;  1LL7 A;  1EDQ A;  3AS0 A;  2IF4 A;  1PBK A;  4Q22 A;  5HW6 A;  3CHD A;  1XRV A;  2A3A A;  1VF8 A;  1ZBV A;  4ODM A;  4MPK A;  1X6N A;  3GPK A;  1NWU A;  1FD9 A;  1FKK A;  1KFW A;  4WK9 A;  1HKM A;  5HW8 A;  1QPF A;  4ODK A;  1NH6 A;  3WD2 A;  1FKD A;  4WKF A;  2ZQV A;  3WKZ A;  5DO2 A;  4Q7N A;  2DG9 A;  3WQV A;  3KAI A;  3WL0 A;  3WD4 A;  4QT2 A;  4DRN A;  3O5G A;  3ARX A;  3EY6 A;  2KE0 A;  2MF9 A;  3UI4 A;  4DRI A;  4IPX A;  4W9P A;  2VCD A;  4ML4 A;  2KR7 A;  1FKS A;  1ROU A;  4U85 A;  4DT4 A;  1FFQ A;  2WLZ A;  3ARP A;  3RME A;  4Z2I A;  3FXY A;  2A3B A;  4L3N A;  3RM9 A;  4MNK A;  1L1P A;  2UZ5 A;  4FAP A;  2LKN A;  2MNT A;  1O6I A;  5I98 A;  1GUV A;  1ZBK A;  4JFJ A;  1ZBW A;  2IUZ A;  3TDB A;  1FKF A;  3ODK A;  2A3C A;  2WLY A;  2RQS A;  4ODQ A;  1Q1C A;  2DT2 A;  2Y78 A;  4KR0 B;  3G6M A;  4WJX A;  2FDM A;  4JYS A;  2PPP A;  2LGO A;  2M2A A;  1HKK A;  2DT0 A;  4LGX A;  1ITX A;  3IKG A;  1HJV A;  1ROT A;  2DT1 A;  4DZ2 A;  5HKG A;  2ZR6 A;  4MNJ A;  2AWG A;  3KCE A;  3RGC A;  4Z2G A;  4DWS A;  1E6Z A;  4L72 B;  4DRH A;  2MLX A;  1EYM A;  4NNR A;  2XP7 A;  2ZQU A;  3CHE A;  2B31 A;  3TCZ A;  4ZPT R;  4ZPV R;  4ZS6 A;  4QIB A;  1ZL1 A;  3O5D A;  2G8Z A;  2RSE A;  3CGN A;  4R0X A;  5GQB A;  3RM8 A;  1WAW A;  2DT3 A;  2FKE A;  4DRQ A;  3AQU A;  3OOB A;  4J4O A;  4Z2K A;  4WIW A;  3UI6 A;  1C9H A;  4NSB A;  1P5Q A;  1FFR A;  2PV2 A;  1K9T A;  3O5I A;  3JXV A;  3O5P A;  3H9R B;  2WK2 A;  1J4R A;  1CTN A;  1ZU8 A;  3FY1 A;  2F2D A;  2KFW A;  4LAY A;  2ZR5 A;  3PA7 A;  4LAV A;  5BXJ A;  1NWR A;  2OLH A;  4JFL A;  4PTM A;  4QT3 A;  1EHN A;  1SYT A;  4DWS B;  4S3K A;  4O2T A;  3B9D A;  4HBE A;  2O92 A;  5HT1 A;  4U86 A;  2DSU A;  3UQB A;  3W4R A;  4DH0 A;  1T11 A;  2KO7 A;  5HWC A;  3ALF A;  3I6C A;  2PBC A;  3KAC A;  4ODP A;  1KT1 A;  2ZQT A;  1W9U A;  3NTP A;  4DRP A;  1ZB5 A;  4MNL A;  1W1V A;  2YBT A;  1JNT A;  2RUD A;  3UQI A;  1F8A B;  3NI6 A;  1W9V A;  1FKH A;  3JYM A;  3PRB A;  3NRK A;  4NZC A;  4WKH A;  2MPH A;  4TW8 A;  5GPG A;  3B7X A;  4JFM A;  1LJY A;  4P8X A;  3ARW A;  4MTV A;  1ZK6 A;  4URI A;  1N1A A;  1OGG A;  4MAV A;  1HKJ A;  1W9P A;  3O5F A;  3ARQ A;  4DRM A;  3O5L A;  2PPO A;  2ZR4 A;  5HWB A;  2DSV A;  4U84 A;  3B9E A;  1FKG A;  3WL1 A;  3CH9 A;  5JH8 A;  1W1T A;  3O5K A;  2PV3 A;  4TW6 A;  1FKI A;  4S3J A;  2A3E A;  1E15 A;  3TC5 A;  4DWS C;  3RFW A;  3AS1 A;  3ARZ A;  5DEZ A;  3UF8 A;  2OFN A;  4DRK A;  3KAG A;  4DZ3 A;  3KAD A;  3KAB A;  2YBU A;  4R5E A;  3ARU A;  4G50 A;  1FKL A;  1R9H A;  4ITZ A;  4WKA A;  5DIV A;  1F40 A;  2DSZ A;  4P8V A;  1FKB A;  1E6P A;  3CHF A;  3ARO A;  1UR9 A;  4IQ2 A;  4J4N A;  2F21 A;  1Q6H A;  1D2K A;  1D6O A;  4QZV B;  3ARR A;  4MSP A;  4HBO A;  1FJD A;  4P8W A;  4DRO A;  2MLZ A;  1QPL A;  1E9L A;  4TNS A;  1NWT A;  1WB0 A;  1OWQ A;  5DIU A;  1U79 A;  4W9O A;  4ODN A;  2DG4 A;  2XP3 A;  1QZ2 A;  4GGQ A;  4ODL A;  2LPV A;  1NMV A;  3O5O A;  1LL6 A;  4IQC A;  2LJ4 A;  1ZBC A;  5D75 A;  1PIN A;  2DPE A;  2M08 A;  2DSW A;  3MDY B;  4MNM A;  4JFI A;  4KQZ A;  1YAT A;  2RUQ A;  2XPB A;  2D9F A;  2XP6 A;  3VAW A;  3IKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...