4NNRA

Fkbp13-fk506 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
HCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic structure of the Immunophilin FKBP13-FK506 Complex: Insights into the Composite Binding Surface for Calcineurin
doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP2
total genus 18
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4nnrA00
1BL4A 1HXVA 3KZ7A 4TW7A 3O5MA 2ZR4A 2ZR6A 1J4RA 5HT1A 3IKGA 1QZ2A 2KE0A 2XPAA 2M2AA 2ZQUA 4DRJA 4DRMA 4TW8A 2LJ4A 2OFNA 2JZVA 2PV2A 3OOBA 1Q6IA 4O2TA 2PPOA 1A7XA 4DZ3A 1YW5A 3O5GA 1D7IA 3O5DA 4IQ2A 4IPXA 1W26A 4LAXA 5GPGA 4FN2A 5HWBA 2D9FA 2F4EA 2KR7A 3LUOA 3O5PA 3O5LA 3O5QA 3O5RA 1Q6HA 3NTPA 4GIVA 1FKTA 5DITA 2K8IA 4DRKA 4ODPA 2MNTA 1PINA 3TCZA 1J6YA 1FKRA 4MSPA 1FKKA 2F2DA 4G2PA 2RUDA 4ODMA 2VN1A 2ZQSA 3TC5A 1D7JA 3I6CA 2MLZA 2VCDA 4QT2A 3RGCA 4W9OA 2DG4A 3PRBA 4DRIA 1FKDA 2RUQA 1F8AB 1NMVA 2MF9A 2MLYA 2DG9A 1Q6UA 1TCOC 2PV1A 4JYSA 1B6CA 3KACA 1D6OA 2FKEA 5DIUA 3PRDA 4ODNA 2PPPA 1FKBA 3FAPA 3UQBA 1KT0A 3IHZA 3NRKA 2Y78A 1FKGA 1ZCNA 3UI6A 5HWCA 2XP5A 2AWGA 2DG3A 1PBKA 1ROUA 2KGJA 4JFKA 4ODRA 3CGMA 4N19A 1FJDA 4ODOA 5HW7A 2KFWA 3O5JA 1JNTA 3JYMA 4TX0A 2PBCA 1U79A 2RQSA 1ROTA 4NNRA 4LAVA 3GPKA 3EY6A 2Q5AA 2ZR5A 1Q1CA 1P5QA 3NI6A 4MGVA 1Y0OA 3KAIA 4TYOA 4G50A 3JXVA 1BKFA 2PPNA 2KO7A 4U85A 4DZ2A 4ITZA 4ODQA 2MPHA 2KI3A 5HW8A 2LPVA 4U86A 2F21A 2XP8A 2M08A 4W9QA 4QIBA 4ODLA 2UZ5A 3KABA 1NMWA 2ITKA 4DRPA 1QPLA 4U84A 4W9PA 3ODKA 2MLXA 3KCEA 3O5IA 1KT1A 2PV3A 3KADA 3WH0A 1NSGA 3O5FA 1F40A 1FKSA 3UF8A 2XP9A 3UI5A 4FAPA 1J4IA 2XPBA 1YATA 2ZQTA 4J4NA 5D75A 1QPFA 3MDYB 1FKLA 3O5KA 4DRQA 1EYMA 1FKJA 4TNSA 4DIPA 3PA7A 2LGOA 1FKFA 3UI4A 3VAWA 4QT3A 2XP7A 3CGNA 3UQIA 1FKIA 3JYJA 3TDBA 1J4HA 2XP3A 3IKDA 2XP6A 2M1IA 4BF8A 2RUCA 4ODKA 4R0XA 2RSEA 2IF4A 2LKNA 5B8IC 1JVWA 1FAPA 4JFIA 4DRNA 3RFWA 4GGQA 3O5OA 4DT4A 2N87A 1FKHA 1D7HA 4J4OA 4TW6A 4JFMA 4DROA 5HKGA 1ZK6A 5HTGA 5DIVA 1N1AA 4JFJA 1FD9A 1R9HA 2XP4A 3KAGA 4C02B 2ZQVA 4DRHA 5HUAA 2L2SA 1M5YA 3KAHA 1T11A 5BXJA 1EQ3A 4DH0A 3B7XA 1C9HA 4JFLA 2RURA 2FAPA 3IK8A 3O5EA 4IQCA 5I98A 3KAFA 5J6EA 3UQAA 1JNSA 3H9RB 5HW6A 1L1PA 4LAWA 4LAYA
chains in the Genus database with same CATH superfamily
3RM9A 1NWSA 3O5MA 3IKGA 3ARUA 1QZ2A 3CH9A 2M2AA 4DRJA 3OOBA 4WIWA 3ARSA 4WK9A 2PPOA 1HKIA 1ZB5A 4IQ2A 4IPXA 1D2KA 2QF8A 5HWBA 2D9FA 2KR7A 3O5PA 4MNLA 3ARXA 3NTPA 3RMEA 3WL1A 1SR0A 4ODPA 4MNKA 1ZL1A 2VN1A 2DT0A 3I6CA 4QT2A 4W9OA 3PRBA 3ALFA 1B6CA 1X6LA 3KACA 2FKEA 4ZPTR 4ODNA 2PPPA 1ITXA 3UQBA 1KT0A 4MNJA 2Y78A 1GPFA 5GQBA 1ROUA 2EULA 5HW7A 4DWSA 2PBCA 2O9OA 4Z2LA 2FDMA 2ZR5A 4MGVA 3WIJA 1Y0OA 4TYOA 1LL6A 4DZ2A 1BKFA 1EDQA 2KO7A 4KR0B 4ITZA 4Q22A 4ZS6A 2KI3A 3PR9A 4U86A 4LGXA 1FFQA 3B8SA 3WL0A 2YBTA 3KCEA 3KADA 1FKSA 2F23A 1XHGA 4R5EA 1QPFA 3MDYB 3O5KA 1JNDA 4DRQA 4UDMA 4MNMA 1FKJA 4DIPA 3G6MA 1IX5A 4MAVA 4S3JA 4QT3A 3WD0A 3CGNA 1FKIA 2XP3A 3WD2A 2M1IA 3WD4A 1JVWA 4DRNA 1FKHA 5HKGA 3CHFA 5DIVA 1WB0A 1N1AA 3KAGA 1NWRA 2XP4A 5HUAA 3KAHA 4DH0A 1W1VA 3W4RA 3EIPA 3O5EA 4IQCA 1L1PA 1JNSA 4QZVB 1W9PA 1BL4A 1HXVA 4TW7A 2ZR4A 2ZR6A 2WLYA 2ZQUA 2XPAA 4MPKA 3RM8A 4DRMA 1LJYA 1H0GA 1Q6IA 4L72B 3O5LA 1Q6HA 3ARWA 2WLZA 1FKTA 5DITA 2K8IA 2MNTA 1FKRA 1FKKA 5DEZA 1LG2A 3BMBA 2ZQSA 2G8ZA 4Q7NA 1UR9A 3RM4A 3AS2A 1E44A 2DG4A 1F8AB 2G41A 4WKFA 1Q6UA 4JYSA 2PV1A 1NWUA 4KQZA 3AS0A 1E6NA 4URIA 1ZCNA 3UI6A 4DWSB 2OLHA 2XP5A 2DG3A 4ODRA 3CGMA 4N19A 2KFWA 3ARYA 2DSWA 2RQSA 1TFVA 1E6PA 1P5QA 3KAIA 1LL4A 3WD1A 3JXVA 4ODQA 2MPHA 2WM0A 1X6NA 2PI6A 4ODLA 1NH6A 3WD3A 1O6IA 3KABA 4Z2GA 2ITKA 4DRPA 1QPLA 4W9PA 3UI5A 4FAPA 2XPBA 1YATA 1SYTA 2ZQTA 3ARRA 4J4NA 4ML4A 1FKLA 1ZBCA 1ZBKA 3UQIA 3JYJA 3TDBA 3IKDA 2XP6A 3AS3A 4AY1A 1CTNA 2LKNA 1FAPA 4JFIA 4GGQA 3O5OA 2N87A 4J4OA 1ZK6A 4PTMA 1GUVA 4C02B 2ZQVA 2L2SA 1GRJA 3ARZA 5BXJA 3B7XA 3IK8A 3ARPA 4LAYA 5HT1A 1J4RA 1E15A 2KE0A 2ETNA 4TW8A 2JZVA 4P8VA 1W9UA 4DZ3A 1YW5A 1D7IA 2B5UB 4LAXA 2P4VA 4FN2A 3LUOA 3WQVA 3O5RA 3B9DA 4GIVA 3B9AA 2WK2A 4DRKA 1W1TA 2F2DA 4WKAA 3FXYA 2A3AA 1D7JA 2VCDA 4DWSD 3BXWA 1TCOC 1D6OA 1KFWA 3PRDA 1FKBA 2ESCA 3NRKA 4XAKA 1HKKA 2AWGA 4JFKA 1PBKA 1OGGA 2KGJA 1FJDA 4HBOA 4ODOA 3JYMA 1U79A 2PN0A 4P8UA 3ARVA 1ROTA 4NNRA 4LAVA 3GPKA 1ZBVA 1Q1CA 1FFRA 4P8XA 4WJXA 2XP8A 2M08A 1OWQA 4NSBA 4W9QA 1LQ0A 1NMWA 3QOKA 4U84A 3ODKA 1F40A 3O5IA 2PV3A 3WH0A 3O5FA 2DSVA 2XP9A 3UF8A 3AS1A 5D75A 2DSZA 2LGOA 3VAWA 3AQUA 2DT2A 1GOIA 2XP7A 2DT1A 1HJVA 1UR8A 4P8WA 2RUCA 4ODKA 4R0XA 2RSEA 2IF4A 4DT4A 1D7HA 4TW6A 4JFMA 1EIBA 4JFJA 1FD9A 1R9HA 2DPEA 3ALGA 1JCHB 4DRHA 3ARTA 3ARQA 2DT3A 4JFLA 2RURA 4Z2IA 5J6EA 1WAWA 5I98A 1HKJA 3H9RB 5HW6A 4IT4A 4LAWA 1WNOA 3KZ7A 3WKZA 2YBUA 2LJ4A 2OFNA 2PV2A 3OA5A 3B9EA 4Z2JA 4O2TA 1A7XA 1LL7A 3O5GA 3AROA 3O5DA 5GPGA 1W26A 2F4EA 3G6LA 3O5QA 4L3NA 3GTYX 1E9LA 5DF0A 4ZPVR 1PINA 4Z2HA 3TCZA 1J6YA 4MSPA 4G2PA 2RUDA 4ODMA 1K9TA 3CHDA 1LG1A 3TC5A 2MLZA 3WQWA 4WKHA 3RGCA 4DRIA 1FKDA 2RUQA 4HARA 1NMVA 2MF9A 1ZBWA 2DG9A 2MLYA 5JH8A 1RD6A 4S3KA 5DIUA 2A3EA 3FAPA 3IHZA 3CHCA 1FKGA 3FY1A 1W1YA 5HWCA 1H0IA 1OGBA 2A3BA 1HKMA 3O5JA 1HJWA 1JNTA 4TX0A 3GU0A 3PRAA 4MTVA 5DO2A 3EY6A 2Q5AA 3NI6A 1E6ZA 1HJXA 4G50A 2PPNA 5HW8A 4U85A 1VF8A 4DWSC 2LPVA 2A3CA 2F21A 4QIBA 1E6RA 2DSUA 2UZ5A 4NZCA 2IUZA 2MLXA 2AOSA 1KT1A 3CZ8A 4Z2KA 1NSGA 3CHEA 1J4IA 4HBEA 1ZU8A 1EYMA 4TNSA 1JNEA 3PA7A 1FKFA 3UI4A 1NWTA 5GPRA 1J4HA 4W5UA 4BF8A 2B31A 5B8IC 1EHNA 3RFWA 4IT6A 4DROA 5HTGA 1W9VA 4ZPWR 1M5YA 1T11A 1EQ3A 1C9HA 1W1PA 2FAPA 3UQAA 3KAFA 2O92A 5HBFA 1XRVA
chains in the Genus database with same CATH topology
3RM9A 1NWSA 3O5MA 3IKGA 3ARUA 1QZ2A 3CH9A 2M2AA 4DRJA 3OOBA 4WIWA 3ARSA 4WK9A 2PPOA 1HKIA 1ZB5A 4IQ2A 4IPXA 1D2KA 2QF8A 5HWBA 2D9FA 2KR7A 3O5PA 4MNLA 3ARXA 3NTPA 3RMEA 3WL1A 1SR0A 4ODPA 4MNKA 1ZL1A 2VN1A 2DT0A 3I6CA 4QT2A 4W9OA 3PRBA 3ALFA 1B6CA 1X6LA 3KACA 2FKEA 4ZPTR 4ODNA 2PPPA 1ITXA 3UQBA 1KT0A 4MNJA 2Y78A 1GPFA 5GQBA 1ROUA 5HW7A 4DWSA 2PBCA 2O9OA 4Z2LA 2FDMA 2ZR5A 4MGVA 3WIJA 1Y0OA 4TYOA 1LL6A 4DZ2A 1BKFA 1EDQA 2KO7A 4KR0B 4ITZA 4Q22A 4ZS6A 2KI3A 3PR9A 4U86A 4LGXA 1FFQA 3B8SA 3WL0A 2YBTA 3KCEA 3KADA 1FKSA 1XHGA 4R5EA 1QPFA 3MDYB 3O5KA 1JNDA 4DRQA 4MNMA 1FKJA 4DIPA 3G6MA 1IX5A 4MAVA 4S3JA 4QT3A 3WD0A 3CGNA 1FKIA 2XP3A 3WD2A 2M1IA 3WD4A 1JVWA 4DRNA 1FKHA 5HKGA 3CHFA 5DIVA 1WB0A 1N1AA 3KAGA 1NWRA 2XP4A 5HUAA 3KAHA 4DH0A 1W1VA 3W4RA 3O5EA 4IQCA 1L1PA 1JNSA 4QZVB 1W9PA 1BL4A 1HXVA 4TW7A 2ZR4A 2ZR6A 2WLYA 2ZQUA 2XPAA 4MPKA 3RM8A 4DRMA 1LJYA 1H0GA 1Q6IA 4L72B 3O5LA 1Q6HA 3ARWA 2WLZA 1FKTA 5DITA 2K8IA 2MNTA 1FKRA 1FKKA 5DEZA 1LG2A 2ZQSA 2G8ZA 4Q7NA 1UR9A 3RM4A 3AS2A 2DG4A 1F8AB 2G41A 4WKFA 1Q6UA 4JYSA 2PV1A 1NWUA 4KQZA 3AS0A 1E6NA 4URIA 1ZCNA 3UI6A 4DWSB 2OLHA 2XP5A 2DG3A 4ODRA 3CGMA 4N19A 2KFWA 3ARYA 2DSWA 2RQSA 1TFVA 1E6PA 1P5QA 3KAIA 1LL4A 3WD1A 3JXVA 4ODQA 2MPHA 2WM0A 1X6NA 2PI6A 4ODLA 1NH6A 3WD3A 1O6IA 3KABA 4Z2GA 2ITKA 4DRPA 1QPLA 4W9PA 3UI5A 4FAPA 2XPBA 4J4NA 1YATA 1SYTA 2ZQTA 3ARRA 4ML4A 1FKLA 1ZBCA 1ZBKA 3UQIA 3JYJA 3TDBA 3IKDA 2XP6A 3AS3A 4AY1A 1CTNA 2LKNA 1FAPA 4JFIA 4GGQA 3O5OA 2N87A 4J4OA 1ZK6A 4PTMA 1GUVA 4C02B 2ZQVA 2L2SA 3ARZA 5BXJA 3B7XA 3IK8A 3ARPA 4LAYA 5HT1A 1J4RA 1E15A 2KE0A 4TW8A 2JZVA 4P8VA 1W9UA 4DZ3A 1YW5A 1D7IA 4LAXA 4FN2A 3LUOA 3WQVA 3O5RA 3B9DA 4GIVA 3B9AA 2WK2A 4DRKA 1W1TA 2F2DA 4WKAA 3FXYA 2A3AA 1D7JA 2VCDA 4DWSD 3BXWA 1TCOC 1D6OA 1KFWA 3PRDA 1FKBA 2ESCA 3NRKA 4XAKA 1HKKA 2AWGA 4JFKA 1PBKA 1OGGA 2KGJA 1FJDA 4HBOA 4ODOA 3JYMA 1U79A 4P8UA 3ARVA 1ROTA 4NNRA 4LAVA 3GPKA 1ZBVA 1Q1CA 1FFRA 4P8XA 4WJXA 2XP8A 2M08A 1OWQA 4NSBA 4W9QA 1LQ0A 1NMWA 3QOKA 4U84A 3ODKA 1F40A 3O5IA 2PV3A 3WH0A 3O5FA 2DSVA 2XP9A 3UF8A 3AS1A 5D75A 2DSZA 2LGOA 3VAWA 3AQUA 2DT2A 1GOIA 2XP7A 2DT1A 1HJVA 1UR8A 4P8WA 2RUCA 4ODKA 4R0XA 2RSEA 2IF4A 4DT4A 1D7HA 4TW6A 4JFMA 1EIBA 4JFJA 1FD9A 1R9HA 2DPEA 3ALGA 4DRHA 3ARTA 3ARQA 2DT3A 4JFLA 2RURA 4Z2IA 5J6EA 1WAWA 5I98A 1HKJA 3H9RB 5HW6A 4IT4A 4LAWA 1WNOA 3KZ7A 3WKZA 2YBUA 2LJ4A 2OFNA 2PV2A 3OA5A 3B9EA 4Z2JA 4O2TA 1A7XA 1LL7A 3O5GA 3AROA 3O5DA 5GPGA 1W26A 2F4EA 3G6LA 3O5QA 4L3NA 1E9LA 5DF0A 4ZPVR 1PINA 4Z2HA 3TCZA 1J6YA 4MSPA 4G2PA 2RUDA 4ODMA 1K9TA 3CHDA 1LG1A 3TC5A 2MLZA 3WQWA 4WKHA 3RGCA 4DRIA 1FKDA 2RUQA 4HARA 1NMVA 2MF9A 1ZBWA 2DG9A 2MLYA 5JH8A 1RD6A 4S3KA 5DIUA 2A3EA 3FAPA 3IHZA 3CHCA 1FKGA 3FY1A 1W1YA 5HWCA 1H0IA 1OGBA 2A3BA 1HKMA 3O5JA 1HJWA 1JNTA 4TX0A 3PRAA 4MTVA 5DO2A 3EY6A 2Q5AA 3NI6A 1E6ZA 1HJXA 4G50A 2PPNA 5HW8A 4U85A 1VF8A 4DWSC 2LPVA 2A3CA 2F21A 4QIBA 1E6RA 2DSUA 2UZ5A 4NZCA 2IUZA 2MLXA 2AOSA 1KT1A 3CZ8A 4Z2KA 1NSGA 3CHEA 1J4IA 4HBEA 1ZU8A 1EYMA 4TNSA 1JNEA 3PA7A 1FKFA 3UI4A 1NWTA 5GPRA 1J4HA 4W5UA 4BF8A 2B31A 5B8IC 1EHNA 3RFWA 4IT6A 4DROA 5HTGA 1W9VA 4ZPWR 1M5YA 1T11A 1EQ3A 1C9HA 1W1PA 2FAPA 3UQAA 3KAFA 2O92A 5HBFA 1XRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BL4 A;  1HXV A;  3KZ7 A;  4TW7 A;  3O5M A;  2ZR4 A;  2ZR6 A;  1J4R A;  5HT1 A;  3IKG A;  1QZ2 A;  2KE0 A;  2XPA A;  2M2A A;  2ZQU A;  4DRJ A;  4DRM A;  4TW8 A;  2LJ4 A;  2OFN A;  2JZV A;  2PV2 A;  3OOB A;  1Q6I A;  4O2T A;  2PPO A;  1A7X A;  4DZ3 A;  1YW5 A;  3O5G A;  1D7I A;  3O5D A;  4IQ2 A;  4IPX A;  1W26 A;  4LAX A;  5GPG A;  4FN2 A;  5HWB A;  2D9F A;  2F4E A;  2KR7 A;  3LUO A;  3O5P A;  3O5L A;  3O5Q A;  3O5R A;  1Q6H A;  3NTP A;  4GIV A;  1FKT A;  5DIT A;  2K8I A;  4DRK A;  4ODP A;  2MNT A;  1PIN A;  3TCZ A;  1J6Y A;  1FKR A;  4MSP A;  1FKK A;  2F2D A;  4G2P A;  2RUD A;  4ODM A;  2VN1 A;  2ZQS A;  3TC5 A;  1D7J A;  3I6C A;  2MLZ A;  2VCD A;  4QT2 A;  3RGC A;  4W9O A;  2DG4 A;  3PRB A;  4DRI A;  1FKD A;  2RUQ A;  1F8A B;  1NMV A;  2MF9 A;  2MLY A;  2DG9 A;  1Q6U A;  1TCO C;  2PV1 A;  4JYS A;  1B6C A;  3KAC A;  1D6O A;  2FKE A;  5DIU A;  3PRD A;  4ODN A;  2PPP A;  1FKB A;  3FAP A;  3UQB A;  1KT0 A;  3IHZ A;  3NRK A;  2Y78 A;  1FKG A;  1ZCN A;  3UI6 A;  5HWC A;  2XP5 A;  2AWG A;  2DG3 A;  1PBK A;  1ROU A;  2KGJ A;  4JFK A;  4ODR A;  3CGM A;  4N19 A;  1FJD A;  4ODO A;  5HW7 A;  2KFW A;  3O5J A;  1JNT A;  3JYM A;  4TX0 A;  2PBC A;  1U79 A;  2RQS A;  1ROT A;  4NNR A;  4LAV A;  3GPK A;  3EY6 A;  2Q5A A;  2ZR5 A;  1Q1C A;  1P5Q A;  3NI6 A;  4MGV A;  1Y0O A;  3KAI A;  4TYO A;  4G50 A;  3JXV A;  1BKF A;  2PPN A;  2KO7 A;  4U85 A;  4DZ2 A;  4ITZ A;  4ODQ A;  2MPH A;  2KI3 A;  5HW8 A;  2LPV A;  4U86 A;  2F21 A;  2XP8 A;  2M08 A;  4W9Q A;  4QIB A;  4ODL A;  2UZ5 A;  3KAB A;  1NMW A;  2ITK A;  4DRP A;  1QPL A;  4U84 A;  4W9P A;  3ODK A;  2MLX A;  3KCE A;  3O5I A;  1KT1 A;  2PV3 A;  3KAD A;  3WH0 A;  1NSG A;  3O5F A;  1F40 A;  1FKS A;  3UF8 A;  2XP9 A;  3UI5 A;  4FAP A;  1J4I A;  2XPB A;  1YAT A;  2ZQT A;  4J4N A;  5D75 A;  1QPF A;  3MDY B;  1FKL A;  3O5K A;  4DRQ A;  1EYM A;  1FKJ A;  4TNS A;  4DIP A;  3PA7 A;  2LGO A;  1FKF A;  3UI4 A;  3VAW A;  4QT3 A;  2XP7 A;  3CGN A;  3UQI A;  1FKI A;  3JYJ A;  3TDB A;  1J4H A;  2XP3 A;  3IKD A;  2XP6 A;  2M1I A;  4BF8 A;  2RUC A;  4ODK A;  4R0X A;  2RSE A;  2IF4 A;  2LKN A;  5B8I C;  1JVW A;  1FAP A;  4JFI A;  4DRN A;  3RFW A;  4GGQ A;  3O5O A;  4DT4 A;  2N87 A;  1FKH A;  1D7H A;  4J4O A;  4TW6 A;  4JFM A;  4DRO A;  5HKG A;  1ZK6 A;  5HTG A;  5DIV A;  1N1A A;  4JFJ A;  1FD9 A;  1R9H A;  2XP4 A;  3KAG A;  4C02 B;  2ZQV A;  4DRH A;  5HUA A;  2L2S A;  1M5Y A;  3KAH A;  1T11 A;  5BXJ A;  1EQ3 A;  4DH0 A;  3B7X A;  1C9H A;  4JFL A;  2RUR A;  2FAP A;  3IK8 A;  3O5E A;  4IQC A;  5I98 A;  3KAF A;  5J6E A;  3UQA A;  1JNS A;  3H9R B;  5HW6 A;  1L1P A;  4LAW A;  4LAY A; 
#chains in the Genus database with same CATH topology
 3RM9 A;  1NWS A;  3O5M A;  3IKG A;  3ARU A;  1QZ2 A;  3CH9 A;  2M2A A;  4DRJ A;  3OOB A;  4WIW A;  3ARS A;  4WK9 A;  2PPO A;  1HKI A;  1ZB5 A;  4IQ2 A;  4IPX A;  1D2K A;  2QF8 A;  5HWB A;  2D9F A;  2KR7 A;  3O5P A;  4MNL A;  3ARX A;  3NTP A;  3RME A;  3WL1 A;  1SR0 A;  4ODP A;  4MNK A;  1ZL1 A;  2VN1 A;  2DT0 A;  3I6C A;  4QT2 A;  4W9O A;  3PRB A;  3ALF A;  1B6C A;  1X6L A;  3KAC A;  2FKE A;  4ZPT R;  4ODN A;  2PPP A;  1ITX A;  3UQB A;  1KT0 A;  4MNJ A;  2Y78 A;  1GPF A;  5GQB A;  1ROU A;  2EUL A;  5HW7 A;  4DWS A;  2PBC A;  2O9O A;  4Z2L A;  2FDM A;  2ZR5 A;  4MGV A;  3WIJ A;  1Y0O A;  4TYO A;  1LL6 A;  4DZ2 A;  1BKF A;  1EDQ A;  2KO7 A;  4KR0 B;  4ITZ A;  4Q22 A;  4ZS6 A;  2KI3 A;  3PR9 A;  4U86 A;  4LGX A;  1FFQ A;  3B8S A;  3WL0 A;  2YBT A;  3KCE A;  3KAD A;  1FKS A;  2F23 A;  1XHG A;  4R5E A;  1QPF A;  3MDY B;  3O5K A;  1JND A;  4DRQ A;  4UDM A;  4MNM A;  1FKJ A;  4DIP A;  3G6M A;  1IX5 A;  4MAV A;  4S3J A;  4QT3 A;  3WD0 A;  3CGN A;  1FKI A;  2XP3 A;  3WD2 A;  2M1I A;  3WD4 A;  1JVW A;  4DRN A;  1FKH A;  5HKG A;  3CHF A;  5DIV A;  1WB0 A;  1N1A A;  3KAG A;  1NWR A;  2XP4 A;  5HUA A;  3KAH A;  4DH0 A;  1W1V A;  3W4R A;  3EIP A;  3O5E A;  4IQC A;  1L1P A;  1JNS A;  4QZV B;  1W9P A;  1BL4 A;  1HXV A;  4TW7 A;  2ZR4 A;  2ZR6 A;  2WLY A;  2ZQU A;  2XPA A;  4MPK A;  3RM8 A;  4DRM A;  1LJY A;  1H0G A;  1Q6I A;  4L72 B;  3O5L A;  1Q6H A;  3ARW A;  2WLZ A;  1FKT A;  5DIT A;  2K8I A;  2MNT A;  1FKR A;  1FKK A;  5DEZ A;  1LG2 A;  3BMB A;  2ZQS A;  2G8Z A;  4Q7N A;  1UR9 A;  3RM4 A;  3AS2 A;  1E44 A;  2DG4 A;  1F8A B;  2G41 A;  4WKF A;  1Q6U A;  4JYS A;  2PV1 A;  1NWU A;  4KQZ A;  3AS0 A;  1E6N A;  4URI A;  1ZCN A;  3UI6 A;  4DWS B;  2OLH A;  2XP5 A;  2DG3 A;  4ODR A;  3CGM A;  4N19 A;  2KFW A;  3ARY A;  2DSW A;  2RQS A;  1TFV A;  1E6P A;  1P5Q A;  3KAI A;  1LL4 A;  3WD1 A;  3JXV A;  4ODQ A;  2MPH A;  2WM0 A;  1X6N A;  2PI6 A;  4ODL A;  1NH6 A;  3WD3 A;  1O6I A;  3KAB A;  4Z2G A;  2ITK A;  4DRP A;  1QPL A;  4W9P A;  3UI5 A;  4FAP A;  2XPB A;  1YAT A;  1SYT A;  2ZQT A;  3ARR A;  4J4N A;  4ML4 A;  1FKL A;  1ZBC A;  1ZBK A;  3UQI A;  3JYJ A;  3TDB A;  3IKD A;  2XP6 A;  3AS3 A;  4AY1 A;  1CTN A;  2LKN A;  1FAP A;  4JFI A;  4GGQ A;  3O5O A;  2N87 A;  4J4O A;  1ZK6 A;  4PTM A;  1GUV A;  4C02 B;  2ZQV A;  2L2S A;  1GRJ A;  3ARZ A;  5BXJ A;  3B7X A;  3IK8 A;  3ARP A;  4LAY A;  5HT1 A;  1J4R A;  1E15 A;  2KE0 A;  2ETN A;  4TW8 A;  2JZV A;  4P8V A;  1W9U A;  4DZ3 A;  1YW5 A;  1D7I A;  2B5U B;  4LAX A;  2P4V A;  4FN2 A;  3LUO A;  3WQV A;  3O5R A;  3B9D A;  4GIV A;  3B9A A;  2WK2 A;  4DRK A;  1W1T A;  2F2D A;  4WKA A;  3FXY A;  2A3A A;  1D7J A;  2VCD A;  4DWS D;  3BXW A;  1TCO C;  1D6O A;  1KFW A;  3PRD A;  1FKB A;  2ESC A;  3NRK A;  4XAK A;  1HKK A;  2AWG A;  4JFK A;  1PBK A;  1OGG A;  2KGJ A;  1FJD A;  4HBO A;  4ODO A;  3JYM A;  1U79 A;  2PN0 A;  4P8U A;  3ARV A;  1ROT A;  4NNR A;  4LAV A;  3GPK A;  1ZBV A;  1Q1C A;  1FFR A;  4P8X A;  4WJX A;  2XP8 A;  2M08 A;  1OWQ A;  4NSB A;  4W9Q A;  1LQ0 A;  1NMW A;  3QOK A;  4U84 A;  3ODK A;  1F40 A;  3O5I A;  2PV3 A;  3WH0 A;  3O5F A;  2DSV A;  2XP9 A;  3UF8 A;  3AS1 A;  5D75 A;  2DSZ A;  2LGO A;  3VAW A;  3AQU A;  2DT2 A;  1GOI A;  2XP7 A;  2DT1 A;  1HJV A;  1UR8 A;  4P8W A;  2RUC A;  4ODK A;  4R0X A;  2RSE A;  2IF4 A;  4DT4 A;  1D7H A;  4TW6 A;  4JFM A;  1EIB A;  4JFJ A;  1FD9 A;  1R9H A;  2DPE A;  3ALG A;  1JCH B;  4DRH A;  3ART A;  3ARQ A;  2DT3 A;  4JFL A;  2RUR A;  4Z2I A;  5J6E A;  1WAW A;  5I98 A;  1HKJ A;  3H9R B;  5HW6 A;  4IT4 A;  4LAW A;  1WNO A;  3KZ7 A;  3WKZ A;  2YBU A;  2LJ4 A;  2OFN A;  2PV2 A;  3OA5 A;  3B9E A;  4Z2J A;  4O2T A;  1A7X A;  1LL7 A;  3O5G A;  3ARO A;  3O5D A;  5GPG A;  1W26 A;  2F4E A;  3G6L A;  3O5Q A;  4L3N A;  3GTY X;  1E9L A;  5DF0 A;  4ZPV R;  1PIN A;  4Z2H A;  3TCZ A;  1J6Y A;  4MSP A;  4G2P A;  2RUD A;  4ODM A;  1K9T A;  3CHD A;  1LG1 A;  3TC5 A;  2MLZ A;  3WQW A;  4WKH A;  3RGC A;  4DRI A;  1FKD A;  2RUQ A;  4HAR A;  1NMV A;  2MF9 A;  1ZBW A;  2DG9 A;  2MLY A;  5JH8 A;  1RD6 A;  4S3K A;  5DIU A;  2A3E A;  3FAP A;  3IHZ A;  3CHC A;  1FKG A;  3FY1 A;  1W1Y A;  5HWC A;  1H0I A;  1OGB A;  2A3B A;  1HKM A;  3O5J A;  1HJW A;  1JNT A;  4TX0 A;  3GU0 A;  3PRA A;  4MTV A;  5DO2 A;  3EY6 A;  2Q5A A;  3NI6 A;  1E6Z A;  1HJX A;  4G50 A;  2PPN A;  5HW8 A;  4U85 A;  1VF8 A;  4DWS C;  2LPV A;  2A3C A;  2F21 A;  4QIB A;  1E6R A;  2DSU A;  2UZ5 A;  4NZC A;  2IUZ A;  2MLX A;  2AOS A;  1KT1 A;  3CZ8 A;  4Z2K A;  1NSG A;  3CHE A;  1J4I A;  4HBE A;  1ZU8 A;  1EYM A;  4TNS A;  1JNE A;  3PA7 A;  1FKF A;  3UI4 A;  1NWT A;  5GPR A;  1J4H A;  4W5U A;  4BF8 A;  2B31 A;  5B8I C;  1EHN A;  3RFW A;  4IT6 A;  4DRO A;  5HTG A;  1W9V A;  4ZPW R;  1M5Y A;  1T11 A;  1EQ3 A;  1C9H A;  1W1P A;  2FAP A;  3UQA A;  3KAF A;  2O92 A;  5HBF A;  1XRV A; 
#chains in the Genus database with same CATH homology
 3RM9 A;  1NWS A;  3O5M A;  3IKG A;  3ARU A;  1QZ2 A;  3CH9 A;  2M2A A;  4DRJ A;  3OOB A;  4WIW A;  3ARS A;  4WK9 A;  2PPO A;  1HKI A;  1ZB5 A;  4IQ2 A;  4IPX A;  1D2K A;  2QF8 A;  5HWB A;  2D9F A;  2KR7 A;  3O5P A;  4MNL A;  3ARX A;  3NTP A;  3RME A;  3WL1 A;  1SR0 A;  4ODP A;  4MNK A;  1ZL1 A;  2VN1 A;  2DT0 A;  3I6C A;  4QT2 A;  4W9O A;  3PRB A;  3ALF A;  1B6C A;  1X6L A;  3KAC A;  2FKE A;  4ZPT R;  4ODN A;  2PPP A;  1ITX A;  3UQB A;  1KT0 A;  4MNJ A;  2Y78 A;  1GPF A;  5GQB A;  1ROU A;  5HW7 A;  4DWS A;  2PBC A;  2O9O A;  4Z2L A;  2FDM A;  2ZR5 A;  4MGV A;  3WIJ A;  1Y0O A;  4TYO A;  1LL6 A;  4DZ2 A;  1BKF A;  1EDQ A;  2KO7 A;  4KR0 B;  4ITZ A;  4Q22 A;  4ZS6 A;  2KI3 A;  3PR9 A;  4U86 A;  4LGX A;  1FFQ A;  3B8S A;  3WL0 A;  2YBT A;  3KCE A;  3KAD A;  1FKS A;  1XHG A;  4R5E A;  1QPF A;  3MDY B;  3O5K A;  1JND A;  4DRQ A;  4MNM A;  1FKJ A;  4DIP A;  3G6M A;  1IX5 A;  4MAV A;  4S3J A;  4QT3 A;  3WD0 A;  3CGN A;  1FKI A;  2XP3 A;  3WD2 A;  2M1I A;  3WD4 A;  1JVW A;  4DRN A;  1FKH A;  5HKG A;  3CHF A;  5DIV A;  1WB0 A;  1N1A A;  3KAG A;  1NWR A;  2XP4 A;  5HUA A;  3KAH A;  4DH0 A;  1W1V A;  3W4R A;  3O5E A;  4IQC A;  1L1P A;  1JNS A;  4QZV B;  1W9P A;  1BL4 A;  1HXV A;  4TW7 A;  2ZR4 A;  2ZR6 A;  2WLY A;  2ZQU A;  2XPA A;  4MPK A;  3RM8 A;  4DRM A;  1LJY A;  1H0G A;  1Q6I A;  4L72 B;  3O5L A;  1Q6H A;  3ARW A;  2WLZ A;  1FKT A;  5DIT A;  2K8I A;  2MNT A;  1FKR A;  1FKK A;  5DEZ A;  1LG2 A;  2ZQS A;  2G8Z A;  4Q7N A;  1UR9 A;  3RM4 A;  3AS2 A;  2DG4 A;  1F8A B;  2G41 A;  4WKF A;  1Q6U A;  4JYS A;  2PV1 A;  1NWU A;  4KQZ A;  3AS0 A;  1E6N A;  4URI A;  1ZCN A;  3UI6 A;  4DWS B;  2OLH A;  2XP5 A;  2DG3 A;  4ODR A;  3CGM A;  4N19 A;  2KFW A;  3ARY A;  2DSW A;  2RQS A;  1TFV A;  1E6P A;  1P5Q A;  3KAI A;  1LL4 A;  3WD1 A;  3JXV A;  4ODQ A;  2MPH A;  2WM0 A;  1X6N A;  2PI6 A;  4ODL A;  1NH6 A;  3WD3 A;  1O6I A;  3KAB A;  4Z2G A;  2ITK A;  4DRP A;  1QPL A;  4W9P A;  3UI5 A;  4FAP A;  2XPB A;  4J4N A;  1YAT A;  1SYT A;  2ZQT A;  3ARR A;  4ML4 A;  1FKL A;  1ZBC A;  1ZBK A;  3UQI A;  3JYJ A;  3TDB A;  3IKD A;  2XP6 A;  3AS3 A;  4AY1 A;  1CTN A;  2LKN A;  1FAP A;  4JFI A;  4GGQ A;  3O5O A;  2N87 A;  4J4O A;  1ZK6 A;  4PTM A;  1GUV A;  4C02 B;  2ZQV A;  2L2S A;  3ARZ A;  5BXJ A;  3B7X A;  3IK8 A;  3ARP A;  4LAY A;  5HT1 A;  1J4R A;  1E15 A;  2KE0 A;  4TW8 A;  2JZV A;  4P8V A;  1W9U A;  4DZ3 A;  1YW5 A;  1D7I A;  4LAX A;  4FN2 A;  3LUO A;  3WQV A;  3O5R A;  3B9D A;  4GIV A;  3B9A A;  2WK2 A;  4DRK A;  1W1T A;  2F2D A;  4WKA A;  3FXY A;  2A3A A;  1D7J A;  2VCD A;  4DWS D;  3BXW A;  1TCO C;  1D6O A;  1KFW A;  3PRD A;  1FKB A;  2ESC A;  3NRK A;  4XAK A;  1HKK A;  2AWG A;  4JFK A;  1PBK A;  1OGG A;  2KGJ A;  1FJD A;  4HBO A;  4ODO A;  3JYM A;  1U79 A;  4P8U A;  3ARV A;  1ROT A;  4NNR A;  4LAV A;  3GPK A;  1ZBV A;  1Q1C A;  1FFR A;  4P8X A;  4WJX A;  2XP8 A;  2M08 A;  1OWQ A;  4NSB A;  4W9Q A;  1LQ0 A;  1NMW A;  3QOK A;  4U84 A;  3ODK A;  1F40 A;  3O5I A;  2PV3 A;  3WH0 A;  3O5F A;  2DSV A;  2XP9 A;  3UF8 A;  3AS1 A;  5D75 A;  2DSZ A;  2LGO A;  3VAW A;  3AQU A;  2DT2 A;  1GOI A;  2XP7 A;  2DT1 A;  1HJV A;  1UR8 A;  4P8W A;  2RUC A;  4ODK A;  4R0X A;  2RSE A;  2IF4 A;  4DT4 A;  1D7H A;  4TW6 A;  4JFM A;  1EIB A;  4JFJ A;  1FD9 A;  1R9H A;  2DPE A;  3ALG A;  4DRH A;  3ART A;  3ARQ A;  2DT3 A;  4JFL A;  2RUR A;  4Z2I A;  5J6E A;  1WAW A;  5I98 A;  1HKJ A;  3H9R B;  5HW6 A;  4IT4 A;  4LAW A;  1WNO A;  3KZ7 A;  3WKZ A;  2YBU A;  2LJ4 A;  2OFN A;  2PV2 A;  3OA5 A;  3B9E A;  4Z2J A;  4O2T A;  1A7X A;  1LL7 A;  3O5G A;  3ARO A;  3O5D A;  5GPG A;  1W26 A;  2F4E A;  3G6L A;  3O5Q A;  4L3N A;  1E9L A;  5DF0 A;  4ZPV R;  1PIN A;  4Z2H A;  3TCZ A;  1J6Y A;  4MSP A;  4G2P A;  2RUD A;  4ODM A;  1K9T A;  3CHD A;  1LG1 A;  3TC5 A;  2MLZ A;  3WQW A;  4WKH A;  3RGC A;  4DRI A;  1FKD A;  2RUQ A;  4HAR A;  1NMV A;  2MF9 A;  1ZBW A;  2DG9 A;  2MLY A;  5JH8 A;  1RD6 A;  4S3K A;  5DIU A;  2A3E A;  3FAP A;  3IHZ A;  3CHC A;  1FKG A;  3FY1 A;  1W1Y A;  5HWC A;  1H0I A;  1OGB A;  2A3B A;  1HKM A;  3O5J A;  1HJW A;  1JNT A;  4TX0 A;  3PRA A;  4MTV A;  5DO2 A;  3EY6 A;  2Q5A A;  3NI6 A;  1E6Z A;  1HJX A;  4G50 A;  2PPN A;  5HW8 A;  4U85 A;  1VF8 A;  4DWS C;  2LPV A;  2A3C A;  2F21 A;  4QIB A;  1E6R A;  2DSU A;  2UZ5 A;  4NZC A;  2IUZ A;  2MLX A;  2AOS A;  1KT1 A;  3CZ8 A;  4Z2K A;  1NSG A;  3CHE A;  1J4I A;  4HBE A;  1ZU8 A;  1EYM A;  4TNS A;  1JNE A;  3PA7 A;  1FKF A;  3UI4 A;  1NWT A;  5GPR A;  1J4H A;  4W5U A;  4BF8 A;  2B31 A;  5B8I C;  1EHN A;  3RFW A;  4IT6 A;  4DRO A;  5HTG A;  1W9V A;  4ZPW R;  1M5Y A;  1T11 A;  1EQ3 A;  1C9H A;  1W1P A;  2FAP A;  3UQA A;  3KAF A;  2O92 A;  5HBF A;  1XRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...