4NOLA

Crystal structure of proenzyme asparaginyl endopeptidase (aep)/legumain mutant d233a at ph 7.5
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
404
structure length
385
Chain Sequence
b'KHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGAWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLADCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Legumain
molecule tags Hydrolase
source organism Mus musculus
publication title Structural analysis of asparaginyl endopeptidase reveals the activation mechanism and a reversible intermediate maturation stage.
pubmed doi rcsb
total genus 139
structure length 385
sequence length 404
chains with identical sequence B
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.130 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4nolA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nolA01
4EHDA 4DCOA 4D3ZA 4N6OA 3IBCA 5LU9A 4NOLA 3H11A 4QU5A 4M9RA 4EHFA 2C2MA 4JJEA 2FP3A 3R6LA 1RWMA 2CDRA 4EHKA 4QUAA 4QUBA 3KJNA 4FEAA 4ZVOA 3ITNA 2QLBA 2DKOA 4HQRA 2QL9A 3IBFA 2CJXA 5IAKA 1SHJA 2C2ZA 5H0IA 4EHAA 1NW9B 1RHQA 1KMCA 4NBLA 1JXQA 4AW9A 2FQQA 2P2CA 3R5JA 4N7MA 4N5DA 2CNKA 1BMQA 1I4OA 2HBYA 4QU8A 2HBQA 3D6FA 3P4UA 4PS0A 4JJ8A 4JB8A 1RWVA 3SIPA 2J30A 3KJFA 2J31A 5I9TA 3R7SA 5LU8A 4FGUA 3V4LA 3GJRA 4QUDA 3DEKA 2C2OA 4EHNA 4DCPA 3RJMA 4I1PA 4EJFA 1SC4A 2C1EA 1RWXA 2K7ZA 3BIJA 3GJQA 3S8EA 5IC6A 4NBNA 5LUAA 3PD1A 3NS7A 1I4EB 1IBCA 2XYPA 1ICEA 1QX3A 2J32A 3K7EA 4FXOA 3V6MA 4D3XA 1K86A 1SHLA 3D6MA 1RHUA 2XZDA 1PYOA 3EDRA 1M72A 4HQ0A 3SIRA 2Y0BA 4PS1A 4NOMA 4ZVQA 5LUBA 3R5KA 4ZVUA 1NMSA 3H0EA 4QUEA 2H48A 4QULA 4ZVTA 5K20A 2H4WA 3DEJA 5IARA 2QL5A 2HBRA 3H11B 4FDLA 1NMQA 3H13A 3R7NA 4N6GA 1RWOA 1RWWA 4IEFB 1RWPA 4EHHA 4AWBA 2CJYA 5JFTA 3D6HA 3DEIA 1CP3A 4AWAA 1GQFA 4NOJA 1PAUA 1I3OA 3R6GA 3GJTA 5I9BA 3V4OA 3EDQA 2QLFA 1NMEA 4N6NA 4QUIA 5IAEA 3R7BA 3NR2A 3KJQA 2H5JA 2CNOA 3PD0A 4PRYA 4DCJA 2QLJA 5IANA 2XYHA 4ZVPA 2CNLA 5IASA 4NOKA 1F9EA 2CNNA 4QTYA 4JR0A 4QUJA 4ZVSA 1RWKA 1QDUA 3NKFA 4NBKA 1RHKA 4QUGA 2C2KA 4JR1A 3V55A 2XZTA 4QU0A 1GFWA 4QU9A 4JJ7A 1RHJA 3V3KA 2Y1LA 1RE1A 1CVRA 4IYRA 2J33A 4JQZA 4JR2A 5IBRA 3DEHA 2FUNB 2HBZA 2H54A 2QL7A 4N7JA 4QTXA 1QTNA 1RHRA 5IAJA 1K88A 3QNWA 5IBPA 3UO8B 3PCXA 2H5IA 2NN3C 4I1RA 5IAGA 3UOAB 2H4YA 3H1PA 5IBCA 3P45A 4JQYA 3V6LA 4EHLA 4PRZA 2H65A 2XYGA 5IABA 2AR9A 3GJSA 3OD5A 4LSZA 2H51A 4ZVRA 2WDPA 4HVAA 3S70A 4D3YA 5IC4A 1F1JA 1RHMA 4QUHA 1RWNA 1SC1A 1I51A 3E4CA 1SC3A
chains in the Genus database with same CATH superfamily
2WJ4A 2G71A 1BXZA 3GJ3A 5T6BA 4LBWA 4EYEA 2EGGA 3C41J 3GV0A 4BMXA 2Q5CA 2Z4SA 3D2BA 4H3KB 1ONOA 5COQA 2PUFA 2YZGA 4PLTA 3UPUA 3E9NA 2B5VA 2MSDB 2VJBA 1DC3A 2C04A 5FF9A 1UDCA 4BB0A 1RPNA 3QFHA 2OTCA 2V4MA 3K2EA 1ZH4A 5JSYA 5TY0A 2UVPA 3QPUA 1KL7A 4QGGA 4F6RB 4XGRA 1UPUA 2Q3HA 1MNQA 4OO3A 4BASA 1SVIA 3T1VA 3WFJA 2F8MA 2UYQA 5K0NA 4WD3A 5ESRA 3PC8A 2G9QA 3DOOA 2W2KA 2XHZA 4X3OA 2MYNA 3MTBA 4NJOA 3QI2A 5CW2A 1M2NA 2C94A 2ZAIA 3Q8WA 5HNKA 3O8OB 4JJ8A 1QH8A 5B6PA 1R64A 2FMHA 3CWCA 1RYYA 2QMYA 2GKGA 4LYGA 4A27A 4LYFA 2FSFA 2EJWA 5LU8A 1RLMA 1E1YA 3WLSA 3UHPA 4BJ5A 2I6GA 5GONA 2H63A 1I0ZA 4HWPA 4Z0PA 3EGXA 5B1HA 3WRYC 4PGFA 3HYTA 3KALA 5HZGA 4ILEA 2YNMD 3OF2A 4U2CA 3RIXA 1Y5RA 2GH1A 4X7MA 1R9GA 4YP6A 1P7CA 4MYCA 3SKYA 4J0EA 1DOHA 3NW9A 1E3EA 1SO8A 5CDUA 1R0KA 5EMJA 4LPKA 1G8MA 3TIVA 5CEJA 4Q01A 2UUBB 5HP4A 5SY4A 3RU3A 3OCCA 4I4TA 1FSSA 2QV0A 3DL7A 4PXYA 3NIDB 2JLWA 3O2SB 5BVGA 1ML3A 2REXB 3B3FA 4IKOA 4TKZA 1UPFA 3I2YX 4DARA 1T0UA 1ZU5A 2OILA 2RC6A 3BBLA 5CNMA 1Q1NA 3ZWCA 5CB6A 2IOHA 1E2HA 3N7UA 3QLVC 1RRMA 3BJIC 1UDBA 3P2JA 5HIAA 4LJRA 1QVZA 3FTQA 1WD5A 4GLOA 3UMMA 2YC2C 5ERGB 1X8XA 4Y2SA 1BS9A 1E9FA 3AR7A 4MRNA 4A8PA 4MX8A 2B6NA 2XTAA 2TMDA 1XMOB 3Q40A 1B6GA 4RZXA 3VYSB 2R2GA 1XNGA 4J2HA 2QBYA 1C30B 3O8QA 3PTLA 4HX9A 1G0NA 2FGKA 4N40A 1WCXA 3GELA 2HYDA 4B35A 2DSNA 3D8HA 3E15A 1TUGA 1Y8CA 4DCCA 1GNTA 4ND6A 4JEIA 1DWQA 2X9GA 4O2BF 3N8HA 5DXJA 1NKSA 2GYYA 4BKPA 2XMSA 5BSEA 1FY2A 2Z5LA 5C52B 3WRYA 4FCVA 2WJAA 3S2ZA 4U4AA 2O57A 1I3KA 4M4SA 2W4IA 3TQFA 4DA9A 1PWZA 1XJ5A 3UFXA 2AXQA 5IEJA 4RH3A 1U6IA 3CF6R 5CJPA 1QYWA 1Z7GA 3X1YA 5F21A 4YYZA 5ITSA 5KYNA 4MKIA 2JIZA 2H1RA 3SJAA 4I14A 1UT8A 4G01B 4P1ZA 4BQNA 2GETA 3WB1A 2IS4A 4ALJA 1ESMA 2GK3A 3NJ4A 1O0CA 1FZQA 3OH8A 2Q1UA 1YH3A 2HA0A 5EJ4A 4AJ9A 4ARCA 3VVCA 3KYCA 2AXNA 5KHAA 2Y67A 3E35A 4CEHB 2FZLA 2FMXA 1DFIA 1NQOA 1ZH6A 1R0ZA 1VCOA 3FOAA 3K5OA 2R92A 3C7CB 5HA5A 5T8KC 1CG6A 3AWIA 1ETHA 2JBWA 2CVQA 3JZIA 3VH2A 1P5HA 3CF4A 1GG8A 3K73O 3KSUA 3N2GA 4D6PA 3DH0A 4PNZA 3L4KA 3DHNA 4KE7A 2C2WA 4GD3Q 4WA7A 4RNCA 1LKZA 2PYZA 1W4ZA 3C6MA 1JXAA 2PMFA 1MX9A 2JGEA 1EUDA 4U1RA 4XVUA 2FPIA 5AXCA 3PNPA 1TL8A 1S3SA 3BFKA 3ZCUA 4JLPA 5AW2A 3PXUA 1ICIA 2O2EA 4DLNA 3W5UA 3PGLA 5LQAA 5KSZA 2PX5A 4BP1A 1VHWA 1CDOA 2C57A 2CXSA 1AQYA 4IFBA 2OV6A 2J7KA 4RIIA 1OWLA 1MEOA 3WMWA 2B4RO 2VNJA 3W8EA 2GAJA 5D86A 5F1YA 4ZWNA 3UQYS 4B2PA 4EYSA 4JYMA 5JTTA 4DV6B 1Y6GA 1QKIA 3LVQE 3JYNA 3STHA 1U7HA 1RXYA 2XNSA 4B87A 5K0EA 4MVJG 3WL4A 1R8XA 1UPXA 1YONA 2CMKA 5L7YA 5IT0A 1L5LA 1NYRA 1FDSA 1YGPA 2H2WA 3HKBB 3ZG6A 5EIEA 5J4YA 2PGJA 5BPFA 1MF7A 1KEPA 1NXQA 3FVRA 3G6KA 5EE0A 4BUJA 5HUJA 4WOCA 4M1QA 3IVXA 5JSUA 3NHKA 3EPJA 3HCBA 4K6KA 4N18A 2NVBA 4KL8S 4DV4B 4KXMA 1SU8A 1T5TA 1I14A 3G2LA 3RC3A 1ZN8A 2Q3BA 3TO5A 3EWSA 1JNYA 5TT0A 3UVEA 1EJ2A 1HDIA 2V74B 1FNMA 3NNSA 2ZXFA 5FWXA 4B75A 1P17A 1QZXA 2A4MA 2X1MA 4L5YA 5JRZA 1HQMD 6NULA 3V8PA 5LL6P 3OI7A 4BVAA 3AEYA 1TW3A 1YNJD 1OBFO 2REOA 3OE7D 2WUDA 5C4IA 1NIJA 2ZT8A 4Y1FA 4ZGWA 1JHXA 3CJRA 3SM9A 2LDBA 3ZPXA 4E31A 4I66A 5BWMA 5JZMA 1VSVA 1MAUA 1EI9A 1OXMA 2YR0A 3K0AA 5IAEA 4CBVA 4BQRA 4PRYA 3DKIA 4J76A 1G5IA 2G17A 3UQZA 3MXTA 4V1CI 2ZWAA 3WSVA 1B41A 2JA7A 3BL6A 4J3JA 5J40A 1GWNA 1G8KA 1RXEA 2CNBA 2OSBA 2FSHA 4AMZA 4HBZA 2W37A 2QG4A 3AEZA 2BFWA 3NYQA 5EIFA 1NVXQ 1RKBA 2WU4A 3OUUA 4A6EA 4KACA 4LDJA 2BHTA 2RGDA 3SKXA 2RK6A 4E32A 4EBFA 1P0FA 5JHHB 2BGUA 1W0CA 3LY5A 1UDRA 4MMYB 4NPAA 1SIOA 1AS0A 1U2GC 4ZMRA 1E5LA 4KH1A 4EI2A 2ZI6A 4L28A 1O1YA 4GWGA 4OFZA 4MZDA 1ZBQA 5IAJA 3TK1A 1WZEA 3R0IA 4PNPA 4RQAA 3BN3A 3H2HA 3V6LA 4BATA 3PDIA 2BLLA 2ZW9A 3JQFA 4DCNA 5DPMA 1EP9A 2GESA 4FIDA 4RS4A 4EX7A 1E96A 1QE3A 1WG8A 4GUDA 3UFBA 1ADCA 3I4CA 5HMLA 1W96A 4OJQA 2X5NA 5FTWA 2TYSB 2YWCA 1A27A 2ZAGA 1CR1A 1X15A 1OLXA 1OOEA 3ED5A 3LX4A 5KOJA 4P35A 1P73A 2IHKA 5K8CA 4PHFA 4EHBA 2I8CA 2RKBA 4D8VA 4D0GA 3F67A 3I6YA 1C2YA 2QVZX 3R6LA 1TM2A 3PHIA 2ZWMA 4FKZA 4P4SA 4QOHA 1I80A 3MGKA 3W8FA 4X71A 1GPWB 2R1ZA 2UXCB 1QB8A 2V59A 1Z0AA 2AMJA 4DDWA 5AVTA 1G4UR 1G6OA 1T9DA 2IY7A 2PMCA 1N2CA 2QQGA 1L4UA 1N7IA 3C3KA 5K0TA 4ZU6X 5JS8A 2CD9A 4C78A 3W6PA 3QBVA 2NW6A 3CMCO 3P2EA 2ZRGA 3AOEC 2JFYA 1FP4A 2X1HA 4RE6A 3IP9A 3E3LA 2BSXA 3WGUA 4JI8B 1EIWA 4GMFA 4BGEA 2BE5D 4MYSA 1T8WA 1XEXA 2I7VA 5D7NA 2R8YA 3JWIA 3SYNA 3U7QB 3AV0B 3ICPA 5E6SB 3KO8A 1WXQA 4LXYA 4RVOA 4UOQA 5FEMA 2WHEA 3GJRA 1N5JA 1U02A 1PT7A 2QPOA 3D5QA 3N8KA 4NI5A 3EEOA 1CQJB 2YOFA 1GZ5A 3EAQA 3Q7SA 3RTCA 1YR2A 3KVRA 3V1UA 2JJ1D 1IWOA 4ILKA 3P9XA 5JMPA 4ER3A 2DP4E 2J07A 1MN6A 5AW9A 4FEYA 1Q6YA 3FFBA 4ZZIA 1XE3A 1H8ED 4YLYA 1PVOA 1J2UA 2TMGA 2V7XA 1UODA 4JIMA 4J3NA 3ZVLA 4M76B 2XUPA 4X44A 4DZTA 4XD2A 5AWFC 4EFDA 1HO3A 3UCEA 1O97C 2JIOA 4AX4A 3QMPA 2IS1A 4MSUA 1K4TA 4UOEA 3Q10A 4M88A 3VTZA 3P2YA 1YCHA 3GAFA 4XDHA 1P18A 4Q1VA 5LD2C 5E2IA 3KYCB 3ND6A 1GLNA 2D4HA 1Z2CA 2J85A 3EYWA 3ODPA 3WAKA 1Y8QA 3P9QA 4KHZA 4PZZA 1F0PA 1EZ1A 4EP1A 1UT5A 5HR5A 2XXBA 1W59A 4UCWA 5IEBA 1HL3A 3OCVA 5FDFA 1OJLA 2IIVA 2O8CB 1NXTA 1Z5PA 2C99A 4L3WA 5AW0A 5KDOA 2XVZA 1GCOA 2HL6A 3GIWA 5C7IO 3TPCA 3D5EA 3UHAA 1OT3A 1FDRA 3HMQA 4YAOA 3KLNA 1HURA 3QVMA 3ZN2A 1BWQA 3OVMA 5AT1A 2GCOA 2IKQA 1DX6A 1O7JA 4OHUA 2J3LA 1O4WA 2MIIA 2V9PA 1Z18A 2G8NA 2PZ8A 3TQCA 4Q9LA 2P9FA 2D4AA 3RAPR 3UJAA 3RS7A 2BFPA 4QRHA 2IXEA 1SHTX 1HTBA 5EZYF 4J0HA 1RI4A 2EBHX 2WSSA 4U6NA 5DYYA 1ISRA 4BNZA 2W6QA 4ZOLB 3CNLA 3MCAA 2W6JD 3BE6A 1U3CA 3BS4A 1SCIA 4IIUA 1XZMA 4P58A 1OJ7A 3IP7A 3ZEAA 4C4XA 4BEWA 3FNBA 5FA5A 1YIDA 2P2DA 3CINA 1HE8B 4IUCS 4JH0A 3HE3A 3ES9A 4G67A 3K0BA 3HXMA 2ILVA 2GEFA 1ZD1A 1QF6A 4LXIA 1P45A 1DNPA 2QVGA 2RGNA 3KLOA 4EMTA 4X62B 1BMFA 4JJAA 3IJRA 1FRQA 1N3YA 2Y0DA 1G8JA 3DBHA 2HU5A 4R8SA 1RRJA 5DGIA 1KK2A 1NM5A 2HLNA 2P91A 1WSDA 4WNAA 3V8MA 3GGGA 1NBMD 1BDHA 2L69A 4UD2A 4R8LA 2P2YA 4Z4HA 1N34B 4FK8A 5DBIA 3DOEA 2P5SA 4PAMA 2O3TA 1E4VA 2TSYB 1CU1A 4IIJF 4D6XA 3K09A 4UHCA 4R2LA 5CAEA 2NAFA 1Q7CA 1FF9A 2QLBA 1WZ2A 4H2DA 1N1MA 2BR4A 4HAYA 1ZD8A 1BJKA 2ZJ6A 4L9RA 4RKWA 3RBAA 3UBMA 4D98A 4ZJZA 1LDBA 4B74A 2VJOA 2GXSA 8ATCA 4DNFA 2DX7A 2PVPA 2X8BA 1U5CA 4R2JA 3DYBA 3U31A 3WA7A 2YH2A 3PXCX 1V16A 3HBFA 3IEVA 2AIRA 2R7LA 3KOZA 1LI7A 2I66A 1H6CA 1DXQA 1FC0A 3TZEA 4AY5A 5IKEA 1E2LA 1OAOA 4UZFA 2FPGB 2E37A 3MTQA 4P8RA 5EXDA 4RMJA 3TBHA 2UUAB 5BN5B 2ZVQX 3TRKA 4L15A 3GJ4A 2QXYA 3KUKA 4QDOA 2JAXA 1PEKE 4XH9B 1TWGA 3DZCA 2MMGA 3IRUA 2XXAB 4XYMA 4YJ3A 2YJ6A 5JTUA 3QHQA 3AM4A 4AKHA 1U0TA 1VP3A 4OKSA 1KP3A 2XKAA 1R6VA 2X2FA 3EY9A 3GDHA 1NP3A 4RZSA 2XZDA 3ND8A 4JJIA 2PLNA 3H2ZA 4AF8A 4G1BA 4DS3A 4K8OA 3THXA 3U62A 4HG2A 3WL7A 3LG2A 4JL6A 1TF7A 3BCHA 2JI8A 2CLDX 1ZCFA 3H2YA 1PFVA 4JZKA 5IARA 1CZLA 2IBMA 4J9UE 1YFJA 1QDLB 3L6CA 2JAQA 2A4KA 2OGZA 2AGVA 4PICA 4UM5A 1C4KA 4RPGA 5KDLA 2G63A 1MOQA 3FCXA 3ITKA 3FCAA 3RTEA 4C07A 1FQKA 4P7KA 4DM4A 1IDN1 3IAS6 3PHJA 1SXPA 2ZRLA 2YNMC 1H8EA 1HT2E 1ANKA 1TAHA 4OXRA 3T9AA 3FWPA 4BWFB 4WN3A 2WT9A 5C4MA 4D9HA 1T1EA 1I3LA 1I6LA 1P5JA 1E2FA 2L19A 3C98A 3FY4A 3I0ZA 4R3WA 2RH4A 4R1QA 4D46A 4TVSA 1JDBC 1OFHA 4PF1A 4TUYA 1W4AA 1SRRA 2EZ8A 2QN8A 3MTIA 3IQEA 3VI3B 5FJIA 5FV4A 1Z5NA 3V4VB 2AVDA 2PVSA 5SV2A 4NS4A 3N0WA 5LMCA 4U3JB 5TGZA 3S1AA 1Q91A 2LD4A 1NVVR 4F2PA 5HILA 4EPRA 4DGQA 4KH0A 1DAIA 1W5SA 4V38A 2XMZA 2D2FA 3P9SA 4M0EA 3OEWA 4E46A 1RAAA 1SA0B 3L4BA 2I2DA 4HNHA 1U3GA 4LQCA 3M7IA 3D8BA 2AF3C 3DC7A 3GCZA 3HKDB 1EX1A 1JHUA 4JI4B 3SF0A 4Z4CA 5UKDA 4Y2RA 3L6EA 1P1JA 3T7JA 5KYUB 1VJ5A 4KU4A 1LS1A 3UAZA 3LD9A 3IHKA 4X24A 1ORIA 4NAUA 5EJEA 2QRPA 3L4BC 3ZBQA 3SQLA 5KYYA 1FP1D 1JG7A 2X1LA 5J47A 1LCIA 4D42A 5LLDA 7GPBA 1GYQA 1WD7A 2Z30A 3WXMA 3ECSA 4YVFA 3Q7RA 1H65A 4DDTA 2C84A 4BMPB 3GJ6A 4W5RA 1RLUA 3PNOA 4MQFA 1S8FA 3I45A 4BO4A 1K08A 4PFKA 3L7IA 4Q19A 4B7CA 1DEHA 3U80A 5AVXA 1XJQA 1DT5A 1NWHA 4DJAA 4JD5A 3DCIA 5E4FA 4BLTA 3FDXA 3GU3A 4PCLA 3ROEA 3RARA 4JWKA 1JQEA 4M9ZA 1T15A 3HCCA 5HHTA 3P9PA 3S5UA 5E95A 1E2BA 3DFUA 1JSXA 1G98A 2X4GA 1Q16A 2GXUA 3H8SA 4ZCTA 5JZOA 3LC1O 4LZZA 4D3DA 3N75A 4NDAA 3AF0A 5BW4A 4OM7A 2H52A 2ZJ8A 1AN9A 4L16A 4NYJR 4QGHA 3OU6A 1J8VA 3TUJC 5AVWA 4PLPA 3O4GA 2ROQA 2HHCA 1BCRB 3DSRA 4DBZA 5LNK6 1S8OA 5BSRA 1L7OA 4XQ0A 3RK0A 3SMQA 3AYXB 4LRQA 3IIEA 1FFSA 1Z5VA 5HGXA 3KJZA 4JOBA 3TLEA 2YJGA 4IYJA 4ZOLF 1KU6A 1O58A 2JGLA 3JAMA 4DV3B 2K4MA 4RK5A 2FWAA 1NJ1A 1SKBA 1QYDA 3H4MA 4Q5VA 4BDSA 1E5DA 4WBNB 3QXJA 3F3MA 4FUTA 4IGAA 2AQIA 2BMFA 1SCAA 3BH7A 4MLDA 5TQ2B 4INAA 4XQCA 5GV7A 4N41A 3EYAA 4IDDA 2CHUA 4ND8A 1TVKB 1ZI6A 1XB2A 4FFLA 4ZZ1A 3PPWA 4WY2A 1THGA 2BGRA 4CR6A 1W36B 2HT1A 2YS7A 1MAVA 3EZGA 3O3CA 3AG6A 4YMSA 4L8IA 1NURA 2Q46A 3R7NA 5HKAA 2QKYA 2G5GX 3GJXC 2DFTA 3A28A 4H1TA 5TRTA 4CQLB 3NEPX 2CL0X 3PHCA 3ZGXA 2B98A 3D3WA 5GZ1A 3A6LA 3QHPA 2NT4A 2P4HX 2H7XA 3G82C 3WO0A 3DZJA 2PSEA 4QDKA 3QJGA 4B40A 3WKEA 2P68A 3PNQA 1NOIA 5F73A 2ANCA 3V1NA 4D26A 1EK5A 1ZH8A 3KUDA 2WAQA 4QUIA 1OX4B 4N3NA 2QK4A 3KFXA 5KNDA 2CNOA 3DP9A 3IEUA 2CVFA 3BCRA 5BXYA 1KSFX 2VOEA 3A1VA 1INLA 1IOWA 1FXUA 3ELWA 3IXMA 3A2NA 1VMKA 3QW4B 4FYXA 3JQAD 3RT7A 4B46A 3G9TA 1CNMA 1QWOA 3RI3A 1IYZA 4LTNA 1CVIA 4ZRDA 3M2PA 3PDUA 3ORFA 4J03A 4R0MA 5F7JA 5LP1A 1NI5A 2LBPA 3AESB 2EIHA 4QBFA 1JQBA 3SVZA 1FMTA 3GN2A 4FFNA 2I62A 2JI4A 1NHWA 3H0KA 5SZJA 4B31A 5K0JA 1A7KA 3OIWA 5B4UA 3FETA 3AIMA 5HBGA 1TTHA 4R69A 4WOJA 1UBFA 5I3ZA 3ZDAA 3WLKX 2HCFA 1RZ3A 4Q12A 5LZ9A 4LOHA 1Z45A 1C9NA 3CBGA 4BXOA 4KQHA 2JJYA 3DE0X 3U3JA 4C6TB 1G7SA 5HIKA 5A3SA 1IULA 1ZSYA 3B5EA 4TPKA 1M5RA 4YRNA 4URFA 5BURA 2O2IA 4IFTA 5I9IA 4MVCA 2H07A 3T7RA 3PYLA 3T1YB 1U2TA 2PWZA 2EXXA 2PZMA 3EULA 3FFWA 3MHPA 3PLNA 4DV0B 4R2HA 4KXVA 3BTOA 3CX8A 4IIHA 1ONPA 4B80A 4TMTA 4HGOA 5BORA 4KAXA 3EIQA 3CKYA 3GNQA 1JU4A 2HJHA 3HU3A 4L4XA 3INNA 3AHCA 3O2NA 2A9PA 1JDNA 1UUFA 4RYLA 3ZH2A 1JHMA 3M0EA 1NJ2A 2ZANA 3EQ9A 5A6SA 3B52X 2P4UA 3OC6A 4TLAA 3NORA 2IUEA 2ZRAA 5B57C 1W0JA 4F86A 2CHEA 3TX2A 2AI2A 2E89A 2JH8A 1JAXA 2G0TA 2X3FA 4HB3A 1G63A 3MBOA 4OBEA 1PGQA 3OJWA 2Z8ZA 5D5PA 3SIPA 2WU8A 3V8VA 2PJUA 3VU0A 5C1BA 5IXSA 1FJXA 4UVGA 2OO5A 4OQMA 2UYOA 5LWQA 3N8GA 1F0YA 2W43A 1XEAA 4EY3A 1IRIA 1CR6A 3IEMA 2BFCB 2VPQA 1JW9B 1P75A 1J90A 3LM8A 1KYXA 4A0GA 2FR8C 1ECBA 5K3CA 3QXCA 1DRJA 3EMVA 1EM8B 3PGJA 4QHTA 4YNBA 4HLQB 2ZRNA 4E15A 3UWSA 1MQSA 3KT6A 4RV9A 1GM5A 2G0NA 5SY9A 4XSGA 1KYQA 4ZCLA 3C14C 1VKNA 3E84A 1AD2A 4MP6A 2NUPA 2QD5A 1GTRA 3TVTA 2PS3A 3OM0A 2QTHA 1J1IA 1R4MB 4PX5A 5H3LA 4BPBA 3HR7A 4R3UC 1P1CA 3UHFA 4UHHA 1WBDA 1VL8A 3GBVA 5AJZA 4Y6GB 2O8EB 2H2IA 1U0LA 4YRDA 2VPZA 3B60A 3FNFA 5AM2A 5AFSA 3PQ6A 3TEFA 1CV2A 1I4WA 1Z0FA 3GLQA 4BLVA 4OI0A 3K4HA 3GBPA 4HAWA 4GKKB 2W2VA 1U6JA 2Q28A 2I33A 3HB0A 1JV2B 3PQ5A 4FR2A 4L2IB 3AUJB 1FJ2A 4I7EA 5EHIA 1SURA 4EITA 3C6ZA 3I92A 1LTQA 3FWNA 1U0SY 4L8LA 5KVVA 3PC3A 3A6DA 3G8CA 5TPWA 4D9JA 3C85A 1T0PA 1RRCA 1O3YA 1MOZA 1KYIA 3G5AA 2I1LA 4PQYA 3X1DA 1N8NA 4GZ3A 2OV2A 4XRGA 4RTNA 5KTMA 2WMYA 3F3SA 4KWEA 2OB1A 4O6VA 1YR7A 3FSRA 1ULUA 3A9WA 2P4SA 1KQ3A 4ITUA 3RF6A 3PKZA 4GQBA 3R3XA 3KQKA 3P5BA 1ND5A 1ZRMA 2CNDA 4GZMA 2EFYA 5BWBA 1E7MA 1QUFA 4MGHA 3QQ5A 4REQA 7AT1A 1RLIA 1DIOB 2WFLA 3AVQA 3ZHRA 5JY1A 2QYSA 4LWZA 4M98A 4MMXB 3PD7A 4ZYYA 5DZSA 5EIBD 1DIGA 1J06A 1C7IA 1T9HA 1IK4A 1MDFA 4EQZA 2CUKA 2ESRA 2C5AA 3C5WP 2OGTA 2X7JA 5CU7A 3TL2A 1UJ6A 2IPMA 2HMYB 3QGMA 1N0HA 3DCJA 4CT0A 5KNDD 1J5PA 1N36B 1QE0A 1O6CA 3CN7A 3FCCA 3L41A 3LQFA 4CM7A 2HDWA 3K8QA 3X2FA 2FZCA 4WNIA 2CYCA 1ZAKA 3HN6A 4MPDA 2RH5A 3ONFA 2X0KA 3KU4A 1EAYA 5A0VA 2HKIA 4ARIA 2IUYA 3P2MA 4NCKA 4NCIA 3C4QA 4F1JA 4AUNA 3DVAA 1HE4A 1GCGA 2Y1WA 4MW1A 1HDGO 3F78A 2CDRA 1IXRC 1LNSA 4OHKA 2VQ3A 3L3BA 3WGMA 4LOIA 2A0KA 2Y1EA 4RDCA 4XD7D 4Y9RA 4YC7A 2VPYA 3IS3A 4AKSA 3PRYA 4JNKA 4EGCB 1CBUA 2Q8PA 2GBIA 3VKUA 1H8HD 1HZZC 1PWHA 3GRKA 2I4NA 3D02A 3KP1A 4PYKA 3GGJA 1VHLA 1CT9A 4MQFB 4W5QA 4ITRC 1XBTA 2TMYA 3KOXA 3DB1A 2VLBA 4JLUA 4EW1A 4KZKA 3G85A 3AI2A 1MENA 1US8A 3N53A 1NR5A 3PTZA 1GZDA 3DLCA 3VKWA 3D1VA 3QKTA 1R1DA 4ER6A 4IJUA 5DMHA 4RHFA 4BX9A 4Z0TA 4QTTB 5I9TA 5SZIA 3ZKWB 4BFXA 4BX3A 2QQEA 3NLLA 4KREA 3LTEA 2WP8J 1ISMA 3I2GA 3UJPA 2X4IA 4BNDB 4Q6WA 3E5RA 4CMAA 2GZSA 4DDVA 3BXOA 1DBRA 2EKBA 2PNJA 3OF5A 3QUTA 3DWGA 1LJUA 5JSNB 2VPPA 4KR3A 3CSSA 3WRVA 1TI7A 4ZI7A 3WIUA 5KJ6A 3A3OA 2X8WA 2WPDA 5DLEA 1ID1A 2H18A 1M54A 4FXOA 4RTQA 1V41E 1SR8A 2YXNA 3B6ZA 4PZ0A 5ALHA 2X0FA 4JENA 3F47A 5EUBA 5BNWA 3SLKA 1OBVA 3TKAA 3LECA 3SYLA 1XCBA 1U0BB 1JFSA 4LHZA 4RGYA 2WLTA 4TVBA 5H80A 2XMDA 3G89A 1NMSA 3WQQA 4C6TA 5GTDA 4BAZA 3AF6A 3NHLA 1P1HA 3C3JA 2F48A 4C5AA 3QKUA 3O5AA 4CETA 3EVNA 6ABPA 1V8FA 4WKPA 2ILTA 4MVJE 1M2VB 5PGMA 2ZQYA 2F64A 1IN1A 4KO2S 1RWPA 4MR7A 1KZ6A 3K32A 4LCEA 4NCHA 1O0SA 2C4KA 2YV5A 1RQRA 2R68A 3GIDA 4JT2A 5CCEA 2HO5A 4E5NA 1KE1A 5BYAA 4B6SA 3ADCA 3L0IB 3JRWA 1SN7A 3EFBA 1WDLA 3DR5A 3QVLA 5F52A 4WN9B 1JEAA 2RHWA 4QQRA 1EWQA 3MILA 4I1VA 1CETA 3GMSA 2O4UX 5EINA 4A73A 4ZZ0A 3EQ2A 3FMVA 2O1EA 2PX0A 4NFSA 3BH0A 3TLAA 1F3LA 1CUAA 1KDYA 3TR5A 1B14A 4U9HS 3TQOA 1SXIA 2XV1A 2W83A 1C7JA 1KDPA 1EWKA 4D9EA 3HXTA 5COBA 4DUGA 4OOFA 3GLIA 4C4RA 4NECA 4K1XA 5E8RA 2QYHA 1LXCA 5CFZA 1QRRA 4I3GA 2O5JD 1GTG1 1PW7A 1A5TA 1QNLA 4A2PA 3QX3A 4Z8XA 4LXTA 3ZCSA 3RRBA 4NZPA 3X2SA 2VF2A 2IBTA 1E2UA 2PWPA 4V1CA 4AMBA 1KJ8A 2VHUA 2VJMA 2VJDA 2X14A 2YJNA 3IAS1 4MRMB 5IMBA 3VR3A 4B5LA 1PFWA 4D5EA 1FVHA 5LZ8A 4GPZA 4IHAA 3DHYA 1O5IA 5JJ5A 1W36D 4OM8A 3EVTA 2PH3A 2WWYA 1W7AA 4HPWA 1PN3A 1G21E 3WGVA 1VCHA 3PRHA 1B1AA 1V4BA 2XSZD 4BFWA 4WCVA 5HJEA 4FC7A 4LF8B 2P35A 3KIPA 3C39A 3X3HA 3IAM6 4TYYA 2I2AA 3ELYA 2OHGA 3NASA 1XVTA 5D1NA 5G41A 3B9RA 1MEJA 3KDPA 5AJHA 1NBWB 2POCA 2UYGA 3YASA 3GVHA 2RB4A 5FI1B 1FNCA 2GO1A 3AVPA 2XOKA 3R7DA 4B6JA 2W98A 3RBVA 2ZBFA 2R8EA 3CO0S 5EAIA 3UA3A 4UTPA 4L4ZA 1ZM9A 3MPUA 2YDXA 3DMRA 3A25A 2DBZA 3NI2A 1XTJA 4ZYUA 1YTLA 1JHYA 3EASA 4M6WA 1CHNA 3PXAA 5LXTF 1MFZA 3NTUA 4I9NA 4IQFA 4G8BA 4OUDA 4KODA 4E1VA 5F76A 2B34A 2P6OA 5H68A 1FL9A 5AVSA 4EPXA 3PKIA 4C4SA 5B64A 3AF3A 4L7QA 2Q62A 1L4NA 2NTVA 1D8TA 2C7VA 4AN1A 1T4GA 2A1TS 1GYPA 3ZWYA 2GOYA 4L4RA 3EEYA 2H2AA 2QAGC 1HQYE 4OHRA 2CSUA 1LPSA 5GMOA 1K6IA 3CTMA 1VE1A 4QJ4A 2BKXA 1AHIA 4OFBA 2V03A 3JQEA 3RC9A 3NVKI 1B93A 1Z6ZA 3ROTA 3N9IA 4PG4A 3ZCPA 4EUSA 2HMVA 1P33A 1CIVA 3GTPA 1C7QA 3CUWA 3L8FA 3QPAA 1YB2A 4AKTA 1U63A 1D6NA 2AG5A 3L01A 2QZPA 1QTIA 1TWAA 4K40A 4PC2A 4AG6A 4A3SA 3BMNB 5B2ZA 3VX3A 3K5PA 5A4KA 3EDRA 2P6NA 4LOLA 3HB4X 4F96A 4YMLA 2FQYA 2VF5X 4KEAA 1QAOA 3L77A 4ZVUA 1WY5A 1R7RA 4MIKA 5B1IA 3ZGLA 3GTKA 1COZA 2VHQA 3BFXA 1K06A 2IGBA 2X9NA 3HVIA 4H9GA 5KX5A 3MGAA 3JAKB 1UJ4A 1RKUA 3ONWA 3NEYA 1RWBA 2C7OA 3N2ZB 4KLAA 5CVDA 4E03A 2P75A 5CH3A 3HBMA 4DXAA 3JQ7B 1VHDA 2FSUA 2RBEA 3C15C 3CE9A 3IVAA 4JBLA 1U90A 2C4VA 2F3SA 3V00A 4F8EA 5M29A 2HEGA 2WT4A 1Z34A 3OUZA 3PC8C 4G23A 1WJGA 4KGVA 4OK3A 3FUUA 3O1JC 2R8XA 5MGNA 4L7VA 1T3GA 2WM3A 3EVEA 5LNK1 3S1AB 5CX4A 5CVTA 4WXEA 2VTEA 1ZDMA 4FM9A 2V3CC 2X42A 1TCVA 1B73A 2H0AA 2M6SA 4Y2VA 2GZHA 1R5NA 2D2IA 1KKUA 2P65A 1REQA 4XWOA 2I91A 3AYZB 4NENB 1T35A 1ZGZA 4TUYB 3KTDA 3CX4A 3ZWQA 4BNKA 3ST7A 4CKBB 4BQFA 3LPMA 3BX1A 1QRUA 1VCNA 3K2BA 4BO3A 2OAP1 4P5DA 1A8SA 1E9AA 4QREA 4JJ7A 1DRKA 4PPYA 1X9IA 5K3DA 4PPNA 3B8HA 4QFBA 3PLRA 1ZM2A 2CLFB 3PWKA 1UMCB 4KDRA 1QZ3A 2XGOA 1QLJA 3OCUA 3KHTA 2C8VA 1DBIA 1NYTA 2ZK7A 1U5BA 3MPOA 2BMVA 5ED0A 2PSSA 1YWGO 3OG9A 3QVXA 4YONB 3V42A 4CIAA 1P1IA 3I01M 4IGFA 1MJGM 2CYAA 4N0PA 4DQKA 3QZUA 3WQBA 5J58A 3E4DA 4KMRA 1DZ3A 4YREA 4NBTA 4UMEA 5E0OA 2JJ2D 4YS6A 3GLGB 2V6GA 5AW7A 1SC1A 2AUTA 1KS2A 2EV9A 3QENA 3WGOA 4A5SA 5JT1A 5AOCA 3UGTA 3JV7A 4QE3A 1JXMA 3MMSA 3E6AA 3P5SA 4YXWA 1ZGAA 2CW0D 1DADA 1EINA 2PXHA 2Q27A 3ILHA 2C07A 1KDVA 3WV4A 2GHQA 2OOSA 1I33A 5B3KA 2OVBA 1MJGA 1W0KD 2PUAA 2IYOA 1E0SA 2WYWA 1DE0A 2XITA 2FWMX 3CH5A 4PLHA 1Z08A 1BA2A 2Q9AA 4BO5A 5JXIA 5C53B 2J9RA 4N82A 2QY9A 3ANYB 2IIBA 4J3FA 4ENTA 2AFIE 2R00A 4G4SP 4TWBA 1BEZA 4HGRA 2B2CA 4HO1X 4Q7JB 2VBGA 2NUAA 2JHFA 4F3EA 2O2HA 4CKXA 4XWWA 1JIQA 4B4WA 2V55B 2A5YB 1V48A 4ONEA 5CGQB 3ZDYB 5DBFA 1N0VC 3BHMA 5B2EA 1BDIA 2JA5A 5EKSA 1HLGA 1TKCA 1LW7A 2WVGA 4MEBA 4OP3A 5KYTA 3UKDA 2G9UA 1SC4A 2HWUA 5F64A 2LCIA 3LWNA 1XRMA 3GO4A 3LLVA 2VRCD 3G2QA 4YHHB 2C3YA 4NCNA 3FYHA 1HE5A 4TYQA 1EG7A 2F8SA 3VPXA 2G88A 4LV5B 5D6OA 2Z6UA 4F4FA 2P62A 3EFHA 4DRYA 1IHPA 2VP0A 2J3DA 1AQ6A 3OZIA 1V2GA 5GY7A 4O1IA 1FFBA 3ABZA 4PHHA 4GRDA 5DE3A 3I5YA 1I6MA 3W4IA 2C4WA 3GT0A 5EKUA 3OJLA 3Q15C 3NIBA 1E7WA 3HKCA 4WWHA 2QTWB 4GWLA 3QKSB 2C98A 4GZ5A 4LNHA 1NX9A 3HCFA 3ZLJA 2A14A 1WSWA 4CIWA 4DDUA 3DHWC 2FG7C 4QGSA 4DB4A 4OU4A 1QP7A 1G6Q1 1M8JA 4Y6QA 1RJFA 3PNLA 5AK5A 3CEHA 4UHEA 1UDWA 1TYAE 4LE0A 3OQMA 5JAMA 1A76A 3I2JA 4NG5A 1X8LA 4WCDA 1EAMA 1GT91 4R81A 4BLUA 3PDWA 1M6EX 1C0KA 2C9OA 4IAOA 4Y1GA 2OFFA 2GZ1A 3WWZA 3HGQA 4BC0A 1AMOA 1C9YA 3FKSD 2A9RA 1T91A 2P9JA 5JQGA 1W47A 4JR0A 2H9YA 3QEMB 4W5WA 2CVPA 3ETJA 3AFNA 1N2CE 3D8NA 5B58T 4FIZA 4F97A 5KCZA 1XZBA 2W6ID 3LUBA 3HNOA 4L4YA 2AKAB 2QIPA 3DTVB 1X86B 3L8DA 4M0FA 2HGZA 4MUIA 4H60A 3JQBA 2IYUA 4MZXA 3RSZA 3FROA 4MS1B 3AU8A 1QMPA 3KXLA 3HDVA 1J9GA 4NU8X 1IN4A 1OQAA 4E4TA 5KTRA 3SM3A 3CPHA 4BYGA 1P1FA 1QGZA 2R1TA 7MHTA 1DHRA 1FQJA 3ZGVA 3EG9B 4RV5A 3I2IA 1JEYA 1KHHA 1E1QA 4KP7A 4OSPA 4KB4A 4M8SA 3HM2A 3VR0A 3ZIDA 4D45A 3U6KA 3WWOA 1C4WA 3I8OA 1NBMA 4ZV4A 3B53X 1Q57A 1X9GA 1Y1KE 3L49A 2BKEA 4G9BA 4IIDA 4MGYR 3QYJA 4QC2A 4QTUB 4RFVA 1AQJA 1I2AA 5DSTA 3LT2A 2QUIA 5C1PA 3T12A 3W05A 3BXGA 3D0QA 3PX2A 4LEIA 4Q39A 1UWLA 2ZIVB 4YRLA 1FMCA 1HYEA 1NAHA 1M76A 4R9UC 2VZLA 3AR5A 2Z1MA 4FEAA 3T34A 5LZ5A 4UEJA 3BICA 2ZUCA 5EJ6A 3QIAA 5IAKA 1NZDA 2IYFA 3T06B 5TMBA 4EG1A 4LZLA 4DMGA 2GDJA 4M1MA 4OHZA 3FKQA 2BN4A 1FRVA 2E4AA 1OPXA 3KB1A 3TLXA 4HDCA 4HUQB 1TXGA 5A4JA 2E1PA 3IEIA 4AY6A 4XA8A 5CFNA 2VIIA 1U99A 4KOAA 1VPVA 4I08A 3A7DA 2H11A 4DBVO 4FKMA 4OEHA 3FHCB 4RF3A 4TUYF 4BECA 2R6DA 2ZBDA 4QPPA 1EWYA 2CUNA 4P31A 2UUOA 2WWWA 4MO2A 2W4QA 1SKQA 1G7TA 2R25B 3OE4A 4D9BA 2JRCA 3QA3E 3VPGA 3WLRA 3TQTA 4JC0A 4KC6A 1ADYA 2ZYWX 4URZR 821PA 1I4EB 4X54A 2ZBRA 3DONA 5HCIA 1WW2A 2Q5HA 1Y4DE 3L06A 5JH7A 3HJBA 2WUGA 2GBPA 1ZD3A 1OTXA 1PLJA 1QG6A 3A37A 3OCWA 9ATCA 1Q7RA 1T8UA 3KBBA 3MB5A 3R5KA 4ED9A 5FUYA 1U2ZA 4O1MA 1NI4A 3ZYCA 3H05A 4M2LA 5GIOE 3RC2A 2SICE 4YACA 1M1YB 3PFWO 4P86A 5EWMA 3VJLA 4F9FA 5A02A 4DA6A 1MT0A 5KC9A 3M4ZA 3LTNC 4CFSA 3P96A 2FW8A 3DUWA 1YJXA 2QX6A 2CWDA 4FCCA 5K3EA 3HO8A 4ZTUB 2X13A 3ASUA 4YK7A 3CT6A 1OD6A 1G18A 3GLRA 5ETJA 4ZAWA 2BDEA 3QUCA 1SBZA 1DBPA 2J5XA 1YIAA 3B9QA 4CLRA 4FBLA 3PUZA 4PHTA 3OFNA 1XL1A 3VOSA 4YX9A 3L7LA 4JLJA 1R0WA 121PA 5BXQC 4OLAA 1LK7A 3RKUA 1EFTA 1YF3A 2FE4A 1MQ8B 1QX4A 2RHDA 5GJWC 2ZBEA 1Y8AA 1RYZA 1QQ7A 3KK0A 3S1LA 3TOXA 2XF2A 5BRAA 1LD3A 4F21A 4X1IA 1SEUA 2WFLB 2JGDB 3K8ZA 1R10A 3DCYA 2Q1WA 3DMDA 1OCEA 2INGX 4ROTA 1S4QA 4DJDC 2XDYA 3KZMA 1DV1A 3OHPA 1Y81A 2QMUA 3LUPA 4B76A 3CX7A 1ABBA 1WR8A 3CX6A 4P9NA 4TSFA 3PQCA 1ZC3A 4KIGA 5IW8A 2HCRA 1Z82A 5FR1A 4BV9A 3LL7A 4XB6B 1EUQA 2XZTA 1P81A 1VG1A 5EJ8A 3EIHA 3KT0A 5J63A 4I2VA 4DUGD 5T6MA 2OPBA 3ZE0B 3QX8A 2H1OA 4L73A 3V8RA 2E3JA 4RDHA 4FFMA 3QE0A 5K0ZA 2JCSA 3SE0A 3DEYX 2DLDA 4IHJF 1ZCZA 2NQ2C 3RVPA 3A2KA 3FUCA 4XCXA 1P2VA 1CKEA 1GQRA 3KV3O 4LDRA 5TVKA 2C9YA 4YT8A 4QGAA 4D96A 3W8DA 1V2HE 2QWXA 1PJRA 4NATA 4QARA 4BJ1A 4R9SA 5DHQA 2IITA 1WQ1R 1GFSA 3CKKA 3QKIA 4DR3B 1N2BA 3W79A 1ZVKA 3DEFA 3MJEA 4TV8A 3ZQ6A 5JJLA 1IB6A 2QUKA 2ZUVA 1Y1WA 4GI3A 2H17A 4U2DA 5CW1A 3G1UA 4B82A 4EECA 2WV9A 2CJFA 5K6AC 1YI0A 2RJOA 3WDKA 3WQRA 5AVRA 1RU3A 1U2SA 3IUPA 4K9QA 4PE5B 4M1SA 5JMWA 1ZI9A 3FMFA 3MT7A 4ZQBA 2DUWA 3F6SA 1XWFA 2GSWA 2Z2JA 3G8BA 1JKJB 3O8BA 4HQ6A 3QBJA 2G5TA 2YV1A 4S1OA 1MTZA 3C4JA 4NEGA 1NNLA 4UBJA 4YWJA 3P0HA 1SBNE 3HHEA 2I65A 4LMPA 3PC6A 4ZU1X 2JGIA 3PKJA 1JDJA 1TX4B 3T7AA 3QMWA 1R15A 2ZT7A 1RAFA 3AY6A 5EXTA 4DBLE 3GAMA 2VQSA 2XGJA 3A6JA 4DCMA 1QORA 3DR3A 5CLIA 1ENZA 3EQ6A 4EQ6B 2QTBA 2GCOB 3FM9A 3WLNA 2PBLA 2TMKA 3LFUA 4R1SA 4FGSA 4IKPA 3BXFA 3TXXA 1BVYF 2GF0A 4W7SA 1H42A 3H9UA 4BTEA 2NUBA 2FQ1A 2X0NA 5FFFA 3HKDA 2O8CA 1XTVA 4QGFA 1TD9A 4DPLA 5TQ2A 2GD1O 2RGXA 2I3BA 3U3ZA 3WNBA 1BHO1 3CO5A 3WGYA 1GL9B 2XYPA 3G0HA 1Z0KA 1G20A 2EF1A 2O19A 3FZNA 5EMLA 2WFZA 4IOMA 4MARA 4CMJA 3Q11A 4ZAZA 1IY9A 3OZAA 3LKBA 4XX0A 2C95A 2FRXA 4QFMA 4PS1A 3P9AA 3RYIA 1AUPA 1JSRA 1P0PA 3OZGA 5DSXA 3TUIC 2HY7A 3LV8A 3A6EA 1TTTA 1KIMA 2I0FA 3BZBA 5IK2A 4MIEA 1A9SA 1FP4B 1ONBA 1ZK4A 2GI4A 2YKGA 4JI0B 1AH2A 4P7BA 2REBA 2RGBA 1Z2PX 4WK4B 3ZWXA 4FS3A 3RJTA 1PFGA 3BGWA 1X9HA 1F8GA 2ZBGA 3GFTA 5AKHA 1JFTA 4QHYA 4X9XA 2PT9A 4HK4A 5BUZA 2BKLA 3GJTA 3FRHA 2Q1TA 2ATVA 4XWYA 3W9UA 4K9MA 4ZCRA 4F3YA 2DC1A 5DWDA 1KRWA 2DMRA 2GNAA 3RKSA 4LHVA 4MWGA 2JL1A 2WJ6A 3D2CA 5GONF 2P67A 3MRTA 3WAGA 1ZJ4A 2W48A 1RM5A 4JFRA 1DO2A 2QT1A 3NFYA 3HU5A 4KX5A 4TM7A 5AVVA 4PZUA 1SFRA 1PR9A 1JI3A 5EZYA 2UVQA 4B43A 2ZGVA 2XWJI 4MXDA 4BE9A 2XB6A 1YZHA 2I34A 2V7TA 2ZI7A 1FCJA 3ORSA 1CNEA 4RPIA 4XPIB 2UZ1A 1WVIA 1KJYA 4EYQA 1F8FA 4BV2A 1LVHA 2QRVA 3DVRX 4LOJA 4EDHA 2BFEA 2XKBA 4HWKA 3ET4A 4N8DA 3FNHA 1S3IA 5C8YA 3VSDA 1J0XO 3M70A 5DM4A 3NHBA 3OZ7A 1U2PA 4LDAA 5TT1A 2YWBA 4O26A 3BRQA 1ULAA 3MW8A 2KYRA 1PJ3A 1PJCA 3JALB 3LH5A 2W0SA 4UUMA 4XW2A 3IDZA 1GKIA 4UEKA 4RK6A 4PLZA 3DMGA 2VDQB 2GZMA 3WMRA 5A1JA 4DM3A 3H6KA 1QC5A 1PL8A 2AFHB 1PYGA 2CZGA 4UTXA 3HUFA 2RD2A 2QN9A 1M0TA 3EXIA 3LYUA 1V8PA 3HRKA 1KZYC 5DX0A 4WBSA 3INRA 4L8FA 1QFMA 4LZJA 4OHVA 1EUCA 2M6RA 4HJXA 1Z8DA 4X1KA 5DXAA 3RV4A 5A4IS 1CEYA 1TM3E 5FUVA 4MUXA 1IXYA 3P71T 4ACAA 2YWGA 4QO7A 3IQFA 1TCUA 3K6KA 4ZP1A 5ALNA 3ZV7A 1FIUA 1HT3A 1M5TA 2XH8A 4PSKA 1ZX1A 4IR7A 5EKTA 4HAXA 3H8JA 3VJMA 3IBGA 1Z74A 1LVGA 2CL7X 1G21A 1UBLS 1ZSNA 3U44B 5BOSB 3IAUA 3ZHTA 4HNTA 4FDVA 2RCNA 3T41A 3SX0A 4G5XA 4YMIA 3D6NB 4AB1A 2I3ZA 3T5TA 4ON9A 1BNCA 2ZB8A 3EMDA 2HSEA 2AS0A 3H5OA 3AR9A 3UENA 2V9CA 3K0EA 4C7VA 3BMQA 2AL7A 4G41A 1JDBB 3G88A 3GJYA 4RWZA 3HI4A 1IBKB 3GUVA 1HR0B 2FN8A 5JXWA 4ND7A 4UAGA 3QF7A 4GPBA 3C7AA 2XT9A 2Q50A 3PJEA 3K94A 3L46A 1J4AA 1P3Y1 3LPLA 5D1HA 2MR5A 4LRTB 4XTCS 1FXSA 4I5GA 2XEXA 3TXAA 1H4SA 1F5NA 5ALPA 2COKA 5IJ9A 3A14A 4HYQA 3T1QA 1VPLA 2F3TA 1F2TA 1OZHA 1M10A 5C8DA 3F8WA 1NN0A 3BK1A 3BA6A 1WM1A 3TSYA 5HOEA 1M72A 4WZBB 1EESA 4HXFB 2JFNA 3VSEA 2LKCA 4UUQA 1NVWQ 1UEXC 1NVGA 2GAIA 3QU2A 4AULA 1SUDA 1T9AA 1SB8A 1ZD9A 3F9RA 2VTVA 3QTTA 2QB5A 4UMDA 3WJ7A 1Y7PA 4PINA 3MZ0A 3WMEA 2CXHA 1TIBA 1E6CA 2FPUA 1UWKA 1A5AB 3RSFA 3TS1A 3FTFA 2QRKA 1X1CA 1RS0A 3ZHUA 4Z7OB 2O8VA 5TNXA 5CLFA 4DA7A 2P69A 1FTQA 1P5RA 1P29A 2AMFA 2WD7A 4O29A 1YIOA 4Y9SA 2JZCA 2A5GA 3DM9B 3IMCA 2LIVA 4JSYA 1IATA 1QHIA 4GLBA 4MUGA 5KS2A 5A06A 4WGFA 4GOJA 2HM7A 1GO2A 1CNFA 3DE7X 3RDPA 3PPIA 4AJOA 1QRSA 3QQPA 3ZU5A 2ADMA 2VJKA 3ZWKA 2EERA 3AKCA 1WVGA 2JAWA 4M87A 2HNAA 4MVJI 2XRYA 2YVQA 2BI4A 3OU7A 3QXSA 1OASA 4FD3A 3ACBA 1B74A 4CG0A 2DOKA 1NUSA 3UK6A 3JYOA 1T9GS 2F59A 4KFCA 4GOOD 3CJTA 2C1XA 4FYYA 4QOSA 1GEEA 1O95D 2R2AA 2WIAA 4F2WA 1DTEA 1NT4A 1RCTE 1R8YA 1VKRA 2EYUA 1V1JA 2R7NA 3ZUGA 5EP3A 3JQAA 3DMHA 2VQDA 4BVFA 3IP5A 2V7UA 1SVOA 3ND9A 3ZCVA 3B78A 3ICCA 3OHMA 2HFKA 1T34A 5DN9A 4D4LA 4ZIRA 5AK3A 4OXQA 2HA2A 4DMMA 5HBRA 5A4DA 3O3MB 4X60A 1MG0A 3E53A 3D81A 2UKDA 3EPHA 3KOYA 1P77A 4UHDA 1SHUX 4XM2A 3ZNPA 1GJRA 2QT9A 4ETWA 3E9ZA 3MINA 3RYCA 3HC7A 1GTSA 2X0DA 4QFCA 4FSHA 4PYQA 1XPUA 4NYMR 3AM3A 5PNTA 3RYFB 3ZOKA 1D8AA 3IT1A 3E7FA 4BQSA 2Y92A 1EDOA 2C0QA 2HFJA 4MV3A 4PLVA 4XUDA 2VZEA 1LSOA 2QJOA 3R7WA 1O5TA 2JGMA 1VLLA 1DKLA 1RVV1 4EHFA 1VPDA 2P2SA 1ISPA 2WDZA 1JU3A 1XYGA 4NNPA 3G0DA 2AC2A 1FRNA 3RODA 2A9FA 2FZKA 1UZAA 3C48A 3E81A 3EXFB 4GR4A 4BP3A 5K5EA 1FS6A 1C41A 1TZCA 1DXOA 2QM7A 4H18A 4ZT4A 2CLKB 3KB6A 1SHJA 2JFZA 3LCUA 3KJGA 3DFKA 3JAWB 2ZUBA 1SXJC 4YUVA 3WYAA 2BRUC 2ECKA 1C7RA 4A6DA 4ERXA 2R8OA 2BAGA 4IO0A 2G36A 2MTBA 2FWBA 1MO5A 3WDMA 1RMQA 5C7LO 2C4NA 4AX8A 4L5AA 5F2EA 4CLOB 4QLOA 5AKEA 2WB1A 5CDSA 2VK2A 1QIFA 1KO4A 5TB5A 5TF4A 4RPHA 1O96A 3VH1A 2AOUB 1U65A 1VIYA 2JIRA 1NXXA 1UBTS 4ADSG 1BU5A 2VTDA 3UW1A 4TL6A 4OOEA 1AKTA 1I2CA 4L5CA 4AZ3B 3N2EA 3ZDZB 2C1EA 2MSCB 1M2OB 2BR3A 3RD5A 1L4BA 2ZUEA 3DXZA 3NDBB 1MFPA 2OFXA 2YYZA 3WKDA 3GI1A 4NARA 4RVDA 1TQ2A 1DB3A 1SHLA 4QDTA 1UFVA 3WRWA 5KQSA 2FR8A 4LBVA 5ALKA 2B5OA 2QN7A 2VHJA 4NBUA 4KDDA 4JI3B 1E8MA 2A1TR 3IE0A 1IAQA 2CVOA 3F6YA 3JALA 4OQNA 5EP4A 3OTGA 4O4IB 3TI9A 3URMA 3CUYA 1DO8A 1CR2A 1EFRA 2CV1A 2FPOA 1NDHA 1KQOA 5TDHA 3DE1X 1CB7A 4NXNB 5FQOA 4XKJA 4F1WA 3HWX1 4I5IA 4I8IA 3RRJA 3SS8A 5E6SA 4P84A 3X44A 4JJ6A 4Q15A 1HNWB 5DTRA 1RZVA 2BSAA 3CT4A 2Y1CA 1M73E 4GSKA 4JGBA 1SXJD 1YRBA 3N5CA 1N6NA 1ZC4A 4BO8A 5KSWB 4MV1A 2LW7A 1TEZA 3BXXA 2FVXA 4DV5B 3PFFA 2BTOA 1GNVA 4W1SA 1RBZA 3GEMA 1L7VC 5JCJD 1WE2A 2YWJA 3B2EA 3VC7A 4GMXA 3GUCA 3VR6A 4R0VA 4ARVA 4DHEA 3LQ1A 3N07A 1F2DA 3CW2A 4FW8A 3EQ7A 5IBQA 1SU4A 3HL0A 1LDEA 4MQLA 4IXDA 4PX9A 2AHRA 1KK3A 3FNQA 4KOEC 1QHGA 2C9ZA 5HE9A 2B4TO 3DO8A 4D44A 4JBXA 2AR0A 5EEHA 1TTPB 1C1DB 3DZHA 4Q0MA 3C4VA 2FPGA 2Q5JA 1FOEB 1Q95A 1GQSA 1X7YA 2A6HD 3GXOA 3IPXA 4GBED 2H2GA 1AY0A 1K8YB 2GMWA 4JVSB 3CN9A 5CBPA 1Y7LA 4BFZA 1ZL2A 2OBFA 2WV7A 2YL2A 2WRZA 2LCQA 4DSNA 5K2MA 3ZZUA 4UCXA 4EG3A 1H2ZA 4KLZA 5KTPA 2W22A 1Q83A 2GN1A 1Y8ZA 3GR6A 5TGTA 1FK8A 1T5BA 4CM3A 2PO5A 4S24A 1QP4A 1DUIA 1VC2A 1JPUA 1D2MA 2QX9A 2YS6A 4K9OA 2W7TA 5FHQA 3R77A 1FDTA 2GEKA 3U3MA 3D9QX 5KTKA 3DA8A 2I54A 3BAZA 2IU6A 4WOPA 1ZJZA 4UXIA 1YXMA 4TOIA 1SD1A 3MT9A 3BUSA 4LAFA 3W4JA 1D3AA 1YR9A 3GFVA 5G1OA 3KQHA 3QV1A 4QDXA 3LPNA 4G4SO 4YLGA 3NB0A 2VDLB 4Z1MD 8AT1A 2G80A 3AM1A 3LRTA 1JUDA 4BKQA 1Y6JA 3HYLA 1H4QA 2VPWA 4B6EA 3DW3X 3C45A 2XJ9A 3TIFA 2AUMA 3RHFA 1GP2A 2OCPA 2WF6A 5IT4A 4CLEA 4DV2B 3OD1A 3CZ4A 1OHHD 1E2EA 4J7AA 1RHQA 3Q3EA 4DDHA 1Q44A 1RADA 3WSTA 5ED4A 4ICIA 4Z3KA 1IG3A 2AG8A 1E1NA 2OLEA 2DPYA 5L7TA 5ESWA 1HA3A 4HL6A 4EBBA 1TNDA 4YBRA 4E5SA 1SEPA 5JATA 2GCEA 2PQMA 3FTPA 2F9FA 1TCCA 3Q12A 4IQ4A 4RHEA 4BTLA 1XF1A 4UAUA 2C7PA 3TLMA 1A7UA 5CT4A 3BTVA 2IYPA 2DTEA 4FBMA 2HMUA 4EKDA 4U5QA 1XQ9A 4EO7A 4CIYA 1C7ZA 4U7HA 5IYZB 3NOVA 1J23A 1F6BA 2XVXA 3GG9A 2Q6KA 1ZOLA 5JECA 4BU0A 3LQQA 3KAPA 4B9EA 4QXOA 8LDHA 3DT6A 2QDKA 3WHLA 4JIGA 4YROA 4NYIR 1WO8A 1ZIYA 4QIHA 5ITZB 4P4SB 5DTJA 1P9WA 3BWYA 3DULA 2LUOA 4J0FA 1TWHA 1CQPA 3KDSE 3RUAA 2XUOA 5DNYB 2H29A 3HKBA 2WWRA 3FVWA 3H0EA 4I4TF 2NYVA 3RIEA 3RUPA 1IZ7A 4II3A 4TRNA 4ESVA 3KPVA 2ZR0A 4NSNA 5DM1A 2N0SA 3TBKA 3WKAA 4BZXA 3T0IA 4DC1A 3D8SA 2AK3A 3IPAA 1YA4A 4K9DA 1L3CA 1Q12A 3CRMA 2VBFA 1EJBA 2VYQA 3G9XA 4F3NA 1ZKDA 5JEDA 1NP6A 1SCUB 3NHUA 5I51A 3PYXA 2NZYA 3R3ZA 4XARA 5AKJA 1IC6A 1N92A 2Q7DA 3K58A 5EIOA 4AO8A 3L0OA 3KQNA 2IQ5A 4LN1A 3AHIA 1XZFA 2JA2A 3ZTTA 1NQTA 4IGEA 1T0JB 1YMQA 2D62A 1I4DD 1P1BA 2YVAA 3TQSA 3RTAA 3CYFA 2VRNA 1G7CA 4HLUA 1XP5A 4TYPA 2RHCA 2ZIEA 5TGDA 2WVJA 2OPHA 3I4LA 4TLLB 1LBSA 1LV7A 3O1LA 1NG1A 2NADA 2Z2XA 3M33A 5CCBA 3BSFA 1RHKA 3UEOA 2OV3A 3I9V1 1YULA 1QHNA 1TLLA 3M4XA 4GBMA 4QUGA 4MW5A 4K26A 1E4EA 2PZGA 4HZUB 3C3EA 2F1OA 1NL3A 5D5HA 3L79A 4I50A 3OKPA 1PE0A 2IHTA 4QBHA 2FSIA 5T64A 2QTAA 3U48A 3WLQA 2COUA 1GYRA 5F77A 3IP3A 2IEYA 5LOVB 4KAAA 2ERYA 3GEDA 2YJTD 1OXKB 3LY9A 4YP9A 3JRNA 1QB7A 2G1JA 4YAUA 4M9XA 3BPSA 7MDHA 4DMHA 2XTMA 5K8IA 4XSVA 1FFGA 1FLVA 1HG0A 4KXWA 4Z51A 3N2KA 3IQWA 5DK4A 3COVA 1M8KA 3CRNA 1KQPA 2R8PA 3CLVA 2R7MA 3S44A 4CRWB 1V5IA 2P0AA 3R0XA 1XZCA 1H2RS 2RDMA 4IF4A 4KQ1A 4QVGA 1E66A 3VR5A 1C14A 2WJIA 3LT1A 3OJCA 1EG2A 2OHIA 5D84A 1P2TA 5JRDS 2FGJA 2B4YA 4C06A 5HTOA 3FRIA 1IOVA 2L18A 1OX6A 4HXEB 4CNQA 2TRSB 3FTNA 3ETGA 4P4LA 3DUFB 4MS4B 1M6VB 3MERA 4JGIA 2FEPA 2VAPA 3I5MA 3K31A 3KS9A 5JS6A 1YQDA 3FGPA 3FBWA 2JARA 1PT9A 3FYTA 1TM7E 3GTJA 1NVVQ 3GLHB 4CVNA 3ZJUA 3IIJA 2J5RA 1DAMA 3OWXA 3UJNA 1UZMA 5CRIA 5EYPA 2BFBA 1U3WA 4HMPA 1JR3A 1YR1A 2FDRA 1XMJA 1H2XA 3UXEA 2BZ1A 2OFPA 1V6AA 3UUFA 1TAGA 2VF4X 2PVCA 2QDXA 2AKYA 2W6NA 5ALIA 3TQIA 1EFCA 1OLUA 3S29A 3K2IA 3TNJA 3ZWPA 3CUVA 2C97A 2O8DA 2D0OB 2WINI 3FXAA 5A5EA 3R9XB 1EX7A 4FXDA 2W8BB 4HCJA 1NVMB 4UBNA 3DBRA 3UB3A 4R7ZA 1QC5B 2AFHA 2DQKA 1DLJA 4YJDA 4AN4A 2O1WA 1RQXA 4JQSA 4MQBA 1FNBA 3W77A 3RAEC 5LP6F 1GVNB 3LHIA 3KSRA 3R09A 1XMPA 2H1FA 2ZAMA 2RHJA 4JCCA 3NHMA 5FLYA 3N76A 2RONA 1UC8A 4K0RA 1SIUA 3EXEA 3LLUA 5TC4A 1GRCA 4Q9JA 4C88A 1DELA 8OHMA 4WHMA 3GPDG 5G2OA 3BA1A 1QO9A 2RE8A 4MP3A 3GLIB 2B3TA 1G1AA 3KAJA 3TRJA 3EB9A 4F56A 5FA6A 5JO0A 5BUSA 1YS2X 5ENZA 3KZNA 2WPNA 3NXKA 4Z4IA 1S4MA 2QRGA 4FGJA 1M6VA 1JG2A 1KIFA 3HM9A 2EVWX 3KTAB 4WKGA 1P31A 4DMLA 2FMFA 5ES3A 4WUTA 1HQKA 3ZD6A 4BN5A 1GA1A 1IIBA 5ALDA 2DR3A 4FFVA 3AW9A 4OAOA 2PO7A 3C2QA 3C6YA 4O08A 3WP1B 4CMKA 2R60A 3IMGA 1IWPB 3KQYA 3E2MA 4H77A 3DEZA 3L0SA 4RGVA 5CNJA 1R9MA 2OQRA 3H1FA 4FZVA 1EVEA 2CLCX 1JIKA 2NXJA 2VYCA 3D54D 2ZRQA 3GUUA 1N2XA 1CY8A 1Q1BA 2HV9A 2MDTA 3S7TA 2WWFA 3L8GA 2HHHB 1PTKA 3WYDA 1DKMA 3QPCA 3IKLA 4EVQA 2EZ9A 2UZ4A 4ZVVA 4PM4A 4DLAA 1DTSA 5JSQA 3RKRA 3L84A 1XPJA 1EJ6A 3QH4A 4RPKA 1VCIA 1H6DA 1KPGA 3MWGA 3A04A 1DRUA 5ELMA 4D8WA 4IILA 3SBOA 3UJCA 5KREA 4PPFA 2RGNC 3R0JA 2J3JA 2AFIB 5IBPA 1A35A 1XA3A 4BB6A 4I4NA 3ERCA 4RY0A 1KH3A 4JOSA 1EK8A 1HETA 1PX0A 3SSOA 3WDLA 5CFOA 3UH0A 3NFRA 1X1TA 3RCBA 5F1PA 3RK1A 2CT8A 4RESA 2BIFA 3EEBA 4B44A 3S28A 1YBHA 1RJWA 1Z0SA 1PWYE 2O6LA 2QD4A 4MR8A 4QHSA 4OHCA 2ZBQA 3OJ0A 4YRBA 3TR6A 3ROMA 4KDCA 4M9RA 4TSKA 4PG5A 2CJPA 5C80A 4AJEA 2YQZA 4DB2A 2XDQB 2PH7A 4L0MA 3DV0B 4CM1A 3K16A 2CFSA 2YX1A 3GYBA 3IXLA 1Z39A 4Q24A 4X1OA 4INJA 2C2BA 4BVBA 2NXWA 5U4QA 4PCUA 3DAPA 2X2OA 1CK4A 2F17A 4WE3A 1QG2A 3VI4B 1S8NA 4AW9A 3LRXA 3NBKA 4DWVA 4BXOB 1NU6A 1YZQA 4HH3C 1GPYA 3P19A 5F51A 3SSMA 4LW8A 3COSA 4GOLD 1JG3A 3RHZA 4M7OA 4G07A 1Q3HA 3N2NA 3PSAA 1P6UA 3EEQA 3QVGA 4Z5XA 1LLCA 3IRVA 3DTVA 3UV7A 4URVR 2GASA 2H8KA 1MC8A 4FGUA 3B1YA 3C24A 4LKOA 4YJGB 1UF9A 2C3MA 2OKCA 1FLDA 4Z4QA 1BEEA 2XOEA 4YMGA 1XDDA 1O6ZA 2FFJA 1JLLA 3EMBA 1P44A 1JL3A 1H0HA 3IEKA 5EE5B 3TZLA 1JG6A 1DCMA 2JKYA 3N86A 3OIDA 1TKAA 2AX4A 1KK0A 1KR5A 3NBQA 4XIGS 5DRTA 4CI0B 1IBCA 1GKLA 3H6HA 2QV7A 3EZ6A 4C1NA 1M6WA 1RCUA 2W93A 5ISMA 4IDAA 2GK7A 4U63A 4V03A 4P5EA 4YJ3B 5AK6A 1ZISA 1D2HA 3FPHA 1IRXA 1XRRA 1XXHA 4K9KA 1YA8A 1YT5A 1KYYA 2J4CA 1DIBA 2JB9A 1I8TA 1SWWA 3H11B 1GPMA 3PFNA 1QO7A 2WTAA 1YMVA 2ZI9A 4RLSA 1RXWA 4WA8A 1A8IA 4L3VA 1Z4MA 3S68A 4M46A 3ZV3A 1DJQA 2QRNA 4V2UA 2C3OA 2Q3DA 3BMCB 4B17A 1AZWA 3AOEA 3O2JA 1B8OA 1DLIA 1V1RA 1ZNZA 3RR2A 1MGOA 4XYLA 3VA7A 2JGDA 4QECA 4GKAA 1OVMA 2FF7A 3BVPA 3PWSA 4EGFA 1BWRA 1JFFA 1XTUA 4KRXA 4NJMB 4RHXA 3M5DA 16PKA 3NDJA 4RVGA 4YECA 4QIWA 5C7YA 2ZBUA 1NBOA 1Y33E 1W581 2ZYGA 4AZ3A 4V0RA 2WSLA 4C76A 5A2GA 1YTUA 4GI7A 1SOMA 3DMNA 1FQWA 3A9UA 3LWZA 1NQXA 3PE3A 2UYYA 2B25A 3LLCA 5J5AA 5DTIA 3KJIA 3S3TA 4C7KA 5JROA 1AF7A 4Q9DA 4KSCA 2QP9X 3MA0A 2Q41A 4N9WA 1YD7A 3IR5A 3NAMA 4RK1A 4RMIA 1N6LA 5BVHA 6PFKA 5IJAA 4EGSA 3FLAA 1OWOA 2FSGA 1L0BA 3SYKA 3ZY4A 4F8JA 4CCAA 1DUVG 3HYRA 3IT2A 1TW2A 4L51A 3OQPA 1KMNA 4PY2A 4UPVA 5L3RA 3NDRA 4NBWA 2J33A 3EOZA 1GOTA 1M5UA 3AXSA 1ESZA 5AI8A 4TLBA 1CE8A 2JIMA 2ZJYA 1Q15A 1QK5A 2C5GA 5BW8A 2VSQA 1T3ZA 3IEXA 2NTYC 2WE8A 4KC0A 5G3ZA 5CNIA 1GRQA 3C5VA 3V1YA 1G2PA 2ZTSA 2QMEA 3IYLW 4I0WB 5AIAA 5IC4A 3U09A 4A10A 4P22A 3TTWA 1P6QA 3I52A 4LJ6A 1RT9A 4LGYA 1C4OA 3GNLA 1VBNA 5I3CA 2EKZA 5AUNB 1F2TB 5FUWA 3WIVA 3GDOA 5FWNA 2B4AA 2HMSA 4EJ0A 3DC2A 1FPQA 3NO4A 3HK2A 1OR8A 2AI3A 1HDEA 1ZZEA 1U8YA 1RSZA 5LBIA 1FFCA 5TEWA 4FYKA 3EXG1 4MOWA 5JAUA 2PUGA 4M8NE 3PT9A 5KQGA 4N47A 3EK2A 4BMVA 3ELUA 1V9SA 2GERA 1PGJA 3KTOA 2B83A 3AHFA 3NHZA 2XA1A 1Z4PX 4PSDA 1TFRA 3U39A 5I7VA 3EG5A 4CM8A 3SGLA 4CKBA 2YHAA 1KRHA 1O95C 1ZJ6A 2AJLI 3Q4GA 5H3CA 2ECOA 2RH8A 3FWHA 3FGOA 4GXRA 1XDGA 2CE7A 1K97A 2VDUE 3TM5A 2WZCA 2IX3A 3ZW7A 4C2UA 3HG7A 2ZUDA 1XTQA 3TQHA 1JU9A 4I50F 4K3UA 2AFRA 4C1BA 1DKPA 1WW3A 4BBPA 3GZNB 2XQVA 2WZDA 2CN1A 1ADJA 1SBTA 2ODPA 1JDPA 3IO5A 4D2IA 5JNVA 1JSLA 1O03A 4YV7A 3RPEA 4YO7A 1RM0A 1JEQB 2QJFA 2DVMA 1JIVA 2QD3A 3E9YA 2SCUB 4HR7A 4EJ2A 3LQKA 4CF6A 2FJPA 5C31A 2HRBA 4JBGA 3FMIA 1A9RA 5HXAA 5HJ2A 2FK7A 2YZ2A 1QPZA 1TJYA 3HA7A 5KINB 2GXAA 2BT4A 4IJQA 2JEOA 1UBSB 4GE0A 1H0SA 1UEJA 4ZAYA 1TT5A 4CG2A 1VJGA 3KPUA 2UVDA 2L82A 3CZ5A 3UICA 5AXAA 2JCYA 3EH2A 4MQMA 4U2GA 4Q7QA 2XB8A 2Z08A 1L5YA 4QODA 4LWOA 4MHOA 4RMNA 1YC5A 2XQGA 2ZSJA 3EBLA 1AK2A 3NUZA 4BQPA 3WMXA 1TOAA 5CIQA 4AWAA 3PDJA 4E3WA 5ERXA 3BGVA 4FQ7A 2ODEA 3WI7A 3O95A 2QRJA 2ACEA 3AFOA 1T5LA 4GKJB 1GFZA 3MUEA 1RPZA 2K2WA 5DMXA 3GK3A 4C7OA 2AHOA 4FOOA 1A8PA 4H16A 2PRKA 4HXGA 1LDYA 1BQEA 1W73A 2DTXA 2RGEA 3MAAC 4GX5A 3GEIA 4Y2XA 4UBKA 5DHSA 5K8VA 4CL8A 3SIXA 4C05A 5BV2P 4US2R 1GD1O 4C89A 4EEZA 4EENA 5H82A 1O08A 3DAYA 2OY0A 2VDKB 3NOOA 4ZEMA 1SKUA 1ZGGA 4HPXB 2WM9B 3B3JA 5EJIA 1PIWA 3V4RA 3W7AA 4JI1B 2C7RA 2BMJA 4YDRA 1R88A 4D0LB 4H59A 5HZKA 3T7DA 1FXWA 4M1YA 1ISFA 1NFRA 4C6HA 4CXMA 4ZAXA 5MFPA 1VSTA 2IEZA 2NT3A 3AHDA 3LW8A 3KXPA 3LCVB 4K2AA 5BOSA 5I4BA 1OY1A 1ZNXA 2SCUA 2FPKA 3Q2IA 3B1XA 4GX1A 1U7PA 1FS5A 4L02A 3W7BA 3W7VA 4AFNA 4GI1A 3R74A 3SHTA 1KF0A 1UQRA 1QHYA 4CCWA 3W2EA 5JUWA 4X6UA 2BUCA 1BWSA 2EBFX 4DSTA 1TB4A 4YJ3F 5FHRA 4CMEA 1WMFA 1RQGA 3WA6A 2LE0A 3ZWNA 4NAVA 1PT6A 1TECE 2O3JA 2R97A 1KE2A 4BMDA 2GEVA 3QVOA 5JCXA 1V7QA 3A9RA 3JWPA 5DGDA 3UAVA 3O03A 4A26A 1H6AA 4MNTA 4G5YA 4CL3A 5AW1A 2Q5OA 5TPZA 4KAJA 1U0NA 3VMMA 4ZXPA 4CW7A 3EPPA 1NVKA 1T4DA 1QFJA 2J5QA 2RHMA 4PXSA 3ZVMA 3N05A 3JWGA 4KKXB 1ODIA 3PU6A 2OECA 2C2ZA 4PHGA 3HBLA 3ANTA 1KQNA 5DN6A 1JDZA 1RE0A 3QJ5A 3ZQUA 2UAGA 4JASB 4BPRA 5B4TA 4QGBA 3GW8A 2OO3A 1P1KA 2CBZA 4FCTA 1VP9A 4OFWA 3LIIA 2O0JA 4IMJB 2R6JA 5K6RA 1V3UA 1DQRA 4JROA 3L92A 1SKYE 3TPZA 2B1GA 1EUZA 4U9IS 1FNSA 1QYXA 1ECPA 1LC0A 2NXEA 1BROA 3V4LA 4OPMA 4HNAA 5K3OA 2NO7A 3AF4A 1A9PA 4PO1A 1T2AA 2Z2ZA 1YZLA 3FR8A 1KO1A 2VRWA 4U0JA 4BUCA 1IHYA 5KAPA 2ZYHA 5I8WA 5A62A 2B8NA 4QXPA 4RTSA 4LECA 4RJTA 2CGEA 1UK7A 1QO0A 2QI9F 3EC2A 3LP8A 4RO0A 5HX7A 1VMAA 1DEKA 2WG1A 3PEFA 1JILA 2OZPA 4AD8A 1CZRA 4ZC8A 2HC9A 1E8NA 1E9DA 4Z7NB 1BDJA 1F2UB 2GZRA 1F38A 3CE6A 3R5HA 1E7RA 4C30A 4YRGA 2OENG 2DT8A 3AUAA 2PA3A 2ERXA 2YV3A 4ZKEA 5JZSA 2X5KO 4NYIQ 1NYQA 1WA5A 1NLUA 4OHYA 2IZ5A 5HK9A 5B30A 3LP5A 4EB8A 3QUBA 2QUBA 2X40A 5IP5A 3SZLA 2GAOA 3OHSX 2QVCA 4Q5IA 3IVRA 4NXMB 3A4MA 4QJIA 2FWIA 3PNKA 1UBJS 2REQB 4IDGA 1C3EA 5INTA 2JLUA 6GPBA 5IKMA 5E4TA 4N0QA 1PAUA 1QOPB 3H4TA 1VM6A 3DDUA 3VC1A 3ZNNA 4RABA 1AB5A 3ENNA 4GSYA 4MVWA 1SXHA 2PMDA 3IQHX 2C5FA 4Z7QB 4N6NA 1PQYA 3IDQA 3LT0A 3SR3A 3KHUA 4AZWA 3NR2A 3VH3A 1TC1A 4Y18A 3EIFA 1ARZA 1BIFA 2ISCA 3ZZNA 4DQ0A 4ZI7B 4HYEA 4IVQA 2ECQA 3VO8A 4H7EA 4QTYA 1DJNA 1UMBA 1W44A 5EY5B 1EX9A 1ORDA 3LX5A 4E2WA 2VT6A 1JAIA 4I1UA 4IMPA 5BMVF 5CVCA 3O26A 2DH5A 4J9VA 1ZWKA 2YYSA 5IZCC 3VV3A 2VP4A 3W8RA 2FRDA 5T4BA 3KWMA 2C8JA 4IYRA 2VDOB 2PSFA 3EIXA 3HYNA 3JD4A 1JAZA 3GLKA 5EJGA 2J0EA 2E2WA 2J09A 4B3GA 1HDCA 4L27A 4W5JA 3H2IA 4EPTA 3L7KA 2I4MA 3WLJA 2LPMA 2ZKIA 3T3IA 1CS0A 4ZTBA 2LXNA 3KYDA 1UKEA 1V8DA 5IABA 1I94B 1GKYA 1SXJE 3SIWA 1DKOA 2QPAA 1RJ9A 1M1ZA 2BFDB 4K9NA 4XSHA 5DBHX 5E4JA 5JH7F 3A11A 4Q4JA 1V9MA 1CJKC 3Q87B 3V4SA 1YZVA 3JVVA 3SSNA 1K7CA 1J20A 1EM8A 2O0KA 5IWAB 4QFDA 4NU5A 3I12A 4H1WA 1WZCA 3D31A 1YB4A 1JIUA 3G8YA 1YNND 2H1WA 3QVVA 4EABA 4EFKA 3HSSA 3WK6A 5M04A 2X8AA 3TOVA 5FTJA 5KIAA 1YA6A 5DU2A 2IIQA 2Q9CA 1WY7A 2CHFA 1BKSB 2WKRA 1ZONA 3JWJA 2I4OA 5FNVB 3SC2A 1EB9A 2EWVA 1CQXA 3ASZA 4FINA 1OC4A 1N2IA 2F1KA 2OCGA 4QPZA 3UJ9A 4Q4AB 4YRIA 5I7UA 4QVIA 1IQ0A 4H7DA 2NZ8A 3JATB 1XMXA 4U3JA 2NU6A 1V7CA 1QZTA 1H9BA 1KR2A 1ND6A 2Y1KA 3ANXA 2P5TB 5KKNB 1RZRD 4LDQA 4TKVB 1L8XA 1GZ6A 2XUJA 1GPNA 4DPKA 1ENYA 3E9MA 1I7PA 1RC8A 5FTKA 3B7GA 1KETA 3DO6A 2OSVA 1U0JA 4M8KA 4DQLA 1GRRA 4CM8B 5CFQA 1ZOPA 1CDZA 1UDXA 1N5LA 5CPFA 1NV9A 3PS9A 4DLZA 2FLKA 3P9ZA 5IC6A 3EGEA 3L7JA 1J7JA 1GKKA 3Q9NA 4ZEOA 3ETDA 4FJ2A 1YK0A 3F6EX 2J32A 4HDRA 4HLDA 4ZO8A 4KYTA 4ZCPA 4XJTA 3ZY6A 3K0CA 3N6XA 3SIRA 3EGXB 2A9JA 5ALZA 1LF5A 3WB0A 1V5WA 4L0CA 3AKZA 2DUUA 4GZLA 4GDFA 4QDZA 4ZVTA 1XZQA 4BBAA 2JAPA 3GT7A 2IHUA 3B5IA 3JASB 4NK5A 4P3PA 4IHJA 5KNDH 2IKSA 2WILA 4U7FA 1AS2A 1UADA 3C6BA 1AURA 2XNJA 3MLBA 4L07A 4KV7A 1DKUA 4XPIA 4Y98A 3SLGA 3U81A 4TLCA 4BMCA 3CLTC 1JKJA 1U80A 4NP6A 1XZGA 3RFCA 2IQIA 1XOIA 3U19A 1A95A 4CT5A 3QXGA 3FPFA 3G0CA 4OQ4A 4ZGGA 4UHBA 4HN9A 5B1YA 3GLFB 1MUUA 3K0FA 3ZOZA 3B9BA 4L72A 2IWRA 1E1CA 1Q0HA 1HDOA 4LMOA 2ZITA 3IO3A 1OLSB 2OYSA 3QYAA 1DT3A 4L9WA 3SICE 2PQ2A 2ZYUX 1Y1SA 3CR3C 1M1YE 5JDCA 3LZCA 1CXZA 1YU9A 3O6VA 4JBHA 3E0QA 1Y82A 3E2IA 4WLVA 1L4KA 2CDCA 2ZPUA 3I2FA 5BSUA 4AUEA 2OOKA 1MRZA 1L5MA 4LPSA 1TQ8A 2OORA 2XOXA 4BIIA 4PZAA 3BGSA 4Z86A 5T7BA 3NVDA 4ISBA 5KMGB 3I64A 2ZI4A 3CA8A 4CFYA 3MELA 2ISQA 3PC4A 5ALOA 4AC9A 2H54A 2J3MA 4MR8B 5EGNA 4XX0B 1PZNA 1GUFA 4LTDA 1R3UA 3RRNA 1C1XA 1GGVA 4KK4A 3AEUB 4BMOB 1H3EA 4NCBA 2VEDA 1KYWA 2BMEA 2Y9PB 3E9CA 4YYEA 4XWTA 1GNQA 4N54A 3H97A 3QRWA 4I8XA 5DFAA 4H4CA 2ZCUA 1MC4A 2EP7A 1LPBB 3DCNA 2OHOA 4LXUA 3P9NA 2B8TA 3HZHA 2GPWA 4W8OA 4TN1A 4UVEA 2Z5VA 1VMIA 2OHJA 1EXWA 1XQYA 1UOQA 1BYIA 2P4QA 1F4LA 2IS6A 2B36A 4TTTS 3TGWA 1IEVA 2Q2NA 4FEGA 3SF8B 2R0QC 1UKYA 3DYIA 4HP8A 1LI5A 4OQEA 2SHKA 1RIIA 1Z3IX 3INTA 4YUYA 2VC2B 1S7CA 2A30A 3Q7EA 4FVTA 4PAOA 2XNDA 4TMFA 5IDXA 1XFDA 2HDNB 1NW3A 2ZIAA 4EHAA 1VA4A 3DMYA 1K6JA 3FD8A 1PV4A 2DR0A 4I55A 1W2HA 2O2GA 1OFUX 2X23A 3LZ6A 3GCWA 4S3MA 5BPHA 1KU0A 3K6SB 3J81k 2QR2A 3Q5EA 1L5HA 1HC7A 4UUAA 1XQVA 1X7YB 2DFKB 3AESA 1K8RA 4S0XA 2J31A 1J07A 2B7BA 4EWLA 1U28C 3K3PA 4RVUA 4YAFA 5LQMA 1NF2A 2HTFA 3EH1A 3A3YA 4CTMA 2VF7A 1WRBA 4PYOA 4EY6A 3LCJA 2D8MA 5I8ZA 3MBIA 1IPHA 1OGYA 1OILA 2JFVA 2OM6A 2BGGA 4PO8A 4FP9A 2QTCA 1MO2A 1W9HA 1EDBA 2FW6A 2V3WA 2FZ4A 3EUEA 4NPCA 4C3ZA 5NULA 2FWRA 2V6BA 4KVAA 2DZDA 3HCWA 3HLKA 3AR4A 2GTIA 1N3IA 3D7LA 1GV0A 4RY8A 5JCPA 3THRA 3ESZA 3G9QA 3JVUA 4B4OA 4H7JA 4CTKA 5CT8A 2IH5A 3GD7A 1SK9A 3KOMA 1V1MA 5ALRA 1Y6FA 1VPWA 1AZLA 4G4JA 1R6DA 3S8YA 4I19A 5JDIA 4G0MA 2XZOA 1C0LA 4I1SA 3LKDA 3PT5A 3G9UA 4O4HB 2C5SA 3DMTC 5FFMA 4DEYA 2J8ZA 2VWGA 3KJHA 1T8SA 4TROA 4P5PA 2VDNB 4O8CA 4MDYA 4YP5A 4NR0A 3RAGA 2ZTHA 3RH0A 2Z2KA 5DN6D 1M0EA 5B7GA 5HK8A 1HSOA 4UTVA 3AWDA 2FJUA 3IQZA 1TD1A 1WHSB 2C4HA 1Z4JA 3A4IA 1Y6ZA 1RI1A 4GYWA 5AI5A 3V4OA 4JLAA 4BCBA 5BYBA 1IQUA 2ONJA 3GTQA 4DKJA 3U0VA 1A1VA 5TPZD 3TINA 3Q41A 5B58C 1JF8A 4IMIB 1BZYA 5FL7A 3FZGA 1RXUA 2B7CA 2VH5R 4HX5A 4DA8A 2FSSA 4IWNA 3O90A 1CEEA 3C3CA 2JLVA 1RFLA 4C6SA 5JQGF 2OMEA 2W2LA 4GL2A 1Q92A 2E21A 5DW0A 4HD8A 4DJEC 1IN5A 1DOAA 1OW3B 1Q2UA 2GEJA 2JJ8A 4QYIA 5EWMB 1WCMA 1NI3A 3GEBA 4JR1A 3EGIA 4B8ZA 5C51B 2QE7A 1LNQA 1ZQ1A 3CUEF 1NTOA 4LBYA 1C9EA 3FGZA 1RJDA 4RVSA 4WFKA 5T4FA 1RI5A 2JBAB 1VL0A 2J9YB 3GFRA 3DOJA 4MUAA 4YGYA 1WQGA 1CD5A 5L3VA 1R00A 2BTQB 2O1XA 4HFRA 1G8YA