4NOLA

Crystal structure of proenzyme asparaginyl endopeptidase (aep)/legumain mutant d233a at ph 7.5
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
404
structure length
385
Chain Sequence
KHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGAWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLADCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of asparaginyl endopeptidase reveals the activation mechanism and a reversible intermediate maturation stage.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
molecule keywords Legumain
total genus 139
structure length 385
sequence length 404
chains with identical sequence B
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.130 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4nolA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nolA01
1NMEA 4QUEA 3GJSA 4QU8A 3QNWA 1SC3A 1RHUA 4ZVRA 5I9TA 4PRZA 3H1PA 2H48A 5IC6A 5IBPA 2HBQA 1QX3A 3DEHA 5IABA 2C1EA 1IBCA 4I1PA 4DCOA 3KJNA 2AR9A 3V6LA 4AW9A 2FP3A 4JR2A 4FGUA 2J32A 3PD0A 2CNOA 5H0IA 4NOMA 1RHQA 2J33A 1CP3A 4ZVSA 2QLJA 4JJ7A 2CJYA 2H51A 1QTNA 4EHAA 4PS1A 3P45A 4D3ZA 4N7MA 1I51A 5K20A 4EJFA 4FEAA 2H54A 2QL9A 2XYPA 4IYRA 4ZVTA 3R7NA 4EHFA 3UO8B 2CDRA 3GJRA 5IANA 1M72A 1JXQA 3EDQA 1F1JA 1BMQA 1RWMA 2NN3C 3D6HA 3P4UA 4QU9A 1RWOA 3KJFA 1I3OA 4QUIA 3PCXA 4QUDA 3ITNA 3DEJA 1SC4A 1GFWA 2FQQA 4QTXA 4QUHA 4EHHA 1PYOA 3BIJA 5LUAA 4PS0A 4QULA 3R5KA 4NBNA 2H4YA 4N6OA 3V4OA 3S70A 4EHLA 1NW9B 1RHMA 4JR0A 3V4LA 5IASA 1RWNA 1ICEA 2QL5A 3R6GA 2H4WA 1SC1A 2FUNB 4EHNA 2H65A 1SHLA 3K7EA 4N6NA 2Y0BA 4NOKA 4ZVUA 3NS7A 3R7SA 4AWBA 4FXOA 4NOJA 2HBRA 5LUBA 3E4CA 1NMQA 3UOAB 4DCJA 3NKFA 4HQ0A 4N7JA 3GJTA 3PD1A 2HBYA 1RWWA 3V3KA 2CJXA 2DKOA 4QUJA 5IBCA 2CNKA 2C2KA 2HBZA 4ZVOA 3H11B 3R6LA 4LSZA 1F9EA 1CVRA 3D6MA 4JQZA 4JJ8A 3RJMA 4D3XA 3H13A 1RWXA 1RHKA 2H5IA 5JFTA 3R5JA 3EDRA 2C2MA 5IAJA 3V55A 2CNNA 1RE1A 1KMCA 3IBFA 4JJEA 4I1RA 3V6MA 1PAUA 3OD5A 4M9RA 1I4EB 4QTYA 2QL7A 4PRYA 1RWVA 3H11A 4EHDA 4IEFB 2H5JA 2QLBA 2C2ZA 1GQFA 1I4OA 4HVAA 5IAKA 2K7ZA 1RHJA 3DEKA 3GJQA 4DCPA 3DEIA 5LU8A 4NBKA 3NR2A 4QUBA 4ZVPA 5IARA 3SIRA 4NOLA 2XZTA 3D6FA 2P2CA 3SIPA 2QLFA 1RWPA 3KJQA 4D3YA 4JB8A 3S8EA 4QU5A 5I9BA 2C2OA 4ZVQA 4JR1A 2J31A 2J30A 2Y1LA 4EHKA 4HQRA 4NBLA 5IAEA 2XYGA 1SHJA 1RHRA 5IBRA 1QDUA 1K86A 2WDPA 4QU0A 5IAGA 4AWAA 5IC4A 3R7BA 4N6GA 4QUGA 2CNLA 1K88A 2XYHA 4FDLA 3IBCA 1RWKA 5LU9A 1NMSA 2XZDA 4N5DA 4JQYA 3H0EA 4QUAA
chains in the Genus database with same CATH superfamily
4AZTA 4AVYA 3OE7D 3OJEA 4BZZA 3GW8A 4UEOA 3VJLA 4QXOA 4B6JA 3T7TA 3WO1A 1YI0A 1U65A 2HMSA 2ODAA 5AKZA 2WYWA 1O3YA 4CFYA 3WIDA 1ZDMA 2R1TA 3B7WA 3OJLA 1QVAA 4IDPA 3SK0A 2QVBA 4EMUA 2BIFA 4DHEA 2VPIA 4HNHA 1BX3A 1Z6ZA 4EA8A 3RC7A 1IEQA 3ABIA 2R6JA 3CLTC 1G64A 2D62A 4LYHA 4GZ5A 2IQ5A 4HWPA 3V7NA 4GDMA 3PXGA 4OP2A 3U7JA 1H2HA 1N57A 4HVCA 2GS9A 3Q3HA 2IYRA 4MQEB 1Q22A 1E0JA 2E0IA 3DC2A 1ZK2A 2ATXA 2FUG1 2HA2A 4GD3Q 4KCGA 1ND5A 1SU6A 1R6TA 3ND6A 1P2BA 2P2ZA 2DPMA 3PB3A 4O3FA 1BXKA 2AFHE 3WGGA 2KE5A 1ST3A 4ZIRA 4LFCB 1G0OA 2AJDA 4YJ2B 4ZVLA 4EW1A 4ONEA 2C07A 4MW1A 3CRVA 3WLFA 1B3BA 5I8WA 3GNQA 3COSA 2O5VA 1V41E 4KTTE 3RTBA 1QH8A 1U28C 2GK4A 2X1VA 2REBA 1PQUA 3LCUA 4Q34A 3G8YA 1WVGA 4JJ4A 1D1TA 3ZKWB 1S7CA 4JWTA 3WFJA 2OZEA 4IFIA 2FP4A 4ZZ0A 1LD3A 4EMTA 3SEAA 4Z4IA 2BAGA 1IXSB 3SP1A 1O7JA 1QR6A 2C2HA 2IEAA 4J7XA 4GM0A 3G1TA 4ROTA 3AM1A 4HWKA 2OGWA 3WDKA 3EXFB 3IP9A 3HJTA 4GKAA 4HNGA 4L6IA 4G85A 3FPCA 3CC8A 4OA5A 3ZQKA 5EC8A 2JAUA 4B45A 2H1HA 2HXYA 4LUCA 1GAEO 4DRXA 5BW4A 3C3WA 5HKAA 2PLWA 1EAYA 1TK9A 2CMGA 2O8BB 1OTHA 2FPGB 2X22A 3OF5A 4L08A 1FRQA 1VE9A 3KYDB 1N2SA 1RI4A 5AHRA 4RTSA 2QVCA 4H17A 1NASA 3BRWA 3IT2A 3HWWA 3Q15C 3WWZA 4B2IA 1Z07A 5E7IA 2V7BA 3OX4A 3TOXA 1CR6A 1BEUB 3CF6R 3Q0TA 1IZ7A 4JP3A 1YR3A 4RCVA 1M2OB 3ZH9B 3I5UA 2P1ZA 3TD9A 1CUFA 2WZDA 2GNAA 3AEKB 3TUZC 1MO3A 4EJSA 5ADUS 3ND7A 4EGSA 1WCXA 1F2TB 1FTGA 2VHZA 1QS0B 2YZKA 4TMVA 3AVWA 1U9IA 2FY8A 1C9MA 3HQ4O 1YD7A 4NFHA 2W48A 4OMUA 4YIKA 2QXUA 4CIWA 1E6CA 1XN4A 3IAUA 1E1NA 2Z8XA 4EEZA 3B1WA 5HJ5A 4PYJA 4ZVVA 2B6NA 3EE6A 4EAAA 5A04A 1C0LA 2YHIB 4YJHA 4DHWA 1GQ2A 5CIWA 4V0ME 4JJGA 3LWBA 1HXHA 4DLAA 1W8IA 4WA8A 2DY0A 1KDTA 1X3SA 1L3IA 4G09A 1IQPA 3WNVA 2ODEA 3TKYA 4B4DA 3GZNA 3IB6A 4DPLA 2AX4A 1K6EA 3IPRA 4N5DA 2QJRA 5TB5A 3GJSA 2KW5A 3GEMA 5UKDA 3O3MB 1KMHA 2M2IA 3GLRA 1KDOA 3W6PA 2WWTA 3W5CA 4XOIA 3TDMA 3Q3GE 5CQGA 2W0SA 4LG1A 4YYEA 2CHGA 5JI3E 2ZCJA 1TVKB 3MJRA 4YAUA 1QFYA 1JKIA 3DAHA 3VOAA 4ZOBA 1LJUA 1OXTA 4DZZA 4GS5A 2ADFA 4L8YA 4YP7A 4BLVA 5LYYA 3B3QA 3KYCB 1GPYA 2JBAB 3NHFA 1BVYF 5F35A 5B5SA 3BC1A 3CNOA 5EZYB 4ATNA 4AWXA 1QOPB 2VPYA 3P45A 4D3ZA 4GL4A 2LCQA 1HM5A 2FMTA 4MV7A 3CLTD 1NUUA 1U9YA 1F9AA 2ICAA 5CA0B 4F8JA 2VP9A 1PP4A 5ILOA 2V5VA 2P9EA 3IT1A 1W35A 2YVAA 1POWA 1WNFA 2M9MA 3BJEA 1T9CA 2ZE7A 3DP9A 3R23A 1RWMA 4HLDA 4AMYA 1LDBA 2MT9A 2YXNA 3UJHA 1FOEB 4LIPD 4EQ6B 1D04A 2JGRA 1I7SB 4C3UA 3ZNPA 2J6IA 1I3KA 3T4EA 3QLVC 1H0HA 4BNZA 2H6EA 4URWR 3HN6A 3E8XA 3ZHYA 1I0ZA 4J0FA 4XTCS 4C05A 5A9SA 3OJFA 1RNLA 4Q7KA 1FFHA 1BXZA 5JNLA 1Q1QA 4G67A 4Z7NB 4IIUA 2G25A 5FLXA 3OHPA 3CSUA 5I5EA 2M1XA 3L4BC 1SZCA 2XZOA 4CF5A 1T0HB 1QFSA 2G07A 3KQMA 3N5CA 3L02A 3GTGA 5DK6A 4MROA 3UXHA 5DHSA 3VC1A 1QF7A 4TV8B 4UAGA 4AP6A 2YHUA 1IM2A 2EX4A 3EFBA 4HSEA 5EGSA 3V3KA 4D3SA 4FD2A 4OI0A 1JKJB 1L7BA 4RY9A 1G8PA 4GF5A 2BBTA 1NKVA 1IPHA 1GGFA 4MWTA 4WFKA 1LBIA 4MA0A 4MGZR 1HYBA 4AX4A 5ALUA 4CIXA 4MRPA 3PC8A 3DC7A 3DMRA 2QROA 4AT1A 5AW3A 1ZA1A 2OCGA 1EB8A 3IIMA 1QGDA 4KH1A 5FWXB 1GGNA 1KZ4A 1R9GA 1SKYB 2P4UA 4FGLA 4P3YA 4F6CA 1KU6A 5HQ3B 3VC3A 3HK2A 1W0KD 2XCUA 1VKRA 1YI1A 2ZEJA 3PK0A 1E3MA 2GK7A 5KTMA 5JCZA 1E2DA 1R3UA 4RS4A 1GSHA 4UEWA 4CKEA 4LE2A 1TIPA 1M6NA 2VSQA 1IE3A 1NTOA 5FFMA 1PLJA 3TJZA 4G2TA 4JHLA 2XEDA 4CFZA 5BWOA 1C4XA 3MC1A 1A9RA 1GUAA 4O29A 3UT5A 1V8BA 4PINA 1GFIA 1CUSA 1FUKA 3DLHA 4MJ3A 5FBLB 2ZJ3A 4MWZA 1ZD4A 2PYIA 1LPSA 3IHLA 5DGHA 2YXDA 5DCYA 5EIXA 2H7YA 2Q29A 1RBYA 4JR1A 5JU6A 4KVZA 1C2TA 5HA5A 3EUAA 5EEGA 1LW7A 3FVQA 5L3SA 4R2HA 1KI2A 2JFHA 5HS4A 2XNKA 3LP8A 1QYVA 3DJFA 4M0KA 1K86A 4X7MA 1X7DA 3PE3A 5HCUA 1QP8A 3K9HA 1XWFA 4IOKA 3BTVA 4CN8A 2GM4A 4G0WA 1GDDA 1VKHA 5KHOC 1VFPA 4FKZA 1EJ9A 4YDRA 3FD8A 2YDXA 4JFRA 3T7CA 1LXCA 2R00C 2E82A 2VHVA 3N9IA 3BIOA 3FWKA 4I50B 1YZKA 5KTYA 1DX6A 1KVTA 1SCBA 1U7HA 4C0BA 2BMFA 4OEHA 4F9TA 3M7IA 4KJXA 3LBHA 1TCCA 1C14A 1DAHA 3V4ZA 1EFPA 3GWZA 2HNBA 4AKIA 4HDCA 1OT5A 1GR1A 1WW8A 4ITVA 2PE5A 3RQIA 1L4MA 2JJ1A 4MH0R 4U7JA 3UHFA 4LFBB 1AD2A 1SC9A 2V59A 3DHEA 2OCAA 5A62A 3VSCA 3LCJA 5EJ8A 2AZMA 1SXIA 2ODBA 2XYPA 2ZI5A 4U2DA 3PD7A 4I6EA 4JUFA 2CW5A 4PNZA 1TOAA 4EGQA 4IY1A 1D6SA 3B9RA 5JNUA 1XCBA 1H2WA 3CH5A 1P9WA 4ZYXA 4C76A 4X8HA 2QRHA 1XCOA 1RXIA 1N32B 4I50A 2QPAA 1MB9A 3IQGX 4TS4A 2HF9A 4Q02A 2C5HA 3EVNA 4PTZA 3SQLA 4E5VA 1U63A 2PU7A 2PRJA 1BYUA 3HFSA 2JA1A 3PNVA 2I3BA 1EVYA 1VE6A 1TPYA 2OCLA 5AOBA 1E0AA 1Q3TA 4XVUA 3NBXX 2RHRA 2XWPA 1RKVA 2DAPA 2JPDA 3K7EA 3ADBA 1P5HA 4RZQA 4I9HA 3OETA 4D9EA 5J47A 4M9SA 1OTYA 2JI4A 3HN7A 3K70C 4D5GA 2IIPA 3DQZA 1U2DC 1UOQA 1YDMA 2EARA 2VKQA 3C1UA 4KWEA 4KOAA 3MN1A 5KSOA 3JQ8B 2VDNB 2HD4A 4RFSA 3FZNA 1TVCA 1ORTA 2A5LA 4GAEA 3A9CA 5CBPA 5JNTA 4EB0A 4LV6A 3D6MA 4JQZA 1KBQA 3EXIA 3CLRC 1L0BA 3KKMA 1WABA 1GL6A 1Y1LA 4HWTA 3K96A 1ZBDA 2GVZC 1MGPA 3OZXA 4MB2A 3AXTA 4D1YA 1YSCA 5EERA 3ZCSA 2CW0D 1YUMA 5IDVA 5E3JA 5AIBA 3JQFC 4J0EA 4UE3S 1GZ4A 4R1MA 1C4OA 1T9GR 1YT5A 4UHKA 4MKHA 5IN4A 2ZZNA 3MWGA 2A94A 3KALA 3GG2A 4PG6A 4Z86A 2HRRA 2EP5A 2E18A 3QWHA 1CLUA 2H1LA 1R4MA 3A1FA 3N2GA 1IZ8A 5F7JA 3TIXB 1GSOA 5FBVB 5IDWA 2AGVA 5T4HA 1THZA 3QU9A 4ZI7A 1J56A 1RKBA 4GE0A 4BJ5A 3A06A 4OQYA 5EEHA 2PUFA 5YASA 1JIJA 4RF4A 1SHUX 5D01A 3G2PA 1GPNA 4BLPA 5FI5A 5BRAA 2EEZA 4MWEA 1QYXA 2IVZA 4YRDA 3FVVA 3N39C 1PX0A 3IV6A 3BN3A 3DPSA 3LX4A 1FTYA 4BN0A 5C34B 4F38A 4EB6B 3WA7A 2V54A 4BQOA 3TN7A 1V16B 3A2MA 5GPBA 4AX8A 3MYRA 4D44A 3RYHA 4ENPA 1O6FA 1BXRB 4JMLA 1FNDA 1NJ6A 4H7PA 4Z49A 3W2FA 1ODJA 4DLRA 3FPHA 4DLVA 3VPBA 5J9FA 2QZSA 4XGQA 3AVXA 1V8PA 1NVAA 2AHOA 2PS3A 1BE1A 1IUNA 3E9EA 3UCEA 4M53A 3VMMA 1HT3A 3CN7A 3CLHA 5TPWA 2BZ1A 4FR2A 3RSOA 4WN9B 3JWHA 3O8DA 1MU0A 1V9MA 2C99A 3HPRA 2Q5HA 4RQTA 2W2QA 4BCBA 1NQXA 3HRKA 4Y7CA 5BSGA 2I87A 1T8YA 4JCCA 1EJ2A 1X9HA 4K05A 3WL8A 3J80A 1Y4ZA 1SCQA 2BZGA 4KWCA 1BJTA 2GLUA 3DZJA 4X94A 1T0PA 4C6SA 4J4BA 1EWVA 1NL3A 3P19A 4QFCA 2XTAA 1E9CA 1HDZA 1TVKA 3S3TA 3IP8A 5HNKA 3SPXA 2GTHA 1GRCA 1J7KA 2YWRA 1PYDA 2VHJA 3DVLA 4N7MA 3RBVA 1GKLA 2IP4A 5KSZA 4KXQA 5TSDA 2IEGA 4L5YA 2E5FA 1U8ZA 3R3VA 1EGHA 4RV5A 3KS9A 1PQPA 1Q14A 2OQVA 4RH1A 4AKEA 3LRPA 2R66A 4DLTA 2WA2A 1LQ2A 4KYUA 1PR4A 5FNVB 1DEHA 5CGZA 3KWMA 3OG9A 3UMBA 1WMFA 1OV4A 1DJPA 4ADSG 5HOEA 3TQQA 1N0IA 3LY5A 4YWHA 3SS8A 2BGKA 2DHCA 1Z2OX 1XQVA 1WPQA 2IXGA 2PUVA 1F1BA 3E22A 3OJOA 5ALLA 5SZHB 1I13A 4XYEA 4HSGA 2YJ4A 4ARCA 1EM6A 3KJEA 4WY2A 3IVGA 5F4ZA 4B4UA 4UASA 3PFIA 5C5IA 1YE5A 3HN2A 1L4YA 4F5EA 1AKEA 1UBOS 4TV8F 5AH0A 4ZOCA 3STYA 4GPTA 1TECE 5TMEA 3S7TA 2HLPA 5SYNA 1ML3A 3UC5A 5LUBA 5L7WA 1SAYA 2ZWMA 1K8RA 1GRRA 2DG2A 3C5VA 4TXMA 3HM9A 3AERB 1NW4A 3A10A 5F21A 3ZLJA 3PDCA 3C14C 4HFMA 5DGXA 2GUGA 1HFJA 2GKGA 1C9EA 4MYUA 3WMFA 3SBDA 4C2UA 1GARA 1ZZEA 2Z56A 3AJAA 1QC5B 4GHWA 4B6FA 1Y5LA 2B8TA 1XTJA 2IY9A 1RR6A 1SHZA 2W8BA 1F3OA 5JLJA 2W43A 3DAPA 3WWOA 5COQA 4YV2A 4HZGA 2M6SA 1XG5A 4IOJA 1OH5A 2JFVA 2QX6A 3ZU2A 1A2BA 1EEHA 1JBQA 1RP7A 2RH9B 3PRKE 3U16A 1M1ZA 4YRJA 1NP3A 3OJCA 1L8QA 1XE3A 4JI5B 2BKAA 2QTHA 4ARAA 4BMPB 4QOHA 4OD0A 4KZPA 2XNSA 4GECA 1LV7A 2IXEA 3C1AA 3VYUB 3B13B 4CR6A 2O06A 3C2QA 3A14A 4JL5A 3E3LA 3P2KA 3EXG2 1ISPA 1IK6A 3AERA 3INRA 5D7BA 5CITA 1B1CA 1YQGA 4Q1VA 3FW1A 2HUPA 1GHTA 1MPTA 1LBHA 2FWNA 4YI3A 3ZDQA 1QC5A 4FE3A 2FLWA 2BEUB 2TMKA 3CA8A 3I52A 1A8HA 5KOIA 3FPAA 2NZUG 1J9GA 5PGMA 1OBCA 1RQ7A 3H5NA 3O21A 4FBLA 2JKZA 1JHZA 1CUVA 1U3TA 2P7IA 4R16A 2R79A 2O4CA 3BEDA 3EIOA 1MFZA 5AI0A 3UB4A 3E3OA 1IHUA 1CQIA 2C4VA 1Y63A 4FNGA 4H1VA 4C0LA 1RXVA 3MFQA 2X6RA 2XQFA 4EBFA 1SKYE 3P9ZA 5D87A 3SBOA 1U9CA 1XDZA 2J7PA 3L40A 3OZSA 4KXFB 2WYVA 3VDMA 3W6ZA 1P1JA 2X0DA 5KWSA 3B70A 4DCSA 3AIIA 3MLEA 4L9SA 2JGDA 4PC6A 3H9QA 2GZRA 2NO4A 1YQQA 4NK5A 1SBYA 1IBSA 4ISBA 2PZKA 2LCIA 3AF5A 1GKIA 4KFSA 4BNTA 3Q1LA 1XELA 1ZMBA 1LJLA 3UCFA 2REOA 4IEIA 2XQKA 4HAVA 3K0HA 4P36A 1NUAA 4W7HA 1IJKA 3THSA 1FFDA 4RPHA 2JA6A 1CRZA 2XWJI 4FMCB 3IUBA 1JDJA 4XUGB 5FWXA 5HGJA 5KOJB 5KX5F 2JIRA 1GPH1 4Q19A 3A1TA 3JASA 4PRLA 2CJYA 1E9VA 1R0SA 1ORIA 1R0XA 3VDNB 3F5MA 1JH9A 3LQKA 1JHOA 4N8EA 1NF2A 2Q3HA 5KWIA 2AF3C 1LK0A 3U4MA 4MCIA 3HVIA 4JVMA 3QE2A 3TD2A 2JI8A 3AI1A 2Z08A 2Q2VA 4INOA 5CNJA 2VWHA 1EXMA 4COKA 3MM4A 3BGSA 4F91B 1NW7A 1T29A 4KNYA 3AF3A 2Z5GA 3HMQA 2X4LA 3WR5A 3KZ1E 1RAGA 4INPA 1M3SA 4L0MA 4C1BA 4ES6A 2JZNA 2UZ1A 2YHAA 2MYPA 4BKUA 1C8VB 4U1RA 4AQDA 1Q2UA 1EXNA 2L18A 1P0FA 3CF4A 1GE9A 4EFLA 3R9XA 4GPZA 2GA8A 1U98A 2DMRA 1I3MA 3W3AA 2P7HA 3ES9A 3PCRB 1G60A 3RS5A 4ZYUA 2PD4A 3QEMB 4OXIA 1UJCA 5MLC9 2WU3A 5EP2A 5L3SB 3QU4A 2NMVA 2OGTA 1N0VC 3AUFA 1HNWB 4C21A 1PWZA 1O5TA 3FGZA 4PC1A 5COBA 2IDMA 2WICA 4FYVA 2HNAA 4FCWA 4DLLA 4EG3A 1V11A 3KT8A 1FBTA 3GTLA 5SICE 1CZUA 1YQUA 4OM7A 3DDNA 1XTBA 3DE4X 1N1EA 4G3XA 4IW3B 2CF6A 2C9MA 4GLOA 4BP9A 2WV7A 4ZODA 1RWBA 2HSJA 4A8JA 2JLQA 3DQQA 2H5IA 2OORA 4AN0A 4Q4CA 3R5JA 5KKNB 3KP1A 3C15C 3E0QA 4IVPA 4X6LA 2J9RA 3BFJA 1M2VA 3WWPA 1KMCA 1MMFB 3U09A 2WJVA 3LYUA 3NOXA 3NBMA 3QPBA 3HJUA 1HQCA 1VL1A 1YDGA 2ATEA 4KL8S 4Y1RA 5BSHA 4WLOA 1LTKA 1JHPA 3P94A 4DMCA 1NAIA 1KGDA 4O4HA 3ZD7A 1RRFA 2WC1A 4YCDA 4BMDA 1Y7LA 2GA9A 3LY7A 2Z2YA 3UV7A 1YOBA 2E2WA 4IIEA 1F6DA 1E6UA 2CB9A 4RVOA 4EIWA 3A05A 1XAHA 3AJ8A 2Q6IA 5EP4A 3D3QA 2MR5A 4LFAB 2H1OA 2ASEA 2CFCA 3AM3A 5B1SA 1FVFA 1JQDA 3R7WA 1RWPA 2GJ4A 2QNBA 2P5TB 3GHYA 3H05A 2HIMA 2IU0A 3U4QB 4LOJA 3HCNA 4HEHA 2R6FA 2ZPTX 2XDAA 1DRKA 4UNPA 2A0FA 2ZJOA 3PLRA 1J2UA 5JWHA 1XCJA 3VO9A 1Q1ZA 1KARA 3BT7A 4GR5A 4LZLA 3D7MA 2FWBA 5CFQA 4MA4A 1GLNA 2PGNA 1KYYA 3LLUA 3EGEA 3OIFA 2FEXA 1HLPA 1JN0A 4CLEA 2DT5A 2XXAB 2FKAA 1T9HA 1KJ8A 2OD9A 1P9RA 4ARZA 1EG7A 3BWEA 2OBYA 2BCGY 3Q11A 5EKXA 5LQCA 5TJHA 4E32A 1WPGA 2ODTX 3LOUA 3MTAA 1RM0A 3LUCA 1GAQA 3H17A 2G6BA 1M2KA 5LBTA 5LZ4A 4MCJA 2PJUA 3IUQA 4FVTA 4E6PA 2JAWA 1NFFA 4RNCA 4RCYA 5EHQA 5CCEA 2H48A 7ABPA 1CZNA 1ECLA 4JMPA 1G5RA 4D79A 1N3YA 1PYGA 2BVNA 3PRHA 1CKEA 4WHMA 4DCOA 3WJ2A 3UAZA 3P9SA 2O2HA 4IO1A 4CL0A 4ZHSA 2GEUA 2YV3A 2ZSIA 3R75A 3B9QA 3UA3A 2I80A 4QJ3A 4JP5A 3U5TA 5D3MA 2WE8A 4XD7A 1TO1E 3R7FA 4NOMA 5DM0A 3RV3A 1TM5E 1YJ5A 4QQKA 2J0EA 4NESA 5LB2A 2GPYA 3DEZA 2RC5A 1I7QB 2QXYA 3R3HA 4Q1DA 3TIVA 4F9EA 2YWJA 1XMJA 1IEXA 3RVSA 5REQA 1H5NA 1KAEA 1AOXA 3CVJA 2EU8A 5EZYF 4H60A 4JI0B 1J1UA 5KKAA 3HLKA 4E4YA 2VPPA 2GBCA 1FMFA 1S8NA 5AKGA 4X1OA 4AG6A 4JITA 3PUHA 5H8WA 2QLTA 1TRHA 4FOTA 4ZRMA 2X19A 6YASA 1AZWA 2DLDA 1JWLA 4M9UA 1N9GA 2W2LA 4HLQB 2OVFA 3ZWBA 4CMEC 1PDWA 2ANBA 3R5KA 4X3PA 3TTVA 5EUCA 3X1ZA 4C5BA 3V4RA 1XJ0A 2E1PA 3K0AA 1AG9A 4X7PA 4WZZA 2DPYA 1FYEA 5BYAA 3DFIA 3EZ7A 2VJAA 3V46A 4TPKA 2WSBA 3HUEA 4KE9A 5FKJA 4DBVO 3NBZC 2Q6OA 4H3HB 5HCNA 4PZLA 3KQPA 6ABPA 2XRMA 3R7SA 3N3AC 3KXIA 1NGSA 4HN2A 2C42A 3ZW8A 5FPYA 2KX7A 3SX0A 4BATA 2IZ7A 4C2BA 3I9LA 5C4MA 1ML4A 2IUYA 3L07A 4C4RA 1BDJA 1K0UA 1MOZA 3H0GA 3PX2A 3Q6IA 1HQDA 1JHRA 2WW8A 2WTBA 1M34A 1M2GA 3EA4A 1P1FA 1H6AA 4EPRA 1RRPA 5GZ1A 2ATCA 4QYXA 1KOLA 3FLMA 4XYLA 4AQYB 4Q6WA 3IB3A 4TLLB 1L4GA 5EXEA 3DDHA 5I9NA 2V9ZA 1ZJYA 1U11A 4QGAA 3ZZUA 4FUTA 1KMMA 3NEYA 4MAFA 3NDIA 1LVUA 3M5CA 4IF6A 4NJEA 2J3QA 5IRCD 4HQNA 3DO5A 1RZRD 4MKFA 1H2BA 4QQFA 5TV2A 3G49A 3DZCA 1Z0UA 2I76A 1X0VA 1AXGA 1IFXA 1RMYA 4YCJA 3DOEA 1SU7A 4P58A 4TMWA 4Z99A 3BSYA 3N2LA 2I8LA 3B6ZA 3FYUB 2CUNA 5FPPA 5A5GA 3DMTA 2WE7A 1WDTA 3C48A 4CCSA 2YJZA 2GDZA 2XMRA 4JI8B 4KO3S 5ALOA 3AOEC 2EF0A 4RXTA 3NP7A 4LDPA 3D4IA 3T54A 2PNFA 4GNKA 2X0EA 1JAZA 1XN1A 4YCLA 1BXGB 1R9MA 1BDMA 1NIJA 3F8TA 3DE5X 2PZJA 3MRTA 2V3CC 3N3BC 3T5GA 4FOSA 5JR3A 3B51X 3BWDD 1AT1A 2HPAA 5DTEA 3F6SA 3ABOB 4TV8A 1CUCA 2Q1SA 2AWNA 2WYOA 2VDKB 3SQWA 3OAAA 1ZSNA 3VNQA 1X2BA 1UMBA 1Y3BE 4MVXA 4C29A 1PJTA 2OQ2A 4WLEA 3WTCA 4E31A 1BJKA 3JQAD 1Z9BA 2A9RA 3PA6A 4C4ZA 4QU0A 3TTSA 4BXOA 4EG7A 1V7CA 1QMGA 1PNQA 2H2WA 1XNGA 4U3JA 1K4SA 4U7WA 3RT1A 4L22A 2WD9A 3WLKX 3CTPA 4PHTA 2I1WA 4G5HA 4AS1A 4NYIR 4ZDJA 4BLQA 3L18A 2A5GA 2H9IA 3IEPA 4FYHA 2HHJA 1BU5A 3OPXA 3X1KA 1V2GA 1DV2A 1NBME 5DCLA 3ROKA 4DA0A 3BREA 3DWIA 2NTEA 3NNNA 4C4XA 2BN4A 1JEYB 4GZ3A 2V7TA 4ZARA 4ZVMA 1LZLA 5EJ5A 3DW1X 4EHAA 3CTMA 3SU8A 5BURA 1J8FA 4R1LA 1BW9B 3NVDA 4MW9A 3PFHA 2O6HA 4RY8A 1T8WA 2LXNA 4JJKA 4U3JB 1EFKA 5B1YA 1KRHA 4DUYB 1X7YA 2EZUA 1W4ZA 5ALZA 4B9EA 3QENA 1MEJA 3NRCA 1XKLA 4M7WA 2VR1A 3SYNA 2ISCA 3OZEA 1E69A 3C3BA 3JVDA 3OPMA 2YVUA 1SOWA 2QMZA 4G1MB 5JQGF 3I8XA 1E2UA 1LWNA 3OX3A 5H82A 3O4GA 1YB7A 5KYKA 2B63A 2I9PA 3L4KA 1ISSA 1P5ZB 1W4BA 3WAGA 3T1HB 2IP2A 4DSTA 2OCPA 1JQEA 2ID9A 3T8YA 3SNKA 2RGGA 2PYZA 4LJSA 3FOAA 2UZ1B 1O6GA 4BMYA 3GLIB 3NHYA 3EGXA 4C0SA 2PKRA 4JJ6A 3UK2A 5J2TB 4MZXA 5FH9A 4N0DA 3BXHA 2PMBA 1Q1AA 3JCZA 5MF6A 3F6BX 2QS9A 1P73A 3PD1A 4OU5A 1N0HA 4RETA 3MPOA 4GKBA 4NMLA 4JCOA 3FFAA 1S8OA 3K1YA 5ENVA 4EKDA 1PJQA 3FUTA 4GGMX 3UUGA 1NR5A 4QATA 3I2JA 3RYFB 1D7OA 1N2OA 1MABA 1US8B 4O8ZA 3B8HA 3ZWAA 4JKYA 5LQSA 3WGOA 3H3JA 4HNTA 3SHVA 1H6DA 2Q3EA 2V7PA 3GP5A 5KVVA 421PA 5E8RA 1IXYA 2HF7A 3KOUA 3IQWA 5CHEA 2CVOA 4Y67A 3ZCVA 4AULA 1H4VB 2AYXA 3AUXA 4QHSA 3EIEA 1O0SA 1N2EA 3S2SA 1L6RA 2OENG 2VSOA 2C98A 4AY4A 3M0EA 2LCFA 2DJIA 5EA2A 4E22A 2AI2A 3CKLA 1XRJA 3U7HB 2FSGA 3ZDYB 4KMSA 1PCXA 1E96A 4LKRA 2HMWA 3ZDDA 5FAXA 4P7GA 3BD8A 1MO5A 4AMVA 1SXJA 2AOXA 3VPFA 1ZAKA 3I72A 2O14A 5D3QA 5DO9A 3PF8A 3AFOA 3EBOA 2F90A 2FUG6 5HR5A 2DYKA 1I94B 5IZCC 1KVQA 4O26A 1WCIB 2V74B 5T6MA 1LS1A 5FBZA 5KQPA 4GYKA 1GZ5A 4TLAA 3BD6A 3EMKA 3ZJUA 3O9MA 3F7NA 1JFSA 4BFZA 3EZXA 1RYBA 5I7HA 3NTLA 3HYTA 5L3RA 3LY8A 2FR8A 4UVEA 5CFPA 2AD5A 2AB0A 1D0SA 3OLVA 1K88A 4R2MA 3RQSA 3VJMA 4IZ6A 4E07A 4L4XA 4KPUA 5LM3A 3QNMA 4M0FA 2XZDA 1E1MA 4KAXA 3S6JA 4K6HA 4ZT7A 2QMOA 2D2IA 4HDSB 4MS1A 5LP6C 2QTGA 3R5HA 2GZ3A 5IDQA 1DG1G 5B58T 2OILA 1IUKA 3LH5A 2N9UA 3IQEA 4JUIA 1Y8RB 1RHQA 1AU9A 2C7PA 1WULS 4UTPA 4RPGA 1UWVA 1NXOA 2C57A 3GVHA 2AT1A 2E4XA 2ZDHA 3HRIA 1LPOA 1HORA 2ID7A 4PAMA 4QFDA 5KYWA 3I64A 1TWFA 4TTJA 2CMHA 3HCEA 1YA4A 2YVQA 3DNMA 2D4AA 2A0YA 1FJ2A 3A4LA 1R4AA 3II6X 2VTBA 2WJPA 4NF2A 4YPVA 2YV4A 3P8ZA 4AB1A 2DFDA 2WD7A 1J97A 1B7GO 1NN0A 1NXWA 1YIAA 3HKEA 4ZK6A 3LUHA 3SICE 4EGAA 2DHDA 4PF1A 1Z2CA 3VNVA 3KHSA 4OFWA 1M2OA 2IYWA 3S1LA 2HIHA 2ZAOA 4JKIA 2A84A 3GPCA 3DCJA 2F4VB 2Y9PB 4MV3A 1DCKA 1JAXA 2FMFA 2QAGC 3UWMA 3QQ5A 5BT8A 5DN6A 5MHTA 2UXCB 1AN0A 3RO7A 1FLVA 2ZRHA 4F4FA 2JARA 3H6HA 3MT7A 3TIFA 1EIWA 1T4CB 2DQYA 3F6PA 4MR7A 3WO0A 4S0ZA 5H7XA 2XXJA 2JLUA 1KY2A 4RZUA 1OF1A 1CR4A 3V55A 1U02A 1VE5A 2Y6VA 3BL8A 3FOWA 1G3MA 1HFWA 3TKAA 4EKNB 2JLWA 4JYAB 1NR7A 3AHCA 1P6QA 4MKZA 3EGIA 4Q4DA 4GIBA 1T34A 1VSTA 2H17A 2IK8A 3HJRA 5AW2A 1HQYE 2OCXA 3ILHA 5BV2P 2ZTLA 3BGWA 2PGDA 3PGMA 4UARA 4EK9A 1NXSA 3VISA 3K9FC 1XO1A 1E4YA 3MWLA 1OB5A 3T1OA 1JR3A 1RLOA 4KLZA 3IXQA 3FTPA 5K0BA 3VR2D 5JQGA 1CE8B 1ECBA 5ADHA 4MR7B 3PR1A 1LW6E 1YI8A 4ABTA 1P8JA 3KV1A 5TPZD 5CPFA 4PX5A 3SX4A 1QH9A 2QR3A 2A7QA 2GPJA 3V8BA 4GVXA 5KAPA 3U7RA 4CODB 2H7VA 1N36B 4JBIA 5HKBA 5EPUA 1YA8A 2WJYA 1GKUB 3EY4A 3MQ4A 4PV7A 1CLEA 4NV1A 5KOJA 2G40A 4CKZA 4GOLD 3EOZA 1HR0B 5A6SB 5FUBA 5IAOA 2WB4A 4TWIA 4L2IA 4U00A 3GUUA 1L5FA 4V39A 3A1EA 3F7MA 3IBCA 5JV5A 4AK9A 4DREA 1L5GB 2CUZA 1U0TA 1W5EA 1DPFA 1P0QA 1Z12A 2PKQP 2FN8A 2XJ9A 3PXUA 1TYDE 3O8QB 3WLAA 1SRQA 1PUIA 1PLLA 3L6DA 4PRZA 5DMHA 3OZBA 2WTEA 3FNBA 1PQYA 1ISEA 1K1EA 3G6KA 3GEEA 1EUDB 4MR8B 4WEQA 1QV6A 4K9OA 6NULA 3GMSA 4J07A 3HPQA 1N1DA 2GAAA 1NYQA 1WBBA 3GRPA 1PFKA 1VKNA 4BVHA 4CBVA 4Y30A 4UMDA 4MB0A 2ZB7A 2AEMA 4YVFA 4NX2A 2V6GA 1PHRA 1XEAA 5A3SA 2IWHA 1LRLA 5I4KA 1C3XA 4PONA 2REQA 1FF9A 2J9ZB 5CFNA 3AI3A 1PT5A 2IXBA 2R4UA 2DCUA 4B74A 4O2BF 2GYVA 1TNDA 1MW9X 4OJNA 2QJOA 5EWMA 1QO0D 3UYLA 2ZUFA 4QELA 4B3RB 2EZ4A 2Q50A 3BGDA 1NSYA 1VKOA 2OAEA 1FDSA 3A31A 4BYGA 3Q5EA 4PSAA 1IOZA 1VE7A 3FHJA 4X00A 3AVTA 2Q4DA 5DM1A 3CX6A 4EHIA 3QKWA 2IS1A 4N6OA 2AMFA 1PR0A 3HFGA 4FEGA 5JALA 5C53B 4HDMB 2RGRA 1KDPA 1U3WA 2JZCA 2OO5C 2F62A 2B37A 2QAJA 5I9LA 4AYXA 1SHLA 1WOYA 2ZRBA 3O8LA 5DTRA 4A5OA 1DAGA 1O97D 2ROQA 1I4WA 3J7AC 3CE9A 3L8DA 1WUIS 1Z39A 2CMFA 2HMYB 5ALIA 3TINA 3V1NA 4LVCA 2GWRA 4UBNA 3U62A 1U0GA 3P4YA 1Y6QA 4WCFA 4H4EA 2NV0A 4H31A 2PUDA 1NI3A 5AP9A 4P6VF 1FQWA 3MBKA 3WNCA 1V3TA 3RJMA 1EFCA 3EGOA 5DX8A 2XUDA 3TLXA 5BSVA 1L2TA 4UUAA 4TM7A 4DNQA 1E89A 1IVSA 1MOPA 1E0KA 3X1MA 3LZCA 3ICCA 4PXSA 4CKXA 5LA6F 2D1YA 1AMOA 4Q9AA 4C2AA 3L49A 4KQ9A 1JEOA 4BWGA 4G5YA 1TA4A 1FDOA 3JZMA 1YDFA 1G55A 3YASA 4JI6B 5KO2A 4RJJA 1UBJS 2B5OA 2EOAA 3FX2A 4GI2A 4WAUA 4D8XA 2G7ZA 3K6SB 4H35A 3TL2A 4NXMB 1U28A 5HG0A 3PT9A 4TGLA 1AY0A 7MHTA 1X1RA 3RSSA 4F97A 1HT2E 4LYYA 3KVYA 3NR2A 4URHA 4G1VA 4KQ6A 1WP4A 4PYNA 3T95A 5BNIA 2I33A 1X7YB 3I4CA 2FEPA 4Y2UA 3SXJA 4PZDA 3L0BA 4ER6A 1BGXT 4S35A 1HGXA 3FM9A 4ZQGA 1QIHA 2R7LA 3A9RA 3KOXA 5DGDA 3S5JA 1Y5NA 2NVXA 1R1DA 3L43A 1OHHA 4MVJH 1IQRA 3ANSA 1Q7GA 1YZTA 1F38A 4NDZA 4NYMQ 5KJCA 4O63O 4AYTA 4TROA 5G0WA 1Z6AA 4KRYA 2HMUA 1N2JA 4DWOA 2ZJ1A 4JIMA 4W5NA 4QOFA 4Q93A 1CQWA 4K6FA 4PPQA 1N8SA 3SEFA 3DKKA 3MB5A 3MRVA 2IYOA 3E9NA 4AY3A 3WDSA 1ADCA 3OE1A 4HFRA 4PFJA 4RWZA 3WWEA 2I2XB 2BFDB 4EZIA 5A2QA 2V96A 3ENWA 3WMWA 1D9ZA 3CEAA 4MS4A 4IVRA 3RYFA 1T2CA 2ZUWA 2COEA 1SMYD 3UOGA 1JYFA 1U90A 1YR7A 1I5RA 2CNOA 4KVFA 5JC1A 1XZMA 4REQB 5F12A 1KAQA 3K2EA 3EOAI 2ZANA 4CJXA 2RSLA 4YJDA 2G1PA 4O33A 2CWWA 4EOGA 2FK8A 3IKLA 2EL7A 2X23A 4JNKA 2W6NA 5G4KB 2QRGA 4DMRA 2PRSA 4Q9NA 1CG6A 4OYLA 4Q7LA 2P6RA 3H0KA 1VDZA 3PTZA 2G4LA 2D0PB 5EMMA 5EYPB 5G1OA 4UPVA 5AVWA 1W1IA 5J2UA 4K3VA 4HX5A 1KQNA 1XK7A 4PZUA 1WX1A 1ZOOA 4YS6A 2ZWAA 1NNI1 1CVLA 2E2IA 2P77A 3DOIA 3GY0A 1E2KA 2Y27A 4LY9A 3B6EA 4BNXA 4GR9A 1Q7CA 4JOSA 4NJMA 5JECA 3ICVA 1XBTA 1JEQB 2VZ9A 1OBHA 1LDEA 3DMTC 3LF2A 1QLHA 5HFNA 1FFGA 3T9EA 1CRQA 1V5EA 2CF5A 2ZB3A 3KHUA 3NGLA 3QWBA 4QQRA 5EHIA 4DBLE 4EELA 3AUAA 3JYPA 3E9YA 3NEAA 1ULHA 4ERXA 1F7UA 1J6UA 2VDJA 1UP7A 3HKEB 1O97C 5DYNA 5ELLA 2Q0HA 2ZBPA 2AKAB 2UYYA 3K0FB 4PO8A 4ZJZA 2A3RA 2JIZD 2YN4A 3AJEA 3JD1A 2GBPA 3LW8A 4O5AA 4AMZA 5FOQA 2N47A 1W49A 1L8LA 1R88A 1JZTA 3DVAB 1N2CB 2EQBA 3IERA 4JJIA 2V45A 4ABYA 2O7VA 3GGSA 3I6ZA 5FJJA 4S3MA 3QBJA 5I8ZA 3ZY2A 3I28A 3RVQA 2E7ZA 3KAJA 2VDOB 1PT6A 2AW5A 1IY2A 1SN7A 2YWBA 4YRTA 1AGYA 2AC2A 4I1RA 3QLEA 1UMBB 1V71A 2H18A 3EG9A 3OZFA 4JENA 3WMEA 2JHAA 4U6SA 1F4VA 1J2TA 2EZ9A 3EXIB 4D56A 2QE7D 3S7ZA 3GDHA 5CEJA 4C9BA 5CIYA 1Q19A 1T9KA 3LO8A 2G82A 3RI3A 3VTAA 1H9CA 2Z8YM 5J4LA 1DTWB 3UUWA 3CVYA 2AL7A 4ZO4A 1FEZA 3VAAA 2R5NA 4PLWA 3EZNA 3QW4B 3WYNA 1LU9A 1I9GA 3HRHA 1QONA 3KZKA 5ALWA 3X1JA 1ZMXA 4CI0B 4C4YA 5LDHA 2FK7A 1SUIA 1YACA 1LSOA 2DTXA 4ZRDA 3QRWA 4ZZ3A 5JQGB 4FDTA 2J30A 4L4UA 1T2UA 3JQ9C 3ODPA 3QM1A 4D0GA 2IRWA 4HT3B 2CY0A 4JXKA 4OQQA 3ROEA 4MV6A 2A5DA 4WQMA 2B4AA 5HJEA 1X1TA 3UAVA 1BW9A 4I9NA 1IW7D 3KUUA 2TMYA 4MV0A 3ZHUA 3KUDA 3R3UA 1BMFA 1EDZA 1G1AA 1VG8A 2J59A 2KLHA 1J1ZA 2OHIA 3KVVA 3I6IA 4U2KA 5B36A 1L7VC 1I36A 2W6MA 1RCUA 3OF2A 4RK5A 1IBMB 1B26A 1Y8QA 1ZITA 2BLLA 2Q0XA 3LKVA 1TZCA 1WZNA 4Z3DA 2HLNA 1ODTC 3M6FA 2E48A 3JX9A 4UZEA 2VT2A 4YV0A 3THXA 2XVZA 1DRVA 3S2ZA 1Z0KA 2WINI 3WLOA 5ICFA 4EG6A 3VR1A 3JW8A 2J41A 3SM9A 4XKJA 2JCGA 1P77A 1UPAA 1W5FA 2QM8A 4DKXA 1NW5A 3UQYS 5EUMA 1E1LA 2WQ6A 1IVYA 2GPBA 2ZSEA 2Q2NA 3GGGA 3ME5A 5A05A 2A59A 1IATA 4OJMX 1I3NA 3Q8MA 3QBVA 1GVHA 2HA3A 3ONVA 1BKYA 4HH0A 4WWHA 4XE5A 1G5PA 3KUKA 4UAJA 2WAYA 2DEUA 3VFDA 4RIEA 2W8BB 2XVXA 3SHTA 3VSEA 2ZYSA 4GOND 5KQSA 2PUTA 2IYEA 3HH8A 3ZE0B 2OHXA 2M32A 1NBHA 5HP4A 2WF6A 1FC0A 4ZREA 1XXHB 1RW4A 2X9QA 3GUZA 3K1AB 3MB8A 3PHBE 3HC7A 2DXIA 1M2FA 1K89A 4K03A 1R8JA 5HE8A 3V4LA 4DW8A 3UPDA 2G1UA 1AKVA 2B36A 4MVJI 5EZ6B 2OC4A 3RIEA 4M1KA 2IV7A 4D26A 3B5JA 1DX9A 2YU9A 2WPDA 1GGKA 4N6NA 2RGBA 3BL5A 3AQIA 1QB8A 4NPHA 2XWBF 2ZSUA 4MVJM 1CB7A 4MV1A 4ND1A 1M0SA 5AXAA 2P11A 1IN7A 4KHZA 1ZNXA 1TKBA 3KLPX 4FMDF 1HMPA 2CCJA 1GUFA 1X86B 1AHNA 2X9LA 2HC9A 2CNBA 3C4JA 1MAAA 3JVEA 3KTAB 4CM6A 4GRAA 4A6DA 4WXEA 1YC5A 4ZV4A 1YRYE 2PZFA 2F9LA 2Q5CA 3B9PA 1XZ8A 1J0CA 4IILA 4C4OA 4C6RA 4ESEA 1K6IA 2H57A 4HKTA 4KR0A 2G9RA 5EMJA 3S8YA 1PJ8A 4GR4A 1GPUA 3TLZA 2HGSA 1E3IA 1A7JA 1XALA 2WDZA 2VXBA 1UBRS 3D3JA 3R0QA 4WTOA 2FDXA 3O75A 3WB0A 4CIAA 2PZBA 4Q01A 1P2TA 3WK7A 3C3JA 4BAUA 4UUMA 2VQFB 4C2TA 3TE7A 3K1JA 3DZIA 2ZKLA 1Y6GA 5CTAA 3PU6A 5CGQB 4W9RA 5BMVA 3AKEA 3QH4A 4B6OA 1L5MA 4ETIA 1J39A 4M2LA 4MRSA 2W6ID 1NM5C 3QOYA 3RHZA 4P80A 5G40A 4PU0A 3IEMA 1IHOA 3C5EA 3I9V6 3PNQA 1ONSA 1NJ1A 2V6MA 4RHYA 1TLLA 5H4GA 4LAFA 1OKKD 3NDRA 1G21B 5F9HA 5DBFA 2GXAA 2R0QC 5A5VA 1I3CA 2H52A 4AU1A 2ZJ7A 4OHRA 1JEAA 3AIMA 2A68D 3SDBA 2XOKD 2PUJA 2Q6LA 1CWUA 4GZMA 2A5FA 4P86A 3DT6A 1S9DA 4X6UA 4X1KA 5AUQA 1AQJA 3RADC 3DMPA 1H0KA 3RUFA 1O54A 2Z2ZA 3I5AA 3NKVA 5AI4A 2GAIA 3K8QA 3OPYB 1Z06A 2JGFA 4ZAVA 4BDTA 2ORYA 1GPDG 1VLHA 1NBMD 1Y89A 3MT8A 4V0QA 4DSNA 5KTSA 4MUMA 1RLIA 1HF3A 2ERCA 1L1RA 2GN1A 3WIVA 2JFXA 4DKJA 4A3SA 4L5CA 4Q3DA 2HO4A 2AFRA 5LOVF 3GLGE 4MI3A 3VXKA 4IM7A 4DNPA 4HGOA 5FA5A 4MGKR 3A4VA 3X2FA 1GN8A 4BE4A 2YOHA 3GTPA 1B8UA 4KQKA 5M7EA 2XYQA 3EQ6A 3DKPA 4JVSB 3FTFA 3WRXA 2QRJA 3KQTA 2J33A 1Z7GA 2D3WA 4XSGA 1CJSA 3WLMA 3ZGXA 1ZEJA 3OIGA 4LJ8A 4NP6A 4Y2QA 3MNFA 4OXKA 4PYLA 1MHTA 3LQRA 2P2GA 1O9BA 1PWYE 3P5SA 4YWJA 4G9BA 1FRNA 3UMYA 1E64A 1OGIA 3OESA 2C9YA 1J8YF 3H9BA 5GMOA 2XTMA 1DWPA 2ODWA 4P81A 2ZTHA 3WNZA 4DT1B 2QUKA 3NUGA 3LCMA 3NNDA 4LCBA 2WT4A 2NUTB 4QBTA 4EB6A 2YQZA 3KJFA 2W6PA 4ODIA 2VTEA 3DUFA 2B21A 4BY9E 3BRCA 1T4CA 1XKXA 1I32A 3L5KA 3BE4A 3CR3C 1ZN2A 4QUHA 4F2PA 3TQFA 5KZMB 2FRDA 2ZJBA 3A4TA 2WV9A 1UC5B 4Q03A 3QI2A 4E1AA 4EF6A 5TC4A 2I54A 1KO8A 2Y0SA 4JT4A 3K9GA 3MQ2A 1M6VB 3E81A 1P1CA 2I3AA 1R0CA 4UQPA 1FXWF 1CUEA 1DQRA 2HJRA 2JLSA 3BCUA 4JQCA 1IB6A 2HA6A 3CIFA 2PO7A 3K5PA 3KCNA 4IUCS 1R5JA 4I46A 1WCMA 2G06A 2E21A 2ZJ0A 4GMHA 1K8YB 3B1JA 4HDKA 4JGIA 1L5QA 4XQGA 2CNDA 3QLUC 4J1SA 4KACA 5KNCA 1PO7A 1WTCA 1HDYA 2J07A 3AVVA 2B2XA 4WVFA 1HDXA 4YHHB 2J3IA 5EXXA 3T3HA 4E08A 4ZYYA 3UJNA 1GQQA 4KI0A 2DOKA 4RM3A 1PV2A 2OFFA 2O8NA 1BRMA 1TF2A 3CHYA 3VUEA 4B80A 5KYYB 721PA 3W9UA 1UAAA 3SI7A 1UDRA 2AQ8A 3KQSA 1BN6A 4PVCA 5KNDD 1W52X 4M38A 4YCNA 2XV1A 4JLUA 4M87A 5BVHB 1XQ9A 5GGYA 5CDSA 1W2GA 3T61A 4P93A 3EIQA 2P9HA 1P3DA 2B30A 4N1AA 4QREA 1Z22A 4R5HA 2GZAA 3SQMA 2OV4A 1C5KA 4P4UA 2VLBA 3N8NA 1GZVA 3ECCA 1RKXA 1NVXQ 1YQEA 4FCCA 4OL0A 2FB9A 4CMBA 1NUSA 2Y0CA 3NVMB 1KQGA 1W44A 4KYVA 3OFSA 3WIEA 5TIIA 2RHCA 4I3FA 5IVDA 1WZUA 1Q15A 4WK4B 4AY5A 4QJ4A 4DJAA 3OZGA 3LHPS 3VBEA 4PC2A 2P6PA 2WKPA 4M7RA 4M7PA 1T0BA 1Z7WA 2JIDA 2ZQZA 1HLGA 3LVFO 4C1NA 4HO1X 1LRJA 2DFVA 4O2AF 3ZEIA 2W2MA 2B5WA 2A14A 2DR0A 3OX1A 2O9JA 1E1QD 4TKMA 3ZX4A 4ZU1X 3D64A 4RA9A 3H5AA 1H4QA 2PUGA 1XZNA 3HWSA 2LTAA 5LOVA 1X92A 2X5OA 1PW7A 1UFVA 2I4TA 3CT6A 2OM2A 2RG7A 2IHYA 2B25A 3Q88A 4YMTA 5CB0A 3ZGNA 2RAUA 2ZRNA 2QTMA 2Y71A 3TTUA 4D4LA 1SD1A 5BV0A 1T3SA 5AK3A 1UXIA 3F6YA 2VYFA 1FNCA 4EECA 4IKEA 1SFRA 4KX3A 2AG5A 4WXHA 1XK6A 3Q10A 3DXFA 4PHFA 3DOJA 3G13A 3FUVA 3L92A 4ROSA 1GTJ1 5ENDA 3KC2A 4M55A 4B9AA 5KYUA 1MQSA 5LSAA 1VI5A 1AQUA 1LDNA 5DLQC 4G0OA 5FWYA 2FW7A 1PJLA 2JIOA 1CQJB 1E5VA 1B4DA 1RLMA 1WHSA 4J90A 1G3IA 4TZTA 3K5HA 1GNRA 2FRDC 3RC8A 3AUUA 3VR6A 4CDGA 2VPZA 3L7LA 4RPJA 4GW3A 2VQ3A 5ELMA 1QUEA 3HCDA 4ZOLA 1NVUQ 2D7JA 4UBKA 2I7TA 2Q9AA 3MD9A 3OQNA 3QZUA 5AM3A 5AVXA 4AJNA 4JN6B 5JAPA 1T8TA 2BFBB 5H68A 3RC2A 3L05A 4XLTA 1PWXA 1T6NA 2WBLC 5DWDA 121PA 3D43A 1QAQA 1PZHA 2CFSA 4G8JA 5DT2A 3RAEC 3V8VA 3HXOA 1ONPA 2Y0BA 1PKXA 1UMDA 1E1KA 3OT1B 1COZA 1M0WA 2A78A 3EWAA 4BJ3A 1HNXB 4KRGA 3GTJA 1JLLA 2ZDQA 3FR7A 4ZAZA 2IP1A 1J5PA 1T9DA 3BIXA 3GT3A 4NDNE 2PL1A 4QUJA 4Z0NA 1RKQA 3K9CA 2CMDA 3F0TA 4BU1A 4ZC8A 4YV1A 2YY7A 3IUPA 1XWWA 3UVEA 2QVYX 1MX5A 3PPWA 5JNVA 5K09A 1JP7A 2V3WA 4Z7QB 4G65A 5C8DA 3MT9A 2IZOA 2XE8A 2PZ8A 2FG7C 2CKDA 4R2JA 1MG0A 1P39A 4QYTA 4XVHA 4MR9A 4C6TA 3HDQA 1FUYB 4IVNA 4L4RA 4AF7A 2GXQA 2DWCA 5DLEA 1JA9A 5K8UA 4M9RA 1XL0A 1TQHA 4YJGA 5I7FA 5IW8A 2O50A 3OTWA 1EK5A 4P1ZA 3DE7X 8ADHA 3RFTA 2FMIA 4WCVA 2BGRA 1FX0A 3ROMA 5K6RA 1VSUA 2HRQA 3SLKA 3MRSA 4GLBA 3CBQA 3LZDA 4LWOA 1I1NA 4WNCA 4E30A 1HZZC 4X6XA 1NQUA 3DLCA 1O57A 4Y3UA 2YWHA 3RUCA 4PCAA 2EG9A 2PL9A 5EKDA 3VZSA 2ZVQX 4TTQA 2G4VA 3WISA 3L0PA 1HDOA 5GWXA 1NZFA 3E35A 2VF7A 5FIUA 5FI0B 4D74A 3X43A 4PN3A 1KHHA 3RRBA 4HQFA 4Y0AA 1J9EA 5DEIA 1DQPA 3KKQA 4WA7A 1TKRA 2V6IA 2JBAA 1KEEB 2QU7A 1KEWA 3LO5A 2F1RA 4ZDKA 1U6KA 5G1PA 1XRPA 2WDPA 2Y8EA 1FX0B 4B8YA 2GASA 4BLWA 3CEMA 4DL9A 2CLMB 2WMDA 2PQ2A 1GM5A 3F6EX 5DYTA 2I8AA 2VHQA 1ZWKA 3HJAA 4YCSA 1GRQA 2YXBA 2F17A 2FR0A 3GRZA 3K6SA 4Z53A 4JP2A 1V8DA 5K5EA 2EG5A 521PA 4N7RA 2A35A 1EX6A 1QIKA 1TGYA 2VDQB 5D51S 3RYIA 4D6XA 2CC2A 1JSLA 2JH3A 1VKJA 2GI4A 3L4BA 4M9QA 1J0XO 2IH5A 5JZSA 5E7MA 1XCGB 4ZVSA 4D0SA 3ZE9A 1LI5A 4JDPA 3R6TA 3NTOA 4RHCA 1E2QA 2HYIC 1V47A 4PTLA 4FSDA 2EAUA 1DWUA 1JQKA 3QXCA 4FFMA 2RD2A 2QP4A 3TW0A 5ALVA 2B3DA 2Y1KA 2QVGA 1AKYA 3VNAA 4CDMA 4G8DA 2Q41A 3KLMX 1NP6A 2CDNA 4OSEA 3G17A 3SE7A 4LSWA 1ZVKA 3GT0A 3UW3A 2NVUA 5LU9A 2Y1EA 3W5BA 4XWKA 2FF7A 5ITZA 1N7GA 5C32A 6PFKA 1X1BA 5HM8A 2J9FA 2VAXA 1SKUA 1ZS9A 2Z2XA 3EC2A 3HVHA 1K83A 3IBGA 1DKUA 4IUBS 4WADA 4ECAA 2HV8A 1C1XA 3HXLA 4MRRA 3EFOB 2R4GA 1P29A 2Q6KA 3FRIA 2VRWA 3U6BA 1IHYA 2VHXA 2H4FA 5CVVA 1G7CA 2HGZA 1UXOA 2PXXA 2ZWOA 1IY8A 1YKSA 4L78A 3OPNA 3U4CA 4DQDA 4ZCMA 2WVHA 5A0VA 5KTKA 3NIBA 3S40A 1G6HA 1KI6B 3HACA 3K16A 1OGJA 4PFKA 3VDRA 4BP3A 1EVKA 4S2EA 1ENPA 2IDJA 4O4IF 4RMIA 1CDEA 1ONNA 1Z18A 3H11B 4US0R 4MJXA 3R8FA 4GXTA 1CU1A 1FUIA 3G9XA 3KBOA 4XM2A 2DHQA 3OP4A 3THRA 5FTWA 2R8RA 2HWXA 4NICA 3WSTA 4NARA 4F1WA 4QSHA 4HNUA 5EE9A 3FWYA 5LXTA 3O8CA 3F4BA 1YL6A 1KSHA 1YXMA 1XGKA 3D6VA 1OZAA 2ZXFA 4OY3A 2X2PA 2EX0A 1TRKA 2QTRA 4IWNA 5ENZA 1HE8B 2DC1A 3N2NA 5E9QA 1PAUA 3DR5A 3ROZA 1OX4B 5FEMA 3GLUA 3LBFA 3OU7A 2XUHA 3O95A 3QEKA 2PIAA 5LZ7A 1D3AA 2MU1A 4J3JA 3PC2A 4LHSA 1XAGA 4HXFB 2FI1A 3VHQA 4KLAA 1ICIA 3AR6A 4IGEA 5IM4A 1U2TA 1M1YA 1MD9A 1X3LA 2MIIA 1YKGA 4BNIA 2PRIA 5JWRA 2ZZMA 2B34A 2HWKA 2XZTA 3SIPA 3ZWCA 4NCHA 1TL7C 1L8AA 1QIIA 2C2BA 4EM6A 3F47A 4PQFA 1YU9A 1H2RS 2Y05A 3O3OB 4U7TB 2Y9MB 1V25A 4DDUA 4QDJA 4I1SA 1XTIA 2VDPB 1A31A 1FS5A 1Q74A 1DFHA 3IOYA 4IH9A 2QEQA 4LGYA 5HF9A 4GEKA 2PANA 4PR0A 4LI0A 4ZAGA 4AZVA 4FZ3A 2JGKA 1SIUA 2J31A 3HKDA 4A0RA 5JEEA 2YY5A 2GD6A 4LBZA 4RLQA 4IV5A 2D2FA 3ET4A 5DJ5A 4EITA 3ECAA 2IV3A 3ZU3A 3IVAA 1QBGA 4CIBA 2QF7A 4D96A 2WZQA 2BTQA 4JVNA 2FMKA 3GI1A 4QXPA 3V3TA 1YZUA 4A2WA 4HNRA 2VK2A 4OUKX 1RZ3A 3HBFA 3TAHA 4Z4GA 2CNWD 2KJQA 3O2NA 1U3FA 2BPOA 3SYRA 1R50A 3ZCQA 1GPJA 1G2QA 3B1FA 3H99A 4R7GA 2XGOA 4I4NA 3UPUA 4YN3A 1OLUB 3DOHA 5HIAA 1MXFA 1MJNA 4M1QA 2UZ3A 5ESRA 4REMA 1YBFA 3GIWA 2OXIA 3KQNA 2R7KA 1GPBA 1VRVA 2KQUA 1B74A 3IJEB 4JBXA 2HIGA 5HS6A 2VEDA 1OXVA 5EP3A 5H70A 1FFWA 2GPNA 3CJQA 2ZR0A 1H94A 2HJWA 3G23A 2WUEA 3PE6A 4RMNA 5AK0A 3RGGA 5HIKA 1IAQA 1ANKA 4FFSA 1G4HA 2JJ2D 4N0QA 1CZHA 2BGIA 2QP9X 3DG9A 1YHZA 5ALKA 3B1KA 1CCWA 3E58A 4BE9A 2DLNA 3H19A 1JKMA 3FCEA 1FVHA 3MVEA 4NAHA 3UGKA 2GZDA 2QT1A 3W6OA 4BCCA 7REQA 2NNWB 1ZGAA 4II3A 5B2ZA 3FNEA 4FM9A 4KDRA 4TTSA 1QO0A 3V5NA 3R3SA 5KMGA 1JT9A 5KWVA 4N39A 1ID1A 2DBZA 4IOMA 1UKVY 4PBRA 3L4SO 5KSYA 1VL6A 3GAAA 3MJFA 4YCCA 1ZGHA 1JEDA 1G18A 2HJHA 3CO5A 3NTUA 3PJGA 4W1QA 5P21A 3DPUA 2A4MA 3L1JA 4UBJA 3UAOA 2X8BA 3JARA 2FZ4A 4EG1A 2ECQA 2WUGA 4YDSA 4OGFA 1II8B 3R09A 4IHKA 1NPDA 3JD3A 1DV1A 3OBBA 2ACWA 4IGAA 4DGQA 3V8PA 4ZVUA 1JDTA 4BOYA 3DDWA 1JLSA 2E1RA 1J2RA 5M3BA 3TX2A 2P3QA 3IUEA 3O4JA 4N7JA 4XGNA 2ZWIA 3R0XA 4J16A 1RXYA 1N1GA 3HUTA 2VQSA 2XUOA 1H9AA 3I32A 1UMCA 1EAMA 4TT8A 3DCIA 2NPOA 2EERA 3D8SA 3R6LA 4HQKA 1HTBA 2C3OA 4OCZA 3FHTA 4AJKA 1UDXA 2EXXA 2GBGA 4CQMA 5KJ1A 4A15A 1DSSG 4MULA 3WIUA 3IGFA 2O05A 3ZXUB 1NRIA 5C1PA 3IAYA 3E5HA 1ZCBA 1HDIA 3IFSA 4NJEB 4R05A 3TCKA 3ZDRA 1AKRA 4DXAA 1ESEA 1MRZA 2GBLA 4R54A 1MIHA 3EAGA 1KEUA 3UHPA 3GMTA 4M8IA 4EUSA 5HXAA 4KIJA 4S1OA 1C7QA 3IE0A 1MDFA 1MQAA 3DHYA 5FNZA 1P5JA 1IN6A 2CJWB 3GRYA 1JVBA 5KTNA 1FMLA 1XDDA 2GJ9A 2RGWA 3EWNA 3NWBA 3IVCA 4FBGA 1G9SA 4X1KB 4EY7A 2O8BA 1DUVG 3PGA1 4IDCA 4Q48A 4WKNA 4A8HA 5CH3A 4M9ZA 4QUBA 4KQFA 4I66A 2NQ2C 4Z54A 1XTVA 3GARA 2PLNA 2J08A 2GYUA 4YMLA 4E3ZA 5IWAB 5F78A 4ZO6A 3RJZA 4DDHA 1M54A 4QPDA 3RS3A 3GELA 4D4JA 1EVZA 2W6CX 4WLFA 3T5BA 1HFEL 1M1UA 3EVTA 1F2TA 5E1BA 4HFNA 1Q7BA 3ZDEA 3RF7A 3NGXA 4QA9A 3LX5A 5HZGA 1G3UA 1RYDA 2HZBA 2YX1A 3H7IA 3IUJA 3IDQA 1W8DA 3PHJA 4FCTA 1FSGA 1K4KA 1NJ5A 1PR1A 2VDVE 3D0RA 4KBFA 4IIHA 4DEXA 4JELA 4JDUA 4ENUA 4Z7JA 1A9PA 3THWB 1DKOA 1R9JA 4FYJA 1IN1A 3R5XA 1YKFA 4G0QA 5FUYA 1H4TA 2FZLA 2ADOA 2XPCA 4FHCA 2J1LA 1YBAA 3H0EA 2Q62A 2EWWA 1YTUA 4YCMA 4RHEA 1KO4A 1TU4A 2AN3A 3PENA 1RHUA 2QUAA 3Q41A 4MQMA 2B20A 2C7VA 3CU5A 3TIGA 2IH4A 4YX9A 4DA8A 2YQ4A 5DHUA 1O8BA 2J0VA 3SMVA 1LTHR 1I2BA 2B0JA 3LPNA 1MV8A 4NKRA 5CG2A 1ORVA 3ZZTA 1VECA 4RVGA 1E2PA 2XGMA 2AJLI 2GPWA 3BFKA 3NHAA 4LVUA 3VZBA 5B57C 2Z98A 5AJXA 2BFFA 2CVPA 2BHLA 2IY8A 2OP0A 3FCXA 1ZM2A 1E60A 1X15A 2BHSA 4M1EA 2V7EA 4DDMA 3RIHA 4EPXA 4B85A 4N5MA 2VA8A 4H9GA 3BE6A 2ISQA 3SXUA 1TTHA 3RGWS 4MINA 1MBZA 1BKSB 1R00A 2GO7A 3K20A 2VPWA 3NBYC 4Y2TA 3ZLVA 1E7YA 1LBSA 1K7EB 3ADOA 4OQNA 4DAOA 3ICQB 1NOIA 2ZRLA 1FP4A 3C24A 1C3EA 2BFEB 4FFWA 1IZYA 1ZRSA 1YS1X 2ZYRA 3PEVA 4MKXA 1SQFA 4NZOA 1N34B 2HSDA 4EFKA 5M5BA 1UH5A 1V3UA 4OQXA 4I8IA 4LV5B 5I7OA 3AF2A 3HJNA 3C1TA 2FPIB 3WVNA 3FROA 3IT3A 2ENUA 1Z8NA 3QWAA 1EFAA 3T5AA 1ZICA 3A4NA 4M98A 3O1JC 2ORIA 3GDOA 4F3CA 2JFYA 1YQ9A 2SNIE 2XMZA 5JFOA 3P2IA 4TV9A 3ZV7A 1G16A 4I3GA 3GOQA 1P6UA 2EJVA 3HKCA 4NOJA 3IMKA 4UOZA 4UEQA 5KYTA 3BB4A 1Z5PA 5EESA 1IZ9A 4BNKA 3L7JA 5BMOA 2FQXA 2VKTA 2AE2A 3HU3A 3MK31 1CUUA 5ERGB 1M2EA 3W5IA 1RS0A 3FDJA 4IQ0A 3D6UA 1C41A 3NWJA 3N8IA 3H1GA 4DDVA 2ORED 1OOEA 2O2JA 2V7UA 1YR9A 2D3TA 1XFDA 2XMQA 2BI8A 3W8RA 3ZJYA 4AKSA 1N3BA 1N6NA 3KUXA 3CUSA 3DXZA 3DBVO 3LC7O 4W5HA 4X20B 2IU3A 2O8CB 2YINC 4FOOA 2YCBA 3KD2A 1PHPA 2IITA 1A4UA 2QTWB 1OQAA 1TK3A 3U9SA 5CT4A 3GH1A 2XH8A 2QR5A 4LRSB 3SBXA 1FA9A 1U0HC 4M0PA 1VYHA 1LLQA 1JTFA 3RROA 1Q20A 1JBKA 2XBUA 3I01M 4Q3KA 4R9SA 4DR5B 4DTIA 1QTIA 4E7OA 4DY4A 2QMQA 4B71A 4DG9A 1OA1A 3T94A 3GJQA 4H3SA 1NF8A 1OPXA 3DUWA 4AJPA 1AS2A 3T0IA 5A2GA 3L8CA 4GKKB 4AROA 1N78A 5ECWA 1M74A 1RZVA 1NJGA 2HOQA 3A04A 4BQSA 1NN1A 3FG9A 1IM8A 3LSYA 4YUYA 2E3JA 4QHTA 1FMTA 1I4LD 4BRSA 1W47A 3DYBA 4QRHA 3HV2A 3SR0A 4IWXA 5E0OA 4ENTA 1ESNA 3E70C 1IUPA 4MRMB 2OP1A 2LBPA 4EY8A 3WK9A 3ZWPA 1VB3A 1ZD5A 2P30A 5BOVA 3TM5A 4GPBA 1JRLA 4RDHA 3GLFA 2V4MA 1A71A 1J2EA 4G5XA 4KSBA 3K94A 2BGMA 1D0VA 1M2VB 4YJ3A 3RTDA 4AYBA 3AILA 3GGOA 3OUUA 5JLAA 1LKZA 3VH4A 4AWAA 2A5JA 2YCLA 3UT0A 5I51A 1GT91 4EABA 1M1NA 2A9JA 2HWUA 3K3PA 5K6TA 6AT1A 2CXOA 4KGZA 4Y1RB 2PN1A 1ZJ4A 1AX9A 2VBGA 4PG8A 2J7KA 4O3MA 1L5NA 1YUBA 1SZPA 2OV6A 2PVCA 2V98A 4ILKA 3I39X 1XD9A 5LKAA 3JY6A 3COJA 3O83A 3NIWA 3DDCA 1Y1PA 3TLBA 3PEYA 2NXEA 1VYUA 3FKQA 4DV6B 2W2XA 2DTEA 4AIRA 3RUPA 2FSVA 2AFIE 3AP2A 1JUDA 4PANA 2QLNA 1L7NA 3U1BA 3FKIA 3NANA 4QXQA 3TW8A 1BDIA 1KS9A 1SBTA 1K9SA 2RGUA 4G5SA 5AJYA 2VYVA 4Z6KA 3HI4A 4OF4A 2GRAA 4PS1A 1T8SA 2QW8A 4Q39A 5EN4A 2VTKA 3SXPA 1CIVA 2WF7A 3UHJA 2B35A 3MUNA 4A10A 4AG3A 2FZVA 3V33A 4K1XA 1T3ZA 5H9WA 3HI6A 3NC1C 4MHSA 4AXXA 1JFTA 3HEAA 2SKEA 1VL0A 2F9MA 4PYMA 2V1UA 1XV5A 3H9CA 4M54A 4HDNB 1KZYC 2HH9A 4NHEA 4D81A 5L51A 2AN1A 3HDTA 3TX6A 4ZYZA 2WD7B 3NYRA 1BWPA 2VDWB 4CEIB 1G8HA 1P18A 2BE9A 3HR4A 3N0RA 3TE6A 2Q5IA 2XUKA 3W2TA 4BC1A 1HNNA 1G7SA 2TYSB 1E2FA 2V6FA 2PGXA 2OKGA 3ND5A 1F5NA 2OM6A 4GX1A 3JAWA 2W8ZA 1JMYA 1ADGA 3OQBA 3OTGA 3ZWXA 2JD2A 3CT4A 4DLUA 1NF3A 4AM8A 1OWOA 4ZU6X 3CZRA 3JPYA 3ZU4A 3BA6A 1CY7A 1P44A 2BKXA 2ZE5A 3OWHA 1Y3AA 1KI7A 4QL3A 2BHRA 4LY0A 4R2LA 2ON6A 2ZUVA 4LRTB 4MVJG 4A6PA 1VGRA 3ZS9A 5REQB 4BAZA 1KKLA 2HBZA 2VJYA 3FMIA 3KB6A 4E7PA 1CVRA 4FMCF 5LKRA 4LF9B 3N1UA 2JDID 1OU4A 3M4XA 4KC0A 5CFOA 1T2EA 2FFQA 1FDUA 1UOEA 1XQYA 2MYUA 1U8EA 2N3ZA 2JLAA 3E7WA 3MELA 4UPDA 1IWBB 2PSSA 4E88A 5IVPA 1RJWA 2OR3A 2V7GA 4WSOA 4HG2A 2G4CA 1Z73A 2CFOA 2PPVA 4RAQA 1DC8A 3R74A 4OK6A 3WYCA 1P6XA 3P9PA 1CR1A 2ZI6A 3D6JA 1OT3A 3NYWA 5BXQC 1BVHA 2ID8A 1P74A 1KVRA 3KKNA 4FFPA 4GLJA 4D5EA 3DVAA 1ORRA 3GRUA 1O4VA 1XD8A 2XYVA 1THGA 1XMIA 1Z6QA 1I2AA 4DLPA 5IG2A 5IPFA 3FFBA 1WZEA 1RQXA 3TRKA 1GL7A 3EHEA 5LVAA 3QU7A 4KXVA 1QH8B 1W2HA 4TMFA 2VRCA 4JJAA 4NZPA 1JHUA 3CO0S 4WBSA 1UEXC 1H8HD 1J07A 5M2QA 4ND2A 5TXGA 1I1HA 3TI9A 2LR0A 5C7LO 5CCXA 2IS2A 4D3YA 1MIUA 2DFKB 2R25B 3FHOA 1BA2A 1E5QA 4D9JA 4O8CA 1ZFNA 4DV3B 3BK7A 3SSMA 4EY4A 3ZNOA 4WDRA 2FKNA 2A0UA 2PJDA 4R1TA 2NP7A 4F6RA 3QEBZ 1IEWA 4BO0A 2O8VA 1ABBA 2YNMD 4UDXX 1IBLB 5JH7B 1QFXA 1D4AA 1KK1A 1MJGM 1X13A 2BD0A 2OVBA 5B3LA 1CULC 1HX7A 5SYAA 3WHKA 1Z0IA 3PHCA 1BDBA 3AR8A 2IIVA 2YWEA 2Y0PA 1RXEA 5SZIA 4YUXA 2WT9A 4O4JB 4V0LA 3JXEA 4EB8A 2G09A 1VI2A 1DBPA 3A1WA 3QVUA 4MARA 4PHGA 4EEKA 3NDJA 4Q1FA 1XPOA 4Q0MA 1YE3A 3TR0A 2WK1A 5ICMA 5DYIA 3OMXA 3E7FA 3ADDA 1DX4A 1NQOA 3LWDA 4OUDA 3ZIUA 2HSGA 5JBQA 3M6IA 3MGAA 1J5EB 4NXNB 2GF9A 1Y1WA 4BFLA 1DOHA 3PIDA 3AM4A 2AFHB 3F7TA 4NBUA 5DI3A 1UAYA 1YR6A 5H0IA 5LNK6 3AY3A 1GXSA 1D5WA 1XLTA 2HEIA 2PMCA 5T3UA 2OYRA 5J4HA 5F4BA 1U2GC 4RSMA 1YZVA 3DBHB 4EJFA 2AH5A 1N7JA 3MLBA 1O87A 4IDDA 3S2EA 3O84A 3P2MA 2EBWA 2XD4A 3U4IA 5DNUA 1E2EA 2FUEA 2VBIA 1DIGA 3TFWA 3U3RA 3CURA 2B1RA 1Z0FA 4WLUA 3EDQA 3ZH2A 1YASA 3R9WA 1EJ0A 1EI9A 1M2NA 2FPXA 2ANCA 5A9SB 2OHGA 3O94A 3DEJA 1TD9A 2TMDA 1BRTA 1B6GA 1GA6A 1DKQA 2A92A 3R41A 1NNSA 2R84A 4FJ0A 4NZZA 3V2GA 3OEED 1ABEA 4XCXA 1CEEA 4ZJYA 4L9WA 1ZZGA 3L4EA 2NU7B 2QAIA 3NLLA 4X71A 5HFAA 4HEJA 5DBEX 4CCYB 4F4UA 4L2IB 1FLNA 3F46A 2NYAA 1N2GA 4QYWA 4UMFA 1KYWA 2H3EA 1UBUS 1JBEA 3IHKA 5KOHB 1KSGA 1U6IA 4PAGA 2EDCA 3ACBA 4MUFA 3S1AB 1KOGA 4NIMA 4MUNA 3LKDA 3H1AA 4FT2A 2RCNA 3IMCA 4AZ3A 2CZQA 2GTIA 2NQTA 2ZIFA 5JSZA 2PKEA 4GOJA 3FY4A 3TQHA 2O7RA 3DU5A 1EA5A 1MEEA 2VATA 2YFYA 4OHVA 1A82A 3WLIA 3LQ1A 3WZLA 1DXOA 3HNOA 3TDKA 3AVUA 3E27A 3DWGA 2P4EA 3F2IA 3DXYA 1RE1A 3SZLA 1W4CA 2XMSA 3A3YA 5J63A 1HEYA 4TWAA 1R6DA 3KQLA 1B8NA 1TWAA 1VE3A 2J7PD 4OVKA 2O1SA 3OPYA 2YBDA 1CB0A 3HB0A 3QPUA 4P98A 3S68A 4JU8A 4KFRA 2HZ7A 4UM7A 5KOHA 1G20B 3DF9A 3F6RA 3VDXA 3G6WA 3L6OO 4MPTA 4DUZB 2B92A 1JR4A 4FGJA 2AMYA 4XPIA 5ALGA 1RJ9B 3PGKA 3GLIA 1GQYA 1Y3DE 2Y77A 2GCPA 1ZJWA 5GZ3A 3OPVA 4ZI7F 3MT0A 4A6XA 2WYHA 5T6BA 5JTUA 3CCFA 4ZPJA 3KJQA 4Y7DA 3JD4A 4HBZA 4BUZA 4MWDA 2R6ZA 3FSGD 4UVGA 2P41A 1OUMA 4FEYA 4DIUA 5JXWA 4FJ1A 4QBGB 2MSLA 2ADMA 1J0DA 1G66A 4YRGA 5HUQA 3HBMA 3LRTA 4HPXB 2XYGA 1Z75A 2O2EA 4GLFA 4KB4A 3HXKA 1DLJA 1Z5ZA 4GMKA 2EFEB 4YRCA 2P90A 3R8CA 4F5ZA 1QP7A 4CEJB 4IUYA 1VZ3A 4W5JA 3KSAC 1WJGA 5AJHA 2DKFA 1YBMA 2ZAGA 3RLFA 4LYAA 3INYA 3WLLA 1N9KA 1V3QE 4ZEMA 5KNBH 4WFIA 5H81A 1STOA 1DIBA 3TB4A 4R1UA 4WASA 5K8TA 1JI0A 4X1IB 3WQSB 4CKEB 3TKLA 1AB5A 2A0XA 3KB8A 3PQ4A 4NS4A 5EJMA 3GN2A 4RK4A 4BFCA 3G79A 3PF9A 2JH8A 3GAMA 5BNFA 4D6YA 8LDHA 1I7NA 4ARIA 4M0UA 4YMIA 1EVIA 1C0IA 3AU8A 4URFA 1A98A 1M1YB 4PX9A 3V8NA 3ZEAA 1CFJA 2X3FA 3CZ5A 3IILA 4KH0A 2PZMA 5DCUA 4HK4A 3CY6A 1YH3A 3UKJA 3ZJVA 4DV2B 4OQPA 3EYWA 1W73A 3L8EA 1WXWA 3G5UA 2DFTA 5TMDA 3TLCA 1Y4AE 1UC9A 2BMDA 2QI9F 2YBEA 3AFIA 3NRBA 1KOJA 3QUSA 3D3NA 4G36A 2IYSA 3LIIA 4NBRA 1AH2A 3WIBA 4IGIA 1AF4A 2XMPA 4J6FA 3VU9B 4D8UA 3P32A 3EVEA 2RK3A 1FU4A 2CLKB 2SECE 3DHNA 2CLEB 3WA6A 3MAGA 1T6BY 5C9ZA 4K8RB 2E87A 3ET5A 4DADA 4QUDA 5EQFA 3TRIA 2W2NA 4P83A 3F73A 2FQQA 2R8YA 4DOMA 1RVV1 1GTL1 2GD1O 4EHLA 3TJRA 1WV1A 5BSWA 5HM6A 4EHNA 4IWYA 2UYQA 5L3ZA 5U4XA 1KE2A 1UBFA 3G89A 4WJLA 3JAKA 1LPQA 3OOYA 2O59A 5JWOA 1FXUA 4H0NA 2GM9A 2Y66A 3BGIA 4HUTA 1D1PA 1NBWB 2I4MA 4LNHA 2IKQA 1EVLA 3QEJA 4PZYA 3WLQA 4ALJA 3HUUA 4MXDA 1DP4A 1MA0A 3GJTA 1T15A 3A1NA 1QH1B 2O1XA 3ZWNA 4B6EA 2CYBA 2FVYA 1CUWA 4MP3A 1G19A 2OV2A 2YWCA 4DMGA 1OXMA 4YQZA 3TD6A 3K5MA 3CLUD 4FNOA 1Y7HA 5ERYA 3T7AA 1O0BA 4AL4A 4H7DA 1TQ8A 3PHIA 1FQJA 1IDOA 1QO9A 1ADYA 2XE6A 2QDKA 1ZNQO 4F6LA 5K8VA 7REQB 5GIPE 3HKBB 2WJJA 3ZDCA 3C3KA 5F98A 4FYPA 3ROFA 1DDIA 1ZD8A 1ZU4A 1I2ZA 3DFKA 3G2JA 2PSFA 2PZEA 2V03A 3WXMA 2CSUA 4II7A 3PNBA 3P20A 4KQHA 4RZ2A 5FCDA 1LLFA 4OHZA 2L17A 1AUPA 2VHEA 1KMIY 4F3TA 5JJKA 3HO8A 4G0YA 3U19A 1ZJ5A 1TM7E 2RAFA 4WJKB 3RSHA 4ASUA 3BL6A 3P0HA 4RTLA 1CEQA 2JCXA 4BRUA 4FP9A 1TZBA 1QHXA 2H1WA 1U81A 4FZ5A 4JL8A 1WUHS 2QM0A 4U2BA 1V35A 1N9ZA 4ITUA 2QNIA 1KWKA 3TQRA 3WQBA 3E9RA 1ZI8A 4QOEA 5JC8A 5AYVA 2VP4A 3G0CA 3KKOA 2TRSB 2GCEA 3AOGA 5KIAA 2OZKA 4HAWA 5KJFA 1AGPA 1OR8A 2O07A 4C7JA 1SZDA 2HWWA 4F96A 1RQRA 2P68A 3ENKA 2AZTA 3WP1B 3RODA 3T1YB 4BO6A 2J6BA 4Q21A 4UD6A 5JBIA 2F9FA 2CJPA 5EL0A 5AVYA 5JZVA 5K9ZA 1KXZA 3IQFA 3COZA 3BZWA 4QPJC 1E5XA 4NR0A 2BWJA 3GNTA 4H0FA 3C43A 1H42A 3O38A 2LWIA 2O3UA 3N07A 4QYMA 5IKXA 2I7DA 3MTEA 2FE1A 3M2TA 3TFQA 1UBLS 3FBGA 3B78A 5DP1A 2BUCA 3KJGA 3RT9A 5KSWB 4RZSA 2J32A 2V58A 3OJ0A 4J6EA 3P2YA 3U3ZA 2I6TA 1QAOA 1F2UB 3NAQA 4RXMA 3SIWA 4BNWA 4YXFA 1AGNA 1EUCA 5DNDA 1ULUA 5KNDA 1JJFA 1NQ5A 3GBSA 3LLVA 2BELA 3VKFA 2N75A 2XECA 4H7HA 3PXAA 4I7EA 5A3RA 1VRCA 1FFAA 2BDEA 2P2SA 4ZEVA 1Q1GA 1ZY2A 1IOWA 4RL6A 4H4DA 3TZCA 4QAQA 3URMA 3V7WA 4EPWA 5C8YB 3HKCB 2AFHA 3MWJA 3ITEA 3AQ4A 5DI3B 1NRWA 1VC2A 3LA6A 4XDYA 4KREA 1L4HA 5FWAA 3BWXA 3U49A 1M1XB 1ZH4A 1BQ3A 3KDPA 2WR8A 4NEHB 4UQLA 2JIQA 5FB3A 4D42A 5GZ6A 1NV9A 4AJ9A 5IJ9A 1I3OA 1KNQA 3A8TA 1QZZA 1EINA 4HS9A 3DL7A 3BPSA 1UZMA 1EX7A 2QTAA 2YIVX 4WNAB 1K6XA 1IU9A 5EQJB 3AWIA 1HETA 3BFVA 3JWGA 4XUDA 1GEEA 1YR8A 3Q72A 5FFNA 1XVIA 4BZPA 2XQIA 3A1UA 5B7GA 1OVMA 2QKYA 3HXPA 3Q8XB 2ONYA 5GONF 3SHOA 3SLGA 2JGAA 2C5EA 4GDFA 4J03A 4DCNA 1EFRA 2YJTD 4J0IA 3ZK8A 1D2GA 2PWPA 4FXDA 4CKCB 1OCEA 3F4KA 2ZATA 3DZFA 3CINA 5CJ2A 1ESZA 5EVCA 1YBVA 2DR3A 3C3AA 1ZN9A 3I9JA 5K2MA 3VH3A 1X70A 3U7QB 2WG1A 3M5WA 4HDQB 4OIMA 2XRZA 3H2GA 4YASA 4KOEC 1QX4A 4KR7A 4F4IA 2BFNA 2NZXA 3HSYA 1S2IA 2CLFB 3ZY5A 4EQZA 5IX8A 3TNYA 4NU8X 5BWBA 1Z2AA 5IT4A 3VUFA 2QG4A 3TL6A 3BF8A 3WWCA 2GN8A 1BN7A 2QIPA 1JTEA 4MIKA 3PA8A 5KNBD 1YVRA 1DAIA 2L69A 4P4NA 1UZNA 3UT6A 2P9TA 5F5LA 1RWVA 2AZ4A 2IYXA 3I0MA 3UMCA 2JAXA 3M89A 1ZRNA 4TLCA 3TZEA 4Z4CA 1EFPB 1LLCA 2D0OB 4XGRA 5E6SA 2YJ5A 2HFJA 4EAQA 2WVAA 1SC6A 3NBQA 3QVLA 4ZI5A 1ZU5A 2DWQA 1N25A 4N5NA 4CQJA 1H93A 2BKVA 2COUA 3K09A 4GWLA 2YS6A 3WXBA 5DRTA 1NBMA 3GJZA 1E1RD 4ENVA 4CEHA 2XMBA 1MB2A 1SD5A 1VPLA 4QDUA 3RJ5A 1T4DA 1NWCA 3ACDA 3L7BA 5CURA 1KEPA 3UBMA 1S1CA 3LNTA 4PLHA 9LDBA 5IF3A 1YFZA 4MYHA 4YMGA 5JRDS 3PQ7A 4H7FA 3JQBA 2G1JA 3N6RA 1L4LA 1W0KA 5D86A 3QU5A 1OIXA 4DIDA 2CLHB 4Q82A 5DTMA 2RHTA 2WRZA 2COKA 2PT5A 3K31A 3Q6MA 4JUDX 5F51A 4BNYA 3GFQA 4XIYA 1OKKA 2DZDA 1R0LA 1Z4PX 4ED9A 2GZSA 5KDOA 3LE8A 3LX8A 5IH3A 1ZD1A 3TRFA 4QG3A 1X7GA 2Q3LA 3HA7A 4KDFA 1KY5A 4HDNA 5GJVC 3JV7A 1ZL2A 4X24A 2ZYDA 4LKOA 4WFJA 1SCJA 1G8MA 2A0KA 4M37A 3P0RA 1T1EA 1TTT