4NO0D

Crystal structure of non-phosphorylated form of rqa_v phosphopeptide bound to hla-a2 in complex with lilrb1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
195
structure length
192
Chain Sequence
b'PKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title The antigenic identity of human class I MHC phosphopeptides is critically dependent upon phosphorylation status.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/antigen
total genus 32
structure length 192
sequence length 195
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4no0D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4no0D02
3QZWG 2X05A 2I5YH 2CIIA 4PJEE 3LN4B 4G9FD 3BD4A 4OQTA 2NY6D 5ITBH 1FLTX 1IFHL 3NN8B 3BUYA 3W0WB 3WFBL 1U3HB 4FQPA 4ODWA 1OTUD 3ZKMC 1HH9A 1N8ZB 2JIXB 4JY4B 3X11A 1SJHA 1WFUA 3RKDC 5AZ2L 4W68A 1JCKA 1T89C 1K3ZA 1XGQB 1UXSA 3KYAA 3M07A 4MCZB 5BCAA 4ZQKB 5T1KD 3HA0A 5J11B 4RGMB 4JRXE 1A02N 3GNML 5JHLL 4X6CE 3D0LA 1H5BB 2NY3C 4Z7NE 1NUDA 4X7FC 4TYUA 4EVNB 3ECBA 3INUL 1HHJA 1FPTH 5BOPA 5AYUL 2PYFB 1KB9J 2P46B 4FZEL 4JB9H 2BVPB 1P5VA 1LO0L 3VXTA 4AZ8A 4JFED 2DDQL 4Y4KC 4P48A 3SDXE 4OIAA 4XCEA 5ITFB 1CG9A 4LPTA 5KJRH 3KXFD 4JFDD 1B4JH 4Z5RB 3L3DB 3T4YA 5F8RC 4KMTH 1A14H 1S5IL 1C12B 1IE5A 3TT3L 3S3JA 3W9DA 1HEZB 1I4FA 2KL6A 1BWMA 4PRID 1J1XL 4PGZA 3RWGA 4LCYB 4PJCE 3I85A 4XXDB 5FGBA 5GHWL 2H2PD 1M05A 4H8WH 5CILH 4LGPB 4RAVA 4PREA 3U0WL 1BD2B 5E2UL 3ZDZF 2NCMA 4R8WL 5DDHA 2B5IC 4XNMB 1HKLL 3WEXB 3SJVE 4NQCB 5GRYA 1Z9OA 4E9LA 3MGTA 5K9KA 3N50A 1NLDL 3WIHA 4AK1A 4GMSL 4M5YH 3WN5B 4WW1A 2CMRH 4OLUH 3N85H 1BEYL 4HBQA 1PJ9A 3MZTA 5E2WH 3OXSB 2G9HA 1WT5A 5D7IF 3G6AA 4GAFB 4OZHA 4Y4FA 3TBWA 3VRJA 4I9WD 5ICYA 4L9LA 4OV5B 1ACYH 1D5ZA 3ZSSA 1FG2A 4G6KH 4LCUA 4FXGA 3DETD 4V1DE 5CJXA 4DZ8A 1RJYB 2XI9A 5FB8A 1BAFL 3ZE0F 1K8IA 1ODAA 3BPNC 3FCTA 1N2RA 1EERB 2HRPH 1GL4B 4YIQA 4JANB 4IRJD 1NH6A 5I17B 1TJIH 4OF7A 4WRLA 2EDLA 3RJDA 4KU1A 2NYYD 1W2KT 1X5HA 2ZUYA 1KTDB 3R1GL 5IVXA 1X5ZA 4LGSB 1U3ZA 1F6AB 3T0ED 5JO5A 4RSVA 2IPTH 3EYUH 2CR6A 2AVGA 5T3XE 5D9SB 5JW4M 3QUMB 5IMLB 4ZUWA 4LMQE 2XACC 2YA2A 3ULUL 4HXBH 4LPXA 4MNGA 3UJIH 4MVBD 3ARDC 1SBSL 4WHTB 1OSPL 4GKOA 5L8KB 3SGJC 1YMHA 4O58H 4L3ED 4LAJH 1BBJA 1INEH 4MJIE 1EJ6A 5KSAD 1VPOL 5L0QB 1AIFB 4U7KA 2VXQL 4L3CA 4NO0A 5FYLD 4YAQA 5F7DB 1JTOA 1QQDA 1QFWM 3UJTL 2EE6A 4POUB 1AO7A 4JLRA 3HC3L 3IFOA 2AV7B 3LKQA 3QG6A 3OPZL 4HDIA 5EU7E 4YNYA 5CJBA 1F3DH 4NFBA 3IKCA 2ZUVA 1KELH 2DICA 3DUSB 3I6LD 4J3TA 1TXKA 1MUJA 5CEYA 4L8BA 1ZS8A 4KUZL 3K4AA 1KN2L 5ISZE 4PJIB 1FHGA 5EO1B 4J6RL 4ONGH 1WBYA 3FQUB 3SKMA 2APBA 2MPAH 3GSNH 4WW2C 2NY4C 4ZXBA 1OAZH 1GIGH 5CJ5A 4GRLC 2HH0H 1LWRA 4OZ4A 1AFVH 1NCBH 4JHZA 3NZHL 3MCKB 1U93B 1ZA6A 3FQNB 2F5AH 1MY5A 2XG4A 1HINL 5JW5B 3NIGF 4Q6IA 2XG5A 5LGJB 1EEZA 1PKQA 2V5YA 2AERT 1YA5A 5DJYA 1XGUA 3QO0A 4OB5H 1Y0LA 3QUXD 3DSFL 1BHGA 4M7LT 5IMOA 1A6ZB 3BP6A 1IGFH 5DQ9B 3MJGX 5ETUB 4JM2B 5BRZE 1YMMB 1XF1A 5C92A 5EWIH 3QXWA 1RFDL 4YEFA 1IEAA 2VB5A 2FBJH 4H1LG 5CLTA 5DVOA 1OARH 4JZJC 3C9NB 3V0VB 1Z9SA 3MUGA 4LASH 4LHUD 4NHUB 3HCVA 4TUJB 1UWXK 3T77B 3VGEA 5E6ID 4MD5A 4EN3A 1TJHH 1CXLA 4H1LB 1ZTXL 4P2CG 5FYKD 4OT1L 5C09A 4U31A 1BBDL 3VXOB 3EUUA 3IDGB 3SE3C 5ICZA 3JV4B 2ZWLT 3MV11 2P45B 4TSAH 5EB9A 3BAEL 2N56A 1S7VB 3RVWD 1KPUA 4TNVF 2NX5A 5E1AA 5ESAA 3TVMD 4F15C 2AXGA 4LHQB 4LBEA 2GYSA 3ULVL 3STZB 2E9IA 2C3GA 4L3AA 1FVEB 2VDQL 4AMKH 4U3XA 5MENB 1FNAA 4ZDHB 2CUIA 2MCPL 2B1HH 2ZG2A 5DF0A 5FCUH 1G7MA 3DGGA 4EUPA 1H3UA 4ZO7A 4M1GL 4Y1AA 2GCYA 3PGCA 2NXZD 2NY5H 4KK5D 2EE3A 3HAEA 1VFOA 3QJHA 4XPTH 3S7GA 1T7YA 1WFTA 2BNQB 4BFIB 3W39A 4HPYH 4HUUA 1OPGL 3MV9E 4V2BA 1U42A 1F3JA 3CX2A 4QNPE 5JHDD 2EDXA 3VXMD 5FUOL 2XRAL 2Y7QA 1MVFA 4PTTB 2ZCHH 4XP9L 2EDRA 2X4NB 4G6AD 1MVUB 5EU5A 4OI9A 2AABH 3CLEL 5T1MB 4LCWA 4OZFA 4PJIF 2YUWA 3P0YH 4BSJA 2QHLA 4NRZA 3O2DL 1ND0B 1BJ1J 5EPMB 4GAGL 4KROB 1CQKA 1UH4A 2OSLB 1EZVY 1KIRA 2PXYD 4ELKB 2I07B 5CP7A 5ICXA 2JELH 1KLFA 2WBJA 3NA4A 4POZC 2IGFH 1OGAB 5KVDH 2NR6C 3O6KH 3VRLE 1FJ1A 1YEKH 2IAND 3OQ3B 4MQ7B 4MA3A 3MFFB 4UDTB 2IADA 1QFWL 1VFAA 2B4CH 1KUMA 3L3IA 1BX2A 1FLRH 4ZUVA 4WFED 1D5MB 3LV3A 1WZKA 5L88L 2CDEA 3OJDB 3NAAL 2IPUK 3DIFB 4F7CB 3CAFA 4WU5A 2FB4L 3GKWL 3MLTB 2DQIL 3QIWD 4JM2F 4UNTA 4QRPD 4G9FA 5EZJB 3F7YB 3VI3F 4FFWC 4NWUL 1NEZA 2AJXH 5IGXL 4FQXC 3NCEB 4RISH 3EW3B 2QEJA 3JV6A 4KH2A 2YK1H 5EBLB 3TA3D 5I8EB 1Q9OB 4R96A 3DXAE 2ZUSA 1T03H 4OI8A 4X4ME 3M8OL 4QF1A 2VAAB 5E08L 3QIUB 2YC1A 2D4DA 5IFJA 4XMPH 2Q1EA 4NWTL 3O0RL 3SKUD 3HR5B 3O2DA 3QUZB 3SDCD 3BZEA 3C8HA 4AIZA 5B4MD 3MYJB 2JCCB 5HHPA 3U9PL 1JNNL 5EO9A 2XOTA 1DTUA 1EZVX 2R9HC 1ZWIB 4EOWL 3PXHA 4HF5L 4UB0H 4UTBL 1T7WA 3BZ4B 4DGIL 3KLDA 4JFEA 4X9HA 3OZ9H 4XZUB 5IBLD 3QIBC 1C7SA 5C08E 1C5CL 2YEZA 4PRDA 3DX7B 1HDMA 5T33H 2ESVE 4OQTH 5F7HA 5HYSA 3KXFA 4JFDA 4NKMB 1AD0B 4PGDB 4X4YB 1RZFH 2YA1A 3CLFL 3L3HB 1PSKL 4JQVC 4RGNE 2P49B 3KYOA 4NM4H 1R5WA 5I1GH 1KCLA 4KZDH 1S7TB 3VWJD 3CH8A 5IUSA 4HMEA 2JKXA 1QSFE 4PRIA 1I7RB 2EC9T 3QDHA 1XF5B 2F58L 4NNXA 4WHDA 3CDGB 4F8QA 4HG4K 2E7LA 1KPVB 3S8WA 1JPFB 5F7EL 1B4RA 5GRWA 2OK0H 1HYSD 4FQ1H 4KQ3H 5I30H 2MSPA 3VCLB 4F37F 2H1PL 3L3KB 2AAVA 3PABB 3MLZH 4Y89A 3V0AC 1K4DA 2VUOA 1GZQA 3C5ZD 1ZT4A 2A6IB 4LP5A 1RUML 1TJGH 4Y5YA 1YYML 5FYLL 3ARGD 3ARBC 4B7IA 1R0AL 5C07E 3VD7A 3QDAA 3WNPA 2FNBA 3EYVA 5F3BA 3WIIL 1NC2B 1YY9D 2NTSP 4J2XA 1AHWA 4X7TB 1AQDB 5D7KD 1IFHH 4JPVL 43CAB 1F3RB 4YHOH 3SY0A 4IRJA 3FAWA 4P2OC 3V6OA 5L2KD 4DCQB 1QLEL 4KKNA 2NY0C 1KPRB 4IS6B 5GSVA 3I50L 3S96A 4MGXA 2HVJB 1DANT 5KS9A 4JKKA 5HYIA 3GNMH 5H35A 5JHLH 4M4RA 1NC4B 3QQ9D 1X5LA 3O3EB 2A73B 3MJ7A 1GGCL 4LQ1A 3E6FA 4U4BA 1PX4A 1HWGB 5BVJB 4G3YL 3JBG7 5AD0B 1NGYA 3HFML 4QY8B 4EDXA 2OCFD 1JYVA 3L95A 5AYUH 5D72L 3MREA 4FZEH 2H45A 2JCCF 1U8PA 4HJ0C 1VA9A 4X5WB 3TO4C 4S10A 2DDQH 4L3EA 5F9JA 1TVBB 1N26A 5B22A 3SE8L 4XXCC 5KSAA 4NQEE 2WV3A 4LLWA 3UPRA 3R4DA 4HGWB 3WHXB 4Z7VB 3L3GA 1JNJA 5JW4R 3BP4A 5IB3A 2X4TB 2ILLA 1SEBB 2BOCB 3S5LG 4KTYA 4YGVA 4UT9L 2EEAA 1S5IH 4QXGL 1JPTL 5FYKL 3TT3H 4I1NB 4AM0B 4FFVD 1J1XH 4RMSA 2EDDA 1BIIA 3V6FA 1NUGA 4LKCA 5GHWH 2P8LB 3S5LB 4G8FB 1HXMA 1QFWI 3IJSA 5EORL 5TDNA 1MI5E 4M7KL 3U0WH 5E2UH 5T3ZE 4FXKB 4FQIL 4R8WH 5L8JB 4YFLI 4Z7WB 3U46B 3JXAA 4OGYL 1BZ9A 4BH8A 1JWMB 3VE0B 3OGCB 4WUUE 1OW0A 1SJEA 2LTQB 2BOBA 1KCUH 1NLDH 5LWYH 1KBGH 4U6XA 1NUNB 4D9QD 4OLWL 3BPCA 4M7ZC 2Y6SC 3QUXA 5GGSY 4EXPX 2BSTB 2C1PA 4BUGA 3DUUB 1HYRC 1NGWA 4MJ5A 1U95A 1KF9B 1YEEL 3DI3B 4Y4FC 1OTTD 5HXMA 2IBBA 1G0YR 3KVQA 4K3EH 4Z77B 2HJLA 1YJDL 3J7HA 2BSSA 3AB0B 1BAFH 1MFEL 5DK0B 4YO0B 2IWGA 1AH1A 2FR4B 1FO0H 4X6EB 1A3RH 2RFXB 3EOYG 2XKSA 1AQKL 3O4LE 4LHUA 5H2BB 3BGFB 1XF2B 3GSXA 1E6OL 2DYPB 4OCYL 4TRPL 5FV2A 5E6IA 5IB4B 1J0KA 2DIBA 5HJ3A 3MLYL 2DLIA 4P4KB 3DRTA 2WMPA 5E95B 1S3KL 2E6JA 4R4BA 2I26N 2RB8A 3PNWA 1F90H 3QEGH 3R0NA 5HD8D 5IVZB 1G84A 4ELME 4NBXB 4F9PC 1MFCL 2BRQA 4BSVA 3ULUH 12E8L 2ADIA 1WAAA 2GJ6D 4HGMA 1JV5B 2E7CA 3Q5OA 3TVMA 2PCPA 3WE6A 5MP6L 3K0WA 4L4JA 1F8TH 1H3TA 1GOHA 1BJ8A 1G7PA 4LNVA 4WI6A 1SBSH 2IF7A 1ZHLB 1OSPH 3LCYA 4WNQA 4ZAKB 4K07A 5DJDB 4WEMB 5JXAL 5HDQL 4HIIB 2NW2B 2YSSB 3TYGL 1JNHB 2Y5TA 3DX9B 2VXQH 4QOKB 5K59E 5F9WC 1KLGB 1P1ZB 1VGKA 4OUUA 5F1NA 3TBSA 2HT3D 3HC3H 3OPZH 2ADGB 4WENB 4Y16B 1RUQH 5JHDA 2RHEA 1JI2A 4KUZH 1KN2H 3GMNA 4J6RH 4RIRA 5HY9A 3RWHA 1JGVH 1Q72L 5TH2A 5I15L 2LFGA 4JRXD 4QXUH 1KGCD 5J12B 3KHOA 4PRNA 4HV8B 1CFNB 4ZXBC 2BY1A 1CVRA 3NZHH 3B6SB 3OR6A 3T2NL 4L8SC 2R4RH 2X4QB 2PXYA 2OJEB 4WFGE 4Z7WF 3CVHL 1XGRA 2IANA 5F21B 2CJUL 1D6VL 3MCG1 3DSFH 4NJ9L 5EIIB 3BP7B 1B3JA 3C5SB 1S7RB 5FEBA 5CSGA 3F7PC 3HAEH 2WINA 3IETA 1WWWX 1GPOL 3PHOB 1N64H 3NFPA 4QHLA 1RFDH 3QR2A 1I1YA 1O5DT 2OYPA 3WIFB 3GHBL 3S4SG 4Q6YA 5E4EB 4YXKL 4NZRL 3ZKQD 4Z9KB 4NZJA 1X3DA 3GSWA 3WFEH 1Q9WA 2CRYA 1LD9B 3IJHB 3VGFA 4B50A 1OSZA 2BFVL 4JQXA 4EN3C 3S4SB 3TA3A 1ZTXH 4MS8D 4OT1H 4CVZB 1BBDH 3BMWA 5HPOA 2FEEL 3H0TA 1IAKB 5I9QB 3SJVD 3MRCA 4LKXA 1DL7H 4NN5B 5EOTA 3F58H 4F58L 1LNUA 2V6HA 4W6WB 1X7QB 1WBZA 3GBLA 2G75B 5DRZA 1C5BH 1IEBB 5EUKB 3FO9A 4UV7L 3SDCA 3U9UA 1A9EA 4HH9A 1MCQA 3QFJE 3ULVH 4TUOA 4MMXC 1RZGB 1AE6L 4KHTL 1PQZA 4YHZH 3CVHA 4PJ7E 3VFTB 4DQOL 2MCPH 2XQBH 2HJFA 4V1DD 3NOIA 3ARED 1I3GL 3KAAA 2GQHA 1LMKA 3F62A 3QSKB 2VKXA 5IBUG 4ZS7L 4M1GH 4PGCB 4ZUUB 5DC9B 3N1PC 1J5OL 5JOFA 3ZE0E 1OPGH 2XY1A 1DBAL 4ZO6A 3MR9B 1G7HB 4UIMB 43C9B 4P3CL 1NDGB 3PL6C 5FUOH 3RTQD 3VWJA 2XRAH 2PTTB 4ZUTB 1DEDA 4F3FA 2A9NL 5DJ8A 5IF0A 5T3XD 2X4SA 1TZGL 5BZWA 5CGTA 3B4NA 4N0CC 1UB5B 2BJML 2NXYC 3DRQB 2VAJA 4HKBB 3O2DH 1GGUA 3VFRB 2Q8AL 1D5XB 3WUZA 4GAGH 3QZWA 2ITDB 3H42L 1MCCA 3PWPB 5F1IA 5I2IB 3VXSE 2WBJC 1BOGA 2C1OA 4Y8AA 3OAYK 4UBDC 4MJID 5HVGB 3D25A 3QUYC 1AD9A 1CD1B 1IGIH 2DQFB 3TBVA 4XVSL 3WS6A 1QFWH 4YHYC 5JDSB 3BP5A 4PJ5B 5L88H 3ULVC 3ARGA 3P9WB 2IH1A 4CVXA 3RZCA 3SDAA 5IW1A 2FB4H 3CFBA 3GKWH 5A1AA 1NDMB 2DQIH 4TSBH 3WFDL 2GK2A 2R2EB 4HGKC 3D39E 3ARZA 3GZKA 5SX4H 4NWUH 3FB6A 5ISZD 1CLYL 3VXQB 2QL1A 1SM3L 5IGXH 3QI9B 1ORSB 2E6PA 2EECA 3CH1A 5HGDA 2R0ZL 3BDXA 5I71B 1OTUC 5L2KA 3FQTB 3ET9F 3QDMB 4PRHE 4M3KB 1HH6A 4Z7UA 2EZ0C 4QCIB 1OP3H 3UYPA 3BH9B 1RUAL 3M8OH 1A5FL 3TM6A 2VDNH 4WTXA 2Z91B 4MA1B 5E08H 2ICWA 1OD7A 2NLJB 1JPGA 2F53B 3BO8A 4GS7C 4J8RB 1QR1A 3VRIB 1VHPA 2HT4C 3O0RH 2QSCL 4MAYB 4ODTL 4YHIA 2P7TA 2C4FT 1FIGL 1MFNA 3BSZL 3WBDA 1Z5LA 3U9PH 3JV5A 1SHMA 1U92B 1ITCA 4WHYG 5TPWL 2MNUA 4OIIH 1Y18A 1F6FB 4HF5H 1MPAH 5BRZD 3ZYJA 5JR1H 4UTBH 4JFFE 1BQSA 3FT3B 3H7BA 3LRSB 5GRUL 4MX7B 4PRBA 4QRQA 4DGIH 4XBPA 4LCCB 1Q1JL 2V9TA 5KANI 4R2GD 4XX1E 3IAGC 3MRMA 1C5CH 1RJLA 4HIEA 4C83A 1FP5A 4CADB 1B6UA 2BXYA 2YD9A 3F12B 3P30L 1D6EA 3UBXG 3QNYA 2VDOH 1S7QA 3EKCA 3ZO0A 1DCLA 1PSKH 4ZOEA 3ZLQC 4HX1A 5EOCL 1DEEB 1TCRB 4UU9A 4XNUL 1RJZB 2B1AL 4YX2L 1MRDH 1RSFA 3UBXB 3EDEA 1L0XA 1IILE 4M7JL 1OP5K 1QFPA 3UTTB 2Y36L 3QWRD 2R8SL 3GIZL 4C57C 2XQYG 4XNQB 5FO8B 4XRCB 1MWAB 5I6XC 2WANA 1MFBH 2VZTA 4MA8L 3K74B 2F15A 5F7EH 3HG1E 1EK3A 4RMQA 1WEJL 5I1LA 3OGOE 2H1PH 3PDDA 4QRSA 2XXMB 1NCTA 3WJLA 3V0WL 1DLFL 4DJMA 2DLHA 1WFOA 2FLBT 4FTVD 1RUMH 3UZQA 4KUCF 4M61A 2XTJB 2FJFA 2BVYA 4IOIB 1YYMH 5ENWA 3BFOA 3AAZB 4ZSOE 5FYLH 1X5AA 3OKLB 5DJCA 3GIVB 2J8HA 5FK9B 1R0AH 2FEEI 1I9RL 1QG3A 3MV9D 3RUGB 5I1HH 4QTIL 5BMFH 3WIIH 4YBHA 4OKVA 3FL7A 4GW5B 2A6JB 2YD8A 1W72B 4JPVH 4N1EA 5ALBL 5GGSA 2WWMC 4R3SB 3BW9B 4YPJA 4NO5A 1NFDB 1JF1B 1QLEH 3MBEB 4CKVX 3LEXA 4RAUB 2NYYC 2W0KA 4E0RA 1JPSL 3I50H 1JL8A 3ZHDA 4MHHG 5FYJL 3T0EC 2HKHL 1E4JA 3PHQB 3MRIA 4X9IA 2EXWC 1HSBB 4OCRL 1KCRH 5CSZA 2YUZA 1FZMB 1GGCH 5IQ9B 1LVEA 5LKNA 4G3YH 5E5MB 1ED3B 2GJ6A 3G6JE 3EAKA 2VABA 2N1KA 4M5ZL 1SVCP 4YDLC 1ZVHA 3FTGA 5D72H 3V5KB 3NGBC 3F7RA 2FEDD 5DMIL 1IGTA 4HS8L 3S3SA 4U1LB 3AS3A 4D2NA 1OB1B 2OJZH 4U6YB 1U8MA 5F72S 3MROB 3ZT6A 2ICWI 2PF6A 4PJEA 1CGSL 4Q2ZA 3ROLB 1G7JB 5DYOB 5L8LB 1LO5B 4PV9A 3TIEB 5KG9B 2DS4A 4KI5F 4NUGL 3T1FA 3VI3E 3P4MA 4UT9H 4QXGH 3DXAD 4R7DA 1JPTH 3O2VL 5FYKH 5HYQB 1PFCA 3CK0L 4LVOC 3FN3A 4K9EL 2Z31C 5ACZA 4XH2A 3GSRA 2Q76A 1UM5L 3H2WA 3O3BB 3REVB 4JRXA 1A7BA 1EHLL 1BF2A 5T5NF 4X6CA 4Y4HC 1DQDL 1R3HA 5EORH 5J56B 4J3UA 5E2TL 4Y5XA 4M7KH 2DQJL 1KN4L 2Q3AA 4Z0XB 5DHVA 4FQIH 2IFFH 4FNLL 3BEVB 4OGYH 4BELD 4LF3A 1UKTA 3MOBL 4YC2B 2A83B 2GFBA 3VFPB 4Z7QF 4QEGA 2R1XA 3G04A 4NQXA 5C08D 1XIWD 4OCWH 5DK2B 3SDXA 4KJYA 3BZFB 4P46D 1D9KB 3QUXC 4GO6B 4HPOL 5FO9A 4NDMA 5D93B 4C56B 2W9EL 1YEEH 3FFCB 2DKUA 2KUTA 4IRSB 2W91A 1T1YA 1JFQH 1A22B 4OZGA 4D0DA 2YMXL 1MFEH 5E8NB 4LGRB 1DSFH 3QHZL 1PVHA 1AQKH 3EZJB 4X9FA 4PJCA 5T3XL 3TT1L 4CJ0A 4OCYH 4TRPH 4XX1G 1L7TL 4JJ5A 3BDBA 4NO2A 1MHEA 5E6IC 5KOVC 3MLYH 1A2YA 2NTFB 2IFGA 4AEFA 4JPWL 2BVOA 3MJ9L 1XCQB 5EOCJ 3SJVA 2QADC 2IALA 1JHKH 3LN5B 5FOJA 3OKMA 1DQTA 3RY6A 4WGWB 2X4OB 1MFCH 4G42A 3VXRB 2APWA 3RVWC 4LRIC 1DVFD 2G5BA 4WTZG 4TTDC 5FHAH 4BQ9A 3TVMC 1AJ7H 2YXFA 2Z8VC 4M1CD 3IF1B 3QPQC 4KK8D 3U36A 3GMRA 1JGEA 5E6YA 2A6KB 3WUWG 1OGAE 2C3HA 5JXAH 5HDQH 3SKJH 4V1DA 2VZUA 5E99L 2AS5M 3AREA 4Y5VB 3PV6A 5HHVL 5E7BA 4UQ2B 3ZYOA 1L9NA 3WUWB 5JQ6H 5EBWA 5GQBA 3TV3L 2JJTC 5IOPA 5DXWA 3QDJB 4C54A 3HB3C 2OS7A 3H9YA 2Z0BA 4UINL 4N1HB 3BWUC 4G8IA 1BFOA 3RTQA 1YNKL 4NC2B 3TBYB 1IM9B 1INDL 4N0UA 1Q72H 5KN5A 4DUVA 3PWNA 3QCVH 1CF8L 2PO6D 3V7AE 3OXRB 1A1NB 4QGTA 2EEDA 4OI7A 4KTEL 3T2NH 1I1AC 1CICB 2VNCA 2HFTA 1PLGL 3ZT5A 3FO1A 3CU7A 2AQ2A 1YEDB 1ULVA 2VDPL 4NPYB 5GGUB 4Z7OF 4E42B 1U8LB 1S9XB 4AEEA 3DYOA 2ZCLL 1E27B 4MJIA 2CJUH 1D6VH 3BIAX 4NQED 4NZUL 4R0LB 5ID1A 1TQBC 2VLJE 2VN4A 5EBMB 5L7XL 1C16B 4NJ9H 5EU6B 1R3IL 3DO3A 1YN6A 3BQUA 5TE7H 4LU5L 1JI1A 1GPOH 2DI9A 3VFUB 1OAUH 5FA4B 2JE8A 1VADB 2GTWB 2IAMD 4LVEA 4YHLL 4JREC 5E8OB 4N5ED 3TWCL 3QIWC 2X42A 4F7MA 5CZXC 1KJVA 5IIEB 2XWBA 3ULSB 3ARFB 1EA9C 5ISZA 1X4ZA 1CXIA 5CZKA 3IT8D 4XNZB 2H41A 4IBLT 4X8JB 1LE9B 3FOLA 4U49A 2AGJL 3V6BR 4G6FB 2BFVH 2J5LC 3P4NA 1MI5D 4M7LL 3RPKA 3K2UL 3LB6D 5T3ZD 4P5MA 4OKDA 2Z4QB 1T2QH 3GSVB 1S9YB 3X12A 3T2PA 1MF2L 5HGHA 3MUZ1 4FRWA 5SX5K 1NCAL 4UV7H 4WI9A 4XHJC 5F1SA 4BZ2H 5JXEC 1VACB 3DX8B 2ARJQ 2DJSA 2UWEE 1S5HA 3MRGB 4NYLA 4IJ3C 1AE6H 5BRZA 1WCBA 2C3XA 3CFDA 4PB0L 3EDFA 4NKOB 1TCMA 1ZANL 2HFGL 4PGBA 5MHSE 3MRQA 3BT2H 2EIZA 5C2UB 1I3GH 5IBLC 3ZDYE 4ONHA 4ZS7H 3HE7D 1QVOA 1T2XA 4OD1L 4I2XB 3O4LD 1J5OH 4APQC 2GITB 2ZP0T 2Q86A 3BYTA 3WV0A 1DBAH 2PTVA 4UV4L 4LSDA 4Z18A 2AXHA 2XNAA 1ZSDA 5CSBA 3NCBB 4P3CH 1T1XB 1NFKA 3SBWC 2APTA 2R0WH 4GLRH 4PG9B 2EICA 2YN3A 2A9NH 1TZGH 5J9PB 4AL8L 4RAHA 3QWRA 2VL5A 2ZNXA 5FDYA 1Z2KA 3K8LA 1U3HC 3NVQA 5DTFB 1AXSA 4P2RB 1TZIA 3H42H 1NPUA 2SEBB 3DUHA 1JNLL 4GKSB 1OF2B 3KPMA 4R4ND 1HYSC 1P6FA 3U6RA 4NC0B 3RWFA 1WC7A 5MEOB 1GOFA 5DVNA 2OL3L 4J7RA 1IAIM 2RQ8A 3I3DA 4XCCL 1XR8A 4XVSH 4G9DB 3C5ZC 2NY3B 4U1IB 4Z95L 4GAYB 1BREA 2XWJA 1LK2A 3IU3A 4LMQI 5D1QD 4OZIB 4HUXA 3QP3A 2GAZA 3MTRA 5AYQA 4YDKL 3MV9A 4CU8A 1SYVA 3O3DA 3U0TA 4ODSL 4Z7VE 5J7CC 2APVA 3IDNA 3F8UB 32C2A 1YY9C 1CLYH 4Y4KB 1SM3H 2P8PB 1FL3B 1I7ZA 1DE4B 1HXYA 3JWDL 1N5AB 2R0ZH 3GK8L 4KI5D 1HILA 1KNOA 4JPIB 4BSWA 4QKXB 5KVGL 2AJ3A 1RUAH 1F11B 3EFFA 2P5WD 1A5FH 5FYKU 5MEPB 2CK0H 3AU1B 4E41D 1WBXA 5BJTB 5CJOL 1Z3GL 5EBGA 4WFGD 2DIAA 2LVCA 4YHML 5F7YC 4YQXL 2QSCH 2VR5A 1TZHB 5DWUH 5I0DA 1FIGH 5E9DB 3BSZH 5HHME 3KYNB 5DA0B 5IR1B 1Z0MA 5TPWH 1T3FB 1C08A 5KZCB 4PP2B 1S9KC 4G80A 3HI1B 5GRUH 3S37X 2ZUXA 1Q1JH 5DRXB 3EOTL 4KJQC 1VDGA 3WFZA 3CFEB 4FHBD 4V2CB 5EFIA 4QTHB 4JHAL 5DVMA 1T7XA 1KENH 3WN5C 1J8HE 3LQZA 2V2TA 4L8DA 5B39G 1MFAL 2CLVB 5EOCH 1D5BB 1WGOA 3U4EA 1TQCB 3AROA 1QRNE 3I9GL 1B0RA 4NQUA 2B1AH 4YX2H 4L29A 1YDPA 3V5DB 5E56A 5CGYC 3DXAA 4X4MA 2YUVA 4OLXH 4KHXL 4JVUA 5FO7B 2FATL 1BOYA 1HN1A 2X1OA 4FFVC 3GIZH 2R8SH 1JP5A 5C0CB 5MERB 3UTQA 2WUBL 5DMGD 1RZKL 4P2YA 3G5VB 4Q58C 4LLDA 1MCSA 4MA8H 3RX5A 5I8CA 5IFAL 2BHZA 3WJJC 2BX5A 4KJWC 4U1SB 2PTUA 3QFJD 2I9TA 1WEJH 1LILA 4BZ1L 4KC3B 4I5BB 2R4SL 4F2MB 1KT2A 4H0IA 4R4FL 1NEUA 1DLFH 1Z6JT 2FSEB 3V0WH 4XBEL 4AH2A 2C3VA 4LEXL 5C08A 5HHQB 1B88A 1JMZA 2B20A 1BZ7A 2UZYB 4P46A 5KW9L 2ESVA 1GHFL 5SWSE 2H8PB 3ZKNC 4YHPA 3U2SB 3HI5L 3ARDB 1MLCB 4ZYKB 3TPUB 1I9RH 3ZSTA 4MA7L 1R3LA 2X4UB 3HMWH 1OTTC 3I6GB 4QTIH 4N8CL 4OZIF 5C0BB 1Q38A 4HIJA 1II4E 4QOKE 4NKDB 4PRAA 3UTPD 2UUDK 3TFKC 4DGVL 5E8DH 1CT8B 2X4PB 4TSCL 4O2FA 5IW6A 2DQTL 5L0QC 3MRDA 4NQTA 2K7PA 1RUKL 4K2UL 3UTSB 1FVCA 1RZ8B 4XPHH 3TNNB 4GBXB 3ISWA 3MRRB 4O02L 3SKNB 3D48R 1WTGT 1WZ1L 3LIZL 3ES6B 3VD5A 1B0GB 5DHVH 4O51A 4KRMB 3GJFA 3VFWB 4H1LH 5FYJH 5F88B 5HI5D 5IKCA 2HKHH 3D85B 1CLOH 3DMMB 3VXSD 1K4CB 3O11A 4OCRH 5D7SL 4JO4L 1U58A 2Q3ZA 3THML 4RFNB 1VERA 1RQ5A 4LLYA 3KPPA 1IM3A 1DVFA 1IAIL 4WW2B 5ERWA 1CFSA 4G8EA 1ZLWK 4FZ8L 3BN9C 3KG5A 4GRLB 2P4AB 5DMIH 5DUML 2FJGB 4HS8H 3NH7L 3DVFA 4J12A 5E5RB 2WWKT 3H9SB 3LKSA 1ZHNB 1T04B 5C07A 3D39D 1CGSH 1NL0L 1DR9A 3TNMB 1U8JB 2LABA 1NBZB 4ZFFA 3HHRB 5IEHB 2EC8A 2EDOA 4IMKA 3O9WD 2FWOB 3MO1A 2HP4A 1JHTA 2LQRA 1ZT1A 4LOUD 1G0DA 3HS0A 4JRYB 4PRHD 4JM2C 3WKML 2EIEA 2CKNA 3O2VH 5D7LB 3CK0H 5T3ZL 5HSFA 5HYEA 5IEKB 3BI9X 3RVXD 4X99A 1UM5H 1UVQB 4OCMC 4JZNB 3AY4A 1EHLH 5IB1A 4IOFD 5DMKA 1CCZA 4LLMB 2PO6A 5E2TH 1P7KA 4Z0BL 2VC2H 3QEHB 4M6ML 4I18B 1A6WH 3SPVA 1KN4H 2V5TA 5JMOC 4FNLH 1AI1L 4RFEA 3STLB 5FOBA 3TH4T 1CQYA 3CC5A 4KKLD 3WL9B 3HI6L 1S78D 4JFFD 1GJIA 1FC1A 1TMCB 2ATKB 4OJFL 4AT6A 1W0VB 4YXLL 3FQWB 3L5WA 3PDOB 3B2VL 1FG9C 4NQEA 2ZZUT 1M7DA 3GSNB 4XGZB 1KLUA 2W60B 4WIQA 1R24B 4O00A 5JPNB 4JFXB 1EUUA 3HNVL 4F15B 1PYWB 1YUHB 2OTUA 1EXUA 2IAMA 3P9MB 3P4OB 1B90A 2YD7A 2X2YA 5F93C 5ANMB 2DLEA 5HVHB 3QQ3A 2YMXH 4NO3A 2AEQL 3ARYA 3VGHA 5HPMB 1CD9B 2A6DA 3G5XB 3MRKB 2EDKA 4L1HA 3TT1H 3MJ8B 4X0KA 2D0GA 1L7TH 1EVTC 4F7EA 5I19H 1S7XB 2GK0B 5IV2B 4XNYL 1TDQA 4PP1D 1MI5A 3DO7A 4JPWH 4MS8C 3MJ9H 2EXYC 3HG1D 4M02A 2W0PA 4XMLL 5EUOE 1QEWA 3HUJE 4WUUA 4U1JA 1CWVA 3FO2B 2DQEL 5HGAB 5D2LB 3U82B 2NW3B 5DEFB 2F74B 4P9ML 5D1XB 2BRRL 2GSGA 2O5YL 1R6VA 4I4WB 4JCLA 2YD2A 3PWPE 1MQKL 2L7UA 3CU1A 3VWKB 3CFIC 1UZ6E 2IQAB 1HHGB 3HLAB 4KROC 1FZKB 5E99H 2CLRB 1FNGA 5I74C 3S37L 5HHVH 1R5VB 2ADJA 3AREC 3BH8A 5EDXA 4PJ5E 4ZNEE 4C55A 5SWZE 3IDJB 1HNGA 1MLBB 3O4LA 2D7TH 4HUWA 3LPGA 4LSTL 1AXIB 4UINH 1CDUA 2Z8RA 4MQTB 2FLRT 3FOMA 3ZE2F 2OM5A 4BH7A 1MHCB 1INDH 3V4UL 3TN0B 1FYHB 3I75B 4BKLB 1JTPA 2HTLD 3GMPB 1CF8H 4F57L 1MCBA 1MFDL 4ELMA 3QDME 2COQA 2H6PB 3HE6D 4NQDE 4XI5D 3RPIB 1PLGH 2A74B 4MJ6A 2X5PA 2ZPKL 2VDPH 1NGXB 2Q7YB 3VA6A 2YRZA 2ZCLH 1GGYA 3MBXL 2B0SL 4LEOA 3QIUC 5C0NC 3CSPA 4X4ZA 3NFNB 5DVKA 1R3IH 5JUEL 1H3PH 2BHUA 3QUZC 3PWLA 4LU5H 3LOWA 5I76B 1JBJA 4WDIA 4HCRL 4YHLH 2R2BB 4XVUD 4GW4A 2YD3A 2CXGA 3BHBA 5L6YL 3TWCH 5CHNA 1QNZL 1S7SA 5C0DA 4IHOB 4WU7A 3QIBB 3VD3A 1PAMA 2XN9D 1HSAB 1IAII 3D18B 2AGJH 3EJJX 3L6FB 3QULA 4DZBB 4M7LH 3K2UH 2CRIA 3CD4A 1DUZA 4QXTB 2X7LA 3QFDB 3UZVB 1RIUL 3NIDE 5CKGA 3BKYL 3T1WA 3BGMB 1MF2H 3G5YB 3NACL 1F4HA 3V6ZA 3HZVB 5BW7A 1XCTB 3PJSA 2GJJA 1T66D 5DUBB 1LP9B 1U91B 5D2LF 1JN6A 5C6TL 5IB2A 3AM8A 1M6OB 2EYSA 1WTLA 4QRRD 3QO1B 2A1WL 2VUYA 3I02B 4P2RD 5EZIL 1NGZB 1W0WA 3N9GH 1VKXA 3GJEB 1T1ZB 4PJBB 4RFOL 4OBSA 3KPSE 4PB0H 2HFGH 4PJGB 4WWKD 2VE6A 5GSRB 5C9JB 4R2GC 2XTJE 3C60B 4OD1H 1NFIA 3B9KD 3NFSL 3PQYB 5EC2B 5DUPL 5IJVB 4RGOL 4HCRA 1A7RH 4MD4A 3QJFA 4MZ2A 4UV4H 4HEPG 3RUGE 3ARBB 3EJYC 3QG7L 5ECJE 3P77B 1KEGL 3PWVB 3PIQA 5BS0B 1PZ5B 3W5MA 4JKWA 4Y2DD 4Z6AT 3ZL4L 4AL8H 4ORGA 4K3DL 3P11L 1NFDE 5B3JF 4B41A 5J4MA 5D5MF 3BUYB 2J8OA 3BKML 3MV7E 1FSKC 4ODWB 2J8UA 2XPGA 1HH9B 3VFNB 5IHUL 1JNLH 3QFJA 5FYJU 4WI7A 1FFNA 3VJ6A 3WSQL 3X11B 1SJHB 1JZ5A 3GSUA 1UXSB 4PJ7A 2OL3H 3H6JA 2FDBP 5HTSA 5HDBF 4Z95H 3D0LB 1P2CA 4ONFL 2CUMA 1BWWA 3MRFA 2ZG3A 4PTUA 4JZOB 1HHJB 4HFWA 1JZ2A 4YDKH 2VR9A 3MNVA 4ODSH 2Y07L 2GI7A 2BVQB 2YBRA 3LN4A 5J8OA 1B0WA 3VXTB 3MOQA 2Y23A 15C8L 1T5XA 2G2RA 3OB0H 3JWDH 5JA8B 2AI0L 3GK8H 1NCNA 4XCEB 1CG9B 1NMAH 3KS0J 4WFHE 3BKCL 3WS3A 3Q5TA 4YBQD 5C0JA 5KVGH 4HK3N 1NCWL 1PBYA 2WUCL 3GSQA 1A3QA 2CSPA 5K9QI 4NFCA 5JNYA 4OF8A 1IGYA 5CJOH 4LSPL 5I1CH 1Z3GH 2G60L 1F45A 1YPZE 4G7YL 1URLA 3VXSA 4D9LL 3PP4L 3QCTL 4YDIL 1I7TA 1H5BA 4PRPE 4YQXH 3W9DB 1I4FB 4UAOC 2F19H 2IJ0C 3P9LB 2VLJD 3RWGB 4F9LA 4NC1C 4QGYA 5JIPA 4WEUD 2FD6H 5J6GA 1LEKA 1M7IA 4I3SL 1YN7B 4HW6A 1UH3A 3MOAL 4MB5A 2H32A 5FM8A 3V4VL 1LP9F 2V5RA 2BVPA 4RAVB 3ALPA 5DDHB 4Z76A 3EOTH 3RDTD 4N0RA 2AK1L 1CFBA 3GEWB 2LTQC 3MGTB 4PJBF 3D39A 2H9GB 4TQEL 5ITFA 5D6CA 1ZVSA 4PJGF 2V2WA 1NAKL 4C56E 35C8L 4M7ZB 2MKLC 3FFCE 4MYWB 1RK0B 3O9WA 4LLUA 1A4KB 4RMTA 3I9GH 2G9HB 3T3ME 1OGTA 2ICEA 4PRHA 3G6AB 4OZHB 4X83A 1S7WA 4Y4FB 1BGXL 3TBWB 3VRJB 4CAGA 2DKSA 4JG1L 1FNHA 4L9LB 3GJFH 2BHYA 4KHXH 5CWSB 1FG2B 4LCUB 4XP5L 4FXGB 4DVRL 3EBAA 3GMOA 1NBVL 4DZ8B 3JWDC 3BX7C 5FB8B 4LPVA 1RZKH 1K8IB 1V8HA 3KPRD 1N2RB 5IFAH 4OM1L 2NZIA 4YIQB 1FAKT 1TLKA 5J0BA 4AIXA 5IVXB 4MAUL 4Q0XL 2R4SH 4JFFA 4P4KC 4I0CC 1TETL 3VXRE 5FFLA 3WFCL 3P40A 4XBEH 4CDGC 5MHSD 4HBCL 5MEQA 4Y19E 1XIWC 5KW9H 1GHFH 5K9OA 1CDGA 4U0RB 4OQ1A 4ZUWB 4P46C 3MLPA 4PJHB 3HI5H 2CO6B 3HPJA 4N8CH 2EDEA 1MCPL 1QD0A 3PXJA 3EFDH 4DGVH 4N9OB 1AKJD 4TSCH 3IDMA 2RAMA 2ICCA 4M03A 1BBJB 3N1GC 4WTZA 4OCSL 3RVTC 2DB8A 2PW1A 5HGBA 5F9WB 3RVUC 1RUKH 4K2UH 3ARRA 4L3CB 1IBGL 4NO0B 4BQBA 4YAQB 2QJDA 1QQDB 1GGIL 1AO7B 1KYOK 5LBSL 1WZ1H 3LIZH 2VQ1A 3G08A 3LKQB 4HDIB 3VW3L 4YNYB 3KPTA 1IC4H 2ATPA 3HG1A 3VDBA 1MCOH 5L9DL 3ZZ1A 3IKCB 5D7SH 1QPXA 2JB5H 5CEYB 1MUJB 3THMH 3BE1L 1ZS8B 1JUFA 5KSUB 1RZKC 4ISVA 1IAIH 1WBYB 3SKMB 2L7JA 1EVUA 3TESA 1DBJL 4FZ8H 5DA4A 3C2AH 5J12C 2R2HB 2CRZA 4ZSOA 4XHQA 3WO4C 5DUMH 4ZXBB 1XR9A 3CIQA 1CFQA 2M8XA 4OZ4B 3NH7H 1T7ZA 4MXVF 2I9LA 3GFUA 3SQBA 1NL0H 4W4OA 4Q6IB 4FN0A 6FABL 1EEZB 3QXDA 4U1HA 5GGQL 5DC4B 4YFDB 3WKNA 5DJYB 1XGUB 3QO0B 1Y0LB 1JWSA 5IMOB 3BP6B 5E8EA 1XGYL 2Q7NA 5T3ZH 1A7PL 2VR4A 1FC2D 3FB7B 4OZHF 1IEAB 1CL7L 1TTFA 1H8NA 4Z0BH 5EIQA 2NPLX 4M6MH 3C8KA 3MUGB 3O8XD 3HCVB 3HE6A 4CL7A 3G6JA 3JTSA 5FDWA 5J13C 2W0FA 5HHMD 1AI1H 2BDNH 3MCKA 4MD5B 4OGXL 4EN3B 4JFPA 2VJXA 2J6EH 2LAAA 2FX8L 3HI6H 2F54D 3H3PL 1XGPA 3CFCH 4OJFH 5C09B 3QEQB 2DOCA 5FM4A 5LGJA 1CFVL 4ODXB 4YXLH 3U83A 3B2VH 5ICZB 3EO9L 1FFOB 4NN5C 5IVXF 4H5SA 1IEHA 2BSRA 2PETA 5D2NE 5DQ9A 1WWAX 4M6NL 4NZDA 1QSVA 3HNVH 5E1AB 1J8HD 1DBKL 5ESAB 1Z9MA 5I66A 3EJZC 4GRWE 2GKIA 3V5HB 5JZ7D 2AXGB 5FF6A 4EUPG 5IROA 4EQ3A 4LBEB 1QRND 4D0CB 1BQLL 5EG6C 3ARSA 1PGRB 2J88L 2X1WL 3C9NA 4N5EC 2AEQH 4LNRA 4JHBA 1ZT7A 2OQJB 4YE4L 3W2DH 1G7MB 1F4WH 3DGGB 4EUPB 4KJPD 1OAXL 1ZXQA 3BIBX 3RWIA 4Y1AB 3RL1A 3PGCB 4X6DA 3HAEB 3QJHB 1S9WA 5GGRY 3W39B 4XMLH 1H0DA 4HUUB 3MRBA 3O81A 5CP3A 3VXUD 4OZFG 1QFOA 1F3JB 3PL6B 3CMOL 1IAMA 3RBSA 2DQEH 3IDIA 1CFTB 1S7VA 2Y7QB 4P9MH 4P5TD 5EU5B 3VH8G 2O5YH 1WIOA 3PE9A 1XT5A 1MQKH 5SWSD 1P4LA 4QRRA 4UQ3B 1UCTA 1E0OB 3TPKA 3H9HA 4QRTB 1U8HA 2D2OA 4ZDHA 4A6YL 1KIRB 3OSKA 3CJJA 2WQRA 5ICXB 2WBJB 3S37H 5DD0H 1BLNA 1FJ1B 4WY7L 3HE7C 4MA3B 4OZIE 3B9KA 3GGWA 5FGCB 1ZV5A 3GBNL 4WHYH 4LSTH 3ULUF 1VFAB 3L3IB 2FHFA 2OMBA 1BX2B 4ZUVB 5C6PB 5GIRA 3LV3B 5FA3B 1LHZA 1YEGH 4QWWC 4KK9D 1ORQA 4PTTA 4WU5B 1IL1A 1QYGH 2Z92B 3V9FA 3Q6FA 4Y2DA 4F57H 1IRAY 2P24A 4G9FB 3LSOA 5ACMA 2NY6B 2QSVA 4KVCL 3ROOA 1NEZB 4POYA 2VMFA 5I71C 1MWAH 1BIHA 3JV6B 2XZZA 3S36L 2CIKB 2ZPKH 2AJVH 1OGAA 3KPNA 3T8XA 2DWEA 5C9KA 3MBXH 4ZFOL 2B0SH 4QF1B 1LDPH 5T1KB 1L7IL 5IG7A 3P0GB 2YC1B 5IFJB 5F1KC 4MAYC 4N8VG 5GGTA 3ZHLA 4WV1A 3VFOA 4XC3L 3BZEB 5D7JA 4AIZB 4HCRH 4RNRA 3C6LD 5D1QC 5HHPB 3WXWL 4A6YA 4CN6A 1CYGA 1XGTA 4HWUA 5EA0L 1T21A 3PWUA 1QNZH 3IGAA 3DSNA 5AUMA 5JW3L 5EZJA 3F7YA 3VFMA 1IKNC 5GISL 4LL9A 4JFEB 1NLBL 2HVKA 4GXUM 5CD3A 1U41A 1ES0A 2YEZB 4EDWL 4PRDB 4JY6A 1W72H 4KI5C 1WZMA 3MA9L 3KXFB 4ZD3L 5HYSB 4JFDB 3BDYL 1Q9OA 3GI8H 5J57B 1MCKA 4OF3A 1NCCH 3C6SB 3KYOB 5J89A 1RIUH 5DQJB 4WGVB 3BKYH 3U79A 1I85C 1R5WB 2YWZA 1A7QL 1MHHA 1CDYA 4N68A 3OG4B 5B39A 5BW7C 4PRIB 4N0YL 2VLJA 3T3PE 1RHFA 3MYJA 5C6TH 4N1CA 5ID0A 2GW5A 2FX7L 5I6XB 4NNXB 2A1WH 1TTGA 1RHHB 2YPLE 5EZIH 1FCGA 1V7ML 4RFOH 4WO4D 1FL6A 4ZFOA 4XZUA 4OV6F 5HYJE 5J3HC 3RDTA 2BZDA 1CL7I 4KKCD 5AG9A 3MLUL 1U8NA 2A2QT 3TYFB 2HAZA 2OR8A 3NFSH 2EC9U 1T0PB 4K23L 5DUPH 1ZT4B 3LS4L 2VISA 3LKNA 1A7OL 4Y5YB 4KZEL 1IKFL 5D1ZD 1AGEA 2YR3A 4FQ2L 2K3TA 3QXUA 1KEGH 1N5YL 4H20L 4MJ2A 2FJHA 5A3ID 1KC5L 4KMQA 3ZL4H 1EHNA 3ZYIA 3EYVB 4OGAC 5C8JB 3P11H 4K94L 4CUCA 1UJTA 1VB9A 3EO1A 3KR3L 1ERNA 3KPRA 3BKMH 1MCNA 5GZND 1BMGA 4Z8FL 3SY0B 4IRJB 1FNSL 1FQ9C 3MBEC 2UWEA 3T0VA 3WSQH 5DD5L 5GSVB 3IS1X 3DBXA 4WUKL 4X6FA 3S96B 3T0EB 1CD8A 5EZLB 5KS9B 1A4JA 5A2KH 2MKWA 5H35B 4I0PD 4ONFH 3Q48A 2KQMA 3MJ7B 5SWZD 2ED8A 4BQ6A 4AEHL 1NGYB 2YPVL 4EDXB 1MHPH 1JRHL 4JGJA 4H25B 2Y07H 4G8GD 4FMFA 1DANU 4TVPH 1E28A 3HN3A 4K71B 4KKBC 4L3EB 2OMNA 2BXZA 5F9JB 1MELA 3NIFF 2B2XL 3MRHA 1WUNT 5KSAB 3M1BA 2AI0H 3UPRB 3NTCL 2X9WA 3VU2A 4I0KA 1P53A 5DFVD 3L3GB 5HGGS 3QA3A 3WD5L 1KPRA 4NQDD 3BP4B 4DK6A 5IB3B 2WUCH 4ODHL 3KGRA 1WIUA 4M43L 5E0QA 2WWKO 2HVJA 3LEVL 4LSPH 5T1LD 2G60H 4YGVB 4D9LH 5HI5C 3QCTH 4YDIH 4MD0A 3OBAA 2NQCA 2FRGP 2YRPA 3FRPG 1MCEA 1A0QL 1X5YA 5C2BL 3SGEI 1BIIB 3L1OL 3QHFH 3V6FB 4LKCB 3F5WA 4AQ1B 2O93L 4HK0A 1HHIA 5ELIA 1HXMB 3IJSB 4I3SH 5TDNB 3MOAH 3V4VH 1GSMA 3DROA 2RCSL 1TNNA 5E8PA 4BH8B 5IWLC 2AK1H 4OFPA 1WF5A 1SJEB 4YC2C 3BGAA 2VDKL 3WHXA 4Z7VA 4X5LA 2BOBB 5HI4D 2XWTA 1DN0A 4U6XB 1J87A 5CJQL 3KLAA 3BPCB 2O5ZL 3QUXB 3HC4H 1D9KC 4PJXE 4U1NA 4DVBA 1NGWB 4IDJL 3WMSA 5HHXL 4MJ5B 4ZPTB 1U95B 3Q5YA 3TP4A 4LOUC 1BGXH 3QAZC 5CINL 4JG1H 4PYHA 3LKOB 4XP5H 4DVRH 3R0MA 3CPLA 2EE9A 3TBTA 3MLXL 2BSSB 3IU4L 3X13A 2P8LA 1L9MA 2AJUL 3MLWL 3ZE1F 1P7QD 1QFUL 5INDB 4IOFC 4EBQH 4OM1H 3QEUA 4LHUB 2VIRA 3RGVD 4FFYL 2DLFL 5E6IB 3VE0A 3MGOA 5HJ3B 4MAUH 4Q0XH 2QR0B 2AXJA 1T83A 3DRTB 1TETH 3KPSD 1MCLA 3WFCH 5CZVL 3K3QA 4R4BB 4ZG1A 4HBCH 3PNWB 5E2VL 3P4LA 5D6DC 4X7SL 4RZCA 3LMJL 3DUUA 4KXZI 2HJKA 3CVIL 1Q0XL 4BSVB 5KS9F 4H0HB 4K7PY 1J8HA 3REWA 1QHPA 3WE6B 3TVMB 3TO2A 2PCPB 1JF6A 3EYFB 1G7PB 2EYRB 2JJSC 4B0MM 3B2UC 2M2DA 1EEQA 1QRNA 1HZHL 3A67L 2D7NA 1PEZA 4M48L 4WNQB 2P1YA 4NQSA 2FR4A 4OCSH 1ADQL 2Y5TB 5H2BA 2YRLA 4GH7B 1IBGH 3MODL 4Y5VC 1AP2B 4XPBL 4Y88A 1HQ4A 4P5KA 1GGIH 3SN6N 4XAKE 3BISA 1VGKB 2NXZB 4OUUB 2XA3A 5F1NB 3TBSB 3MV7D 4U0QB 3VW3H 2F8VA 2UZXB 4J4PD 2X89D 1FFPA 3L5XL 5L9DH 5IMMA 3MX0A 5IVOA 5JHDB 3BE1H 5SV3A 5GRZA 2DN7A 3VXMB 4P57A 3GI9L 2V2XB 3GMNB 4RIRB 5HY9B 5C0AE 2DKMA 4P5TA 5TH2B 2V5MA 1OQOA 1DBJH 1Z9LA 1KCKA 3MLSL 5DO2C 2EIBA 4O2EA 5SWSA 2DM7A 1F02I 4PRNB 5GGRA 4ZAKA 2VH5L 3SCMD 4LDEB 3OR6B 3TF7C 1CICC 2VDML 2PXYB 3VI4E 6FABH 4W4OC 1OTSD 5GGQH 4JCMA 4DUXA 2IANB 4R0LC 4K7PX 4TNWF 5FUCC 3VGGA 2NX5D 3KPOA 4S2SA 1XGYH 2V7NA 4QHNA 2YWYA 1UJ3C 5JTWA 4GOSA 2EKSA 3D69A 1DFBH 1CN4A 2WINB 3V2AR 3IETB 3LZFL 1A7PH 2AQ3A 4ODUA 5DJ2A 4QHLB 2D7QA 3BKJH 4PPTA 1ADQA 1I1YB 2EH8H 3QIWB 1CL7H 1SQ2N 2YD1A 4NIKB 3D1MC 4PRPD 3ELAT 4L4VD 4QRPB 5KANG 2A38A 4JEGB 1MY7A 4PG2C 3GSWB 1Q9WB 1I9JL 4FA8A 1BQUA 1JRHI 1OSZB 2FX8H 3H3PH 3TA3B 2DMBA 2HG5A 2XFXA 4D0BB 5EC1B 3H0TB 1G6RL 4DKAA 2VLRE 3D0VA 4LKXB 5EOTB 1LNUB 5EIIA 1D5IL 2YPKA 1WBZB 3VXPB 3LKRA 5FHBH 5JPMA 5JOEA 3FO9B 1DBKH 4UOW0 2E9BA 4JFQA 1REIA 4GFTB 5F6HJ 1S9VA 1OLZA 4LCWD 4U2YA 3SDCB 3U9UB 3PHOA 3C6LA 1A9EB 4HH9B 4KDTC 3WIFA 1BQLH 2BVUA 4TUOB 1WAAF 2PKDA 2J88H 3LDBC 1PQZB 1MAML 3CVHB 1CTNA 4PJ9D 1PZUB 1M4KA 3DECA 4QRUA 1UADC 3IJHA 1T6VN 3PQYE 1FBIL 4YE4H 1OHQA 5EO0B 2HJFB 3F7VA 1J86A 5F6HI 1CK0L 1F4YL 4NNPL 1OAXH 4E5XA 3RIAF 1G9MH 4GRMA 1RZ7L 3OG6B 2OTPA 1JPST 5JOFB 1W8NA 5I8KL 4NZTH 3GM0A 1LO3H 2A0LD 3CMOH 5H94A 1X7QA 3VWJB 5TE4L 1DDHB 4HXAL 5EU4A 5IF0B 3GRWA 5EN2B 2X4SB 1T5WB 5BZWB 3SE9L 2X1QA 4Y19D 3EYQD 2NMSA 1FYTD 1T66C 2O5XL 3FONB 4Q9RL 2GJZA 1G7IA 4PV8A 4WO4A 4DKDC 2ZKHL 1G6RA 1NCDL 3QZWB 4A6YH 3D9AH 2VITA 5F1IB 1UB6A 3FJTA 4OTXL 2WK2A 4WWKC 3RNQA 5HBBA 1S8DA 2NZ9C 4M1DL 1BOGB 2C1OB 3ZMRA 4WY7H 4ZUUA 3SGEH 3D25B 1AD9B 3C5ZB 5CFHA 3GBNH 1VFMA 1U3YA 3TBVB 5DC0A 3WIHL 2NY2D 4MDIA 5D1ZA 5A40E 3BP5B 3ARGB 1H3XA 4CVXB 4X80L 5F3HA 2PTTA 1Y6KR 2VXTL 1QTYT 5IW1B 3CFBB 5EUOA 2AP2A 2N7AA 4KKAC 1F2QA 2VZOA 3HUJA 4K8RD 4Y2DC 3PP3H 4CU7A 4HWNA 2N4IA 4KVCH 3FB6B 4G5ZL 1G9MC 5CD5D 2NY1D 5HGDB 2HYMA 4HWBA 1J1OL 5L2KB 4DOHE 1HH6B 1EO8L 2X41A 3D3VE 2ICWB 3J8F7 1J7VR 1JPGB 1QR1B 3BEWB 4FABH 4I0PA 3WDIA 4YZFE 1QBAA 5MI0C 4PJ5A 3RL2A 4ZNEA 4XC3H 2I60L 4GG6A 5SWZA 4WV1C 2P7TB 1RY7B 3WXWH 1Z5LB 1RZJL 1NDMA 5EA0H 3VXNA 1Y18B 2YXMA 4G8GA 2R69L 3SDDD 2X6MA 3H7BB 4GUPB 5GISH 4PRBB 4QRQB 4XBPB 3VXQA 5DURD 3LHPL 2FECL 4HKZA 3QI9A 1ORSA 3BD3A 3MRMB 1RJLB 4HIEB 4C83B 1QP1A 3QNZA 3E1F1 1RIHL 5DZOA 1D6EB 1NGQH 2C4FU 3BDYH 2AEPL 3QDMA 3QNYB 1I3UA 3FN0H 1S7QB 4NQDA 3BH9A 4XCFH 4YBQC 3HR6A 3WHE1 4DW2H 1OWRM 3S9DB 5C0GA 4C4KO 3EZ8A 4HX1B 4YGAB 1TQCC 2GSIA 2NLJA 4UU9B 3OHXB 1JVKA 1X6LA 5T1LA 5DEGA 4F80A 2JLLA 3CZFA 1A7QH 4HJJH 4FQQA 1Q8MA 1MCWW 5T1DL 5SWQA 1J8KA 1I8LA 2FX7H 5HI3C 3CUPB 1FE8L 1UEMA 1WVZA 1V7MH 3LRSA 2AXFA 2P47B 3ZTNL 1YEJL 5SV4A 3TZVD 4CADA 5I1LB 3RDTC 3MLUH 4XVJH 4OBRA 4AJ0A 1QO3A 4QRSB 1A1MB 5IM7A 4XT1C 4K23H 4PJHE 4PJDE 1DQJA 3LS4H 2DM2A 1A7OH 4M61B 2ID5A 2PUQT 2FJFB 5ENWB 3ZDXE 4KZEH 2O61A 4L4TD 3Q3GA 4NNYA 5DD6A 1TCRA 1WQVT 4H8WC 1CXFA 1V3KA 4FQ2H 3NCMA 4K7PL 3KPQB 3QUKA 1N5YH 3W9EA 4H20H 3OAZH 3L3JA 3JWOL 1FFRA 4MNQE 1HI6A 1M71A 3WNKA 4OKVB 4S1QH 1J05A 4K94H 5D71H 3MXWL 3RI5K 5LG1A 4BA8A 2P5EE 1KG0A 1P7QA 3KR3H 1AO7E 5GGSB 1BQHA 4Z8FH 3QRFM 5FKPA 4OLVL 3CGTA 3RGVA 4NO5B 1KB5L 3VFGL 1J12A 4GBXC 3RKDD 4RDQG 4GKNA 3LEXB 5DD5H 4XCNA 4RBPK 3CX5K 4YHKL 3SGKA 4E0RB 4WUKH 4XAWL 3KPSA 4KRPD 4PJFE 5I1AA 1I8KA 2BY3A 4JAMA 4Z7UF 3DMMC 3SO3C 5CSZB 3HNTL 4RFNC 1X6NA 5C3LD 1V3MA 2QSTA 1X9QA 5J6HA 2GJ6B 4AEHH 5FK9A 3RWJA 1JRHH 2VABB 2ZUTA 1JK8B 3FTGB 1PEWA 3RUGA 8FABA 1T7VA 5TDOA 1TVDA 4YHNB 1MJ7L 3ARVA 1IGTB 4MZ3A 4AIOA 4OD2A 1UWGL 4RMWA 1OP9A 1U8MB 2B2XH 3MPCA 4JN1L 1T1WA 5GJSL 4NUJA 3NTCH 1ROWA 4HJGA 4PJEB 2FO4A 4Q2ZB 1NFDA 1JF1A 3P0VL 1ZOXA 2DMKA 3T0WA 1QBBA 3MV7A 4ODHH 4PV9B 3NZ8A 3RNKA 5GS1A 1CLCA 3T1FB 4J4PA 2X89A 4Q97A 4UDUA 2VZ3A 3L7EA 3FRUB 1XEDA 4QHUB 3CFKA 5AAMA 4PLJD 5ACZB 4XH2B 5E94B 2Q76B 3F7QA 1K2DA 5E5MA 1JGUH 4JRXB 1KB5A 5DJAA 4ESKA 3IXTB 4EKXA 3HZMA 4HLJA 1R3HB 2XKUA 5AEAA 4I18C 4Y5XB 1DZBA 5C09E 3QEQE 3SCMA 5DHVB 4R9HA 4TPRL 4ZTPL 2EDHA 1IQDA 1CGWA 1FL5A 4LF3B 1G7QA 5CIPA 5CCKL 2VDKH 4MNHA 2GFBB 3ROLA 2JK5B 5LGHL 2R1XB 3MNZB 5DYOA 2IMMA 3G04B 4Q74A 4NQXB 5CJQH 4FOMA 3IAPA 2O5ZH 3SDXB 3DX6A 4KJYB 5EZOL 5KG9A 4CMHB 1KEMH 4IDJH 3UTOA 5FO9B 5HHXH 4NDMB 4NQVA 5IJKC 4JHWL 4XP6L 5H8DA 4OM0L 5CINH 5HYQA 4R7NA 1T20A 5F7MC 1DQLL 3KYMA 1T1YB 1NCUA 1IT9L 3CSYA 4OZGB 4X4XB 3S34L 4UMGA 5HVHC 1YPZA 4EJ1C 3IU4H 2AJUH 1AGDA 5JIKA 4D0DB 1IC5H 4PRPA 4L4VA 1QFUH 2R2CA 4P9HL 2EE2A 3DHMA 1CE1L 1KIQA 1MQ8A 3IVKA 4FFYH 3IKKA 2DLFH 1BFVL 1T4KB 3O8XC 4JJ5B 3DV4B 2EDNA 1MHEB 1I9IL 1A2YB 2YPLD 1G0XA 3UDWA 1A6VH 4ZFZA 5HYJD 1MEXL 3ME0A 4LSUL 3SDYL 2R1YA 3SJVB 2FECI 4X7SH 2IALB 3IXAA 5DD1L 4FG6C 3OKMB 3LMJH 1MREL 1T22A 3CVIH 4G42B 1Q0XH 4C56A 2G5BB 4RMRA 5D1XC 1OP3K 1P84K 4PD4K 5JZ7C 4RMUA 3T0BA 1HZHH 1H8OA 5ACLA 3U36B 3GMRB 3VWKC 4M48H 1JGEB 2IQ9H 3IJYA 4PJ9A 4ZS6C 3TEUA 1BVZA 5F9DC 3QDGE 3VH8A 1ADQH 3JVGA 5I74B 1EUTA 4MMZC 3MODH 4V1DB 4XPBH 3AREB 2GUOA 4UTAH 4K8RL 4Q7DA 3PV6B 3ULVE 4TVSa 5IP4A 2NTFA 1IGCL 4PJEF 5EBWB 3FHQA 5E6ZA 5IFHL 1MCDA 4NN7B 5LVEA 1A6UL 4R6UA 3RJQB 1NSNL 4G8IB 3RTQB 1GAFL 3GI9H 3VXRA 3TN0C 1SJVA 3KYKL 1DLHB 4N0UB 5KN5B 2Z93A 2FO1A 3WCYA 3PWNB 4P5TC 2NY4D 4Y19A 1FYTA 3VA2C 5TF0A 3A6CH 3RAJL 3BD5A 2NY5C 4HWEL 2VH5H 2A6KA 2ARJA 2E9WA 3BOVA 3VG0L 4X6CF 5E00A 5HVWA 4P59H 2F8XC 4Z7NF 2VDMH 3SE4A 3FO1B 1KTKE 2W59A 3C2SA 1V7NL 4Z78A 4CDHA 2V7HA 4MJIB 4XWGL 5ID1B 1MJJA 4I48A 4PBWD 2QKIA 1LE5A 2ITCA 1MRCL 3ALWA 3NCYP 1YN6B 3SDXF 1U8IA 4C58B 3LZFH 5DMJB 2XZQL 3GUTA 4OUOA 3DVIA 4XPGL 4KK9C 4LK4A 3OKNA 2OX5A 1UM6H 3HTLX 4N8VA 4F7MB 1KJVB 3MCLL 5TGBA 4OZGF 5ISZB 1I9JH 1ONQA 1ZEAL 4KK6C 4HFUL 4CN4A 3GSOA 1EGJL 5KSBE 2B4CC 3P4NB 1FNEA 1YEDA 4PJCF 3GBML 1PG7X 4GSDL 4JG0L 5GGUA 1S9XA 3S97C 4P5MB 2X9YA 1E27A 3FN9A 2AK4E 1C16A 4JO1H 1D5IH 2W92A 2PN5A 2ADFL 3X12B 5HGHB 3SQOL 1J1PL 2HLAA 4FQHA 4P49A 1EBAA 5FA4A 3RHWK 3LQAL 3D2UD 1G9EA 4WJ5A 2HWZL 3IDYB 4UT7L 3QB7C 1S5HB 4NYLB 1FN4A 4HIHB 4G7VL 2Q6WA 5BRZB 1MAMH 2R1WA 1WCBB 3SDDA 4NBZB 3CFDB 4LVHB 5GS0D 1FBIH 4PGBB 1P4IL 4R2GB 3MRQB 2EIZB 4NNPH 3C60C 1XF4B 1E6JL 4U1MB 1QVOB 1MOEA 3MV8E 4I9WE 2Q86B 2VLKE 4O2CA 2BNRE 3B8SA 4FQJL 4DKFL 4P2QE 3RZCD 4CN1A 1AGFB 5DFTA 4XB8A 3SDAD 3GSVA 4OCXL 4K3JH 2DMCA 4WFFD 5TE4H 2VDLH 5TF1L 4BK5A 5JORA 1EGJA 3SE9H 1T0MA 1VACA 1L6XA 2VL5B 2O5XH 4PLOB 5D2NA 3UP1A 4Q9RH 3O6ML 3WFBH 3GHEL 2UVFA 1FSKB 1E4KA 1NCDH 1AXSB 3T0EE 1TZIB 3ILQC 5C0EB 5AZ2H 4OTXH 4I8DA 3TZVA 2NR6D 3KPMB 5GZOC 3LKPA 2D0HA 6CGTA 1WC7B 4HHAA 4FTVB 1XR8B 2FIKA 3WIHH 1INQA 4XAKD 4L4TA 1LK2B 3INUH 3IU3B 4X80H 2Z9TA 5TQ2L 4HUXB 2GAZB 4L3EE 3RIAK 2Y4SA 3MV9B 2DBLL 3UYOD 1SYVB 3O3DB 3U0TB 1LO0H 4EQ2A 4FFWD 3IDNB 1RVFL 5ITBL 4FQXD 4G5ZH 1I7ZB 5C0AD 4S0TD 1HXYB 5DTFA 1U6AL 5GZNC 3OKEA 1CDHA 4BSWB 3K4ZA 3O41A 3RFZC 2D03L 1T89A 2AJ3B 1MJUL 2EDJA 3PWJA 3EFFB 4RWHA 2DTML 4IOSD 1G1CA 1WBXB 4G9DA 2VLME 3G6DL 2EDTA 1IGJA 4UAOB 4L8CB 3E6HA 4U1KA 3U30B 3HPLA 3VGDA 2R9HD 5FGBC 1RZJH 5IHZA 3T0XA 2FYYA 1I8MA 2PYEE 3FRPA 3RA7L 3DVGA 1HKLH 3FB5A 3GMLB 4G80B 4NCDA 4Y4KA 3LHPH 2OL3B 3LVEA 1FV1A 4Y2OA 1RIHH 4GMSH 1EEYA 2AEPH 4PS4L 4DN3L 3BRGC 5EIVA 4HUVA 2V2TB 1BEYH 1UM4L 4L8DB 3U4EB 4IIQA 4U7MA 5BJTA 1WT5C 1B0RB 5GJTL 4L29B 1YDPB 3CXDL 4DWHA 3DXAB 4B5EA 4L9LC 4XBGA 5T1DH 2VLRD 2ZSVA 4EI6A 5CJXC 3IAQA 3UTQB 3U0PA 2BNUB 1I8LC 1BJ1H 5E24E 1FE8H 5C86A 4LLDB 2NY7L 4S1DC 5I8CB 1FVDA 3BXNA 3R06A 2ZSWA 3ZTNH 3R1GH 2I9TB 1TIUA 1H3VA 5DRWA 3KLHD 1KT2B 3NABL 5F70A 1VFBA 3RGHA 4AH2B 2C3VB 4LLAA 5C08B 2VWEC 1QRKA 1XIWB 3H7LA 4QHKJ 1UCBL 3JV0A 1BZ7B 4P46B 4U0RC 4NT6A 4K7PH 4YHPB 3U4BL 3EDDA 1MSPA 3V5DA 4KV5E 2AJSL 3L5JA 3JWOH 5CLWA 4JRWA 1R3LB 4MQXC 3DNKA 1MIEL 3HZYA 1WICA 4G6KL 4RCAA 1KYOJ 2PR4L 4QHKI 5MERA 4PRAB 3AVEA 1VPOH 3TIDA 2JB6A 3QT2A 4QNPF 4O2FB 5IW6B 2HRPL 4P2OD 1ZGLM 3MRDB 2RJMA 3UJTH 3PG2A 4LIQL 1KB5H 5C0FA 3FFDA 1FVCB 3RGVC 3E3QC 1N3NB 2NY0D 4JM4L 1D3CA 3WLBA 1KJ2L 4YHKH 1S7UA 2YPLA 4XAWH 3VXME 4O51B 3B3IA 4O5LL 3GJFB 5HYJA 3JUYA 4DUWA 5IKCB 4D8PA 4ZNCD 3MXVL 5CIPH 1PG7L 4GQPH 3HNTH 1U58B 2IPUG 2AV1A 3OMZA 4JN2A 3KPPB 1IM3B 1DVFB 5ERWB 2DWDA 1CFSB 4ZYKA 4G8EB 3WO4B 3B43A 3VRLF 2PNDA 3SGJA 1MJ7H 3QRGL 4RRPA 4KVNL 2RR3A 4U6HA 3TO4D 3HRZA 5DJ6A 1UWGH 3DARA 4KFZC 3X3FL 1HINH 4CW1A 2PW2A 2W1NA 4JN1H 5C07B 2R0KL 5GJSH 3K4DA 4Q6IC 5I1DA 4F7PA 3P0VH 3MRRA 4ZFFB 3ULUC 3UROR 1CIDA 2Z8WC 4DEPB 3EDJA 4GQ9L 4EUPH 4M4PA 3DTXA 1ZT1B 5GS1C 3HS0B 4IMLA 1QA9B 1QSEE 1K4CA 1KELL 3DGCR 2BCKA 4QRPE 5HHOE 5F6IB 3D3VD 4QHMB 3BUTA 4X99B 4RBPH 4ONGL 3R8QA 1FZJA 1JZ6A 1UQSA 5IB1B 1VGEL 2P43B 2PO6B 1HOCA 3WDJA 1P7KB 3EO0A 1KJ2A 3HC0A 4MXQC 4PGEA 1CDBA 5J13B 1GIGL 5DK3A 2HH0L 4ZTPH 1O7VA 4OZFH 4RFEB 1RMFL 5FOBB 4UT6L 3CC5B 5CCKH 2W9DL 1HHHA 1AGBA 4XVTL 5LGHH 4AT6B 3MRLA 3FB8A 4OAWA 2Y6SD 3ZDZE 1JYWA 3EOBA 3BAEH 4NQEB 4LVNB 5GS0L 1M7DB 4JKPL 1KLUB 4ERSL 4LPYA 1YQVL 1BECA 3EGSB 4MWFA 2VXSL 4OF0A 5D8JL 4XP6H 4OM0H 4ONOA 1CE6A 2OTUB 1GGTA 1EXUB 3TCLA 3LPFA 2IAMB 5FKAA 1MH5A 1UVQA 2KH2B 1J0HA 3S34H 3ARTA 2EEBA 2VDQH 4JZJA 1RUPL 2DQUL 4X9BA 1H15B 4NO3B 1U0QA 5D7IE 1T0NA 1CE1H 2A6DB 5CKAA 1BFVH 3O4OB 4X0KB 4F7EB 2HT2C 1JF5A 4YR6A 1UKSA 1TJHL 1I9IH 1MI5B 3DO7B 3L7FA 2B8OT 4YLQT 3SE3A 1U8QA 3SKOA 1QLRB 4BZYA 5BQ7B 3FQWA 3P73A 4LSUH 3PDOA 3SDYH 3K2MC 3MACL 3SOBL 1QEWB 5IBUB 4XGZA 3ZYZA 2FX9L 1MREH 1CIUA 4XP9H 3K81A 3W0WE 1X44A 3T08A 1FZOB 5AAWA 3CLEH 4N0FA 1RK1A 1O0VA 2GSGB 1VSCA 3D2UA 4PJXA 4PYGA 3N1FC 4CMMA 1ETZA 2Y5EA 5GS2D 4ENEC 2F5BL 2QSQA 3GMQA 4TNVK 4MNQD 1IMHC 3ARXA 2P44B 2UV3A 1SEQL 2IH3A 1FNGB 3JVGC 1IQWL 2ADJB 2P5ED 3BH8B 5IV2A 1BVLA 3HE7B 1IGCH 1NMBL 4XPTL 4URTB 3O4LB 5IFHH 1TPXB 1A6UH 5DHYB 3K46A 3BQUD 1ZLVH 1NSNH 3NAAH 3S88L 2A0LC 3BYYA 1GAFH 3FOMB 2VLLA 4BH7B 4DTGL 1TVHB 2ZCHL 3KYKH 3OKDA 5FXCH 2AABL 3D87B 1N59B 1BM3L 4I4WA 2NY6C 3RAJH 4ELMB 3P0YL 4HAFA 4HQQL 4HWEH 1KULA 3VG0H 3DHJA 3VGAB 1EEUA 1J11A 4MJ6B 1V7NH 4OFDA 2IGFL 5K9QG 2GT9B 3O6KL 3CFJA 4XWGH 4LEOB 1A1OB 1FGVL 4YH6A 4KGLA 3I84A 4JDTL 4NWTH 5C6WH 3OKKA 5F9AC 1MRCH 1BD2E 1FLRL 4U3HA 3NIGE 1ITBB 4JFHE 3PWLB 1JNNH 5D1QB 2XZQH 4NQCE 4WDIB 4EOWH 4XPGH 2Z8SA 4GW4B 3OKOA 2Q87A 5GXBB 4BKLA 2X9XA 3BHBB 3WO3B 5CHNB 1S7SB 5C0DB 3HZKA 3QH3A 3MCLH 4WU7B 4ZUSA 4FQXA 1QBML 3SGDI 1ZEAH 4HFUH 1ZGLA 1CR9L 5C0AA 1EGJH 1CBVL 1ZA3A 5FAAA 2NNAA 4ZOAA 1EH9A 3CLFH 2VXUL 3GBMH 4GSDH 4JG0H 1DUZB 3SO5A 4KY1L 2X7LB 1F3DJ 1C5DA 2P5WB 4E41B 1B2WL 4XMPL 3B8YA 2ADFH 3TLRA 3SQOH 3V6ZB 1J1PH 3PJSB 3BPLC 3MLRL 3LQAH 2GEEA 2F58H 1JN6B 2HWZH 4UT7H 5IB2B 2EYSB 2H2PC 3LD8C 2XY2A 5IESL 2DL2A 3LS5L 4JFOA 1VKXB 2W65A 1TITA 2CDGA 2E7LC 3QIBA 1EO7A 1P4IH 5A2IH 2VE6B 3KLSA 1EJOL 1E6JH 2J3SA 5T33L 5F8QC 3WXVL 2FIRT 1NFIB 1NBYA 4JQVA 4MD4B 2K1MA 1ZGLP 3QJFB 4Y5YC 1JMXA 1KFAL 1JGDB 2W9LA 4FQJH 2RBLA 4DKFH 4KPHL 4OCXH 4X7CC 4MCYA 1F58L 4IDLA 1Q94B 1KTRL 2VLRA 4N0CD 3MMEB 1DQQA 2IC2A 4JDZA 3DETC 3MC0A 4YFEA 2NXYD 1VEMA 1AHWC 3GHEH 1CLZL 3NBNA 4JO3L 1T1ZA 2J8UB 2XPGB 4NOBA 1SY6L 4IRJC 4ELMF 3VMOA 3V6OC 2V9QA 1E4KC 3QFJB 5J1TC 3VGBA 1FFNB 4JR9L 4FQ1L 1YY8A 4GJTB 4KQ3L 3VJ6B 4BJLA 5C9JA 1DUYA 3A0OA 1UACL 4PJIE 3QUYD 4PJ7B 3DLQR 1J18A 3QDGD 3PQYA 3QXAA 3VG9B 5C70A 1TJGL 5FGSA 1P2CB 5LGKA 3MRFB 4F37K 3HFMH 4RQQA 3X14A 2FGWL 4PLKD 4PTUB 5K59F 1A6PA 4HFWB 4MVBC 3U1SL 1I1RA 3MNVB 2H2SD 2YBRB 4PJAA 1RVFH 1LEIA 5DFWH 3SE8H 4K71C 2BY0A 4S0SD 25C8L 3JTTA 5KSAC 1T5XB 1UFUA 3MFGB 2G2RB 4P2OA 1U6AH 3VFNA 4YHOL 3PGDA 4YBLB 5E7FA 1LDSA 4ALAL 2EZ0D 3WS3B 1YMME 4HZLA 2D03H 3N1QC 5C0JB 1MJUH 4O4YL 4HT1L 3GSQB 2DTMH 3FQXA 2KZWA 5JNYB 4WTWA 3K1KC 4JGMA 1IGYB 4KRPC 2DQDL 2HT4D 3VXSB 3G6DH 1UWEL 1I7TB 1KGCE 4ZODA 3DVNA 1K9TA 1LEGB 2E27L 5TFSL 4D94A 4NFDA 2DRUA 1SY6A 1P5UA 4JZOA 1F5WA 2CUHA 1ZLUH 4YUEL 5FYJE 3U7AA 1LEKB 5J6GB 1M7IB 5KVMC 4XP1L 1VESA 2BVQA 2H32B 3RA7H 1U9KA 3UO1L 3OF6D 3TO4A 2WIMA 5DEZA 1E4XL 5JLZA 2HN7A 1CS6A 4XXCA 2UYLA 2KBGA 4Z76B 1OW0C 1R3KB 4Y7MA 3D39B 2KZ1B 4OLWH 5D6CB 1ZVSB 4DAGL 4PS4H 4DN3H 3DWTA 1JYXA 2V2WB 2APFA 1IAOA 2JJUA 1UM4H 2ESVD 3O9WB 4LLUB 5DJXA 1ZKAA 4OZGE 3QAZB 5GJTH 1OGTB 2ICEB 3CXDH 4M6AA 4PRHB 4IIQC 1S7WB 4RGND 5MENE 4GW1A 3GM8A 1AGCA 3D3VA 1YJDH 3P9LA 3VDAA 2AK4D 1SYSA 4PLJC 3GMOB 4D9RE 1JIBA 1QSFD 5CS7A 1YN7A 2BNQE 2NY7H 1E6OH 5DMYA 2D7MA 4YPGB 4J3XA 1QUNA 4ZOCA 5D96C 2WIIA 1FGNL 1S3KH 2H9GA 2J8UF 4JFFB 4U33A 3NABH 1KCUL 1JJUA 5LWYL 1KBGL 3BPOB 4G43A 3KJ4B 4JDVA 2YA0A 1RK0A 3T09A 1UCBH 3EYOA 5MEQB 4NSKB 4PJ7F 3HMXL 12E8H 5K9OB 1A4KA 3Q1SL 2C9AA 5MP6H 1F00I 3U4BH 3QQ4B 3MV8D 5F96L 2AJSH 2VLKD 5I73C 4HKXA 3RQ3A 1OT2A 2GTZB 2BNRD 3HPJB 5CWSA 1MIEH 4P2QD 4K3EL 2PR4H 3CDYA 1CGUA 1KXTB 1ZAGA 4M6OL 5C07D 3IDMB 3TYGH 5FECB 2WWMD 1FO0L 1A3RL 5CBEB 2PW1B 5HGBB 2EDYA 2R23B 1L6ZA 4LIQH 4M9PA 4XP4L 1KIPA 4JM4H 4GG8A 4MDJA 2J2ZA 5DSCA 1KJ2H 2NXZC 4P4RA 4KK5C 2VQ1B 3G08B 4OLZL 4O5LH 2ATPB 3HG1B 2WZPD 2EXWD 4N0UE 1F90L 4EZMA 1YJDC 3QEGL 3MXVH 1PG7H 2ED7A 1F6LL 5B38A 4HUNB 4F9PA 1JUFB 3SGDH 5I15H 5DHXB 1JWUA 4ISVB 4G6AC 4PJHA 4PJDA 1FAIL 1F8TL 4ZSOB 3ARPA 1XR9B 2HFFA 3QRGH 4KVNH 1CFQB 2FHCA 1MAJA 4OFYD 1WISA 5GS3A 3X3FH 1MAKA 4MNQA 2I9LB 2PXYC 2R0KH 3CVHH 1EAJA 3HMXA 5GRVK 4KQ4L 4LP4A 4PJ8D 4LPCA 3O45A 1EDQA 2P5EA 3QXDB 4U1HB 2CR3A 1Q9KA 3KHQA 4GKZA 2JCCE 3R8BB 4GQ9H 5A43C 4HMCA 1JWSB 1UJ3B 1R3JB 1OLLA 5E8EB 3VFVA 4UUJA 2K7QA 4P23D 5KSVA 1YECL 1RUQL 2Z31D 1FO0A 3GHBH 3O6FD 4PJFA 5KSUA 2AJZB 1BP3B 2QLVB 2X1PA 4YXKH 1JGVL 5J1SC 4Y4HD 4MSWB 4NZRH 2VLMD 1VGEH 4QXUL 2R2HA 5TDPA 1EFXD 5I1KL 5INCA 2CH8A 2BMKA 3C8KB 3C8DA 3HE6B 4L8SA 3G6JB 3JTSB 5FDWB 2JJWA 2W0FB 2E9JA 4YDJA 1RMFH 4UT6H 4JFPB 2R4RL 2X4RB 1EO5A 4JQXC 3TA3C 2PYED 2W9DH 1XGPB 1VEOA 2YD4A 2Z35A 4XVTH 4P3WA 2OXHA 2RIKA 4WUUD 1N4XL 1GCFA 4F58H 2ZOLA 5HVFB 5GS0H 4N90E 4JKPH 4H5SB 4ERSH 1YQVH 2BSRB 1RZIA 5BZDA 2ZNWA 3T4AA 2VXSH 5D8JH 3L9RB 5I66B 3SDCC 1E4WL 2FH6A 1JZ3A 4MQSB 5B4MC 5ESQA 1CXHA 5FF6B 1N64L 4OGZA 3FB7A 4KHTH 3W11D 4EI5D 3LDBB 5LAXA 1RUPH 2DQUH 4DQOH 4LDLB 3UAJD 1QZ1A 3IRPX 3T0DA 1DBML 4LNRB 1ZT7B 3WFEL 4NHCL 2XN9B 1V3LA 1AR1D 3QBTB 3RWIB 3RL1B 5FCSH 4X6DB 1S9WB 3QEQA 3RWCA 1E4XI 2QADD 4ODXA 1H0DB 2A77L 4QYOA 3MRBB 1FFOA 3MACH 4L1DA 4X5XA 3SOBH 1YNTB 1DL7L 5ESVA 3OB0K 1FORL 3F58L 2FX9H 3VWJC 2MHAA 3IDIB 2CXKA 1C5BL 4TTDD 3V5HA 2E8YA 2BJMH 3BZDA 4JY5L 3VFSA 1K8DA 3QPQD 4N9GA 2D9CA 4D0CA 1BJMA 1P4LB 2C7UA 4QRRB 2Q8AH 3H9HB 1U8HB 2F5BH 5A16B 1I9EA 4YHZL 3BVNA 2RGSA 1KOAA 2OQJA 2XQBL 1SEQH 4JKMA 4WWKB 4FTVE 5GS0C 1K5NA 1NUFA 1IQWH 1I8IA 3BIKA 2C3WA 1BLNB 2DAVA 3FZUD 4XPAL 1NMBH 3MQIA 5B8CA 3B9KB 3GGWB 3HB3D 1QLFA 3WS6C 1M7XA 1U8KB 3MSPA 3RWDA 3PL6A 4LLVA 3ARGC 4OF6A 5GIRB 3S88H 1CFTA 3RZCC 1ORQB 4RMVA 3ALXA 3SDAC 3WFDH 4DTGH 1LQSR 1IL1B 1VENA 5IK3A 3Q6FB 4Y2DB 1BM3H 2P24B 3C09B 3LSOB 1VFUA 3MNWA 3ROOB 3OB8A 4HQQH 4UQ3A 4QRTA 1I1AD 2P8MA 1T2JA 3GJFK 5DS8A 3NCYS 4NRYA 3G6JF 4D3CL 5DJ0A 3KPNB 3T8XB 4GXUN 2DWEB 3QUYA 1XF3B 3QDGA 4NC1E 1FGVH 1O7SA 1IGIL 4JDTH 4WI8A 5IG7B 5MI0B 4LSSL 4ODTH 1I7UA 3QQ9C 1OAKL 4WV1B 3OX8A 3VFOB 3C5JB 4Z7WE 5FA3A 1N7ML 4LRNL 5D7JB 4RNRB 4A6YB 2Z92A 1XGTB 4TSBL 1T21B 1QSED 3PWUB 5CZXD 3V7AG 1P6AB 3IGAB 3C08L 5AUMB 5HHOD 3VFMB 1QBMH 3UMTA 1CR9H 2HVKB 3P30H 5CD3B 1ES0B 1CBVH 4JY6B 3AXLA 5EULV 4F33B 3MUY1 1I3RB 2VXUH 2CIKA 2VZ1A 4LARL 1HQRA 4J3OC 4NKQB 4KY1H 2CO7B 4XNUH 2VDNL 4X6DF 1B2WH 5T1KA 5EOQL 3U48A 1XH3A 1MHHB 4M7JH 1LK3L 2Y36H 4XHJD 5J06A 5JXED 2Q8BL 3MLRH 5B39B 2VLJB 4JPKL 5ID0B 5LCVL 3FQRA 3AMLA 4S11A 4M00A 5IESH 1ZLSL 3M17A 3LS5H 4OIIL 3GMMB 5JR1L 1MPAL 4XPFL 3RX7A 3OF6A 1FL6B 4B53A 4ZFOB 4BK4A 2IPKA 3RDTB 4XMKL 3RWEA 2XZCL 1EJOH 1F4XL 1U8NB 3A6BL 3WJLC 3WXVH 3CZJA 4APQD 3G5ZA 2B7DT 1QFHA 2VDOL 3KNBB 2VISB 3LRGA 1EX0A 2YUXA 3LKNB 4Y8DC 5KSBA 1RAMA 3C6SA 1KFAH 5DQJA 1AGEB 1KCSL 5K9JL 4HWZA 3K8MA 1NJ9B 4KPHH 1MRDL 2OXGA