4NNRA

Fkbp13-fk506 complex
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
102
structure length
102
Chain Sequence
HCPIKSRKGDVLHMHYTGKLEDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIPGGATLVFEVELLKIERRTEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP2
publication title Atomic structure of the Immunophilin FKBP13-FK506 Complex: Insights into the Composite Binding Surface for Calcineurin
doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 18
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2013-11-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4nnrA00
1QZ2A 5DIVA 3KACA 3VAWA 1NMWA 5B8IC 1L1PA 4R0XA 4LAYA 3UI6A 5I98A 2RUQA 2XP4A 4IQCA 5DIUA 4FAPA 2LPVA 4DRMA 3O5PA 4ODMA 2ZR4A 3UQAA 4G2PA 1YW5A 3O5LA 2MF9A 3EY6A 3PRBA 1QPLA 4MGVA 2LGOA 3O5GA 1J4RA 4ODKA 2KFWA 1W26A 4GIVA 4QT2A 3KZ7A 4TYOA 2RUCA 5HKGA 4ODQA 4LAXA 1NSGA 5GPGA 5J6EA 2M1IA 1Q1CA 5HT1A 1ZCNA 4O2TA 4J4OA 2MNTA 1Y0OA 2XPBA 3KAGA 2KGJA 1PBKA 3TDBA 1FKIA 1Q6UA 4QT3A 3RFWA 4DRHA 3O5JA 3O5KA 3KAFA 2ZQTA 3MDYB 3O5DA 2PPPA 2XPAA 4JFIA 4QIBA 1EQ3A 2XP5A 4TW6A 3O5FA 4DRIA 1D7IA 2N87A 5HWBA 4ODNA 2MLYA 2PV1A 2XP3A 1J4HA 1J4IA 1HXVA 1U79A 1JVWA 2DG4A 3KABA 1FKDA 3B7XA 1ROUA 4LAVA 3TCZA 1J6YA 4DIPA 2ITKA 4GGQA 1ZK6A 2RURA 4DRPA 4JYSA 4ODOA 3O5MA 4ODLA 2F4EA 3KCEA 1FAPA 4U85A 2F21A 3IKDA 3O5IA 5DITA 4ITZA 4FN2A 1T11A 1FKHA 2RSEA 3ODKA 4NNRA 1Q6IA 4TW8A 3RGCA 2KE0A 4DRJA 5D75A 3CGNA 2KI3A 3UQIA 4TNSA 3TC5A 2Q5AA 3NTPA 2AWGA 4DZ3A 1ROTA 2ZQSA 4G50A 4N19A 4W9OA 3IHZA 3LUOA 4MSPA 1FD9A 2IF4A 3JXVA 3KADA 4ODPA 3WH0A 4DT4A 1FKKA 5BXJA 2Y78A 3FAPA 1FKFA 2VN1A 4JFKA 1C9HA 1FKGA 1FKJA 2ZR5A 2PV3A 5HUAA 2XP6A 5HW6A 3OOBA 3PA7A 2L2SA 2PV2A 2VCDA 1JNTA 1FKLA 2ZQUA 4W9PA 2F2DA 1FKRA 2M2AA 5HW7A 1JNSA 3KAIA 1YATA 4U84A 4C02B 2FKEA 4ODRA 2LKNA 4W9QA 1EYMA 4JFLA 1B6CA 2ZR6A 1P5QA 2XP8A 3UQBA 4DH0A 1FKSA 1D7JA 4U86A 3JYMA 1D7HA 2LJ4A 2JZVA 2ZQVA 1BL4A 1Q6HA 2MLZA 3CGMA 4IQ2A 4TX0A 3UI5A 4BF8A 3IKGA 5HTGA 2FAPA 3GPKA 1FKBA 2PPOA 1NMVA 4DRQA 1M5YA 2DG9A 3UI4A 3H9RB 4JFJA 3NRKA 1QPFA 2RQSA 3UF8A 1F40A 2KR7A 2XP7A 3I6CA 4TW7A 1TCOC 5HWCA 3KAHA 1KT1A 2KO7A 3IK8A 4DROA 4DRKA 4IPXA 1F8AB 5HW8A 3PRDA 4LAWA 2M08A 4J4NA 1N1AA 2XP9A 1R9HA 2PBCA 3O5EA 3O5RA 3O5QA 1FJDA 2UZ5A 4DZ2A 2DG3A 1FKTA 2D9FA 2OFNA 1BKFA 4DRNA 2MLXA 1PINA 4JFMA 3NI6A 2RUDA 3JYJA 3O5OA 1D6OA 1A7XA 1KT0A 2MPHA 2PPNA 2K8IA
chains in the Genus database with same CATH superfamily
4DWSC 4UDMA 1NMWA 4DWSB 4LAYA 5I98A 2XP4A 1E6ZA 3RM4A 5GQBA 3B8SA 2DT0A 1HKKA 4ODKA 1ZBCA 1W26A 2RUCA 5GPGA 2M1IA 1HJWA 1W1TA 4Q22A 3RM8A 3KAGA 3OA5A 1FKIA 1E6RA 4QT3A 3O5JA 1OGBA 4P8VA 3RM9A 1EQ3A 2N87A 3WD1A 2PV1A 4W5UA 2XP3A 3PR9A 1J4IA 4L72B 4S3KA 3PRAA 2DG4A 1ROUA 4ZPVR 4P8WA 3TCZA 4DRPA 1HJXA 1UR9A 4JYSA 4ODOA 4ODLA 3KCEA 5DITA 4WIWA 3ODKA 1VF8A 5D75A 3CGNA 3AQUA 3TC5A 4DWSA 2Q5AA 3G6MA 1NWSA 3B9DA 1ROTA 2ZQSA 3ARWA 4N19A 3WH0A 4MSPA 2IF4A 1ZL1A 3KADA 5BXJA 1FKKA 4PTMA 1X6LA 5HW6A 1E15A 1LQ0A 2O92A 2ZQUA 2PN0A 1FKLA 1SR0A 3AS2A 4C02B 1H0GA 2LKNA 3BMBA 2ZR6A 1LL7A 4WKFA 3UQBA 3G6LA 4DH0A 4Q7NA 4XAKA 1BL4A 4BF8A 4IQ2A 1FFRA 2OLHA 4Z2JA 3UI4A 3NRKA 3UF8A 2KR7A 4DROA 4P8UA 4DRKA 1TFVA 4LAWA 2M08A 4HBOA 5DF0A 3O5EA 3O5RA 1FFQA 1H0IA 1FKTA 2OFNA 4ZPTR 3WD2A 4DRNA 3ARQA 4JFMA 5DEZA 1NWTA 1NH6A 2ETNA 4KR0B 1KT0A 3QOKA 3ARYA 2PPNA 1K9TA 2FAPA 4R0XA 3UI6A 3RMEA 2RUQA 3CHFA 4ZPWR 5DIUA 3ARRA 1W1VA 3O5PA 3UQAA 1E6NA 2A3BA 3CHCA 3EY6A 3PRBA 2FDMA 4QT2A 4MGVA 4ZS6A 2KFWA 4GIVA 4ODQA 3ARSA 4MNKA 5J6EA 3ARTA 5HT1A 1ZCNA 4O2TA 2DT3A 2EULA 2MNTA 2XPBA 2KGJA 2DSUA 3O5KA 3AROA 3MDYB 3O5DA 2PPPA 2XPAA 1GUVA 4JFIA 4QIBA 2XP5A 4ML4A 4DRIA 3CHDA 1WB0A 1OWQA 2DSWA 1J4HA 4Z2LA 1HXVA 3ALFA 3B7XA 1RD6A 4DIPA 2ITKA 1ZK6A 3CH9A 3O5IA 4NZCA 2A3AA 4NNRA 1WAWA 1OGGA 2KI3A 4Z2IA 4TNSA 3CZ8A 2YBUA 4G50A 1J6YA 1NWRA 2Y78A 1FKFA 5HUAA 2XP6A 3OOBA 1XRVA 2L2SA 2PV2A 5HW7A 1UR8A 4W9QA 1LL4A 1D7JA 1ZBWA 2DT2A 4U86A 4MNMA 2ZQVA 5HTGA 3WQWA 1NMVA 3BXWA 4WKAA 4DRQA 3H9RB 1W1YA 4JFJA 2RQSA 3I6CA 1TCOC 3KAHA 1W1PA 2F23A 1N1AA 2XP9A 2B5UB 2O9OA 1FJDA 2UZ5A 1W9PA 5JH8A 2MLXA 2WK2A 2RUDA 4S3JA 3JYJA 4Z2GA 2DPEA 1A7XA 2MPHA 1QZ2A 1JCHB 1KFWA 1L1PA 3WL1A 2WM0A 1EDQA 4IQCA 2LPVA 4ODMA 4G2PA 1QPLA 2LGOA 1J4RA 2PI6A 4TYOA 3WD4A 5DO2A 4L3NA 1Q1CA 1HJVA 4J4OA 3WL0A 4Z2HA 1Y0OA 1ITXA 3ARXA 2ESCA 1PBKA 3RFWA 4DRHA 3KAFA 2ZQTA 1EIBA 1W9VA 3O5FA 1D7IA 5HWBA 2MLYA 3AS1A 1U79A 1JVWA 4LGXA 2AOSA 4LAVA 4GGQA 3WKZA 3O5MA 2G41A 2F4EA 4MPKA 1FAPA 4U85A 2F21A 3IKDA 1CTNA 4FN2A 1FKHA 4IT4A 3RGCA 4DRJA 3UQIA 1LL6A 1WNOA 4AY1A 3WQVA 4W9OA 3IHZA 3LUOA 1FD9A 3JXVA 2VN1A 1C9HA 1FKJA 2ZR5A 2PV3A 1ZU8A 1NWUA 1FKRA 2M2AA 1YATA 1ZBVA 4U84A 4JFLA 1B6CA 2A3EA 2XP8A 4WJXA 2WLZA 1D7HA 1O6IA 2JZVA 2LJ4A 3CGMA 1Q6HA 2MLZA 3WIJA 4TX0A 3IKGA 1FKBA 2DG9A 3B9AA 1LJYA 1SYTA 2XP7A 4TW7A 3IK8A 4IPXA 3ARVA 3GTYX 3PRDA 5HW8A 4J4NA 1E9LA 1IX5A 1R9HA 1GOIA 3EIPA 3WD0A 3AS3A 4DZ2A 1E44A 2D9FA 1HKJA 1D6OA 1XHGA 2YBTA 5DIVA 3KACA 3VAWA 5B8IC 1LG2A 1JNEA 1GPFA 4HARA 4FAPA 4DRMA 2QF8A 2ZR4A 1JNDA 1YW5A 3O5LA 2MF9A 1HKIA 4DT4A 3O5GA 4MNJA 1HKMA 5HKGA 3KZ7A 4LAXA 1NSGA 4WK9A 3FY1A 3TDBA 1Q6UA 2A3CA 1LG1A 4TW6A 4ODNA 4KQZA 1EHNA 1ZB5A 3KABA 1FKDA 3B9EA 2RURA 5HBFA 3ARUA 2G8ZA 4ITZA 3AS0A 4MAVA 1T11A 2RSEA 4TW8A 1Q6IA 2KE0A 3ALGA 4R5EA 3ARZA 3GU0A 3NTPA 2AWGA 4DZ3A 4NSBA 1GRJA 4ODPA 4URIA 4WKHA 3FAPA 4JFKA 1FKGA 1X6NA 1D2KA 3PA7A 2VCDA 4W9PA 1JNTA 2F2DA 1ZBKA 1JNSA 3KAIA 5GPRA 2FKEA 4ODRA 3FXYA 2DSZA 1EYMA 1P5QA 1FKSA 3JYMA 3ARPA 2P4VA 4MNLA 4Z2KA 3UI5A 2IUZA 4IT6A 3GPKA 2PPOA 1M5YA 4DWSD 4HBEA 2DSVA 1E6PA 1QPFA 1F40A 2B31A 5HWCA 3W4RA 1KT1A 2KO7A 1F8AB 4MTVA 2PBCA 2WLYA 1W9UA 3O5QA 3WD3A 4P8XA 2DG3A 2DT1A 1BKFA 1PINA 3NI6A 3CHEA 3O5OA 4QZVB 2K8IA
chains in the Genus database with same CATH topology
4DWSC 1NMWA 4DWSB 4LAYA 5I98A 2XP4A 1E6ZA 3RM4A 5GQBA 3B8SA 2DT0A 1HKKA 4ODKA 1ZBCA 1W26A 2RUCA 5GPGA 2M1IA 1HJWA 1W1TA 4Q22A 3RM8A 3KAGA 3OA5A 1FKIA 1E6RA 4QT3A 3O5JA 1OGBA 4P8VA 3RM9A 1EQ3A 2N87A 3WD1A 2PV1A 4W5UA 2XP3A 3PR9A 1J4IA 4L72B 4S3KA 3PRAA 2DG4A 1ROUA 4ZPVR 4P8WA 3TCZA 4DRPA 1HJXA 1UR9A 4JYSA 4ODOA 4ODLA 3KCEA 5DITA 4WIWA 3ODKA 1VF8A 5D75A 3CGNA 3AQUA 3TC5A 4DWSA 2Q5AA 3G6MA 1NWSA 3B9DA 1ROTA 2ZQSA 3ARWA 4N19A 3WH0A 4MSPA 2IF4A 1ZL1A 3KADA 5BXJA 1FKKA 4PTMA 1X6LA 5HW6A 1E15A 1LQ0A 2O92A 2ZQUA 1FKLA 1SR0A 3AS2A 4C02B 1H0GA 2LKNA 2ZR6A 1LL7A 4WKFA 3UQBA 3G6LA 4DH0A 4Q7NA 4XAKA 1BL4A 4BF8A 4IQ2A 1FFRA 2OLHA 4Z2JA 3UI4A 3NRKA 3UF8A 2KR7A 4DROA 4P8UA 4DRKA 1TFVA 4LAWA 2M08A 4HBOA 5DF0A 3O5EA 3O5RA 1FFQA 1H0IA 1FKTA 2OFNA 4ZPTR 3WD2A 4DRNA 3ARQA 4JFMA 5DEZA 1NWTA 1NH6A 4KR0B 1KT0A 3QOKA 3ARYA 2PPNA 1K9TA 2FAPA 4R0XA 3UI6A 3RMEA 2RUQA 3CHFA 4ZPWR 5DIUA 3ARRA 1W1VA 3O5PA 3UQAA 1E6NA 2A3BA 3CHCA 3EY6A 3PRBA 2FDMA 4QT2A 4MGVA 4ZS6A 2KFWA 4GIVA 4ODQA 3ARSA 4MNKA 5J6EA 3ARTA 5HT1A 1ZCNA 4O2TA 2DT3A 2MNTA 2XPBA 2KGJA 2DSUA 3O5KA 3AROA 3MDYB 3O5DA 2PPPA 2XPAA 1GUVA 4JFIA 4QIBA 2XP5A 4ML4A 4DRIA 3CHDA 1WB0A 1OWQA 2DSWA 1J4HA 4Z2LA 1HXVA 3ALFA 3B7XA 1RD6A 4DIPA 2ITKA 1ZK6A 3CH9A 3O5IA 4NZCA 2A3AA 4NNRA 1WAWA 1OGGA 2KI3A 4Z2IA 4TNSA 3CZ8A 2YBUA 4G50A 1J6YA 1NWRA 2Y78A 1FKFA 5HUAA 2XP6A 3OOBA 1XRVA 2L2SA 2PV2A 5HW7A 1UR8A 4W9QA 1LL4A 1D7JA 1ZBWA 2DT2A 4U86A 4MNMA 2ZQVA 5HTGA 3WQWA 1NMVA 3BXWA 4WKAA 4DRQA 3H9RB 1W1YA 4JFJA 2RQSA 3I6CA 1TCOC 3KAHA 1W1PA 1N1AA 2XP9A 2O9OA 1FJDA 2UZ5A 1W9PA 5JH8A 2MLXA 2WK2A 2RUDA 4S3JA 3JYJA 4Z2GA 2DPEA 1A7XA 2MPHA 1QZ2A 1KFWA 1L1PA 3WL1A 2WM0A 1EDQA 4IQCA 2LPVA 4ODMA 4G2PA 1QPLA 2LGOA 1J4RA 2PI6A 4TYOA 3WD4A 5DO2A 4L3NA 1Q1CA 1HJVA 4J4OA 3WL0A 4Z2HA 1Y0OA 1ITXA 3ARXA 2ESCA 1PBKA 3RFWA 4DRHA 3KAFA 2ZQTA 1EIBA 1W9VA 3O5FA 1D7IA 5HWBA 2MLYA 3AS1A 1U79A 1JVWA 4LGXA 2AOSA 4LAVA 4GGQA 3WKZA 3O5MA 2G41A 2F4EA 4MPKA 1FAPA 4U85A 2F21A 3IKDA 1CTNA 4FN2A 1FKHA 4IT4A 3RGCA 4DRJA 3UQIA 1LL6A 1WNOA 4AY1A 3WQVA 4W9OA 3IHZA 3LUOA 1FD9A 3JXVA 2VN1A 1C9HA 1FKJA 2ZR5A 2PV3A 1ZU8A 1NWUA 1FKRA 2M2AA 1YATA 1ZBVA 4U84A 4JFLA 1B6CA 2A3EA 2XP8A 4WJXA 2WLZA 1D7HA 1O6IA 2JZVA 2LJ4A 3CGMA 1Q6HA 2MLZA 3WIJA 4TX0A 3IKGA 1FKBA 2DG9A 3B9AA 1LJYA 1SYTA 2XP7A 4TW7A 3IK8A 4IPXA 3ARVA 3PRDA 5HW8A 4J4NA 1E9LA 1IX5A 1R9HA 1GOIA 3WD0A 3AS3A 4DZ2A 2D9FA 1HKJA 1D6OA 1XHGA 2YBTA 5DIVA 3KACA 3VAWA 5B8IC 1LG2A 1JNEA 1GPFA 4HARA 4FAPA 4DRMA 2QF8A 2ZR4A 1JNDA 1YW5A 3O5LA 2MF9A 1HKIA 4DT4A 3O5GA 4MNJA 1HKMA 5HKGA 3KZ7A 4LAXA 1NSGA 4WK9A 3FY1A 3TDBA 1Q6UA 2A3CA 1LG1A 4TW6A 4ODNA 4KQZA 1EHNA 1ZB5A 3KABA 1FKDA 3B9EA 2RURA 5HBFA 3ARUA 2G8ZA 4ITZA 3AS0A 4MAVA 1T11A 2RSEA 4TW8A 1Q6IA 2KE0A 3ALGA 4R5EA 3ARZA 3NTPA 2AWGA 4DZ3A 4NSBA 4ODPA 4URIA 4WKHA 3FAPA 4JFKA 1FKGA 1X6NA 1D2KA 3PA7A 2VCDA 4W9PA 1JNTA 2F2DA 1ZBKA 1JNSA 3KAIA 5GPRA 2FKEA 4ODRA 3FXYA 2DSZA 1EYMA 1P5QA 1FKSA 3JYMA 3ARPA 4MNLA 4Z2KA 3UI5A 2IUZA 4IT6A 3GPKA 2PPOA 1M5YA 4DWSD 4HBEA 2DSVA 1E6PA 1QPFA 1F40A 2B31A 5HWCA 3W4RA 1KT1A 2KO7A 1F8AB 4MTVA 2PBCA 2WLYA 1W9UA 3O5QA 3WD3A 4P8XA 2DG3A 2DT1A 1BKFA 1PINA 3NI6A 3CHEA 3O5OA 4QZVB 2K8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZ2 A;  5DIV A;  3KAC A;  3VAW A;  1NMW A;  5B8I C;  1L1P A;  4R0X A;  4LAY A;  3UI6 A;  5I98 A;  2RUQ A;  2XP4 A;  4IQC A;  5DIU A;  4FAP A;  2LPV A;  4DRM A;  3O5P A;  4ODM A;  2ZR4 A;  3UQA A;  4G2P A;  1YW5 A;  3O5L A;  2MF9 A;  3EY6 A;  3PRB A;  1QPL A;  4MGV A;  2LGO A;  3O5G A;  1J4R A;  4ODK A;  2KFW A;  1W26 A;  4GIV A;  4QT2 A;  3KZ7 A;  4TYO A;  2RUC A;  5HKG A;  4ODQ A;  4LAX A;  1NSG A;  5GPG A;  5J6E A;  2M1I A;  1Q1C A;  5HT1 A;  1ZCN A;  4O2T A;  4J4O A;  2MNT A;  1Y0O A;  2XPB A;  3KAG A;  2KGJ A;  1PBK A;  3TDB A;  1FKI A;  1Q6U A;  4QT3 A;  3RFW A;  4DRH A;  3O5J A;  3O5K A;  3KAF A;  2ZQT A;  3MDY B;  3O5D A;  2PPP A;  2XPA A;  4JFI A;  4QIB A;  1EQ3 A;  2XP5 A;  4TW6 A;  3O5F A;  4DRI A;  1D7I A;  2N87 A;  5HWB A;  4ODN A;  2MLY A;  2PV1 A;  2XP3 A;  1J4H A;  1J4I A;  1HXV A;  1U79 A;  1JVW A;  2DG4 A;  3KAB A;  1FKD A;  3B7X A;  1ROU A;  4LAV A;  3TCZ A;  1J6Y A;  4DIP A;  2ITK A;  4GGQ A;  1ZK6 A;  2RUR A;  4DRP A;  4JYS A;  4ODO A;  3O5M A;  4ODL A;  2F4E A;  3KCE A;  1FAP A;  4U85 A;  2F21 A;  3IKD A;  3O5I A;  5DIT A;  4ITZ A;  4FN2 A;  1T11 A;  1FKH A;  2RSE A;  3ODK A;  4NNR A;  1Q6I A;  4TW8 A;  3RGC A;  2KE0 A;  4DRJ A;  5D75 A;  3CGN A;  2KI3 A;  3UQI A;  4TNS A;  3TC5 A;  2Q5A A;  3NTP A;  2AWG A;  4DZ3 A;  1ROT A;  2ZQS A;  4G50 A;  4N19 A;  4W9O A;  3IHZ A;  3LUO A;  4MSP A;  1FD9 A;  2IF4 A;  3JXV A;  3KAD A;  4ODP A;  3WH0 A;  4DT4 A;  1FKK A;  5BXJ A;  2Y78 A;  3FAP A;  1FKF A;  2VN1 A;  4JFK A;  1C9H A;  1FKG A;  1FKJ A;  2ZR5 A;  2PV3 A;  5HUA A;  2XP6 A;  5HW6 A;  3OOB A;  3PA7 A;  2L2S A;  2PV2 A;  2VCD A;  1JNT A;  1FKL A;  2ZQU A;  4W9P A;  2F2D A;  1FKR A;  2M2A A;  5HW7 A;  1JNS A;  3KAI A;  1YAT A;  4U84 A;  4C02 B;  2FKE A;  4ODR A;  2LKN A;  4W9Q A;  1EYM A;  4JFL A;  1B6C A;  2ZR6 A;  1P5Q A;  2XP8 A;  3UQB A;  4DH0 A;  1FKS A;  1D7J A;  4U86 A;  3JYM A;  1D7H A;  2LJ4 A;  2JZV A;  2ZQV A;  1BL4 A;  1Q6H A;  2MLZ A;  3CGM A;  4IQ2 A;  4TX0 A;  3UI5 A;  4BF8 A;  3IKG A;  5HTG A;  2FAP A;  3GPK A;  1FKB A;  2PPO A;  1NMV A;  4DRQ A;  1M5Y A;  2DG9 A;  3UI4 A;  3H9R B;  4JFJ A;  3NRK A;  1QPF A;  2RQS A;  3UF8 A;  1F40 A;  2KR7 A;  2XP7 A;  3I6C A;  4TW7 A;  1TCO C;  5HWC A;  3KAH A;  1KT1 A;  2KO7 A;  3IK8 A;  4DRO A;  4DRK A;  4IPX A;  1F8A B;  5HW8 A;  3PRD A;  4LAW A;  2M08 A;  4J4N A;  1N1A A;  2XP9 A;  1R9H A;  2PBC A;  3O5E A;  3O5R A;  3O5Q A;  1FJD A;  2UZ5 A;  4DZ2 A;  2DG3 A;  1FKT A;  2D9F A;  2OFN A;  1BKF A;  4DRN A;  2MLX A;  1PIN A;  4JFM A;  3NI6 A;  2RUD A;  3JYJ A;  3O5O A;  1D6O A;  1A7X A;  1KT0 A;  2MPH A;  2PPN A;  2K8I A; 
#chains in the Genus database with same CATH topology
 4DWS C;  4UDM A;  1NMW A;  4DWS B;  4LAY A;  5I98 A;  2XP4 A;  1E6Z A;  3RM4 A;  5GQB A;  3B8S A;  2DT0 A;  1HKK A;  4ODK A;  1ZBC A;  1W26 A;  2RUC A;  5GPG A;  2M1I A;  1HJW A;  1W1T A;  4Q22 A;  3RM8 A;  3KAG A;  3OA5 A;  1FKI A;  1E6R A;  4QT3 A;  3O5J A;  1OGB A;  4P8V A;  3RM9 A;  1EQ3 A;  2N87 A;  3WD1 A;  2PV1 A;  4W5U A;  2XP3 A;  3PR9 A;  1J4I A;  4L72 B;  4S3K A;  3PRA A;  2DG4 A;  1ROU A;  4ZPV R;  4P8W A;  3TCZ A;  4DRP A;  1HJX A;  1UR9 A;  4JYS A;  4ODO A;  4ODL A;  3KCE A;  5DIT A;  4WIW A;  3ODK A;  1VF8 A;  5D75 A;  3CGN A;  3AQU A;  3TC5 A;  4DWS A;  2Q5A A;  3G6M A;  1NWS A;  3B9D A;  1ROT A;  2ZQS A;  3ARW A;  4N19 A;  3WH0 A;  4MSP A;  2IF4 A;  1ZL1 A;  3KAD A;  5BXJ A;  1FKK A;  4PTM A;  1X6L A;  5HW6 A;  1E15 A;  1LQ0 A;  2O92 A;  2ZQU A;  2PN0 A;  1FKL A;  1SR0 A;  3AS2 A;  4C02 B;  1H0G A;  2LKN A;  3BMB A;  2ZR6 A;  1LL7 A;  4WKF A;  3UQB A;  3G6L A;  4DH0 A;  4Q7N A;  4XAK A;  1BL4 A;  4BF8 A;  4IQ2 A;  1FFR A;  2OLH A;  4Z2J A;  3UI4 A;  3NRK A;  3UF8 A;  2KR7 A;  4DRO A;  4P8U A;  4DRK A;  1TFV A;  4LAW A;  2M08 A;  4HBO A;  5DF0 A;  3O5E A;  3O5R A;  1FFQ A;  1H0I A;  1FKT A;  2OFN A;  4ZPT R;  3WD2 A;  4DRN A;  3ARQ A;  4JFM A;  5DEZ A;  1NWT A;  1NH6 A;  2ETN A;  4KR0 B;  1KT0 A;  3QOK A;  3ARY A;  2PPN A;  1K9T A;  2FAP A;  4R0X A;  3UI6 A;  3RME A;  2RUQ A;  3CHF A;  4ZPW R;  5DIU A;  3ARR A;  1W1V A;  3O5P A;  3UQA A;  1E6N A;  2A3B A;  3CHC A;  3EY6 A;  3PRB A;  2FDM A;  4QT2 A;  4MGV A;  4ZS6 A;  2KFW A;  4GIV A;  4ODQ A;  3ARS A;  4MNK A;  5J6E A;  3ART A;  5HT1 A;  1ZCN A;  4O2T A;  2DT3 A;  2EUL A;  2MNT A;  2XPB A;  2KGJ A;  2DSU A;  3O5K A;  3ARO A;  3MDY B;  3O5D A;  2PPP A;  2XPA A;  1GUV A;  4JFI A;  4QIB A;  2XP5 A;  4ML4 A;  4DRI A;  3CHD A;  1WB0 A;  1OWQ A;  2DSW A;  1J4H A;  4Z2L A;  1HXV A;  3ALF A;  3B7X A;  1RD6 A;  4DIP A;  2ITK A;  1ZK6 A;  3CH9 A;  3O5I A;  4NZC A;  2A3A A;  4NNR A;  1WAW A;  1OGG A;  2KI3 A;  4Z2I A;  4TNS A;  3CZ8 A;  2YBU A;  4G50 A;  1J6Y A;  1NWR A;  2Y78 A;  1FKF A;  5HUA A;  2XP6 A;  3OOB A;  1XRV A;  2L2S A;  2PV2 A;  5HW7 A;  1UR8 A;  4W9Q A;  1LL4 A;  1D7J A;  1ZBW A;  2DT2 A;  4U86 A;  4MNM A;  2ZQV A;  5HTG A;  3WQW A;  1NMV A;  3BXW A;  4WKA A;  4DRQ A;  3H9R B;  1W1Y A;  4JFJ A;  2RQS A;  3I6C A;  1TCO C;  3KAH A;  1W1P A;  2F23 A;  1N1A A;  2XP9 A;  2B5U B;  2O9O A;  1FJD A;  2UZ5 A;  1W9P A;  5JH8 A;  2MLX A;  2WK2 A;  2RUD A;  4S3J A;  3JYJ A;  4Z2G A;  2DPE A;  1A7X A;  2MPH A;  1QZ2 A;  1JCH B;  1KFW A;  1L1P A;  3WL1 A;  2WM0 A;  1EDQ A;  4IQC A;  2LPV A;  4ODM A;  4G2P A;  1QPL A;  2LGO A;  1J4R A;  2PI6 A;  4TYO A;  3WD4 A;  5DO2 A;  4L3N A;  1Q1C A;  1HJV A;  4J4O A;  3WL0 A;  4Z2H A;  1Y0O A;  1ITX A;  3ARX A;  2ESC A;  1PBK A;  3RFW A;  4DRH A;  3KAF A;  2ZQT A;  1EIB A;  1W9V A;  3O5F A;  1D7I A;  5HWB A;  2MLY A;  3AS1 A;  1U79 A;  1JVW A;  4LGX A;  2AOS A;  4LAV A;  4GGQ A;  3WKZ A;  3O5M A;  2G41 A;  2F4E A;  4MPK A;  1FAP A;  4U85 A;  2F21 A;  3IKD A;  1CTN A;  4FN2 A;  1FKH A;  4IT4 A;  3RGC A;  4DRJ A;  3UQI A;  1LL6 A;  1WNO A;  4AY1 A;  3WQV A;  4W9O A;  3IHZ A;  3LUO A;  1FD9 A;  3JXV A;  2VN1 A;  1C9H A;  1FKJ A;  2ZR5 A;  2PV3 A;  1ZU8 A;  1NWU A;  1FKR A;  2M2A A;  1YAT A;  1ZBV A;  4U84 A;  4JFL A;  1B6C A;  2A3E A;  2XP8 A;  4WJX A;  2WLZ A;  1D7H A;  1O6I A;  2JZV A;  2LJ4 A;  3CGM A;  1Q6H A;  2MLZ A;  3WIJ A;  4TX0 A;  3IKG A;  1FKB A;  2DG9 A;  3B9A A;  1LJY A;  1SYT A;  2XP7 A;  4TW7 A;  3IK8 A;  4IPX A;  3ARV A;  3GTY X;  3PRD A;  5HW8 A;  4J4N A;  1E9L A;  1IX5 A;  1R9H A;  1GOI A;  3EIP A;  3WD0 A;  3AS3 A;  4DZ2 A;  1E44 A;  2D9F A;  1HKJ A;  1D6O A;  1XHG A;  2YBT A;  5DIV A;  3KAC A;  3VAW A;  5B8I C;  1LG2 A;  1JNE A;  1GPF A;  4HAR A;  4FAP A;  4DRM A;  2QF8 A;  2ZR4 A;  1JND A;  1YW5 A;  3O5L A;  2MF9 A;  1HKI A;  4DT4 A;  3O5G A;  4MNJ A;  1HKM A;  5HKG A;  3KZ7 A;  4LAX A;  1NSG A;  4WK9 A;  3FY1 A;  3TDB A;  1Q6U A;  2A3C A;  1LG1 A;  4TW6 A;  4ODN A;  4KQZ A;  1EHN A;  1ZB5 A;  3KAB A;  1FKD A;  3B9E A;  2RUR A;  5HBF A;  3ARU A;  2G8Z A;  4ITZ A;  3AS0 A;  4MAV A;  1T11 A;  2RSE A;  4TW8 A;  1Q6I A;  2KE0 A;  3ALG A;  4R5E A;  3ARZ A;  3GU0 A;  3NTP A;  2AWG A;  4DZ3 A;  4NSB A;  1GRJ A;  4ODP A;  4URI A;  4WKH A;  3FAP A;  4JFK A;  1FKG A;  1X6N A;  1D2K A;  3PA7 A;  2VCD A;  4W9P A;  1JNT A;  2F2D A;  1ZBK A;  1JNS A;  3KAI A;  5GPR A;  2FKE A;  4ODR A;  3FXY A;  2DSZ A;  1EYM A;  1P5Q A;  1FKS A;  3JYM A;  3ARP A;  2P4V A;  4MNL A;  4Z2K A;  3UI5 A;  2IUZ A;  4IT6 A;  3GPK A;  2PPO A;  1M5Y A;  4DWS D;  4HBE A;  2DSV A;  1E6P A;  1QPF A;  1F40 A;  2B31 A;  5HWC A;  3W4R A;  1KT1 A;  2KO7 A;  1F8A B;  4MTV A;  2PBC A;  2WLY A;  1W9U A;  3O5Q A;  3WD3 A;  4P8X A;  2DG3 A;  2DT1 A;  1BKF A;  1PIN A;  3NI6 A;  3CHE A;  3O5O A;  4QZV B;  2K8I A; 
#chains in the Genus database with same CATH homology
 4DWS C;  1NMW A;  4DWS B;  4LAY A;  5I98 A;  2XP4 A;  1E6Z A;  3RM4 A;  5GQB A;  3B8S A;  2DT0 A;  1HKK A;  4ODK A;  1ZBC A;  1W26 A;  2RUC A;  5GPG A;  2M1I A;  1HJW A;  1W1T A;  4Q22 A;  3RM8 A;  3KAG A;  3OA5 A;  1FKI A;  1E6R A;  4QT3 A;  3O5J A;  1OGB A;  4P8V A;  3RM9 A;  1EQ3 A;  2N87 A;  3WD1 A;  2PV1 A;  4W5U A;  2XP3 A;  3PR9 A;  1J4I A;  4L72 B;  4S3K A;  3PRA A;  2DG4 A;  1ROU A;  4ZPV R;  4P8W A;  3TCZ A;  4DRP A;  1HJX A;  1UR9 A;  4JYS A;  4ODO A;  4ODL A;  3KCE A;  5DIT A;  4WIW A;  3ODK A;  1VF8 A;  5D75 A;  3CGN A;  3AQU A;  3TC5 A;  4DWS A;  2Q5A A;  3G6M A;  1NWS A;  3B9D A;  1ROT A;  2ZQS A;  3ARW A;  4N19 A;  3WH0 A;  4MSP A;  2IF4 A;  1ZL1 A;  3KAD A;  5BXJ A;  1FKK A;  4PTM A;  1X6L A;  5HW6 A;  1E15 A;  1LQ0 A;  2O92 A;  2ZQU A;  1FKL A;  1SR0 A;  3AS2 A;  4C02 B;  1H0G A;  2LKN A;  2ZR6 A;  1LL7 A;  4WKF A;  3UQB A;  3G6L A;  4DH0 A;  4Q7N A;  4XAK A;  1BL4 A;  4BF8 A;  4IQ2 A;  1FFR A;  2OLH A;  4Z2J A;  3UI4 A;  3NRK A;  3UF8 A;  2KR7 A;  4DRO A;  4P8U A;  4DRK A;  1TFV A;  4LAW A;  2M08 A;  4HBO A;  5DF0 A;  3O5E A;  3O5R A;  1FFQ A;  1H0I A;  1FKT A;  2OFN A;  4ZPT R;  3WD2 A;  4DRN A;  3ARQ A;  4JFM A;  5DEZ A;  1NWT A;  1NH6 A;  4KR0 B;  1KT0 A;  3QOK A;  3ARY A;  2PPN A;  1K9T A;  2FAP A;  4R0X A;  3UI6 A;  3RME A;  2RUQ A;  3CHF A;  4ZPW R;  5DIU A;  3ARR A;  1W1V A;  3O5P A;  3UQA A;  1E6N A;  2A3B A;  3CHC A;  3EY6 A;  3PRB A;  2FDM A;  4QT2 A;  4MGV A;  4ZS6 A;  2KFW A;  4GIV A;  4ODQ A;  3ARS A;  4MNK A;  5J6E A;  3ART A;  5HT1 A;  1ZCN A;  4O2T A;  2DT3 A;  2MNT A;  2XPB A;  2KGJ A;  2DSU A;  3O5K A;  3ARO A;  3MDY B;  3O5D A;  2PPP A;  2XPA A;  1GUV A;  4JFI A;  4QIB A;  2XP5 A;  4ML4 A;  4DRI A;  3CHD A;  1WB0 A;  1OWQ A;  2DSW A;  1J4H A;  4Z2L A;  1HXV A;  3ALF A;  3B7X A;  1RD6 A;  4DIP A;  2ITK A;  1ZK6 A;  3CH9 A;  3O5I A;  4NZC A;  2A3A A;  4NNR A;  1WAW A;  1OGG A;  2KI3 A;  4Z2I A;  4TNS A;  3CZ8 A;  2YBU A;  4G50 A;  1J6Y A;  1NWR A;  2Y78 A;  1FKF A;  5HUA A;  2XP6 A;  3OOB A;  1XRV A;  2L2S A;  2PV2 A;  5HW7 A;  1UR8 A;  4W9Q A;  1LL4 A;  1D7J A;  1ZBW A;  2DT2 A;  4U86 A;  4MNM A;  2ZQV A;  5HTG A;  3WQW A;  1NMV A;  3BXW A;  4WKA A;  4DRQ A;  3H9R B;  1W1Y A;  4JFJ A;  2RQS A;  3I6C A;  1TCO C;  3KAH A;  1W1P A;  1N1A A;  2XP9 A;  2O9O A;  1FJD A;  2UZ5 A;  1W9P A;  5JH8 A;  2MLX A;  2WK2 A;  2RUD A;  4S3J A;  3JYJ A;  4Z2G A;  2DPE A;  1A7X A;  2MPH A;  1QZ2 A;  1KFW A;  1L1P A;  3WL1 A;  2WM0 A;  1EDQ A;  4IQC A;  2LPV A;  4ODM A;  4G2P A;  1QPL A;  2LGO A;  1J4R A;  2PI6 A;  4TYO A;  3WD4 A;  5DO2 A;  4L3N A;  1Q1C A;  1HJV A;  4J4O A;  3WL0 A;  4Z2H A;  1Y0O A;  1ITX A;  3ARX A;  2ESC A;  1PBK A;  3RFW A;  4DRH A;  3KAF A;  2ZQT A;  1EIB A;  1W9V A;  3O5F A;  1D7I A;  5HWB A;  2MLY A;  3AS1 A;  1U79 A;  1JVW A;  4LGX A;  2AOS A;  4LAV A;  4GGQ A;  3WKZ A;  3O5M A;  2G41 A;  2F4E A;  4MPK A;  1FAP A;  4U85 A;  2F21 A;  3IKD A;  1CTN A;  4FN2 A;  1FKH A;  4IT4 A;  3RGC A;  4DRJ A;  3UQI A;  1LL6 A;  1WNO A;  4AY1 A;  3WQV A;  4W9O A;  3IHZ A;  3LUO A;  1FD9 A;  3JXV A;  2VN1 A;  1C9H A;  1FKJ A;  2ZR5 A;  2PV3 A;  1ZU8 A;  1NWU A;  1FKR A;  2M2A A;  1YAT A;  1ZBV A;  4U84 A;  4JFL A;  1B6C A;  2A3E A;  2XP8 A;  4WJX A;  2WLZ A;  1D7H A;  1O6I A;  2JZV A;  2LJ4 A;  3CGM A;  1Q6H A;  2MLZ A;  3WIJ A;  4TX0 A;  3IKG A;  1FKB A;  2DG9 A;  3B9A A;  1LJY A;  1SYT A;  2XP7 A;  4TW7 A;  3IK8 A;  4IPX A;  3ARV A;  3PRD A;  5HW8 A;  4J4N A;  1E9L A;  1IX5 A;  1R9H A;  1GOI A;  3WD0 A;  3AS3 A;  4DZ2 A;  2D9F A;  1HKJ A;  1D6O A;  1XHG A;  2YBT A;  5DIV A;  3KAC A;  3VAW A;  5B8I C;  1LG2 A;  1JNE A;  1GPF A;  4HAR A;  4FAP A;  4DRM A;  2QF8 A;  2ZR4 A;  1JND A;  1YW5 A;  3O5L A;  2MF9 A;  1HKI A;  4DT4 A;  3O5G A;  4MNJ A;  1HKM A;  5HKG A;  3KZ7 A;  4LAX A;  1NSG A;  4WK9 A;  3FY1 A;  3TDB A;  1Q6U A;  2A3C A;  1LG1 A;  4TW6 A;  4ODN A;  4KQZ A;  1EHN A;  1ZB5 A;  3KAB A;  1FKD A;  3B9E A;  2RUR A;  5HBF A;  3ARU A;  2G8Z A;  4ITZ A;  3AS0 A;  4MAV A;  1T11 A;  2RSE A;  4TW8 A;  1Q6I A;  2KE0 A;  3ALG A;  4R5E A;  3ARZ A;  3NTP A;  2AWG A;  4DZ3 A;  4NSB A;  4ODP A;  4URI A;  4WKH A;  3FAP A;  4JFK A;  1FKG A;  1X6N A;  1D2K A;  3PA7 A;  2VCD A;  4W9P A;  1JNT A;  2F2D A;  1ZBK A;  1JNS A;  3KAI A;  5GPR A;  2FKE A;  4ODR A;  3FXY A;  2DSZ A;  1EYM A;  1P5Q A;  1FKS A;  3JYM A;  3ARP A;  4MNL A;  4Z2K A;  3UI5 A;  2IUZ A;  4IT6 A;  3GPK A;  2PPO A;  1M5Y A;  4DWS D;  4HBE A;  2DSV A;  1E6P A;  1QPF A;  1F40 A;  2B31 A;  5HWC A;  3W4R A;  1KT1 A;  2KO7 A;  1F8A B;  4MTV A;  2PBC A;  2WLY A;  1W9U A;  3O5Q A;  3WD3 A;  4P8X A;  2DG3 A;  2DT1 A;  1BKF A;  1PIN A;  3NI6 A;  3CHE A;  3O5O A;  4QZV B;  2K8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...