4NO0D

Crystal structure of non-phosphorylated form of rqa_v phosphopeptide bound to hla-a2 in complex with lilrb1
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
195
structure length
192
Chain Sequence
PKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, A-2 alpha chain
publication title The antigenic identity of human class I MHC phosphopeptides is critically dependent upon phosphorylation status.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/antigen
total genus 32
structure length 192
sequence length 195
ec nomenclature
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13895 Ig_2 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4no0D01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4no0D02
4WNQA 1MJUH 4HXAL 4YFEA 3SCMA 2HLFC 4NC1C 2ZUQB 3MJGX 3PP4L 4YNYA 5GRYA 1F6AB 3GJFA 1R3KA 3VFWB 4DK6A 4DGIH 4KK6C 5HGHA 5MENB 5C6PB 4P2CG 4IDJH 5IW1B 1F11B 3L3KA 4R2GB 1XF3A 2WSKA 4Q2ZB 1PZUB 4M6OH 5I71B 4K3JL 4TN9A 3NCYP 3QHFL 4HG4K 1J0YA 3VWJB 3WXWH 4Q0XH 3WNOA 1MF2H 2ZPKL 5C3TA 2B0SH 5L88H 5DFVC 3MREA 3SDYL 3NFNB 4WFFD 4LLAA 2YK1H 1YMHB 1GAFL 3OZ9L 2XFXB 4FQCL 1ZTXL 4I4WA 2VLRD 2VXVH 1RIUL 2Z0BA 5H94A 1TMCB 1JFQL 1OT1A 3L7FA 4CU8A 5LGKA 3CSPA 3CGTA 1DVFC 4I2XB 2UZIH 1AGDB 5BO1H 2R0WL 3UTSE 1KIRA 3WKNA 4QRPB 2QSVA 4LLDB 3WXVH 1A3LL 1Z9MA 1QYGL 1S7TB 4XWOD 5HYSB 4EVNB 5KSUB 5KOMC 1OARL 3EYQC 3RHWK 3V52H 1BBJB 4LMQI 2CGRH 3HAEH 2XZAL 4JZJB 5JXEC 1F3DH 2P7TA 2DWDA 4PRNA 3DARA 4K2UH 3U7WH 1F4WH 3ZDZE 5GGSY 2PNDA 2LAGB 4ORGA 4WV1B 3PIQB 1JNJA 2Z8SA 1I9JL 5EPMA 4LPVA 4K8RH 1EHAA 2VLRA 4PIRF 1BFVL 5D7SH 3CX5K 4OKVB 1JE6A 4DQOL 3X3FL 3MJ6A 2DQGH 2EIBA 4MA8L 1LO5B 1RJLB 4W4NA 3K4DA 1DSFH 2Y4SA 4PBWD 2P8MA 4P23B 1L9MA 1P84J 4WY7L 4ZDHA 3F62A 3I3BA 2DQCL 4UUJB 3RY6C 4L9DA 1AE6L 3BPOC 5DUMH 2H32B 4Z6AT 4I0KA 5F1NB 3S36L 1JHKH 1YZZA 4ZO8A 2XN9D 3MGTB 3V6ZA 2UWEE 4XPAL 3ILQC 2IJ0C 1NANI 4QHKI 2QQLH 4M48H 3CMOL 4LPXA 4TVPD 1FAKT 4IM8A 4HG4J 1MJ7H 4KQ3H 3PXHA 4TNVF 3UJJL 3VXNB 5EO9A 2DOCA 2VLMD 3SCMC 1KCVH 1KENH 3NA9H 4Y16D 3T0EB 5HHXH 5FYLL 2XPGA 4NGHH 3BVNB 4UV7H 2CMRL 3ARPA 5GGRB 1JV5A 2P1YA 3KS0J 2NR6C 1FNSL 3GSUB 2CIKA 3MCG1 3PWNB 4XH2B 1C5CH 3VD4A 2PETA 4ZAKB 1NCBH 1Z5LB 5I1IH 5FHBL 4FNLL 2HT2C 5CJOH 1VB9A 1XGRB 2FB4H 1WBYA 2IAMD 1CFQA 3WNMA 3WFHA 3AXLB 2OR9L 1CXKA 1XEDA 4XNQB 5IBLD 1IGTA 2JJSA 1J11A 5GRZA 3MGOA 4E42B 4ONOA 3IFNL 3FO0L 1VEMA 1DLFL 3TH3T 3SOBL 3ZDZF 4PJXB 3IVKB 2XN9A 1KN4H 2C3XA 2AXGB 3ZL4L 2EYRB 3QH3B 3MFGB 2Q8BH 1HINL 5GXBB 4PJIE 2GCYB 5JMOC 1EAPA 3HR5B 3PWUA 1NMCB 3HCVA 2FEDD 4HQQL 1U58A 4Y16A 2EO9A 1CE1H 1WJ3A 5BJTB 3SKMB 4OT1L 5E1AB 1A6VH 3LD8C 1VFBA 2PYEB 3V4PH 5JLZA 3L3HB 4D9LL 5IB5A 2C4FU 4NN7C 1HH6B 2A77L 3C5SB 1PG7W 3CX5J 1RZJL 1FG9C 3L1OH 2QADD 1YA5A 3KGRA 5I73B 3MMEA 3MRGB 4PLKD 3BKCH 5C0EB 1IRAY 2R23A 1OAQL 3UYRH 5DHVA 1K2DB 1QEWB 1A7PL 3LS4L 2XQBL 2A6KB 2DQJH 5D4QA 3O3AA 1FPTH 5KVEH 5M95B 1FO0B 2UWEF 1CQYA 3OKOB 3QEQB 5DXWA 1UB6A 3RU8H 4ELKA 5HDOA 2YD3A 4IS6B 3NCJL 3V8CA 3D85D 4PJ9D 1PFCA 4PD4J 3QUMA 4WFEE 3BKMH 1CVSC 4XWOC 1H5BB 4GRLB 5I8OH 3FRUB 5MHSE 5FB8B 2LE9A 2GAZA 3BZ4A 5GS2D 3T2OA 2IF7A 1MCKA 2AV1A 3MROB 3T3PE 4WU7B 4NQCB 3PHOA 2E9IA 1G7IA 1KTLA 1S7XA 3NCMA 5F6IB 1P2CB 3U7AA 4CVXA 2ADFL 3N50A 5EUKB 1A1OB 5TE6L 1GL4B 3MYJA 1J5OL 1HNFA 4U2YA 1D5BA 1LO2H 4K55A 3C08H 1BIIB 4YDKL 1FNEA 1FE8H 4H8WC 1JN6A 2GITA 1C5BH 3REVB 3OAUL 4HV8B 3TT1H 1W0WB 3T4YB 1MFEL 1BQUA 3M1BA 4UU9B 4PJIF 1ROWA 1WGOA 1YEKL 4F7EB 2XWJA 2X44D 4F80A 1XCQB 3CFBA 3RBGA 1MJ8H 1VENA 5D1QD 3W0WB 1JK8B 1TZGH 5EBMB 3BQUD 4LIQL 5CZVH 1MLCB 4X4XA 2HKHL 3ARED 1O5DT 1VEOA 2JJSC 3MNWA 2GK0A 4JFHD 5FAAA 3G6JE 3MJ7B 4WI9A 5CSZA 1FGNH 5A2JH 4E9LA 3HLAA 3N9GL 3VD7A 5JIIA 1MFNA 4YBHA 2AAVA 1DUYB 1QRNB 1UEMA 1I7TB 5GISL 3JV6B 5J0BA 2WNGA 3K1DA 2OR8A 2APXA 5SX4I 4UT7L 3KPSB 2HLAA 4EI6A 1CCZA 4FFZH 2NNAB 1XGPB 3HUJA 4JDVA 5C7XH 2BSSA 3W11C 4WGWB 4P48A 1DQMH 4ODSH 1R3IH 4DKFL 2Z35A 5EC2A 5F89A 1BVLA 3AC0A 4FFVD 3C09B 5D1QA 2QL1A 4ZUUB 3SQOH 5BV7B 3BQUA 5IM7B 4GOSA 4JQXA 5DJ2A 4JPKL 4ZD3H 4J7RA 3QXTA 4H25B 3AREA 4XCEB 1KPRB 1TETL 2A6DA 4PV8B 5IBLC 5IKCB 1R3HA 4G7YH 5DEGA 3LB6C 5GGVL 3V4VL 2FD6L 4HZLA 1S7VA 4WIQA 4I3SH 4XI5C 1JF1A 4KTDH 3MTRA 3C8KB 2BMKA 4WHYH 3H0TA 2IADB 1WTGT 4P49A 5A2KH 4YQXL 3HRPA 1S7SA 2DQEL 1F6FB 5FK9A 1PSKH 5C0AE 1UH4A 3SE9L 3CVHL 3I6LE 4J3WA 5T3XE 3FT3B 4MA7L 4PLKC 4OCWL 3S37L 2VH5H 3IF1A 2CJUL 3L3JA 3WFEH 5TFSH 1EJ6A 2X4RB 4PJFE 1H3UA 4Z7UB 3C2AH 3G6JF 1PGRB 3ULUD 1HKLH 1YDPA 1DQQA 4Z7VE 3MV9B 3ARVA 5ENWB 4XMPL 1TZHB 1TZIA 1T0NA 1FCCA 1RHHB 1TQBB 2VLKB 4OUUA 3GSQA 1MHPH 3B43A 4MA1C 4MXQD 4WFHE 5DJAA 3ESVF 3WNPA 4JPVL 4HWUA 5F97E 5KSAD 1NEZG 4XP4L 3CLFH 4NRXA 1R5VA 2VDKL 3QCTH 5I1JH 3SE8H 2WUCH 3I9GH 3DHMA 3QEGH 1UB5B 3V0VA 5I1DB 5ALBH 1YEHH 4HIJB 3BEVA 5B3JF 1CXIA 3HG1B 1YEIH 4X5XA 2HJKB 4WFGE 4JDZB 4LNRB 2BNRD 2A9NL 4NZUL 1HEZA 4M6ML 3G9AB 1DEEA 5MEOB 4XMKH 3RP1A 2NY7H 5DUBA 3EDFA 4JG0L 2VQUA 4DKDC 5JO5A 2H41A 2W1NA 5DYOA 5I17A 5C6TL 5KSAA 1ZVSB 4AMKH 2OJZL 2D3VA 5A2FA 5ICXA 1QR4A 1VCAA 4V1DD 5D1QC 4G6FB 5FKAB 2QSTA 3BQUC 4W6YB 3TBWB 1IGMH 2M26A 4JQXC 4YHZH 4U0RB 5C0FA 3W5MA 1NC4D 3F7VA 2AJXL 3AREC 2CLRB 1C1EL 3A6OA 4L3EB 1JUFB 1U6AL 2FIKA 5D2NB 5F21B 3KR3H 4QHMB 4J3VA 1IM3B 1BOYA 5C0ND 4MB4A 4NO5A 4PJFF 2BNRA 2AQ2A 4HKBB 1U8HA 4Z7VF 4R26H 3TFKD 4PJGA 3OAZK 1W72B 4RAHA 4HKXB 3QQ4B 2WAHA 2AV7B 3CDCA 1I1AD 2F5BL 2W0PA 4HMCA 1JNNH 3FO9B 3QUYB 4TNVK 4EN3D 4DZBB 1UVQB 5JOEA 5L2JA 4KDTC 2PTUA 1I8IB 2QJDA 4UNTA 4LL9A 4FFVC 4V1DA 5KG9B 4TTGA 3RAJH 5J8OA 3ZSSA 1FYTE 1ONQA 4U1MA 3QFJE 5KS9F 4NQXA 1NC4A 2X6MA 1KNOA 2G5BB 1QA9A 1PG7X 2AK1L 4P46B 4M1GH 4M6AA 1Y0LB 5D2LA 4M8VA 4YDJB 5L8JB 3FAWA 4KVCL 1WFOA 5EBGA 4ZS6D 5GJSL 3A67H 4EXPX 2WBKA 4JZOB 1KF9B 1QNZH 1RZ8A 5HGAA 2VXQH 5EO1B 1JI1A 3D6GA 5JA9A 3PP4H 1G9MH 4U05A 5FUCC 1I1AA 4PJ7F 4EN3A 4A6YH 3H42H 3O11B 2WWKO 4HC1L 4OGYL 2JELH 1WCBA 2ICES 2NCMA 5D7LB 4LRIA 2AJUL 2E6PA 1E27B 2AI0L 4PJBA 1IJ9A 2GJZB 5IOPA 4ODUA 4WHDA 3D18B 2DI7A 1FH5L 2WMPA 4QRSA 3I75B 4JG1H 2HAZA 4AZ8A 4P4KB 1T83A 1GAFH 4LDOB 4NKMA 1ZTXH 5IEHB 3U9UB 4GMTL 1RUQL 5FOJA 1RIUH 3ULUC 4QTHA 5D5MB 4K8RC 5FFLA 3AS0A 2R0WH 4XX1G 4H0GA 4MCZA 4KTEH 5GGQH 5IBUG 3FOLA 1QYGH 2DBLL 4NN5C 5KSAC 1EGJA 1CICA 4GXVL 1OARH 5I8EB 2P8PB 1HQ4A 1IFHL 4OF7A 2E6QA 3Q5YA 3OXRB 2Q7NA 5IMOA 5ACLA 1MFDH 4MNGB 2DLEA 2OQJB 3RRQA 2XNAA 3BN9C 3MRPB 2R1XA 4XZUB 4NO0A 1P7HL 3MRQB 3LKSA 3ULUL 3MOBL 1JGDB 1ED3B 3LKNB 1I9JH 3HTLX 1J1XL 4XAWL 2L7UA 4QXTB 1BFVH 3OTTA 4P3WA 5FYJD 4DFIA 2D4DA 1LDSA 1N0XL 2EE6A 3JTTA 4OD1H 1U3HD 1XZ0A 3X3FH 4DWHA 4ZPVB 4MSWB 1IVLA 4ZODA 5DSCA 4DN4L 3HR6A 3B9DA 1BF2A 3MJ9L 2I9LA 4F57H 3T77B 1IL1B 2AQ1A 5HI3D 4OGXL 5DHYB 1F4XL 4HS8L 4B53A 4C56B 4X98B 1EFXD 2Q7YA 3KYMB 2A2QT 1N4XL 4WI8A 3UBXA 4YK4B 4P59L 2WINB 1AE6H 1OGAB 3QZWB 4NIKB 3S36H 1ZHLB 3AS3A 1QLFB 1MQKL 4ZFZB 3WHXA 4X0KA 2PYFA 4PS4H 1ES0B 1E6OH 5C0NC 5EU7C 5I76B 1WCQA 4D0DA 5E2TL 2ED8A 1A47A 3MRIB 4NDMA 4FN0A 1OSZA 2EO1A 3UJJH 3UMTA 3TFKC 4G6KH 2NPLX 5DJ8A 1OP3K 1U3HA 1AJ7L 4JFZH 4NZDA 4GT7A 1NH6A 3EOYG 5E94A 2BRRL 5SWZD 2R0KH 1I1AC 3BP4A 2CMRH 4EN3C 4FQQB 4G8GE 2WP3O 4FQJL 4IJ3B 3GSNH 1J8HE 3UO1L 4UB0H 1X7QA 1IGJA 4IIQB 1MHEB 5M7QA 5AZEH 3TO4B 1EFXA 4LRIC 3DXAE 4GG6E 3U4EA 4PJEE 1J86A 1NEZA 4FFWD 1WUNT 3NCBB 2UY6A 2UYLA 1RHFA 4JCMA 5D70L 2J8UE 3IFNH 4JRYE 3FO0H 1LGVA 1DLFH 4XPBH 1T83C 1PLGH 3STLB 5B38G 4KROD 3MXVL 3FONB 4P2QE 4ZS6C 4LVHC 1WZ1L 4FHBD 4GUPB 5F7DB 1TVHA 5J3HD 2CDFB 1X4XA 4OKDA 5F88B 4POUB 3UTTB 2H1PL 3D2UB 4HQQH 3MBXL 5SWZA 4B41A 1SJVA 3EO0B 4P9ML 3S35X 1IILE 4OT1H 1A14H 1CICC 4UIKH 3KNBB 1OM3H 4NNXA 3C6LD 2ARJB 4U1LB 4PGDB 4C59B 1AP2B 3QFJB 1NBVL 3OJDB 2YEZB 4FQLL 1MHCA 3O3DA 1G7LB 4BH7B 3R8QA 5I8KH 3QQNA 1DBML 3NFSL 5IHUL 1A7PH 4WHTB 4IRSB 3DX7A 1UH2A 1A02N 2P8LB 1J8KA 4OV5B 1FBIL 2BNQA 4MS8D 3OR6B 3UJTL 3K1KC 1CR9L 4DTGL 1DCLA 1U8MA 1ZHNA 4HIEB 3MRFB 3NOIA 2SEBB 2YA1A 1ORSA 3NCJH 3VMPA 5HJ3A 4JRXB 2X4PA 3T1FB 5BZWA 1U3YA 3GB7A 1P7QD 3VXME 5D8JL 1QFWL 1HSBB 5JPNB 3QRFM 5DVLA 1R24A 3C6LA 1KB5L 3MUGB 5GJTH 1WFUA 3WIIH 2VZUA 3D39D 4KDVA 4PRDA 4Z7OF 3ILPB 4D0BB 4PJEF 1ZS8A 4XNYL 5C0RH 1RUAH 5TE6H 3IAQA 4R7DA 2DIAA 1D5MA 5IK3A 1J5OH 2J8UF 4JREB 5SWSE 2I07B 4YDKH 3KYAA 3P30L 1FSKC 1UJ3B 3GSOA 4HBCL 3H9SD 4NKOA 1TPXB 1MFEH 1U3HC 1TIUA 3RZWA 4RQQA 1WIPA 4UNUA 4OZ4B 1DP0A 2CKBH 5JNYB 2X05A 3VXRE 1P7QA 1DDHA 4MQ7B 1U41A 4ZO9A 5HI3C 3OSKA 3VFPB 4DCQA 4LIQH 3V5HB 5A3ID 1DBKH 3W9DA 5EOTB 2HKHH 3IJHB 1YMME 3K2MC 2FHBA 3WSQL 3F58L 3T2NL 3UTZA 4GW4A 5HHOD 3KHQA 1UQSA 2CDGA 2BHZA 3N9GH 4O2FA 4P2OB 4HJGA 5I16B 2G60L 4P2RB 4O5LH 5GISH 3FZUD 3L5JA 4X9IA 3X12B 1JZ2A 3H9SA 4UT7H 3I50L 4R7NA 3MNVB 5CEZD 3RGVB 1Y18B 1FFOB 3ZYZA 5JQHC 5L2KD 3NPSB 2D7MA 3V0WL 4XCNB 4S1SL 2JB5L 2APFA 4DKFH 2J4WH 4D3CL 1V3JA 1F6LL 4RGNE 5F9AC 4MGXA 2VSCA 1BM3H 5BMFL 5DJZB 4LPYA 4RAVB 2VE6A 4ELME 3FQTB 3P9LA 3DUSB 4JPKH 4FFWC 5HYQA 3V6FA 3EO9L 4NC1E 3GUTA 4TUJB 3LRSB 3V8OA 1JYXA 3F6IA 4QXGH 5HHOA 1SM3H 5T1LB 1FFPA 4KROC 4WTZA 3FB7A 1YPZF 2V5RA 2BVPA 3EYVA 3SKJH 4J1UA 3DRTB 2RIKA 2YOCA 3DSNA 3LV3B 1HQRB 4HFWA 5J3HC 3QG7L 1MEXH 1CFTA 3RNKA 4E0RB 1ZA3B 5E7FA 2OMBA 4A6YA 5L2KA 4AM0B 3PQYD 2ERJB 3SE9H 3CVHH 3GHBH 1EO5A 3DXAB 4JKPL 4GG6B 1BZ9A 4R9HA 5CBEA 4ZFGL 2YRPA 3HRZB 4MA7H 4JFXA 5JQ6L 3RNQA 1U3ZA 4OCWH 2IFGA 4P5KA 1F4YL 4ETYA 5E6IB 2CJUH 2EH7H 4Y2DD 4Z8FL 3BP5B 1INQA 5JOPD 1XGUA 4G7VH 4GRWB 4P2QB 2CPCA 3IXAA 1T2JA 1KN2H 1DN0B 4XMPH 1XIWB 4MS8C 1A4JB 1OB1A 4P5MB 4DKAA 2XZCL 1SY6H 1NMBH 1WAAF 4UT9L 3DX8B 1AGCB 1WC7B 2ZSWA 3HMXA 4KRLB 1VEPA 1T4KA 2AK4E 3IU3B 1T04B 5IG7A 5A43C 3LPFA 1C16A 3QP3A 1NUFA 4LDLB 1XF2A 4ZXBD 1Q9OB 1XCTA 1M7IA 2VDKH 1RPQA 3PQYA 1JPFB 3C8DA 2ZKHH 4F58L 1S7UA 4MCYB 4L1DA 2ITCA 4O00A 3ULVL 4HDIA 1EHXA 3FB5B 4LCWB 4XVJL 1ZHKB 3O0RH 4JKWA 4ODXB 1XMWA 3LIZL 4Y2DA 4I1NB 1YECH 6FABH 5AG9A 3IFPB 3BMVA 4NZUH 5F9OL 5ISZE 2CXKA 1IEBB 1EZVX 5C0DB 1N5YL 4LF3B 2VDNL 4G80B 4NHUB 1EZVY 4OM1H 1AGFA 5HVGB 1KLGA 4TUOA 1GZPA 5EZLB 5B38A 1AGEA 4R8WL 2YD8A 4JFED 4LEOB 4JFOA 2K3TA 5HGBB 4JFQB 2FGWL 3MA9H 1OY3B 2X4TB 3OKLA 2OMNA 3VXMB 2B2XL 1YNTB 3HC3L 1T03L 1JWSA 3QT2A 3ZHKA 3D25A 4YPJA 1MY7A 4L8CA 2RQ8A 5IB2A 3AMKA 4RGMB 2GJ6E 2VISB 5JORB 3DHJA 5A3IC 1A6WL 3T2QA 3U2SB 4Y5YB 4EI5B 3VRIA 4N0RA 5MEQA 4GKSA 5MEPB 1QLRA 1C1EH 2HFEA 1AR1D 3EJYD 5F8RC 4R90L 3RWEB 2DWEA 3G6AB 2K7QA 5JPMB 1E4JA 1HH9B 2R8SH 3VFVB 1GIGL 2EIDA 2DD8L 4X99A 3UTQB 1TLKA 2D9QB 4S1QL 5LG1A 4F7PA 3PDGA 3K46A 4MNQD 2VITA 4J3TA 2YWYA 4K23L 1Z0MA 1LEIA 4DAGL 4JFEA 4PRAA 2IH3B 3VXQA 4JHBA 1G9MC 1Q9LA 3K4ZA 3VXRB 3GSNA 3D3VE 1RZ7L 2IBZX 5C3LD 1OHQA 3CPLB 4GRMB 2BFVL 2IBZY 4H0HB 5CWSA 2F53D 4AY0A 2ZWLT 2JK5A 3P11L 1FZMA 3RDTB 4KKAD 4ZSOA 2A0LD 5AYQA 1RIHL 2AK1H 3DTXA 4ACPA 4K94H 3G04A 5F7LB 5DLMH 5CIPB 4PRBA 2IFFL 4KVCH 4PJDB 1JPSH 5GJSH 1NBZB 1RUKH 1T1ZB 4WHCA 2H9GB 2GIYA 2WANA 4Y8DC 4PGJA 2CRYA 5T33L 4MNQA 4HGKC 4D0CA 4D9QD 2OL3A 2W9DL 5KAQG 4R3SA 2C4FT 5GIRB 1RAMA 2J6EL 2ATPA 2PO6B 4HC1H 4OGYH 4RGNB 5HI5D 5FHAL 3GGWB 4JHWL 1MAKA 5LGJB 4XBGB 4ELMB 5JHDA 2F53A 2CRZA 2NTFB 2GTWB 1MQ8A 1E6JL 1KJ2B 1NFDF 1X5GA 2AI0H 2AJ3B 1JNLL 4U1JA 4XNMB 2F19L 1FH5H 1LNUA 4Y2DC 4CW1A 3LN4B 5JIHA 5BQ7B 3CMGA 4OLEA 4PG9A 4GMTH 4GKNA 1RUQH 3FFDB 1Z2KA 1FL3A 5TDNA 3TF7C 1FDLL 4N9OB 5DJ0A 3QPQD 2Y36H 4QXWA 3IETA 1ITCA 1PQZA 2DBLH 2AGJH 5EU6E 2BSTA 5J6HB 4K9EC 4NKDA 3BUTA 3PHQA 5AAWA 4GXVH 1IFHH 1FZOB 4HJ0C 4XCFL 3FOMB 1FHGA 4LVNC 1RZIA 1DVFB 3V9FA 3QISA 4QGYA 4GSDL 3QWOB 4DUXA 1ORQA 5BZDA 2NW2A 1H3XA 1QD0A 3OG4B 1OTSD 4MZ3A 1M7DB 1Z9SA 1A4KA 4FG6D 1TJGL 5C0BD 3SEPA 4ZNCD 2ZCKH 3MOBH 1NLBL 1YQ2A 2EYSB 5IW6A 3CNKA 3FB8A 4AEHL 5C9KA 2NQCA 1T66D 4UT6L 1H0DA 4XT1C 1S9VA 1EPFA 1N5AB 4L8BA 2ZUUA 2X7LA 4EJ1C 4GO6B 1AH1A 4PJ5B 3MJ9H 3PGDB 3AU1A 3IDMA 2CKBA 3P4NA 2VAAB 2A83A 1F8TL 4OGXH 5JW4M 1F4XH 5LAXA 1XGTB 1KC5L 3IKKA 3QJHB 5ETUB 4E41D 4TVPE 4X6FA 4EDWL 4P59H 1OPGL 5JW5A 1HSAB 1BPVA 1ZA6A 2DI9A 5CILH 3GIZH 2B4CL 4WUUB 1I7ZB 3EOAB 3R1GL 1BOGB 5CBAB 5T3ZD 1X4ZA 1AR1C 3EJYC 3H9HB 5C0BA 4LSPL 1CXHA 2C7UA 4KJPD 5E2TH 2N4IA 4YHNA 4QHKJ 3RWDA 5KJRH 1X44A 1E28B 3BPOB 4X6EA 4ALAL 5CCKL 1Q9KB 4YHIA 1Q1JL 2V2WA 2Q6WB 4PGEB 4O51A 5H37H 4JFFD 1ETZB 4FQJH 2VDLL 3U0PA 3UO1H 2RFXA 3MRKB 2X5PA 4XRCB 3KPPB 3BPLC 4EOWL 5J12C 2OYPA 2XQYK 2ADJA 4WEUD 4WNQB 4E41A 1JVKA 3SCMB 1QPXA 3ZDXF 4YNYB 3VXOA 1OAXH 3GJFB 4KKAC 1R3KB 1MCJA 2A0LC 3QNXA 3AVEA 3E6FA 1GYAA 3ULSA 3T0VA 3HB3D 3L3KB 4KQ4L 2MKWA 2R0LH 3ARDD 1XF3B 4FOMA 2R4RH 3X17A 1JL8A 2D2OA 4L4TA 4NWUL 1IGCL 1A3QA 4ODVH 4TNWF 2H1PH 2QQQA 3MBXH 4J23A 3MREB 4I3GA 1GGBL 3OG6B 2H8PA 4P9MH 2QLVB 1JWUA 2J5LC 1QSED 4I4WB 4JFFA 1A7QL 1OLZA 4CN1A 5INDA 3FTGA 5H94B 1ZT7A 3QHTC 1GC1L 4GBXD 5HI5C 3L7FB 3BKJL 5E8DL 4LAQH 2Q20A 1KIRB 4S0TD 3BX7C 5IFAL 2OK0H 4FQLH 1L0XA 5E56A 5KSBE 2VLLA 1V7NL 1NCAL 3IFOA 2HMIC 4XVSL 5IHUH 1QVOA 4CVZA 3HNTL 4P4RA 4NN7B 4LBEA 1FBIH 3STZA 3ETBF 1B4JL 5D96C 2VQ1A 3KLSA 1KJ3L 1CR9H 4DTGH 4U1IA 1MI5D 2P7TB 3L9RA 1SY6A 2DWDB 3QPQC 4H5SA 1NBYA 4GAFB 1FIGL 4PRNB 4Q58C 3SGDH 2FHFA 3WFBL 1MUJA 3ARBD 2HP4A 4ORGB 3M8OH 1QFUH 2VERN 5EPMB 1QSEA 2D0GA 2ZNWA 5D8JH 4U7SA 2VLRB 4HMEA 1HZHL 1KB5H 4GBXA 3CDFA 2P5WE 1I7RA 4TSAL 3U0TA 2BSRA 1EEQA 3I02A 3MZTA 3RWFA 4XNYH 1OTSC 4FG6C 3ARTA 2P8MB 4OD3L 3BPNC 1H3PH 4ZDHB 3Q6GL 3P30H 1T1XA 2YKLH 1B0WA 2EKJA 3VGDA 3P73A 3SE3A 2CLZA 4G9FD 4IOFD 2V7HA 5KVDL 1NGWA 3VD9A 5IVXA 2BK8A 4JLRA 3ARBA 4UNVA 4JR9H 4ZNEE 3V6ZB 3DRQA 2YRZA 1QBML 4X83A 2BVOA 4WWKD 1ZSDB 2R69L 3QB7C 1A3RH 5K9KA 3BDXA 3WSQH 2XPGB 4FA8A 3T2NH 1JV5B 3UPAA 2QR0A 3LQAC 2BP3A 2CIKB 5KSBF 5I0ZA 1A6UL 4NM8L 5GS1A 4KJPC 4Y5VA 2EDWA 4EKXA 5DC9B 5IESL 3CH8A 3VDAA 5IB4A 1T3FA 1WBYB 3FQRA 1FG2A 1HHGA 3WFHB 2DBJA 4LSUL 4QEGA 1K3ZA 4G9FA 2Y23A 1IGTB 3MGOB 4MJ6A 3H3KA 1OAYL 2XKSA 3TA3D 2XN9B 5CJ5A 3WL9A 3MLXH 4GLRI 4D3CH 4I48A 1MRCH 5D1ZD 5FUZL 5BMFH 1EAPB 1PW3A 3EZ8A 5FF6A 3N1QC 1JHLL 3PWUB 1T20A 1CD9B 3EO9H 4OLVL 2DF3A 1U8OA 1X9QA 3ROLA 4KUCD 1VFBB 2DJ4A 5JLZB 3GSVA 3HB3C 1P1ZA 4YXKL 1SHMA 3MMEB 1N6QH 4OTXH 4LLQA 2R23B 4PLNC 4WENB 5DRNB 4HFUL 5HI4C 3MXWL 5DHVB 2VDQL 1S7WA 1DL7L 4OBSA 3TWCH 2R2HA 5D71L 5C0GA 3QNZA 3K4AA 3KLDA 3O3AB 4MHHI 1T7YA 5HHNA 1CZ8L 3D1MC 4GBXC 1KCRL 1SJHA 4U1HA 4OGZA 4TVSa 3F7PC 2LVEA 1K5NA 5D1ZA 4CADA 4JPWH 3WO3B 4ELKB 3NH7L 4N0CD 1UA6L 4JN1L 1F4YH 4NKIH 1TNNA 3GI8L 3QUMB 4OLWH 4JM4L 5F1OB 5DEFA 5ERWB 2Q3ZA 4U7KA 1MAMH 2GAZB 3BZ4B 3TIEA 1CWVA 3DO3A 2AV1B 3VWJD 3V4UL 3PHOB 3SE3C 1G7IB 1S7XB 2XZCH 3VXUE 5HD8D 4CVXB 2ESVA 2FDBP 1W0VA 2E7MA 4OZGA 3VW3L 1A21A 3ARBC 3DUUA 4HK3J 2DTMH 1D5BB 3DURA 1XH3A 1FNEB 3CCHA 1FVDA 4EZMA 3KPMB 1MVUA 1JN6B 2GITB 3O6ML 2X4OA 3ULVH 3M1BB 4MA1B 3Q5TA 4XVJH 3HI1A 2QHLA 1OD9A 3O3BA 5JW4Q 1JCKA 1WIOA 2XWJB 1LP9F 1F11A 5IW1A 5GS1C 4YHKL 1CQKA 5F9OH 3F5WA 3WUWG 4Y5VC 3SJVD 1N5YH 1S9YA 2EDBA 4P9HC 4X4XB 3TV3L 4NN6C 5FM4A 2MCPH 1T0MA 1JHTA 4FQ1H 3MNWB 4HKZA 2GK0B 2E7BA 2FJGA 4OB5L 5CSZB 1PEZA 2I5YH 3HLAB 5D2LE 1BJ1J 2B2XH 3HC3H 4BZ2L 4XP6H 2DAVA 3ARQA 3SKNA 2VO5A 5EU7E 4HWBH 1JF5A 5AYUL 1G7PA 4TUKH 3LZFH 2HLAB 5HDLA 4B5EA 3FQWA 4EI6B 2VZ3A 3HUJB 4JDVB 5KOVC 3DECA 4HLZH 4QRRE 2BSSB 4K94C 3GI9L 4XC1L 2AEQL 4WI3A 2Z35B 5EC2B 1WV7T 1BVLB 5F89B 1CGSH 5D1QB 4M6NL 5FUOL 4N0UE 3SJVA 3BQUB 4S1QH 4YHOL 4UZGA 5DJ2B 2VYRE 4XTRD 3RWJA 5C08E 4U1NA 4PRID 2X9WA 3AREB 3V7AE 4G42A 4K23H 2A6DB 3HE7D 1R3HB 4FS0A 1OP3H 5DEGB 3BI9X 2RCSL 5ICZA 2X1WL 1KPUA 1XGQB 3OKMA 1OAKH 4HZLB 4XP1H 5FA3B 5HHVL 1S7VB 2DICA 4R96A 2HRPH 1JF1B 2BFVH 4X5WA 5D1ZC 1HYSD 2E3VA 3P11H 2BMKB 4XNZC 3LEYL 1KTDA 5MP6L 3VI4E 1TTFA 1S7SB 2E9JA 5FK9B 5DA4A 4MJ4A 4NC0B 3BH8A 4B0MM 4UV4H 5SV3A 3B5GA 4EDXA 2EDFA 1JZ6A 4NUGL 2V5MA 3UTPE 3ABZA 4PP2A 3GNML 1IAMA 3PABA 3IF1B 1KT2A 5T33H 3L3JB 3FMGH 4PRIA 5C70A 2FBOJ 3ZT5A 2RGSA 2W9DH 3HE7A 3FQXB 4TNWK 2J6EH 3MLUH 3OKEA 4FQIH 2EE9A 4AT6A 1I8MA 1YDPB 1DQQB 4PRPE 2FJFA 1JRHH 1TZIB 1T0NB 2F54D 4OUUB 1DFBL 3GSQB 5DJAB 4N0CC 2CRIA 4EXKA 2F19H 1QFOA 4NRYA 1H8SA 2HRLA 3TBSA 4NQSA 2FYYA 1G6RA 4NRXB 4OLUL 2IPTL 2MKLC 1IZKA 4LVOC 4QNPE 4AQ1B 4I77L 1I3RB 5HD8C 4ONFH 1FVCA 3BD4A 3BEVB 3CSGA 1MCIA 5E99H 1YEDA 3E6HA 4AYFA 4X5XB 5I30L 4WO4D 1O0VA 4PP1D 3D69A 4IOIA 3IFLH 2Z8VC 4XCFH 1DEEB 1GSMA 5DUBB 2HWZL 1FL6A 1IC5L 5FDWA 2F54A 2I26N 3GSRA 1MCDA 3ARSA 5CD3A 5JO5B 4YWGH 5LJYH 1SEBA 5A2IH 1EXUA 3EDJA 4NN5B 5I17B 3K2UL 5KSAB 4X6CE 3SE4C 3MR9A 3HNSL 4KXZH 4G8FA 1NLBH 5ICXB 1EMTL 1JTTA 5ESVA 2XXCB 1DQDL 5IHLB 3U4BL 5C0FB 3F7VB 2GEEA 3JBG7 1BQLH 2FIKB 1A9BA 4WO4A 4NO5B 5DRXA 3MRMA 1SBBA 1F8TH 4FMFA 3TBYA 3UTSD 4UIMA 3LHPL 4OGAC 5GS0H 1F97A 1U8HB 5DZOA 5TQ0L 2PF6A 4PJGB 4EDWH 1OPGH 4IS6A 4OF6A 4PBVC 2ENYA 2B4CH 1KCSL 3EFDL 3R1GH 4N90E 4UTAH 5SWZE 3GO1L 5KVMC 5FB8A 5A40E 1BQHA 1WVZA 4YXHL 1RJYA 5FDYA 15C8H 3DGGA 4V1DB 1OLLA 3GMMA 3PWJB 5DUPL 1SMOA 3BRGC 4NQXB 4NUJA 4XTRC 2FBJL 4QNPF 4ALAH 5JW3H 3G6DH 1NC4B 1KNOB 1QA9B 3VXTA 5CCKH 3VFGL 1A1OA 1Q1JH 3HE7C 5D2LB 5DQ9A 3RGHA 5FECA 4U49A 5KTEL 1CYGA 5E2WH 1LO0L 5HHPA 2BNQE 3HZKA 3UTSA 3MLPA 1CDBA 1RZ8B 2JLLA 3REVA 1HYSC 1KB9K 3FKUS 1LK3L 3P40A 4NP4L 2W91A 4LLWA 1TQCC 1I1AB 4EN3B 4O02L 2R2EA 4YJZL 32C2A 4L8DA 4PPTA 4NJAH 1S5HA 1QFHA 4X6CF 5GGSA 4EIZC 1WCBB 4N0UB 1FAIL 1HCVA 4Z95L 4E5XA 4XPGL 4MB3A 1G7MA 5IOPB 1VADA 4ODUB 5DMKA 1YUHA 5I1KL 3TVMC 4MD5A 1P7KA 1X5FA 3MJ7A 4QRSB 2O26U 3WUWA 3U48A 1RMFH 4DOHE 1ZK9A 4MAYD 4NKMB 3WKML 2YR3A 4QTHB 1I7TA 5DI8A 1GC1H 4PFEA 4LVHB 1NDGA 1P9MA 3BKJH 4NFBA 1NBQA 5IFAH 4MCZB 4HS3B 4JGUA 1NFIA 2AQ3A 2AEIT 2VMFA 2P24A 1HILA 2PTTA 3FOLB 4QRQA 3S3SA 4XVSH 1MREH 1CICB 2DQTL 1M7XA 5TF1L 2EDJA 1HQ4B 4CKVX 1R3JA 4KHTL 4EBQL 3HNTH 4F7MA 3DIFA 3DNKA 4ZFOA 5TGBB 3C5ZC 1B4JH 5ALCH 5IMOB 1KJ3H 3MO1A 2ICWJ 2XNAB 4PV8A 4LLVA 3WFBH 4R97C 3C5JA 3MRBA 5CP7A 2R1XB 2OBGA 2X89D 4NO0B 2UWEA 4PLJD 5D93C 4YBQD 4WO4C 3LKSB 3WDHA 4PP1C 3MLZL 4MAYA 3QXVA 1L4IA 1YEFL 1OQOA 1JYVA 2M1KA 4YHLL 1QBBA 2HTLC 3JTTB 1XZ0B 4CMHC 1UGNA 4Z0XA 5DSCB 4ZUTA 2B1AL 2I9LB 3QZWG 4OD3H 3N0PB 1PG7H 3Q6GH 1FN4A 4NO2A 3WFZA 3FT3A 3UBXB 4HIHB 3ZKXC 1KB9J 3FQNA 1QKZL 2G9HA 4W70A 4M7JH 5KVDH 1WZKA 2IC2A 4H20L 4HUMB 2YD9A 5I1HH 2NXYD 5I0DA 1X5HA 3WHXB 4X0KB 2PYFB 4MDJA 4XP9L 3RPIA 5K33A 5T1KD 4BUGA 4G6ML 4N1EA 5C92A 1TZHA 4PJIA 4MD0A 1FSKB 1XF5A 4HWBA 1XF1A 4NDMB 4CL7A 2MOVA 1OSZB 5EU5A 2JF1A 2FECL 4WFED 3O2DA 5DJ8B 4BSWA 1U3HB 3V6OA 1U95A 2ZUTA 2H3NA 2W59A 5E94B 3UCRA 5MHSD 3BP4B 3G5XA 2NYYC 3QNYA 2VABB 3W2DL 1A6UH 5HPOA 4NM8H 4G6FD 3U1SH 2I25N 1X7QB 1IGJB 3D0VA 1Z0NA 1EFXB 1TVBA 5IESH 5I1DA 1KPVA 1NEZB 2WM0A 4LSUH 2UYLB 2VDML 4XCYA 2VJXA 5ANMA 1LDPL 3C9NA 3DVNA 1OAYH 2E27H 2AJSH 3TN0D 4RWYL 1OCWL 5T1KA 2YA0A 1WWCA 1P9MC 5FCUH 2HG5A 1TVHB 3OKYA 3UAJD 1JHLH 1RQ5A 5GRVK 5GSVA 1PYWA 3MA7A 5SWZB 5KANG 2AW2A 5AWNH 4KMQA 4PRHE 4EQ2A 1ZVSA 5FM5M 3MJ8A 4Z7NE 4NNXB 1VGKA 3V0AC 5FKAA 3ARFC 3VJ6B 1HOCA 1G0YR 3WIHL 1S5IL 5LGHH 4J3OC 1MHCB 3O3DB 1L7IL 2J7LA 4UI2A 3J8F7 1K6QH 3MXWH 4PJCE 5J57B 1DL7H 3DX7B 5D71H 4MAYC 4KROB 3RWGA 3TN0A 2BNQB 5FYJU 4XPHL 3MLTA 1CZ8H 5F96L 1KCRH 1E4WL 4O4YH 2YHGA 5LQBH 3BDBA 3P9WB 1U8MB 1UM4L 1ZHNB 3K81A 1HXYA 3NH7H 1ORSB 5HJ3B 5IBTL 1T89A 1NANH 2X4PB 3GI8H 4XNUH 2EDLA 4HSQA 5BZWB 3QUZD 4GAJL 1I8IA 5IHZA 5DF0A 1R24B 5BV7L 3V4UH 3BP6A 3HI6L 4PRDB 5F9DC 4OCSL 5I19L 2AXFA 3G6JA 1ZS8B 3GIVA 3VW3H 5IK3B 1D5MB 3FCTA 3PDOA 1IC4L 4L5FH 4PLJC 4Z76A 1RV6X 4QT5A 4NWTL 1CFVL 4JZOA 2XRAL 3BHBA 3KDMA 2DLHA 3S36X 3GSOB 1RK0A 4NKOB 3O6MH 8CGTA 3V6OC 3OKNA 3RQ3A 4NBYB 4QRUA 3N1FC 5J9PA 5KVFL 5C0AD 2X9XA 4LHUA 3I6LD 5BVPH 5T3XD 1P7QB 1DDHB 3PP3H 3QUZA 1CL7I 2DI8A 4F8TA 4DCQB 3QDME 5F6HJ 4Z7NF 4ONGL 5ITBH 4NQDA 2VXSH 3D18A 1RURL 3UTZB 1MLBA 4GW4B 4NQEE 1IC7H 4DN3L 2DLGA 5L8LB 4ERSH 1UQSB 2CDGB 2NXYC 4JPIA 4LDEB 4O2FB 4HJGB 4M43L 5DTFA 1YNLH 4PJCF 3KPQA 1B4RA 4HCRL 1J1PL 3R0NA 4KRNA 4WFHD 5IB1A 1MCWM 4HWZA 3O2DL 5KSVA 3AM8A 5DURD 3NVQA 1LO3H 3LEVL 5IGXL 3W5NA 2Y72A 4QTIH 2P49B 5C0AA 2P8PA 3GI9H 2HFTA 2DJUA 3SDXE 1EH9A 1RZGA 4XC1H 3ALXA 1EJOH 2AEQH 4PGZA 3MRNA 3BZDA 1NKRA 5LCVL 2X4SA 4GAGH 5IBUB 3WHE1 3VFRA 5F7HA 4YHOH 3TYGH 2VE6B 3P4LA 3P9LB 5JHDE 3WN5A 2GQHA 3V6FB 4PJFA 3P77A 4WFGD 4LFHD 5CZXD 3GUTB 5ID1A 3VGBA 5CKGA 5HDQL 5HHOB 3L3GA 4Z7VA 1FFPB 1NAMH 1WFTA 2BC4A 5BXFA 4JFDE 3T4AA 3TN0C 2LTQC 3FB7B 4OFPA 4N5UA 5C07E 3EYVB 2BVPB 3DX9A 4J1UB 4P3CL 3U82B 4HFWB 3UAJC 1MWAH 3JV4A 1CFTB 1T89C 3RNKB 1U8IA 5MP6H 2O5XH 2OXGA 4K71C 4A6YB 4H1LH 1A7BA 2X1XR 1X5LA 5HHME 3L6FA 5L2KB 4OIIL 5GRUL 5IJKA 1QBLL 3CFIC 5KS9A 1UWEH 4PJ8D 1BZ9B 5CBEB 4N8VB 3P4OB 1LILA 4JFXB 4M8QA 3RNQB 3D9AL 3EOBA 3QZWA 3GNMH 4P5KB 2Z93A 1T80A 1QG3A 1RZKH 2EE3A 1INQB 1XGUB 3ESUF 2ZOLA 3VFNA 3AGVA 4GMSH 5C1MB 5GGUA 1E0OB 3KYNA 4YIQA 3BZEA 2J3SA 1NLDL 1W72L 4WI2A 4HX1A 1QFWI 1FLRL 4PJ7A 3WIFA 3D2UD 3RVWD 1DFBH 2ZCHL 4MD4A 4OZFH 2VXTH 4PB9L 1CGWA 1T4KB 5KN5A 4QLRA 2KL6A 5E8NA 5IG7B 3QR2A 1A9EA 1WITA 5E2VL 1RU9H 4AIZA 1C16B 1XF2B 3QCUL 3QA3A 5SX4H 2XKNA 1XCTB 3QUZC 5F93C 1M7IB 3PQYB 1EHLL 1FYTD 3SDXF 4ZS7L 1S7UB 2RB8A 2ITCB 4PJ8A 3T65A 5ADPH 2YPLE 2DLIA 4DFHA 4LIQE 4HDIB 1T6WA 4LOUD 2DQUH 5J06A 4Y2DB 4IRSD 4WTXA 5I30H 1IGYA 3MV7A 1AGBA 1VKXA 2XQYG 3MRRA 3KWWA 5F7DA 4OI7A 5ADOL 4OM0H 2VDOL 1IC5H 5GS0C 1AGFB 4WUKL 2YC1A 4BFIA 1KLGB 4OFIA 3MUY1 1BGXH 4TUOB 3AM8C 5B38B 1AGEB 5HVHC 4JFOB 4JM2F 4BA8A 3K2UH 5KW9L 3OKLB 1IGIL 3HNSH 3ZKND 3NZ8A 1JWSB 2OZ4H 3D25B 1EMTH 4RSVA 4L8CB 5IB2B 1FZJA 4LVNB 2KQMA 5DJXA 2Q8AL 1FYTA 1DQDH 1NDMA 2X42A 3WN5C 3MPCA 1ZVYA 2GI7A 3VRIB 3OXSA 2NTSP 3E0GA 4GKSB 5MEQB 1QLRB 2HFEB 1V3MA 5K9OA 4R0LA 4XPFL 5DMGD 1IM9D 2DWEB 5JUEH 5FM8A 3KYOA 4XBPA 3OAYK 1T7XA 4R4FL 2MQCA 3UC0H 4ETQA 3OPZL 4ZFFA 1NPUA 4X99B 4YX2H 5HYEA 1Q0YL 2DQFA 3WJLA 4L4TE 3IDGA 2SEBA 3CAFA 2P43B 2VITB 5GGVY 2XA3A 1UM5L 1LEIB 4JFEB 1UKSA 3VXQB 5GZND 1Q9LB 4RFNC 1ZEAH 1UXSA 3CLEH 2NLJA 3GSNB 4X9HA 5IJKC 3NAAH 5JPNA 3MCLL 4UOJA 1B0RB 5CWSB 2EDKA 1ADQH 4OCYL 4DZ8A 4RIRA 2JK5B 2B1HL 1CDIA 5I2IB 4NQEB 4HH9A 1FZMB 2FBJH 5DZNA 4ZSOB 3DTXB 5CZXC 2ICEA 5ESAA 3QIUD 3VFGH 3I85A 5DJCA 3G04B 2XA8L 1IM9A 1G0XA 5KTEH 1VDGA 4PRBB 3S37X 3L5IA 3JWOC 4D9RD 4H88L 5T1DL 4KKBD 4U3XA 4M5ZL 3C60A 4MNQB 4C54A 2IMMA 3PGFH 4D0CB 2OL3B 1DBJL 1D6VH 4R3SB 3JSSA 1IQDA 3EGSA 2KQNA 4V2CB 1G9NC 1WF5A 2ATPB 4PREA 1EO7A 3BPLB 4Z95H 2E7HA 5J12B 4MJIA 4PJ8C 5JHDB 2F53B 4DGVL 1ZLWK 3HC4H 4U1JB 5IQ7L 1LNUB 3NIFE 5T5NF 4CW1B 3PWLA 4XB8A 4BK5A 1KLUA 3QIUA 5FYKH 1SEQL 1ZAGA 5JDSA 3WKMH 3AS1A 4PG9B 2DQDH 2Y07L 4GKNB 3FAXA 3U4AA 1FL3B 5TDNB 4C57C 5DJ0B 4OZHE 3MLYH 4XHJD 3RVWC 5E7BA 4FZEL 1H8NA 1J1OH 3UTOA 4G8GD 1KACB 3MLRL 5DHXB 1PQZB 1J8HD 1JYNA 2YUWA 2HT3D 2BSTB 4NKDB 1II4E 3PHQB 2J5LB 2DQTH 5TF1H 4DW2L 1WIUA 4XCNA 4KHTH 4EBQH 4G43B 3OWEA 1HHHA 1RZIB 4YLQT 3O41A 1ORQB 4JRYD 4TPRL 2AABL 4LOUC 2NW2B 1LK2A 3I6GA 5DJ6A 4U1GC 2HFFA 3MFFA 1A4KB 4R0LC 1I8KB 1V7ML 4GW5A 3LCYA 1OWWA 1UJTA 4M1DL 4F33A 3I2CL 3LKPA 4PB0L 5D96B 1H0DB 2DN7A 4XAKE 3LV3A 4YHLH 3TJEL 1S9VB 3WJLC 1UXWA 1JNHA 4L8BB 5CEYA 1KEMH 4G8GA 2X7LB 5DVMA 2H2SD 4HKJA 3HI5H 4ODTL 1J8HA 4KPHL 2B1AH 3AU1B 3IDMB 3QWQB 2CKBB 3P4NB 2VXUL 1MCBA 5F7WC 2A83B 3ZKNC 1F2XK 3IAGC 4HH8A 5LAXB 4GG6A 1X5XA 5D72L 4PJEA 4NFCA 4JQIL 5BOZG 2FEEI 1CLZH 4X6FB 4Q9QH 5JW5B 1JIBA 1F45A 1ZA6B 2J8UA 4JHAL 4JRYA 1CF8L 1ZT4A 4H20H 3ARUA 5TPWH 2VC2L 5DMGC 5K9JL 3NIFF 5C0BB 4LARL 1ZLUK 2C7UB 3TYFA 3BPNB 4RISL 1FO0H 4G6MH 3FHQA 4OI8A 1A4JA 2YUXA 4NT6A 3EKCA 4YHNB 1I8LC 2GY5A 1YYLL 4LASL 3C60C 4X6EB 1T04A 2YPVL 4OZHF 4YHIB 2V2WB 4Y4KD 2VL5A 2DQHH 4O51B 3VXMD 1QQDA 5GZNC 1EX0A 3U0PB 4JB9H 2RFXB 3W2DH 1KIQA 3LSOA 3MLWL 3BZFB 2GK2A 5KVGL 1I4FA 3BJ91 2ADJB 4OQTL 2D0FA 4MXWL 1IQWL 4E41B 3WV0A 4EI5D 5GGTA 2VDMH 4CGTA 1MIEL 3VXOB 5IVZA 3HNVL 3ZE2E 3QNXB 3E6FB 1LDPH 3QIUC 5SWSD 2WBWB 4JANA 3THML 3ULSB 1J0JA 4RWYH 1WWBX 1IEBA 1NAMA 4RAUA 5IR1A 1A22B 5E95B 4L4TB 1KGCE 1NGQL 5I1EL 1CK0L 1CLYH 4BELD 3F7YB 3M07A 2ESVE 2DYPD 4OZGE 43C9A 2H8PB 3VXRD 4Y4KA 1FQ9C 1JWUB 1JTPA 4HF5L 4JFFB 5INDB 3FTGB 4AQOA 1JGUH 1ZT7B 2CO6B 2LU4A 1IAIM 4CBPA 1YMMD 3T09A 3WIHH 4OJFL 1S5IH 3NA4A 3U2SA 2ID5A 3U36A 2VLLB 1WK0A 3ZYIA 3G5YA 3EYOA 3PGCA 1S9WA 3IFOB 2FX7L 4IHOA 2M8XA 1QVOB 3SDAD 4CVZB 1YPZA 5SWSA 1X5ZA 5DVKA 3RL2A 1BECA 4P4RB 3BGAA 3ARGD 3D5OF 4LBEB 1H8OA 5A1AA 5F96H 1E4WH 4ODWA 2VQ1B 4LLYA 3K74B 2E9WA 4U1IB 5JHLL 1UM4H 3GMPA 1MAJA 3L9RB 4H5SB 4ODHL 4XHJC 1NBYB 1I9EA 3DVIA 5IBTH 1MUJB 3WNLA 2DYPA 3DETD 4FMKA 2HT3C 1YN6B 3VXRA 1KELL 4RGND 4NSKA 2WW8A 2BRQA 4GAJH 4YXLL 4GBXB 4OV6F 1XGYH 1G7QA 1CT8A 4F7TA 1YMMA 1MRFL 1Z9OA 2EH8H 1AY1L 3HI6H 3U0TB 4FFYL 2BSRB 5I19H 3S4SG 3T8XA 1IGFL 3I02B 3LDBC 4JVUA 5HTSA 4LSVL 5JXAL 4PR5A 3SDAA 1XF4A 1JYWA 3ZE2F 4HJJL 3R4DA 3DX6A 4GKZA 4G9DB 1CFVH 3ARGA 1T1XB 4YFLI 3P73B 5K93A 2CLZB 3SJVE 4DVRL 2UUDH 4MMXC 2V7HB 4HGMA 1NGWB 4CU6A 2R29L 1OSPH 2P5EE 5IVXB 5J1AA 4JLRB 5GHWH 3O3UN 3ARBB 2H2SC 3TP4A 2CR3A 3DRQB 1H15A 4WEBH 5BRZE 3OKDA 4HXBL 2OZ4A 2BVOB 1DVFD 2P44B 3GRWH 1F3RB 4LCIL 3WUZA 3NTCL 2EEDA 4NRZA 3CFDA 2GSIA 4ONGH 4QF1A 2BJML 5J56B 1E4XI 5K9KB 3BT2L 2FX8L 3JZ7A 1YEJH 4U6YA 2QR0B 3BEWA 1YJDH 5EU4A 4M43H 2YS4A 1WQVT 5I1AA 5GS1B 2O5ZL 4GKOA 1PKQA 3S8WA 4Y5VB 3TNMA 3QJFA 2Q87A 4HCRH 1JJUA 3S35L 5IB4B 1T3FB 4NN6B 2AK4D 3FQRB 4YDVA 1CDYA 1FG2B 1HHGB 4CDHA 5TDOA 4CJ0A 4G9FB 4MJ6B 3VGAC 5IGXH 1RUPL 5GZOD 4Y4KC 1I1CA 5IROA 3WL9B 4EIGB 3O81A 5IMLA 1IT9L 1BAFH 1B9ZA 4I48B 1DVFA 5HDBE 5LCVH 3IRPX 4JY5L 5FF6B 5LWYL 1T20B 4KWUA 4FXKA 1INDL 4K3EL 1OAZL 1U8OB 3LS5L 1RZKC 3ROLB 5ISZD 5HDQH 5FYKD 5JTWA 1IC1A 2UY7A 1DUZA 1N8ZA 3CU7A 3GSVB 4FTVE 3FL7A 1VFOA 5JW4N 1P1ZB 1DJSA 4YHYC 3JWDH 4LRNL 4HEME 3M17A 4P3CH 2V17L 4LLQB 2AK4A 2EIZA 2AXJA 2IGFH 2UVFA 4S11A 4U31A 2O5YH 35C8H 1BX2A 3PF2A 1S7WB 4GAYA 2R2HB 3QNZB 2GJ6D 2XY2A 2ARWA 3OJVC 5GRUH 1QBLH 3O2WL 5HHNB 3QJHA 1SJHB 4U1HB 3WJJA 1TJHH 5EORL 1JMZA 3HE6D 1K5NB 5D1ZB 4CADB 3SO3C 2F54E 5CINL 4XNZB 1RZFL 3P0GB 2CRMA 4LLUA 3EYFA 2EDEA 1OAUH 4OFYD 1REIA 5DEFB 1AKJD 1KFAL 3SDAC 5ISZA 3TIEB 2DM7A 1QOKA 3ARGC 1K8IA 3BOVA 3NACL 2CH8A 5I18L 2NY2D 2MPAL 4WI7A 4FQXA 1E28A 1AXIB 1FLRH 1S3KH 2J88H 1M05A 4F15C 2ESVB 3HMWL 3QO0A 1W0VB 4OZGB 3RX8A 1DBAL 2F8OA 5D7JD 3IDJA 4KGLA 1J0ZA 3D3VD 4Y19E 3DETC 3DUUB 4M7LH 3DURB 3GKWL 1XH3B 2GJ6A 1NFDA 3DOSA 5D7IE 3CCHB 1FVDB 1EHLH 3UYPA 2M2DA 1MVUB 3BP7A 2FATL 2X4OB 2PXYD 3HE6A 5HDBF 2Y25A 4XXDA 2V9TA 5CJQH 3O3EA 3HI1B 3OQ3B 2FNBA 4PJBF 1MRDH 3X14B 3O3BB 4OFYA 3FN0H 3RUGE 3CZFA 5E2JA 4N8CL 1AKJA 1IKFL 5DK2A 2VN7A 2ATKA 3CFJA 3F5WB 5FIEA 2EC9U 2IANE 4HIIA 5ADOH 1S9YB 4LVOB 3PNWA 4WUKH 4C83A 1T0MB 1JHTB 4DUWA 4DGYH 1ZHBA 4F9LC 3U6RA 2R2CA 4HKZB 2FJGB 3KPLA 5EA0L 5D7JA 1HHJA 2BY3A 5KW9H 3D3VA 5IROC 3SO5A 4HUXA 3SKNB 3EYUL 1CD1B 1OL0A 4RBPK 3VRLE 3LEXA 1KJVA 1KJ2L 2Q8AH 1YC8A 4IOSD 1N6VA 1WLHA 5JOFA 1G7PB 1U8PA 2PXYA 5E2UH 3FQWB 3NZHL 3H3BC 4CNIA 1NMAL 4DKEL 2FHCA 4EUPG 3OPZH 5C09E 3SJVB 1YEEL 4N0YL 2OXHA 3RWJB 1MELA 4U1NB 2YPKA 4Y8AA 5EU6D 4G42B 1UM5H 3TT3L 5GZOC 5ICZB 1KPUB 1NL0L 4WDIA 3OKMB 4A2MA 4R96B 5EIQA 1D5IH 1FRGL 3MCLH 1S9XA 4X5WB 2WWMD 3WJJC 4CU7A 4OCYH 5D7IF 1N6UA 2B1HH 1U8LA 3INUL 4HGWA 2X1PA 4M00A 1KTDB 5JR1L 4ZPTA 4KKNA 2LU3A 1I3GL 5GQBA 1C5DA 3TBTA 1T21A 3RWIA 2APWA 3QXAA 3BH8B 2YD7A 3RUGF 1FLTX 3S4SA 3IS1X 3QEUA 4EDXB 4O2CA 5T1DH 5L8KB 1AD0A 4FQXC 1B2WL 2NY6D 1RIVH 4M5ZH 4PP2B 1WT5A 3PABB 1KT2B 3Q6FA 1J9CT 4PRIB 4OFDA 2GY7B 5EU6A 3HE7B 1DBJH 1OD7A 2ITDA 2D7TL 5HSFA 3FRPG 3OKEB 1I7UA 1Q38A 4GS7C 4AT6B 1TFHA 2WBJD 3QWRD 1I8MB 2FJFB 4S1RL 1ZSDA 3GBMH 4KJWD 5IEKA 5IW3A 3F7RA 3WFDL 1NGZA 4QWWD 3VRLF 1BREA 3HE6C 5IFHH 2QKIA 1J7VR 1ZANL 3HAEG 1UYWL 2HA1A 3ULVE 5I75B 3AY4A 1TQCB 1MCOH 1GH7A 4NRYB 4J6RL 3W11D 3ZMRA 3ZTNL 1SEQH 5MI0C 3RKPA 3TBSB 1K8DA 4NQSB 2Y07H 2FYYB 1G6RB 1U8QB 3OX8A 5DD3L 3CXDL 4G5ZL 2NY2C 5I66A 4YEFA 3BJLA 2H26A 4FZEH 4W4OA 3TVMB 1FVCB 1WICA 1YEDB 3E6HB 3U83A 1JWMA 3LB6D 5D7JC 2ZJSL 1A7RL 3D69B 3D87B 3EDEA 1MJJA 4IOIB 1AO7E 1IAKA 4XI5D 5IMKA 2WBJA 3QWRA 3BSZL 1FL6B 2V5TA 3L95A 4ZO7A 5FDWB 2F54B 4LVEA 2Y06L 3GSRB 3TC9A 5CD3B 2PXYC 2D7NA 1VFMA 1T2QH 3V6OE 1N7ML 1SEBB 4BQBA 1EXUB 4POYA 3MR9B 4NNYA 2ZCLL 1DQTA 5EN2A 4G8FB 4M1DH 1ODAA 5DQDH 1Q72L 1MCQA 4KI1A 5ESVB 3JUZA 5F7UA 3C5ZB 4PB0H 2YD2A 1A6ZA 3TJEH 4TRPL 2DKUA 5AEAA 5E9DE 5DRNA 1QPPA 5DK0A 4OSUL 3QDJA 4RDQF 4R97B 2VDPL 4Y19B 5ANME 1A9BB 4NKQB 5D93B 4PJHE 1MOEA 4WO4B 3IJYB 5DRXB 5C2BH 1UCTA 3MRMB 1JPTL 3VWKD 3ZHLA 3TBYB 4UIMB 2XZZA 5D72H 3GRWA 4ENEC 4YE4L 4JQIH 4HAGA 5BVJA 4HK0A 1HHIA 5FO9A 1CF8H 4BM7A 4CMHB 1HN1A 3S96A 5ERWA 4LSRL 4MLIA 3ULVF 1UG9A 1BQHB 2OS7A 1CGUA 5EO0A 1RJYB 2NY5H 1ZT1A 3DGGB 4PGBA 3GMMB 4LCUA 2XWTA 1YYLH 2FZ3A 3ZKXB 3P3YA 5DEZA 2HJLA 4TSCH 1I9IH 1WT5C 4NUJB 2C5DC 5M94B 4HMDA 4N8PA 3VXTB 2W60A 5IVOA 5DQ9B 5FECB 2ICWA 3WCYA 2P5WD 1A7NH 5HHPB 1J0KA 4TULL 3VWKA 3HZKB 5F1SA 3UTSB 5KVGH 2LV4A 3KPMA 4OZIE 1N3NA 2WWMC 4OQTH 1IQWH 4ZTPL 5KSBA 4C58B 1HIML 3V5DA 1ZMYA 1MIEH 3OJMB 4LLWB 2VN4A 3AY4C 2C1PA 3HNVH 4P0DA 3G08A 3DYMA 12E8L 1GPOH 3V7AG 2R2EB 1YNKL 32C2B 4L8DB 4O58L 5AAMA 4XMLL 2FL5A 1S5HB 4JRWA 1KBGH 4D8PA 5GGSB 5DC4B 4LSSH 1F3JA 1U92A 4KI5E 3SDCD 4CJ1A 5CJXA 4E5XB 2D7QA 1G7MB 1CTNA 1VADB 1NGQH 5SWQA 5DMKB 1YUHB 1CK0H 1BVKA 2NY6C 5I1EH 4W4OC 5DMIL 2MTPA 4MD5B 1P7KB 1BD2D 4RMVA 3WUWB 3S97C 1WEJL 1NCCL 3O6LL 1PDKA 5EZOH 2WQRA 1DQJA 4J8RA 4K7FA 2WBJC 1QO3A 1W8OA 5DI8B 2P5WA 4H8WL 4PJHF 4ZUSA 1NDGB 1DBBL 2BXYA 4KJWC 1QTYT 4BK4A 4QWWC 3TCLB 4YH6A 3CVIL 1NFIB 3CX2A 1CE6A 2P24B 4OF3A 1HILB 2PTTB 4KHXH 4QRQB 2D03L 2A9ML 4YDIL 1AQKL 3BMWA 1R5IA 1R3JB 4F7MB 2AP2A 3DIFB 4ZFOB 3ARFB 3P9MA 4HAFA 4O9HL 5B21A 2CUIA 1FORL 3SDCA 3ZYOA 3MO1B 5B3JE 5K59E 4NQDE 4ODHH 3UEZA 5TE4L 3VA6A 4LLVB 3C5JB 3MRBB 5CP7B 4I13B 1BD2A 4EUPA 4ZNEA 1GGCL 2UWEB 1XGQA 5ACZB 1KELH 5FA3A 3TLRA 4MAYB 2NW3A 2Z4QA 4YXLH 2N56A 4UTBH 4IMKA 4TVPL 4NQUA 1LD9A 1F90L 3FO2A 5A16A 1VPOL 4FP8H 1AY1H 2F5AH 3PWVA 4FFYH 3VCLA 4OZIF 1IGFH 3KG5A 1NCUA 3UBXG 4Z0XB 5JXAH 5C0IA 3OGCA 3KLHD 4ZUTB 2Y7QA 3ALWA 4KDTA 5CAYB 3DSFH 4HJJH 3ZTJH 1YJDC 1AC6A 3ALPA 4AEEA 1FN4B 4NO2B 5C0CE 4OLXL 4UQ3A 4QRTA 3T2PA 1DTUA 2BNUA 2BHUA 2W0LA 4RFOH 3FQNB 1DLHA 2OP4L 4DVRH 4KI5F 2G9HB 1JPGA 4QXUL 1SBSH 3WEXA 3FQXA 5I1CL 1QSZA 4BYHA 4MDJB 3QCVH 3RPIB 2GSGA 4K8RD 4R4BA 1DR9A 5I1GL 2VR9A 3VWKC 4HXBH 4YGVA 4PTUA 4PJIB 4MD0B 3TZVD 2EDNA 3NTCH 2X09A 2GTZA 1XF5B 3DPBA 1PJ9A 3LN5B 5EU5B 5EUOE 4RGOL 3BT2H 4BSWB 3FRPA 3QUML 1U95B 4IRZL 2H3NB 1BF8A 1YQVL 3LAFA 4KKCC 4GRWH 3O2VL 3RTQD 1EEZA 3G5XB 3QNYB 3V7MA 3IDXL 2JJTA 2JCCF 1MPAL 3D0VB 2O5ZH 3HAEA 3VXUD 1C08A 4PUBH 4NQVA 1TVBB 5KS9E 3OAYH 3IDNA 3WFCL 5CJXC 5E9DB 1KPVB 1P6FA 1I3RA 3BN9D 43CAA 4XCYB 1FIEA 4AEIL 2APTA 4LSTH 5K59F 5ANMB 3C9NB 4XVTL 3DVNB 5EULV 2NXYB 2I60L 4C4KT 1UZ8A 4WHYG 4EEEA 2VLJE 5T1KB 2KZ1B 5IJVA 3LRHA 2XKUA 4M7KL 3CDGA 4YFLF 3TZVA 2HG5B 3IKCA 2E7LA 2PR4H 4KKLD 2APBA 4PJ7E 5GSVB 1PYWB 5CEXA 3MA7B 3OKKA 2R4SL 5EFIA 1GCFA 3RTQA 3GSXA 2PW1A 3MJ8B 1HYRC 4I0CC 1KCUL 1VGKB 3IGAA 1BP3B 3VE0A 1HOCB 3VXUA 3MLVL 4LRNH 3SDCC 1KOAA 2V17H 2MWCA 1QSFE 2XG5A 2YD4A 1NGPH 1NQBA 4KFZC 1NSNL 3Q3GA 3TESA 3VGHA 5EOQL 5L7XL 3WE6A 3MV7E 1YYML 3RWGB 3TN0B 1I3VA 4CN6A 2LTQB 3L7EA 4IMKC 3MLTB 4ZTOH 4X7TB 1N2RA 3Q1SH 1URLA 4PY8J 1PY9A 3R0MA 2Y5TA 5F7NC 1HXYB 5DS8A 1RZFH 2HKFH 1R0AL 4QRRD 3EOTL 3QXWA 5EUOF 2BVTA 4WCYL 1ZLWH 5F9WC 4JAMA 4K71B 1CXEA 1B90A 4X7SH 4PGCA 3P0VL 4ZUWA 1BJ8A 5IHZB 2VZSA 5EU3A 2H45A 1NC2D 3NACH 2D7PA 5C08D 1CU4L 2HN7A 3BP6B 3PWJA 2MPAH 5CKAA 2AS5M 2AXFB 3G6JB 1SJXA 5LXGH 2JJUA 3GIVB 5E5RB 3FCTB 3HZYA 3PDOB 3L5XH 4Z76B 3VDCA 4QT5B 3KPRD 4M62L 2OTUA 2EDQA 2WIIA 3BHBB 3KDMB 2AJZA 3RY4A 4S2SA 1RK0B 5JMRA 5E70A 1MJUL 2FATH 2IALA 4HXAH 4HEPG 3STBA 5ACMA 1OWRM 3OKNB 1C7SA 4QRUB 4QRRA 2X1OA 4GLRH 3GBNL 5J9PB 1CICD 4IDJL 4LHUB 3KLHC 2JJTC 4HT1L 4N8CH 1IKFH 4QKXB 3QUZB 4N0UA 4TQEL 3UTPD 1WWAX 1N0LA 1D5ZA 4K3JH 1NC2A 3RY5A 3QHFH 4NQDB 5C08A 3WXWL 4X6DF 2ZPKH 1MLBB 4NCC2 2B0SL 1XR9A 4C55A 4NO0D 3SDYH 3MRCA 4LCYA 5IV2A 4LMQE 2FECI 4PRPD 4JPIB 4OF8A 3OZ9H 5EH1A 4FQCH 2VXVL 5DTFB 2A6IB 3EYUH 3O45A 2KH2B 3KPQB 1JFQH 1JP5A 3KPRA 2R1YA 5CGYD 3GSWB 3LKOA 3DROA 2UZIL 3TZVC 2E7LC 1KJ2H 5IB1B 4LSQL 4HWZB 4J3SA 2EDOA 3DUHA 3B9KD 4HS3A 5KSVB 5HVHB 4GG8A 5TH2A 1A3LH 3GMRA 3I6KA 2AJVL 3RTQC 1U36A 5C0AB 5B39A 3V52L 1NMAH 1RZGB 2CGRL 2E8YA 3SPVA 5TGBA 1UZ6F 4CMMA 2XZAH 3MRNB 2X70A 1QP1A 4GW1A 1ZLUH 2X4SB 1A1MA 3VFRB 1C12A 1PY4A 2CIIA 1YEEH 4LPUA 4MJIE 4WTZG 3WN5B 3IXTA 3VG9C 3U7WL 4PJFB 3P77B 3TT3H 5ID1B 3SGEI 4U1SB 2XICA 4Y1AE 3DYPA 4K3DL 5CJBA 5SX5H 3DVGA 3L3GB 4PRPA 4Z7VB 4NBZB 2BC4B 4K8RL 5BXFB 4N68A 3T4AB 1P4LA 2DDQL 5D7SL 3QUXD 3DX9B 4KJYA 4DQOH 4K7PL 3NFPA 4D9RE 4KKLC 3ES6A 1MSPA 3JV4B 3WS6A 3B9KA 1TTUA 5DURB 1TVDA 5JR1H 1U8IB 4MA8H 4N8VG 3AB0C 3HPLA 3BYYA 4RFNB 2DL9A 3TM6A 1F13A 3L6FB 4YGAB 3B83A 4WY7H 5J13C 3X13A 5KS9B 1U8KA 2DQCH 4HIHA 1ERNA 4OF0A 5DMYA 2NY0C 4M8QB 4ZOBA 3EOBB 2YN5A 5DUML 4CDGC 2Z93B 1MNUL 1CL7L 4NYLA 3WO4C 4PJAE 2ZOLB 4X9BA 3VFNB 4GJTB 4XPAH 2OI9C 5GGUB 4Y89A 5K9QG 3CMOH 3KYNB 4U3CA 2OM5A 4YIQB 2P46B 2YXMA 3BZEB 3QUXA 1MJ7L 4KQ3L 1JZ7A 2L0DA 3HPJA 3WFDH 4HX1B 4PJ7B 3WIFB 2F8XC 5CD5D 1KENL 4MD4B 2NY1D 4N90D 4NGHL 5FYLH 5KN5B 3TNNA 4B50A 5E8NB 1UYWH 1KTKE 4UV7L 1A9EB 4X6CA 1FNSH 4AIZB 2VABA 3ZTNH 1YY8A 3QA3B 2DB8A 3ARYA 2XKNB 5DGRA 1HXMA 1C5CL 2UVEA 5DD3H 1RULL 1NCBL 3MRHA 5FHBH 4Z7OE 4FNLH 5CJOL 2FB4L 4PJ8B 3T65B 4Y4HD 3VFSB 1M1SA 1ZKAA 2OR9H 1BZ7A 1AIFA 4GXUM 3NN8A 5J4MA 4X4MA 3SOBH 1A7RH 1IGYB 3MV7B 3NIDE 3OBAA 1AGBB 2BNQD 4ESKA 3ZL4H 1VKXB 3MRRB 3KWWB 3BSZH 1HINH 1VA9A 1MCWW 4BFIB 2YC1B 3TH2T 2Y06H 4DUVA 2X40A 3H7BA 4Y5XA 3V4PL 1A6AA 1AD9A 1CIDA 1UFUA 2ZUYA 3NZ8B 1TCRA 2R0ZL 1P5UA 4D9LH 3DYOA 1Q72H 2A77H 3VJ6A 5DK3A 1RZJH 3L1OL 2L4OA 1Q9WA 1FZJB 2NY5C 5IIEA 4Z7QE 3O4LD 5DJXB 1FYTB 3L5WA 3BKCL 3QDAA 1NDMB 3T0DA 4H0IA 2BXZA 4Y4HA 1OAQH 3W9EA 3MUHL 4OSUH 1JGVL 3UYRL 5ICYA 3OXSB 3WS3A 2VDPH 4U1GB 5K9OB 5ABDE 4R0LB 3CC5A 3LS4H 2XQBH 1ACZA 4JVPA 4UAOC 5EB9A 2V5YA 3KYOB 4XBPB 4PJAF 5KZCD 2DIJA 1JPTH 4CRPA 2Z8RA 3SN6N 4ETQB 2C4XA 4JE4B 4ZFFB 4X6BA 5CGYC 2ED7A 3RU8L 2DQFB 4YE4H 3IDGB 4QOKE 3WS6C 3B9KC 3JV0A 3MSPA 3SBWA 3S3JA 4ZYKA 1EGJL 5SV4A 1JGEA 5I8OL 5EZJA 5AUMA 1UXSB 2NLJB 4YHPA 2IPUK 4JEGB 1MCPL 4DZ8B 3O4LA 4RIRB 1LEGA 4OUOA 4Z7WE 5DD5L 2YD6A 1FNGA 2VB5A 1NUGA 3HC0A 4HH9B 2ADFH 3EJZC 4KC3B 2ICEB 5ESAB 3KYKL 5DJCB 1JI2A 3VD5A 4N0FA 3GKZA 1IM9B 1YPZE 3C08L 1VGEL 3OB8A 3CUPA 3NIDF 3QUXC 3U30C 1C5BL 2HT4C 2F58L 3OAUH 5ITFA 2F74A 4QCIA 2XTJC 3C60B 1X5JA 4XHQA 1YEKH 1AHWA 4CVUA 4JO4L 3T3MF 4M3JA 12E8H 1IQDB 3EGSB 3RA7L 1MJ8L 4PREB 3G5VA 4IMLA 5H2BA 2CKNA 1TZGL 2EDYA 2XV6B 5D6DA 3FFCE 4MJIB 1QUNA 5E8OA 4U0QB 4Z7QF 4ONHA 3T0XA 1G7HA 3LPWA 3PWLB 4RZCA 1KLUB 1WEJH 3QIUB 5JDSB 1FNFA 1WBXB 1KULA 4X7FC 4X4ZA 3MOQA 1WAAE 2IG2L 5EBWB 4H8WH 5FYJL 3IS0X 1D3CA 4DVBA 4WU5B 5CD5C 2X10A 3CVIH 1FCGA 2EDHA 1FNAA 2NY1C 2E9BA 4Y5XC 5JDJA 2A9MH 2N7AA 4YDIH 5MENE 4ODSL 3DGCR 1R3IL 1HHHB 3BPCA 4O9HH 1FFQA 3SQOL 4U6XA 3O41B 1KCKA 4ZD3L 3O6FD 4Y4HC 4QHUA 1ZV5A 2BOBB 3S5LG 4BSJA 1TNMA 5F3HA 2CK2A 4Z7WF 1TETH 1LK2B 3I6GB 4G7YL 5DJ6B 2HFFB 3MFFB 3NMEA 4GW5B 1KUMA 5GGVH 4WW2F 3V4VH 5IFJB 3EDKA 2FD6H 4F33B 2DM3A 1PKQE 3LKPB 4KTDL 1T7VA 1F90H 3BFOA 4FQPA 5D9SA 1UXWB 1JNHB 3AS2A 4Q6IA 5CEYB 4QRPE 5J7CC 3SBWC 4PRHD 1JPST 2XYCA 3BIKA 4G8GB 4HKJB 4YQXH 1J8HB 3BDYL 3S7GA 5CFHA 2EZ0D 2DQEH 2EC9T 1PSKL 3QI9D 3UP1A 2X4NA 1BMGA 4Y0GA 4PJEB 2K7PA 4N8VA 3P4OA 4OLXH 1ULVA 3S37H 5C0JA 2P47B 2VH5L 3O6FA 2J8UB 5DHVH 4JRYB 4QXUH 5TFSL 3WFEL 3LDBB 1ZT4B 4HHAA 3CH1A 4HUNB 5I1CH 3RWCA 4HPYL 2PTVA 1HKLL 3TYFB 5CMAA 5I1GH 3VG0L 2GYSA 4OCXL 4NT6B 1D9KD 4WRLA 5C6WH 3IU4L 2Z9TA 4RBPH 1GHFL 5IB3A 5J1SC 1EDQA 2F9BT 3QUMH 4JPVH 1IAII 5GS3A 3MGAA 4RFEA 1AHWC 4PRHA 2VL5B 4G8EA 3O2VH 3QRGL 1QQDB 4XP4H 3CLFL 4ZUVA 4HJ0D 2R9HC 1KIQB 3LSOB 1MPAH 1WWWX 2FLBT 5I1JL 2ZP0T 3QI9A 1I4FB 4O2EA 5D6DC 3QEGL 5BS0A 4YC2C 2VTFA 1IE5A 3EFFA 1IZJA 1YEHL 5IVZB 3ZHDA 4PJCA 1T1WB 1M6OA 4JANB 1L6ZA 2RJMA 4MA3A 1WISA 1VSCA 3OB0H 2A9NH 5FYKE 4M6MH 1NAMB 4XMKL 4JN2A 2BOCA 4MXVF 4MZ2A 4QHLA 2NY7L 4RAUB 5IR1B 1L0YA 4JG0H 5LBSL 1D9KA 3BYTA 2JE8A 5FYLD 3T0EE 3ZSTA 4YPGA 3VGAB 2GUOA 2R4SH 43C9B 5C6TH 4Y4KB 1D6EA 5GS2H 2OJZH 4AEFA 3QDMD 1NFDE 1P5VA 2W65A 2C3VA 3K8LA 5GGRY 2NZ9D 4G8IB 4YHZL 4HUUA 4LGRB 4NQED 2AJXH 5EOCL 3U36B 2YBRA 3QG6A 2MCG1 3G5YB 3EYOB 3PGCB 1S9WB 3X11A 1U6AH 4IHOB 3J7HA 3QPXL 5L7XH 1YPZB 5SWSB 4KK8D 2FEEL 3RL2B 2VWEE 2BCKB 2VQTA 3C2SA 4HD9A 2YZ8A 1L7TL 5F7KC 4YHYB 3QQ3A 4ODWB 4LLYB 4R26L 2WLZA 2G2RB 3HN3A 4Q6IC 3GMPB 1AXSA 3EOTH 1R3LA 2F5BH 3MBED 1JNNL 3BIBX 1F2QA 1MCCA 2DYPB 3WMSA 1LVEA 1FYHB 4NSKB 2PYEE 5H35A 3QDMA 5DRZB 1B0RA 5JHDD 1G7QB 2RHEA 3RAJL 1CT8B 4F7TB 1YMMB 4Q6YA 3SO3B 5I2IA 3V5KA 3O6FC 4NQEA 5C9JA 4KMLB 4X8XA 3T8XB 4M1GL 3JTSA 5FEBA 4PR5B 2FIRT 4JFDD 3SDAB 1XF4B 1UENA 3DX6B 3A67L 4X9FA 5C07D 4GKZB 1WSST 1U42A 3ARGB 5GSRA 5B4MD 3GFUA 4JM2D 2VXQL 3HHRB 4HW6A 3U9PL 4F15B 5CEZL 5IVNA 5KANI 2CLVA 1G9ML 1LHZA 2DTSA 5J1AB 4F7CA 3MBEA 4OIAA 5HHMD 3GBNH 4A6YL 1U9KA 3H42L 3VMNA 3OMZA 3SDXA 3IDYC 2EZ0C 4HT1H 2JELL 1H15B 1IEAA 3OKDB 2XWBB 3QI9C 4TQEH 4NRZB 4Z78A 2AJUH 1P4IL 3CFDB 2GSIB 1ZLSL 4QF1B 4NQCE 1UADC 1RI8A 2G75A 2Q86A 4FXGA 3KXFD 3D48R 2HMID 4I8DA 4JG1L 1BEYL 4MYWB 5D1XD 3IJSA 4U6YB 3DJ9A 4I9WE 1G9EA 5GPRA 3BEWB 4JFDA 4K3GA 5EU4B 2N1KA 1CS6A 3UPCA 5T5FL 5I1AB 1PKQB 3MYZA 3PWPE 4HWEL 5C07A 3TNMB 3QJFB 2F15A 4PJXF 3GMLA 2LABA 4LSQH 3HMXL 4JM2A 4YDVB 1D9KC 1P6AB 5TDOB 5E8PA 1I85A 4KTEL 2IQAA 5GGQL 1VFAA 1T22A 5ID0A 1KJMA 1ZGLP 2AJVH 2R2BA 3SKOA 4G43A 4L4JA 4YEEA 5IMLB 2YPLD 3W0WE 1MFDL 4L4VE 3ZDXE 3BXNA 1VACA 5CJ8A 5J6GA 2A6JA 3O9WD 3KXFA 4FXKB 3E8UL 1I8KA 3PP3K 4LCCA 3AFLA 5D1XA 1CTOA 4K3DH 3ULUH 1DUZB 1N8ZB 5L9DL 1J1XH 4XAWH 1QRNE 2DDQH 1KIPA 3S5LA 2ADGA 5I74C 1EVTC 1N0XH 3M17B 4OD1L 4K7PH 2AK4B 2EIZB 3WLBA 5DRWB 1TTGA 1P69B 2EXWD 1KXQE 3KPSE 4WI5A 4QYOA 4K9EL 4DN4H 1BX2B 2X41A 3ET9F 4F57L 4GAYB 5E08L 3RZCD 4FQ2L 2W38A 1S9KC 3HFML 4HS8H 1J12A 1V3KA 1N4XH 2YPLA 5F1KC 2NZ9C 5EC1A 2OSLA 2IEPA 3CDYA 4LLUB 3EYFB 1MNUH 3O9WA 3KJ6L 2IWGA 1CL7H 4PD4K 2BY0A 1MQKH 4RMRA 1BVZA 3QDGD 1OQXA 1FFNA 2ZNXA 4PS4L 3VH8G 5ISZB 4LGPB 1E6OL 4KK8C 2JB6A 1E4XL 5DD6A 3K0WA 4HIXL 2XY1A 4BH8A 3Q48A 1K8IB 1B0GA 3MV8D 4L4TD 2B8OT 4FQXB 4M5YL 4G6KL 1M05B 1AJ7H 4JFZL 4KJQC 3GMOA 2D9CA 3QO0B 2BRRH 4X4YB 2Q3AA 2R0KL 3QDJE 3MBEC 3ARWA 5E4EC 3IDJB 3MODL 1JZ4A 3GSNL 3WD5L 4UB0L 4GS7B 3RZCA 2GJ6B 1NFDB 3BZFA 5AZEL 3EZJB 1RULH 1RZJC 4MMZC 3BP7B 1J05A 2EYTA 3HE6B 1BFSA 3SQBA 2CSPA 5D70H 4XXDB 3O3EB 1BFOA 3NCEB 4JFPA 1QHOA 4L9LA 5HHQA 3VMOA 4XPBL 2OJEA 1IAOA 3QQ9D 1PLGL 3CZFB 5MI0B 1AKJB 3QDGA 5DK2B 4Z7UE 3MXVH 5I15L 2ATKB 3CFJB 3H9ZA 1WZ1H 3MV9E 3RVXD 4HIIB 5B4MC 3MV8A 3PNWB 3DV6A 4JM2C 4JY4A 4C83B 2GT9A 2NY2B 2VLKE 3F7YA 5HI4D 1I85C 2DIBA 1ZHBB 2OL3L 4TSBL 3U6RB 1OVZA 4RA0C 3FT2A 3KPLB 5D7JB 1HHJB 1QLEL 4RMWA 1A14L 4UIKL 3D3VB 1OM3L 4HUXB 2R0ZH 3QIBD 3RKDD 4KAQL 5CLWA 3LEXB 3CVHA 1KJVB 1NBVH 5JOFB 2ORBL 2IAMA 1U8PB 2PXYB 1JGVH 5FYKU 5I8KL 1DBMH 3NFSH 4LCCC 5D1XC 1K4DA 4CNIB 3HG1E 5EIIB 2FR4A 2W9EL 4AG4L 2LU7A 1M71A 1NKOA 1XAUA 3QEHA 1U93A 3UJTH 3SY0A 5H37G 5HPMA 3MX0A 4RNRB 3KLAA 1PKOA 2PCPA 2YPKB 3NCFB 2EDTA 4AL8L 4JY6A 2W0FA 1EGJH 2ARJQ 5MERA 1SVCP 1YN6A 2JKXA 1L6XA 4WDIB 1QFWH 3QIBA 5GJTL 1S9XB 2MMXA 3WIIL 1MCPH 4ZMAT 5DD5H 1U8LB 4HGWB 4L3AA 2EECA 3O9WC 4ZPTB 5C0RL 1RUAL 3WDIA 3KYKH 1C5DB 3TBTB 1T21B 4L3EE 3RWIB 5D2NE 3PWPB 3QXAB 4G9DA 4XAKD 1VGEH 3UPRA 1N26A 3S4SB 3QEUB 4Z7UF 2BVYA 4HBCH 4MQTB 4OZHA 5HGDA 4O2CB 3REWA 1AD0B 1PBYA 1V5JA 2F58H 2VZVA 3JUYA 4P5TD 3UYOD 1CDGA 3Q6FB 2EXWC 1W8NA 2X9YA 3D85A 5EU6B 1FP5A 4PJ9A 4J2XA 2CKBL 2ITDB 3QULA 4JO4H 1BD2E 3RA7H 3RI5F 1I7UB 3RZCC 2VZTA 3LQMA 4P57A 3B4NA 4L4VB 4NJ9L 5IEKB 1DBKL 1KEGL 1NGZB 3HZVA 5HBBA 1HKFA 4FZ8L 1CGTA 2QKIB 3F58H 1BQSA 4L9LC 1DQLL 2KPNA 3ECBA 3F7QA 5T1MA 3DMMD 3TIDA 1FVEA 2G60H 1K8DB 3CFEA 3OX8B 4GQ9L 4O5LL 2HH0L 2IG2H 3V6BR 5FYJH 2V7NA 1MCSA 3ORJA 4LEXL 5I66B 5L6YL 3I50H 4P5TA 2H26B 2NY6B 1MHHA 1S8DA 4Y16C 5GRJL 2D31A 1JWMB 5CS7A 5FOBA 3UDWA 3V0WH 1MJJB 4S1SH 2JB5H 1IAKB 2J4WL 5IMKB 2WBJB 1BM3L 3L95B 3H9YA 1CG9A 5D7LE 3T3PF 2IAMC 1HE7A 3S34L 1LP9E 3FN9A 4I0PD 3LQAL 5T3ZL 4M4PA 4QXGL 1SM3L 4NNYB 3QQ9C 5EN2B 1S78D 4HS6A 2VL4A 3DMMA 2ZUVA 3JVGA 5I1LA 3JWNC 1Q0XL 2KKQA 5D5ME 1KGCD 3SKJL 3RVXC 1A6ZB 1RJZA 2ESVD 3QG7H 1MEXL 5DK0B 1YEGL 3QDJB 2FEDC 1K4CA 3QFDA 2A1WL 2FWOA 2QV2A 3BDYH 1NGXA 3TO2A 1EIBA 3H7LA 3CJJA 3A0OA 3QIBC 2CDEA 1QRKA 4HC1A 3GHBL 3RKDC 2WV3A 4JKPH 2QADC 2HVKA 4ZFGH 5JQ6H 4MNGE 1BQHG 3K80A 3MACL 5DDHA 1ZLVK 5BVJB 3GM8A 4HK0B 1HHIB 2EH7L 5FO9B 4Z8FH 3S96B 4G7VL 5EWIL 3UROR 4I0PA 2Y6SD 4HPYH 4HLJA 2OCFD 4R4ND 5EO0B 1KN2L 1CD0A 5F71A 1ZT1B 1ZOXA 2ZOKA 3VG0H 4PGBB 4OCXH 2F8VA 4LCUB 1SY6L 2FSEA 1NMBL 2FZ3B 2XWTB 4QY8A 4ZO6A 3IU4H 2HJLB 5F1IA 1T1YA 2MNUA 4UT9H 1GHFH 2V9RA 2DRUA 3VH8A 1QBAA 2W60B 4PJ9C 3QRGH 4CAGA 4GQPH 4FABL 2ICWB 2LQRA 4NPYA 3TH4T 1IBGL 4X7DC 3VWKB 2ZKHL 4C56E 3ZE1E 4F58H 3U79A 1N3NB 4F2MB 1LE5B 5KSBB 1HNGA 3V5DB 1OGAE 3O0RL 3LIZH 1SYSA 2C1PB 2ZSVA