4NOMA

Crystal structure of asparaginyl endopeptidase (aep)/legumain activated at ph 4.5
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
407
structure length
407
Chain Sequence
b'EDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHRNGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLRGDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKMYQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWMEDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPPVTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAGFGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPIDRIEMAMDKVCL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Legumain
publication title Structural analysis of asparaginyl endopeptidase reveals the activation mechanism and a reversible intermediate maturation stage.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 151
structure length 407
sequence length 407
ec nomenclature ec 3.4.22.34: Legumain.
pdb deposition date 2013-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01650 Peptidase_C13 Peptidase C13 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.132.130 Mainly Alpha Orthogonal Bundle Topoisomerase I; Chain A, domain 4 Topoisomerase I; Chain A, domain 4 4nomA02
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nomA01
3IBCA 2QLBA 3R6LA 4NBNA 4PS0A 3K7EA 4NOMA 3E4CA 3EDQA 4ZVOA 4N6NA 2QL7A 2H48A 4ZVPA 1K88A 2FP3A 3BIJA 3PCXA 4QUBA 3R7BA 3V4LA 4EHHA 4EHDA 1QDUA 2H5JA 2FQQA 1SC3A 1KMCA 5LUBA 1CVRA 4JJ7A 4DCOA 4PRYA 3D6HA 2XYGA 5IAEA 2CNLA 2H4WA 2XYHA 4ZVQA 5IAKA 3H13A 5IASA 4HVAA 3H11A 4JJEA 1QTNA 2C2MA 4NOKA 4N6GA 1RWXA 4QUHA 1K86A 2XZDA 4JR0A 4EJFA 4IYRA 5IBPA 1PAUA 2H65A 2QL9A 1JXQA 2HBYA 2AR9A 4FDLA 4IEFB 4AWBA 4JR1A 4NBKA 4QUIA 4AW9A 2NN3C 2C2ZA 1F1JA 4HQRA 3R5KA 4EHFA 5IANA 5IAGA 2J30A 1RHQA 1SC4A 3GJTA 5IBRA 3UO8B 4ZVRA 4PRZA 1I51A 2CNOA 2QL5A 1RWVA 1I4EB 1I4OA 4N6OA 5H0IA 1RWNA 3V3KA 5IABA 4JB8A 2QLJA 3NKFA 1RWKA 4DCJA 4EHKA 4QU9A 2FUNB 1QX3A 2DKOA 1SHJA 4QUJA 2HBZA 1ICEA 4AWAA 1F9EA 4QU5A 1RWOA 2H4YA 3V6MA 3D6MA 2P2CA 4FGUA 3R6GA 4JR2A 4EHNA 1NMQA 2H54A 1M72A 1RHRA 3OD5A 2XYPA 4PS1A 1RHJA 4QUDA 1GQFA 3KJFA 4QUAA 5JFTA 2QLFA 3NR2A 4NBLA 4NOJA 3RJMA 3GJSA 3V4OA 3R7NA 3S8EA 5IC6A 3PD1A 2CJYA 4QUGA 2H5IA 4QU0A 4QU8A 1NMSA 1RHMA 2J31A 3V55A 1SC1A 2K7ZA 2Y0BA 2WDPA 3H1PA 2CDRA 3EDRA 4I1RA 1NMEA 3S70A 1RWPA 4NOLA 3IBFA 3SIPA 2H51A 4FXOA 1RWMA 3NS7A 5LU8A 1RE1A 3DEKA 3QNWA 1SHLA 3R7SA 4D3ZA 4JQYA 4ZVSA 5LU9A 4EHLA 3GJQA 2Y1LA 4JJ8A 4N7JA 4QUEA 3PD0A 5IBCA 5I9BA 4JQZA 5I9TA 4EHAA 3KJNA 4FEAA 5IC4A 1IBCA 3R5JA 4M9RA 3SIRA 4QTXA 3DEIA 5K20A 5IAJA 3H0EA 1NW9B 2C2OA 3DEJA 4N5DA 5LUAA 2XZTA 1RHUA 3P45A 1RWWA 2J33A 4HQ0A 4D3YA 2J32A 3D6FA 3H11B 2CJXA 3KJQA 4DCPA 4ZVUA 4QULA 4LSZA 4QTYA 1BMQA 2C2KA 2HBQA 1PYOA 3P4UA 3GJRA 3V6LA 3DEHA 1GFWA 4D3XA 4ZVTA 2C1EA 1RHKA 4N7MA 2HBRA 1CP3A 2CNKA 5IARA 1I3OA 4I1PA 3ITNA 2CNNA 3UOAB
chains in the Genus database with same CATH superfamily
1EK0A 1F14A 1RYMA 2HJ9A 3DWFA 2I34A 3NV9A 1U2PA 1FP4B 1T9ZA 2AMJA 1MN6A 2LKCA 1ZHFA 2JBWA 1NVVQ 4QUBA 4C0HA 3OPNA 1W0KA 4C5AA 3JS5A 2WZDA 4HYQA 4BVLA 1RLMA 1ZESA 2NU7B 3MLAA 3F97A 4HLUA 3HR4A 4RK4A 1N5IA 4IXWA 3RPEA 3WNDA 3OPMA 3D6HA 2RBGA 4RKFA 3OVMA 1XZLA 4W99A 4JA0A 1QONA 2PANA 1PR1A 1U0OC 2GRUA 5D6OA 3UAOA 2VZLA 1MIOA 2X7HA 1C7ZA 4GOJA 6REQB 3I8XA 2IWHA 3THWB 5CA1F 3KP1A 4WOKA 3FH0A 1KZ4A 5EWMB 1RYBA 2F4QA 3URKA 5E7IA 4D8WA 4DLTA 3GH3A 1M6VA 4OF4A 5JJKA 4KCGA 1NUHA 1QHXA 2XVMA 4KR0A 1XA3A 2IX9A 1NNLA 4BV8A 1A7KA 2J4DA 4R3UC 4J6EA 3ZHVA 2UUPA 4RK1A 4LX0A 5CM2Z 1DWQA 1XTQA 3OFNA 4RXUA 4Y6PA 5D00A 1DQRA 5AW4A 1ODTC 2WAYA 3M2TA 2Q4DA 1I6MA 1J8VA 1I0IA 4PAQA 4Y2GA 4O2BF 1P4JA 4FCCA 1HT0A 4PANA 4R5MA 5JSYA 3SC2B 2YZKA 5HTOA 1XI2A 1N78A 1EQ2A 3CYFA 2JGIA 5J9FA 2HQ1A 4FBLA 4D74A 3EPLA 2G1PA 3TCKA 3TNFA 2V6GA 2ZAYA 1EUDA 2GD6A 4D4JA 4MR7A 1W35A 1B2RA 1OBCA 5CHEA 3P71T 4JY7A 5LZ9A 2N1BA 3PR1A 5BOSA 4HQFA 3EPKA 3TKAA 4NX2A 1GNQA 1OF1A 4HLDA 4ABYA 1QRAA 3M8KA 2HPZA 4J6FA 1ENOA 4QQRA 4BRSA 3MWGA 4WXMA 3KSBC 4EPRA 1ZJJA 1W5BA 2XWPA 2OHXA 4NESA 2L82A 4JVMA 2V6FA 5A5DA 3C48A 3Q8KA 3UBMA 4CLRB 1T25A 5KAMA 4C3VA 5ICSA 1U0GA 2PFSA 2OP1A 5G4LA 4EYKA 1OBVA 5KTSA 5L6MB 3MQ4A 5F2NA 1YB4A 3QHPA 4CTOA 1NJ1A 2IXAA 3PHBE 4FFSA 4EENA 5IDQA 1IU9A 2H5EA 2ILVA 1VLQA 2RK6A 4WLOA 1U94A 3D7RA 5AHOA 4PAOA 5C1IA 5C46F 1B0AA 4GECA 3KXIA 4GPTA 3DEYX 2UZ1A 3SJ7A 1VGRA 2AYYA 3KT6A 4MDHA 1E6KA 2QLTA 1E62A 1SM4A 2EKBA 2X0FA 3C14C 2TMDA 2YU9A 1WVMA 1M3SA 3ZN2A 2XF2A 1XNJA 2AQHA 2O5JD 2XBUA 1G6HA 1ZH0A 3H6GA 4NRDA 1VLLA 4H2DA 2G4CA 2P9GA 1E69A 1Y4AE 5AI0A 3MCZA 1XLTA 3M49A 3UMBA 2JZCA 2A9QA 1WUIS 3GG2A 4TL7A 2OCGA 5HCIA 1GU7A 4XEHA 2GAIA 3Q4GA 1R16A 2WLSA 4ZJZA 3PNKA 3HDVA 1CF2O 3HMQA 5AYVA 4DGQA 4KN9S 3PQ8A 4QC2A 5HTKA 4EW3A 3PGKA 1SXQA 3MPUA 1UDWA 4O59O 1XVLA 3SLKA 5EKDA 2R8BA 1PZXA 1ZGJA 2ZR7A 3GFBA 3PRKE 1UOOA 4X6YA 5AUQA 1TAUA 1XG5A 5CFPA 5CGZA 4BY9E 4RHCA 1EM8B 2DOKA 4LWOA 1RC1A 3EGDB 1Q3TA 2G8LA 4YQFA 2P79A 4JAVC 3VNRA 2BKUA 1N9GB 1SUCA 2WD7A 5HGXA 1QU2A 2CNKA 4YCAA 1I3OA 5IARA 1N3YA 3NM5A 3P4XA 3ONDA 3IHLA 1YRQA 2IHBA 3QBJA 2R60A 4EW2A 3TBFA 1U2GC 4KXUA 5CLGA 1GTRA 5L45A 4Z4GA 4B6GA 2BFCB 5GADl 3GP3A 1QFZA 1JEQA 1IBLB 3PGXA 4RF5A 2EW8A 5CB6A 5KYXB 1ZJ6A 3MINA 5EIFA 4ESVA 2BSAA 2JZOA 1VIDA 3D8UA 4EBBA 1OZFA 4WV3A 2PPVA 2GR9A 4OKNA 4CKZA 4EY7A 2PLFA 3NT2A 1J25A 1Q91A 1VE3A 2X9LA 4I46A 3ROFA 3ZXYA 1VYVA 2COEA 1UR5A 3T38A 4JU9A 2DWUA 4OL9A 1X7ZB 1YZ3A 1E1CB 1PQUA 3QEMB 4JR1A 2CVFA 4NQZA 3PQDA 4PX3A 1Z5OA 4MLPA 1VPLA 4BQOA 1M2OA 5HKOA 1NI5A 1ZYRD 4FQ8A 4HQRA 5CVTA 1H5QA 1TCBA 5J58A 2UYHA 1XT6A 3NNSA 2AE2A 4PIVA 1ZIOA 5ENDA 4ZT6A 5KNDH 1SD1A 3B38A 4CEIA 3NUGA 4K9SA 4GLOA 2OM2A 3JYOA 1Y34E 5HRAA 5KU7A 1QLJA 1DRJA 1XEFA 1Z2DA 2IK8A 1GPAA 1C0IA 1K98A 1OFHA 1I4LD 1S7GA 4O2AA 4YRTA 5F78A 1KS9A 3UFBA 5ICGA 2AFIE 2UXBB 3FBWA 2D5LA 4PX5A 4LYJA 4TTTS 3E8SA 2ZAGA 4ZK6A 4OKSA 1Y6ZA 2UV8A 2R4UA 4J29A 1UXGA 5F1PA 4P5DA 3H2JA 4CFZA 2VBGA 1F9EA 2VSNA 1NULA 1M75A 5IJ0A 4MCAA 5FOVA 3VU3A 3U37A 1W85A 1DKRA 1NMYA 1Z6ZA 3W1EA 3W5JA 2IS1A 1C5KA 1N6KA 1Y0BA 3K5WA 1KEUA 3B7WA 3EG9A 3FN4A 4FMPA 1Q95A 3K4PA 3KPVA 4FN4A 4GDMA 4MS1B 2PV0A 1C3VA 3DOCA 4N5NA 1MA0A 4OAQA 4WVFA 2HQRA 4XYEA 4ER6A 2JI4A 1EFPB 3FSEA 4KR2A 5JO0A 1VL1A 2FSFA 3FMGA 1UPUA 4MLCA 3RU9A 4GP7A 1IVSA 2J9XB 4PLPA 2MSDB 1Z9BA 2PLWA 3OQPA 3W5BA 1QK5A 2D1SA 5AW0A 1RM0A 2PM8A 4ZO8A 1G3UA 4PFQA 3T9EA 2IZ0A 3EH1A 5FL7D 4L5AA 4FXOA 1CEYA 2OHGA 2NO6A 4V0RA 4CLOA 1WX1A 3A05A 1UZNA 4DANA 4W9MC 1HOTA 1E1MA 1BXKA 3ZIUA 2WBLC 1ZK3A 4TT8A 6AT1A 1KVRA 1OU0A 2JK0A 2XKJE 3ZDCA 1WRBA 2WUWE 3KPUA 3VHLB 3S7ZA 4QWWA 4E13A 2OE2A 2MHCA 4A5OA 1P2TA 1T5TA 2LTAA 1IXKA 2WSBA 1JFFA 1GFIA 2X1VA 2XF8A 1WCXA 3B6KA 3JATA 3EMDA 3N5KA 4GP6A 4TYQA 4JODA 2FEXA 1QGUA 1JHRA 1U7HA 2OGWA 2Z5FA 3AI1A 3HL4A 3WLQA 3GRYA 1AQNA 4L85A 4MWSA 4BLPA 4YRZA 3N8DA 1CR1A 1K0FA 4RLFA 4Z9FA 1F8YA 3U7FB 1UXJA 2CDNA 3EHEA 3B20A 1LLUA 1E3QA 4IHAA 1BWSA 2AN1A 3AI2A 1I6VD 1O9GA 1WZUA 4PGHA 5JU6A 2CUKA 2QF7A 4Z4CA 4MX8A 1VBMA 4CI0B 1LJUA 4LGMA 1KNQA 1GGFA 2PKWA 1C1XB 3D31A 3T9AA 2ATXA 3MW8A 3PVSA 1YJCA 1GUFA 2JASA 2SKEA 2W8ZA 1XCGB 2NPOA 3B1VA 1W4ZA 2ZBGA 4MQBA 1HF3A 1PR9A 4C04A 4EZBA 2BGWA 3UT6A 1KI2A 1W2GA 2V7WA 1A8SA 1JKMA 3IOCA 2CL6X 3SQDA 4E5UA 1B00A 2CZGA 3R0QA 4HI0E 4V0MA 4WDQA 4CQJA 2VUIB 3RJTA 2FNAA 3WO0A 5TV2A 1JJIA 3QVXA 3ZTYA 2XZPA 3UWMA 1H5NA 1IEVA 3SSMA 3DE7X 5HNKA 4DA4A 1V26A 4ARAA 3CIOA 3H13A 3EEOA 4YCCA 4NV0A 3RT7A 1YQQA 1QTNA 4CDNA 1QIMA 1RKBA 2QRQA 2ZYAA 1IONA 1JRLA 3EH2A 4OO3A 3TR5A 4UBKA 4KFSA 3PUKA 3ZC3A 4CLXA 5GJBA 3AF0A 1K92A 3OBIA 2HMSA 2HO4A 2FEMA 1O6GA 2GCOA 1DXHA 1Z47A 1VPVA 3ND6A 1U98A 4BB5A 4HX9A 1TEXA 5KKNB 4WXRA 2V6BA 1KKUA 1M2JA 4RGYA 2DBYA 1Q0SA 2FRXA 2D0PB 5LP6B 1EH5A 1XTJA 2HMUA 4P4NA 2SCUB 1KE1A 5TDHA 4JBNA 2OLKA 1I4EB 3ZVRA 1SN7A 1A8UA 1RWNA 4CKYA 4DKXA 3CWQA 4Q1EA 2YN2A 2HLDA 1AHNA 3D02A 1E1LA 1W88A 3PSAA 1BDBA 4TTIA 1PV1A 5CPBA 2TMKA 2H4XA 1OH7A 1R0CA 3DZHA 4ZANA 2AMLA 3GXBA 5FBZA 4CMJA 4DT1A 1D2NA 4QDZA 4QOHA 5DNAA 4W8GA 4YX9A 4R81A 1FDSA 2DQYA 3CCBA 3G0DA 1Z7GA 4CN9A 2ZJ1A 3S2IA 4XM1A 3V4FA 4KGXA 1Z17A 4GL2A 3M1IA 4E08A 2DPLA 3IQGX 2YOHA 4QUAA 3MS2A 3T94A 1AQUA 1ABFA 2UUCB 3FDZA 3AY6A 2F4NA 2XUAA 3DEZA 3PQ3A 3U13A 3OZIA 3VPFA 3F98A 1XHLA 2Q1UA 1A7JA 2REXB 4YXWA 4D57A 1YVEI 2UYQA 3QU2A 3OEED 2RHDA 2Q8QA 1BWQA 1PG5A 4RZHA 3E1KA 5DBEX 5IJAA 5CBPB 1XN1A 2ZRQA 3ZWOA 3MD9A 2CE7A 4J0KA 2FW9A 2GD1O 1OIWA 4P3OA 5ETJA 1DPGA 4CODB 1G2IA 1E9FA 3IEKA 1RYNA 4R1MA 4YMTA 3WAGA 2BC9A 5ED4A 2J6HA 1POWA 1J09A 1RWMA 3KEMA 5HVNA 4C22A 4A16A 1Y3HA 1XYYA 1HDZA 1MB3A 2FTKE 2H11A 1DAOA 2IDMA 2J6IA 2QTRA 1C80A 1DCMA 3EA5A 4LTNA 5TGTA 1O94A 3ZWXA 1THGA 2RCNA 3GCWA 1LK5A 1KI9A 2G5PA 2VT3A 1QGDA 4FDTA 4DLZA 3QOWA 3KJNA 3A2KA 1WMBA 5IBCA 2EFDB 3K70D 4LSGA 1IZ7A 4J0CA 2UUAB 2CEAA 1I01A 4QYIA 1PJTA 3RT1A 1MX9A 1JDNA 3IQXA 1NJGA 4FSHA 1OJ7A 4EUEA 5LJLA 4DV3B 4RULA 2N46A 3RU2A 4NPAA 3KJHA 5BUZA 3QLEA 4QT0A 3WIUA 3MNFA 1XZIA 3D5EA 4IEIA 3LWDA 3AVWA 4P3XA 2RGBA 3AKEA 3TLCA 3QOXA 4C1NA 3GMTA 2IIVA 3GNLA 1Z7WA 3MTIA 4WLVA 3ZGYA 2IZZA 2WU4A 3K6SB 1QK3A 3KUDA 2P9TA 5FI3A 3DOJA 4BN4A 3L06A 4ZT5A 2I99A 2IX3A 3C41J 4WUVA 2EQ5A 3I04A 2GEBA 2I4LA 1KI3A 1N6PA 4YJHA 1KQ3A 2I2AA 4RTOA 2MSCB 3K7EA 2MU1A 1JILA 3I6BA 4D0SA 2YWXA 1ZD4A 1NFQA 1MHPA 5BV2P 2OSVA 1MX5A 1XAJA 6GPBA 2Q3BA 5I4KA 2BPOA 3ESAA 2PT9A 2FWRA 1QHSA 1YS1X 3OT5A 3PENA 1O95D 4BMXA 4EEKA 3P19A 4F7WA 1W96A 2PPLA 1ATZA 5EPEA 3URMA 4HGRA 1WD7A 4BLSA 3FKSA 3BZBA 2EZ9A 4PFJA 3RUAA 4PGMA 3KXKA 4LDRA 4NG4A 4Y2YA 4DLKA 4EQ6B 5EIXA 1JTVA 2H4ZA 5LUAA 4ZZ0A 3M82A 4Q7LA 1T6BY 2FA9A 4W7SA 1OB2A 3ERCA 1T5BA 3O8NA 4R8MA 3RC8A 1Y6RA 4HN2A 4JP2A 1BCRB 2EBHX 2RH4A 3GVPA 3RADC 2QU8A 4U7PB 1V6CA 5C9ZA 3VC3A 4Q82A 2G0AA 3CN7A 4IV5A 4J3JA 3OTQA 4PRZA 3VZPA 4MKGA 2A0FA 1WCIB 4EKYA 3RG2A 2QPTA 1I4OA 2ZRBA 3GLHE 4GF5A 3VR2A 3WSVA 1GKUB 4YCJA 1JQDA 3AI3A 3QV2A 4NICA 3K1YA 3W7BA 4EI8A 4IUBS 4R01A 2QTVA 4EY3A 2AK3A 4OHMA 3BKWA 4RENA 2H2FA 3IDQA 1VKZA 5CXQA 3LUPA 5KHAA 6ADHA 3W4IA 1KORA 2PUJA 3BMXA 2CHVA 5IM4F 4FR0A 1C0LA 3JYHA 2PTHA 1JU9A 2Q4OA 2FKAA 3I0MA 4WZBB 1IY1A 1A04A 4X85A 4E03A 3DTVD 2VZ0A 2EG5A 4K9QA 4BMOB 4DLSA 4DV2B 1V8FA 3IAAA 1VYUA 5DTJA 3GRVA 4BCDA 1SQ5A 4EB0A 3PRYA 4R1QA 2WTAA 4UHEA 5KYGA 4KE7A 2R5NA 4V02A 5IC6A 1Z6GA 2ALJA 3FETA 3O2QB 3C5VA 1E7SA 3COSA 2LV8A 5FUYA 1RYZA 4XGRA 1OI7A 3F6YA 4TRNA 3RLIA 1P7WA 3KAJA 3KSMA 4XCVA 2OEPA 1JZQA 2ZU6A 3DFZA 4UXHA 4CMEA 2O3RA 1Q0RA 1L5MA 2CL7X 1NXVA 3JD2A 3X1ZA 1N9KA 4MQEA 4XX0A 3ZDQA 2WSLA 1OAKA 3HB0A 1BW9A 1NVVR 3OOHA 2EZ8A 1P2VA 1OI4A 3HY6A 3NRCA 4JCCA 3T7JA 4WGFA 2OTCA 3EIQA 4Q16A 2F6RA 2Y1KA 4G0OA 1JLHA 2XLCA 5FH9A 3DU6A 1J8MF 5K3DA 1CRQA 3AR3A 2Z6VA 3IJRA 1EZ1A 1LH0A 1AF4A 1SZDA 2GQ0A 2QZSA 2I29A 4ZT4A 4BEWA 5JPDA 3F4KA 4DJFC 1YJ8A 1TUGA 3SF8B 5CD9A 1NN5A 1O03A 4EHBA 2ZIVB 3D8RA 3R5TA 2WIBA 4YRPA 3ICOA 4TUYF 3RAEC 1KHHA 1MEEA 3PQ2A 5AM3A 2V54A 1GKKA 3OP4A 2HFKA 1I5EA 4A1OA 3WNQA 4JYAB 2HLPA 2IYZA 4HDOB 1JR6A 4ARZB 1NATA 2H7XA 2PX3A 3PVCA 4J1TC 2P5UA 3LWNA 4IV8A 5H5JA 2ZYRA 4EY4A 1I3CA 2VXBA 1MJ5A 2NQTA 4UNNA 2PD4A 5EWLB 2HBRA 4TLBA 3UV6A 3R0JA 4CUJA 4IZHA 1V8ZA 3E3OA 4XVCA 2IH4A 3I6YA 3PJRA 3QITA 3RVLA 2ISCA 1R00A 2YWCA 4MXDA 2O57A 3P9IA 2FMUA 1AK2A 2VRCA 3GGGA 3PCXA 3SR3A 3AZQA 2JL1A 4BIMA 3HHEA 1TIPA 3UV7A 4AKEA 5LYJA 4C0QC 1F7VA 2DLCX 1VKNA 3I2YX 3M3HA 1TTQB 5DSTA 1SBNE 1YR1A 4K9MA 3NB0A 3P0JA 4RAOA 1PL8A 1FYWA 2A0KA 3UUEA 2EHJA 3CUKA 3DHNA 5AJHA 2ZROA 4YV1A 1RI3A 2IH5A 5BQXA 4QUHA 5AVOA 4ERXA 2PVCA 3NH9A 1L5LA 1D1SA 1JS1X 3OO1A 3TEMA 3WLOA 4OGWA 3ELYA 3SSAA 3ZOKA 4CQLA 4Z49A 2HA4A 1RC8A 1XSEA 1TWCA 1F38A 3B6IA 3FOWA 3DQPA 3GAAA 5DIFA 5GONB 3LYLA 4AO6A 3NHKA 4CL2A 3R20A 2HWYA 5HZGA 3DO6A 1EQUA 5KVQA 1Z39A 1KJQA 2A57A 1QANA 1D8TA 3HE3A 1YDGA 4KPFC 1K3UB 2BM8A 2I2FA 2H17A 4GMDA 1QHGA 5AM5A 4PGGA 1DG1G 2BOVA 4MS4B 1UWLA 5ALUA 3RBXA 4AZ3A 1F0KA 3M1YA 5EE1A 4WD3A 5JYBA 4NPCA 2PH7A 3B7PA 1K4TA 5AK4A 1PQWA 4C3OB 4D7AA 4B43A 4PO3X 1D7AA 3JXEA 3OQVA 4GOOD 3GFSA 4GGPA 2O8CB 3VHXA 5KPDA 1SVWA 1L5VA 2IC5A 3F6EX 3I6ZA 3QWHA 4E88A 1TIBA 1Y80A 4RZQA 2AEJA 1QHHB 1J0CA 3ZPXA 4LRSB 5MLC9 1DDGA 4RETA 1RHJA 3HU1A 5KYWB 3ZD8A 1RR6A 1OZ0A 2GBGA 1E1RA 3GP5A 1PO7A 4LTDA 1QRDA 4OFBA 5E3JA 5IEJA 1OGJA 3C7KA 3S8EA 3NTXA 4Q05A 4Y6RA 1F0NA 3CVWA 1KO1A 1Z5ZA 1DC5A 1I10A 4OBXA 3RUEA 1RRMA 4XFJA 3NO4A 1TAHA 4ZT2A 1W1IA 1OWNA 4CG3A 3QWFA 3WGKA 3OD1A 4DR5B 4E3ZA 3NUZA 3ND5A 5FYDA 5L7TA 2WB1A 3B12A 4BBPA 3WXMA 5FNVF 4WLEA 4N7RA 3PITA 1XQYA 4ZJYA 1JLRA 3R5SA 3WQHA 3P94A 3RHFA 3TE7A 4OHOA 2YJ6A 4YJKA 1R9NA 1DINA 1LFDB 5L3RA 1XD9A 3P9KA 2YMMA 3HXKA 2Y67A 3TX6A 3EGIA 4K40A 4W1PA 4YTEA 4OGGA 4M9RA 4QOEA 2JGKA 1BRMA 1T3ZA 4ISBA 2XUHA 3RTDA 2G70A 4DQVA 3WYEA 2G0TA 4XD2A 4Q3OA 1H1DA 5ALWA 4HQ0A 3CRRA 1KQPA 3N2GB 4LDPA 4QPNA 1A3CA 2Q5EA 4Y6SA 2O8VA 4ND8A 2AZTA 1KO7A 1N57A 1V1RA 2BR5A 2HTFA 2IOFK 3TI9A 1KGSA 5DKFA 3VISA 1JQKA 1KK1A 5CCXA 2OSBA 1WDKA 2AJ8A 3PTLA 5H4GA 1Z33A 2RDMA 1S96A 2HJSA 4KXFB 2V03A 4AY6A 3UANA 4Y7DA 1R9MA 2JFOA 1F48A 3ZLJA 4BJHB 4JNKA 4RM2A 3U4GA 4Z7QB 1K27A 2JCYA 2PTGA 3NYIA 3Q1KA 4D80A 5LP6C 2CMFA 2NVUB 4A10A 1EX6A 2E55A 2RGCA 2FEKA 4EPTA 3D7SA 2JH8A 4BNUA 1AUQA 2R00A 2WAAA 1Z88A 1EGAA 3K0CC 3NAQA 3FRHA 4UAJA 4JBGA 3N59A 4U2FA 1GNVA 1RLJA 1W5AA 2EATA 1QGED 3CZPA 3EWNA 4KU4A 5C8YF 1W93A 1KMCA 4W8HA 4UE3S 2ANCA 3HK2A 1PLJA 5AIBA 5H83A 5JJLA 1XDSA 4PZ9A 5BV8A 4K6OA 3U3MA 1J20A 1GL9B 2WFLB 3Q87B 4Z0TA 2O06A 4OK5A 1AO3A 4IUYA 4QATA 3O03A 4YDSA 3UICA 1Y1RA 1KZHA 1ZVJA 4AY2A 2V9PA 4L7VA 4UJ3A 1MO4A 1II8B 4HWSA 5MN5A 4UAUA 1EAYA 1BG6A 2AMVA 4PZZA 3P52A 3TYXA 4I1OA 2CWWA 5IDWA 2AYZA 1RABA 4L4XA 2F4VB 1MC1A 2C42A 4TLLB 3PNBA 3K32A 3SXUA 3U09A 4FJ0A 3D0RA 4L50A 1JNYA 4CFSA 2DYKA 4D82A 2Y6UA 4HB4A 2XV1A 4RJKA 3PR2B 1SNYA 3FB1A 3Q0IA 2CGEA 4IVRA 1KO8A 5IK2D 2QORA 2X2EA 1CR0A 1S3FA 3GJTA 5K3BA 1DIAA 4RKEA 1DAFA 3TQFA 5K0CA 3DMTA 1LPQA 4FUQA 2ZIWB 3P1JA 3L7KA 4NKRA 2W22A 2XY4A 5L53A 4GQBA 1FRNA 1XZBA 2E2HA 3G9ZA 4MUBA 4BNDA 1P18A 4HHEA 5G0UA 4N18A 3WK6A 2A1UB 2ODWA 1U65A 3QKUA 3ETHA 4HFJA 3VZDA 4NYMQ 5AVYA 4HC4A 1T2NA 1V3UA 3NBXX 4FWBA 4QEZA 3B85A 1KSHA 3W5IA 2YDYA 1CQIB 2X14A 3CT4A 2OL4A 3LVFO 5M04A 1T4MA 4DNFA 5IW8A 4DKJA 5AVJA 5HMMA 1GHTA 3U39A 4C0WA 2H54A 4RUKA 8OHMA 1EYZA 1H2AS 1ZWLA 2C61A 3UJ6A 5KMGA 2JANA 2JKVA 1TA4A 2CFSA 4R9UC 1S2LA 2XB9A 4RD3A 4YB8A 2BM9A 3IBTA 3O4IA 4QSMA 1QF6A 3OKFA 5BW8A 1BIFA 4TRMA 1CX9B 4R4JA 2B8TA 4JEIA 3WFZA 2C0QA 4OJKA 4Q6BA 2Z2XA 3D3JA 4RTKA 1YZFA 2WM2A 2YUTA 3WFIA 1U2ZA 1UBHS 2I2XB 3MF4A 3KTOA 2FU5C 2ZTUA 1A7AA 2BELA 1E79A 1EK1A 1P1JA 1FTSA 1ZNZA 1Y4ZA 3HR8A 3MQFA 3AFOA 3BB4A 3Q5GA 3BFPA 3FYDA 3OM9A 4GMGA 1Z68A 4IIEA 2Y2UA 5JCJA 2IP4A 3TOVA 4NU5A 2NVXA 2VHXA 1JTFA 3VYWA 3ISVA 3M7IA 5JJIA 5A9SA 1DD5A 2D06A 1NVFA 1VTKA 3NXKA 1Y4UA 3CLUD 3HRHA 3M4XA 2VJQA 4JOSA 1PR0A 3K0AB 4GBED 5AXBA 3FPKA 2J46A 1BU8A 4EG6A 2Q21A 4NCBA 4PHHA 1CF4A 1MF7A 2AFVA 4F93B 4GVLA 1SKUA 1UBRS 3L0SA 4NULA 3T7EA 1JWBB 1LJLA 2BMFA 2VXOA 3W5CA 3N6RA 3A27A 1IUNA 1T6YA 2NP6A 4B1FA 2BW0A 3QKRB 3T15A 4REOA 1TM1E 4K1XA 4U39A 2CMDA 4LVCA 3MRSA 3VOBA 1HEYA 2J0SA 4P3PA 4QASA 1M10A 2BZ1A 1RQ2A 4FYXA 4HAZA 4V3BA 5DGIA 4UZEA 3WIBA 1F7UA 3LSTA 4KMRA 1O87A 1RNLA 5EXPA 1DIHA 2ATCA 2LWIA 2KYRA 1LC0A 3LQ1A 1XDDA 4GR9A 2Q0XA 2RHTA 3I58A 3L7LA 4QXQA 2BP7A 3PEEA 3E7PA 1UFKA 2EFGA 1NMXA 3FMVA 3ZU4A 2FHPA 5JAQA 3AW9A 1GA1A 2XUJA 2FUKA 7ADHA 1IBMB 3HDHA 2NYVA 4B6EA 3E9ZA 2CW5A 1JLSA 3S81A 1Y8QB 2AE1A 2ADMA 3R41A 1F20A 2JPDA 1YDWA 2G6TA 4Y1RA 1MQ8B 2B82A 2QJWA 3R0IA 5MGNA 4LBVA 4GPIB 3V4VB 2PV7A 4YRLA 3D4IA 1BMFD 2D0DA 2O50A 1SG9A 3I53A 4MWDA 5KTMA 5BMOA 1G8HA 3HWWA 1U9IC 1GPWB 3EXHB 3MS7A 3QU7A 2RIPA 4FUTA 2HBYA 3JVDA 4KRYA 4LOAA 2BEKA 2HF7A 4CIAA 2D7DA 2GPSA 3PXBA 3THYB 4NSNA 4HNSA 4M54A 1E7QA 1QZZA 3O7MA 5DK4A 1JXAA 5GM1A 1F9AA 4UASA 5JJBA 2A92A 3I1FA 5CFMA 2ZUTA 1E4OA 1IAQA 2I2BA 4OMCA 1ECCA 1H42A 1P77A 2Q41A 3WAKA 4C4AA 5KCZA 2PJRA 1KJZA 1ZCFA 2CV2A 1ZM4A 2AN3A 1BXZA 4KW7A 1A96A 1LQTA 1JKXA 2VA9A 3MFQA 4QAQA 4UHKA 2O6LA 2OFXA 2OCAA 1JG3A 3X1WA 2HBZA 4YUWA 3BREA 3GJ5A 1HYBA 1RWOA 3KR1A 3TSYA 3N2NA 4LNHA 3CUWA 5JAUA 4PS1A 2CUZA 1X7GA 1RHRA 3OD5A 3V1UA 4ZHQF 4MH0R 3VJMA 1EBFA 4KFTA 4XVRA 1KEWA 5EXXA 3Q2KA 3UTDA 2X19A 4URXR 4LFBB 1DBIA 2GTPA 3HCEA 3P32A 1WS6A 3G0IA 3IRUA 4HRVA 2YHIA 3BMOB 2GUWA 1ID1A 3UMMA 4OYDB 2NO9A 1AT1A 2W6MA 3M1AA 3QK7A 3RRYA 1H3FA 2JLSA 4QBFA 1ULBA 3TZHA 1IJKA 3CJTA 1J2UA 1GYPA 1KH3A 1U9JA 2HWWA 1HO3A 1XZJA 4ZPJA 4K6FA 4IXNA 5DGXA 1IB0A 1L7PA 5LQJA 3B82A 3ICCA 3TJZA 2FZKA 4XWAA 1EDOA 3O94A 1DAPA 2JATA 4RFLA 4F72A 1SEPA 4UJ5A 1G9XA 3N7UA 4HDQB 3WLAA 4KWIA 3Q72A 1NE2A 2GZMA 4ZQFA 1L7VC 4DWJA 3THXA 1LD3A 4KQMA 4N3GA 2AZXA 4DQDA 2KWIA 1S2DA 4GHWA 1DO8A 1XTPA 3FLEA 3D1VA 4IDAA 1YIAA 3AF2A 2QX6A 3MJRA 3OA0A 1U3UA 2Z9BA 3NDBB 1DQSA 1E7YA 2HV8A 4IV0A 2C2KA 5A03A 3P4UA 4QA9A 1ADBA 1WUYA 5TT0A 2HRDA 1C9KA 3V1MA 4AL4A 3L0DA 2GBFA 2QZZA 3QELA 1T43A 1X1EA 3CNBA 3MLBA 4YASA 3VBCA 1XXLA 2DUWA 2IYVA 2X4DA 5G4KA 4Q4HB 5MN6A 4DR7B 1R49A 1WB4A 1OHHD 1MR3F 2Q6LA 2ZIGA 1T3SA 2DBQA 3EDQA 4JC4A 4Q9JA 3Q7QA 5EUQB 2WI8A 3CISA 2ECFA 4QQ8A 5E95A 4OQPA 4AAYA 1F6BA 2Y3IA 5KOJB 2D2VA 2N0SA 2ZU0C 4Q3NA 4YRQA 2YJNA 1ZICA 2W2XA 1ISIA 2IGBA 3GHHA 3RVJA 4DM3A 2WTBA 2HJGA 2VK1A 5SV2A 1PG2A 2FK8A 3LC1O 4X0EA 3LUBA 2MJLA 3CEJA 4HAUA 4WLNA 1WLYA 3MCVA 5NLLA 3TAHA 4GRAA 1B0UA 2VP4A 3OBBA 4R5HA 4BDTA 1A69A 4TZ0A 3MXTA 2DHEA 2QTZA 5CB4B 1F1JA 4G0MA 3BF7A 1E3WB 1JMYA 3EAQA 3K1AB 2JFPA 3L3BA 5FUVA 4XYMA 4PYNA 3LGAA 3SZOA 3VR6H 1ZD8A 1KY4A 2R6CA 1B14A 4J7UA 4WNYA 2X2FA 2VH5R 5ICEA 2IODA 2ROQA 1ZP6A 3FFBA 3RSSA 2O19A 4HFRA 4ZYYA 2JJ1A 4L9WA 4ODIA 4F6LA 2IIQA 3IVRA 4E5KA 5F2OA 3GEGA 5I9LA 4G81A 3ETJA 4J0GA 3KV3O 4W1RA 1GPKA 1UWCA 4MUHA 3BXGA 1DU4A 1IHDA 2D1YA 1EH1A 4RMNA 4RVCA 5DEIA 3GPBA 5L8VA 3PRHA 4PCVA 2ZB2A 4DZRA 1W94A 2ZI6A 4ZP1A 1MTOA 4KIWA 4DLVA 1ESCA 1OYWA 1CE8A 3UPDA 5D7BA 4B34A 4B2PA 3FDXA 4TLMB 3N53A 3AVYA 1PFYA 3L4BC 3NBAA 3AUSA 4MROA 3SLGA 4X3PA 5CFZA 3FFTA 3L0CA 3NP9A 1KBOA 1F0PA 4FJ1A 4ETIA 1R5ZA 2O48X 1TGOA 1J42A 4R2WA 3OMWA 4TZKA 1IPEA 1Y9EA 5JDCA 4MUFA 4A0SA 1KFEB 3SCZA 1KI1A 4E3WA 1T5HX 3B3FA 4RNDB 5IM5A 2YV5A 3IRVA 4E15A 3STWA 1TO6A 2FPWA 2WWIA 1QP0A 3HKCB 1ZL2A 3IDAA 5BWNA 2C7RA 2B8NA 2UUOA 4DR6B 1REQB 4IMPA 1R0LA 5AT1A 1E18A 3DE3X 5IJXA 1H2FA 4AO8A 4KC6A 1SA0A 4EITA 2PZAA 3TLXA 2OBMA 2OFWA 3WY9A 3TDMA 1VMKA 4MVJD 2WQ6A 1KNXA 1NP3A 3AEYA 5A4FS 3NLLA 1A88A 1MO6A 3A3KA 1OX5A 3IKVA 1B8UA 4I9HA 4BECA 4ZI7B 1UPCA 2E5WA 2EG9A 4M6WA 3C98A 2V1XA 2HSGA 3S2GA 3H0EA 3LVBA 5H02A 3RC2A 4GXQA 5CB4F 3TE6A 1B6RA 4ZAFA 3GDHA 1MH1A 2OK7A 1LF0A 2NSJA 4DEXA 3USCS 4DLUA 4GGMX 1ZD2P 4JROA 4XQ0A 5C4IA 4RVUA 3TWOA 4ZYTA 3KZNA 3S55A 2IIBA 3E2MA 4PZAA 4FS8A 1OXMA 3FFWA 4F9EA 1XWFA 5JWRA 3RYTC 2B4KA 1UC4B 2X77A 5AK0A 2JVIA 3OICA 4BLTA 5HKBA 3M3DA 2REQB 3IMFA 1PT7A 1WUTA 3LPMA 2RGRA 2QLBA 3PCTA 4WN9A 2QVBA 4II3A 4UCFA 4AXBA 4EPWA 1DC3A 2GSDA 3YASA 1FNSA 1SU8A 3RRNA 1UKZA 2YWBA 3D43A 4FE7A 4EK9A 1KDZA 5J4HA 5E1BA 5DYGA 3A28A 1NF9A 1CD5A 2Q99A 3BMQB 4CHTA 2QRJA 3LHSA 3QF7A 2DWQA 3VI3B 4UBMA 2ZBPA 4WK2B 2XYRA 2QRHA 3MMSA 4OHYA 3Q9LA 1B4DA 4IPTA 4CIXA 4U00A 5E8JA 1P17A 5HFNA 1EFHA 4ZGBA 2VTEA 2YKGA 5A62A 1XTUA 1RZRA 1GDTA 1UT6A 3C3KA 3PLRA 4G56A 2QVLA 4BAGA 4R2IA 1OPRA 1ZSNA 3A06A 3IUNA 4TS4A 5KPJA 5DK6A 4QVIA 3IPCA 2Y68A 2NZUG 4UOZA 5CK4A 3EZFA 4C43A 3VKWA 2H7YA 2RGNA 3AL2A 3LQQA 4PICA 5JI2E 2C7VA 4MJ7A 4MYTA 2H06A 3EZXA 4GR4A 2YOFA 3B1FA 1Z74A 4ZI7F 2XCSB 2YZGA 1FEZA 3HHPA 4NARA 1E0KA 1X9IA 3FPFA 3NTOA 1Z08A 1UKAA 1P2BA 4R8SA 3NAZA 3ZU2A 2PX2A 3OT1B 1MP0A 3PL5A 2PFGA 3V8RA 1BJTA 1HFEL 4CF7A 1SUAA 3CJRA 3GJ4A 2VTBB 4A73A 2PSJA 1F5SA 5JSBB 2JIZA 3WC4A 1UKCA 1E5VA 3TW0A 4B2IA 2PAAA 3JQ7B 4DMHA 1R4AA 1JXOA 1LV7A 2OCBA 4CPDA 3F7TA 4EHJA 2CJFA 4X61A 2FPMA 2WAQA 4TTVA 1FUUA 1IIBA 4ZAGA 4XJSA 4GI3A 5FUXA 4HNQA 3HBMA 1RYHA 5DX0A 4E5NA 2QLFA 1AF7A 1T36B 3H2HA 1CUYA 4BX3A 3R4VA 3ROKA 2DHRA 2XSZD 3IV6A 1BHSA 3B6EA 3BIOA 3OECA 3S8MA 2ZM6B 4G36A 3FTEA 4HLNA 2WA1A 3VSCA 1EEHA 2Z2YA 3H8JA 3PK0A 4Z54A 1FFYA 1RXVA 3OFND 3H8WA 2BJWA 1MA3A 2NT4A 4O4LB 2NX2A 3UKDA 3QVTA 2YCLA 1RZ3A 2PJUA 1OXKB 1W25A 3ABZA 3UAGA 2O54A 4LJYA 1T1JA 1P0FA 3GJQA 4D3SA 5CYOA 2MDTA 3NTVA 4FOLA 1KI6A 3KOMA 2FR0A 2FY8A 4K2AA 1CLUA 1ZUWA 1E8DA 5I9TA 4XDGA 5A5EA 2OV2A 5B3KA 3A1WA 1WB9A 2FDCA 1IN4A 4OL0A 4H3TA 2R6GA 3LP8A 5IJ9B 3ZHUA 3VSDA 4EYSA 1P62B 1N5DA 1F60A 4RJJA 1ZI6A 1LRLA 5ADUS 2F55A 2GZSA 2QP3A 2YTZA 3I8OA 2VH2A 3HN7A 3KL4A 4IVPA 3OKAA 1NI4A 4GWLA 4RK5A 5HQJA 4ALLA 2W4MA 3NUQA 1VL6A 3DP9A 3O3NB 3OCWA 4PE5B 1RXWA 1DE0A 4NV3A 5A0TA 3PX3A 4JJ4A 4CV1A 3HP4A 3EUFA 2G7ZA 1SB8A 1CVIA 3L4SO 4G0WA 2OBYA 3T5GA 1QDEA 4A82A 3BJRA 4XRGA 4AUEA 1SBTA 3FYSA 4CT5A 1JHOA 1N3IA 4IH1A 3P2EA 4K9DA 4YJFA 5ECDA 2AFHA 4G6ZA 3UHOA 2VPYA 4ISCA 2Q1SA 1MGOA 2FG6C 2X0NA 2BF7A 3R0XA 4NYMR 3S29A 5DLDA 1ZY2A 3EWIA 3TZBA 3OU6A 4YDQA 4Y2XA 4LF6B 5D51S 4CV2A 1DRWA 3OF2A 1FFXB 1L7RA 5IASA 4F6RB 3M33A 1WPRA 1CJSA 1WWKA 4K05A 3HXOA 1HOXA 4KGVA 3CLSD 1V1JA 3GD5A 1ZJYA 1FUKA 1BHO1 5A2GA 1Z7EA 4G8CA 3SZLA 1SB9A 4O4LF 1X8XA 4OA8A 2HD4A 4AP9A 4BFSA 2GM5A 5A3VA 2NN3C 2XRZA 2ZWPA 1Z0SA 2IIPA 3FCEA 3OX4A 3L8ZA 4J07A 1W0JA 4IOJA 5E7QA 2GPJA 1SUPA 2FGJA 4RFVA 5IJZA 1K0UA 2XJ9A 3CA8A 3BSFA 1Y5LA 4JWTA 1H0RA 3FPHA 3V48A 1QG0A 1SELA 4H77A 2CT8A 2H8KA 1LLCA 3SVLA 2VHTA 1U2QA 4GT1A 3HU5A 1WJGA 1L4NA 2OC9A 3GBPA 3L05A 4HQOA 4MCJA 1E6LA 2F3QA 3UZUA 3I5YA 2JD0A 1UBTS 1E4EB 2TYSB 4GBJA 4J91A 4M9XA 1X8JA 1V39A 1YB6A 1QOQB 4X45A 4EG8A 2I8AA 2IP1A 1L7DA 3KQLA 3K9GA 1NDQA 4JN6B 2H59A 4XX1A 3UMVA 4ZFNA 1IXYA 1O9BA 1UM8A 1SVMA 4DLPA 1Q1BA 3SMVA 1GSAA 2I33A 4OUDA 5B2FA 4KSCA 4EJSB 4IJQA 1ZGZA 2ODEA 2V7VA 3DBLB 1P60A 2R1UA 3MUOA 1AH2A 3HXQA 1CUVA 2X0IA 1IJBA 4QVKA 4XKJA 2Q49A 3DAOA 1ORTA 1ISPA 1T8PA 1Z29A 1FU4A 1P0MA 4CM8B 4MRNA 4BNGA 1IY0A 4F86A 4ND3A 5BY2A 3FNEA 3RE1A 2A5GA 4YHHB 2GHIA 1U28A 1YRLA 1M0TA 1EE1A 2WUFA 3GVHA 1J8YF 3TLYA 4ZMBA 3MOSA 1XPUA 1Z4PX 5T5QA 4ZN6A 2ZYUX 4G89A 4L5BA 3H2YA 1M7HA 2HEGA 3GJ6A 1JF8A 3AFGA 3IBYA 3RVKA 3V8VA 1F6WA 3GD7A 1FX1A 4QTZA 2PQ0A 3DVRX 1VB3A 1NKSA 4WLUA 1YB2A 1UIMA 2PZMA 1X0XA 2B4AA 2WT8A 4W5QA 1V25A 2XUGA 3FRJA 3C8MA 3ZG6A 1OBHA 3CUYA 2NV2B 5HGJA 1NM5C 2CBGA 3JCZA 1Q8IA 1VCHA 3MWDB 3GLSA 3T9BA 2ZSFA 1NF2A 4KQ2A 3SE7A 5LR6A 3WGUA 4YFVA 3ON5A 1QC5B 4GFDA 4LKOA 3AUAA 5CP8A 3D7KA 3DEHA 3W04A 1ZAYA 3SX0A 2FPUA 5JQGB 1FJXA 3T5CA 3DLTA 1VJDA 4B82A 5BQOA 4P0PB 2G9NA 1JDTA 2V96A 1XFDA 3T1QA 1FYXA 1PL6A 1WUJS 2VYCA 4PWYA 1R9GA 3GWGA 4WKGA 3BGIA 2K4MA 4IHQA 5TPWB 4AG6A 1Z6TA 2I3DA 2C7BA 2Y93A 2I67A 5E4JA 1QO7A 2DRIA 4AECA 3ZGZA 4J0IA 1ISRA 1SU6A 3MMZA 1EVZA 4S1PA 1VHWA 5IUJC 4DIKA 5JG7A 1A9QA 3V4RA 3RFXA 5F3DA 2HPHA 1LLDA 1ENZA 4C9BA 5K03A 4URUR 3LC2O 1MZVA 2BZGA 2VHUA 3E3MA 3F0TA 3T7TA 4U6QA 4N4AA 1OH5A 3GRRA 4DABA 2HHAA 3KJEA 1HLFA 1TQDA 1Z2PX 4HDCA 1Z4KA 2GYWA 1DKLA 2GWHA 2P0EA 5C4MA 3RBAA 2J5QA 2IKQA 4BGEA 1XKLA 3EIWA 2ORIA 1QFJA 5KYYB 5IVPA 3RHZA 4DA9A 1HG1A 1R3UA 1BJKA 5BN3B 3WIOA 4JI4B 4F8JA 2X3YA 1KDOA 4JP1A 3TIXB 1QE5A 5J47A 1CFZA 2AQKA 4DPKA 1QYVA 4L5CA 2EYUA 4EVRA 2ZP1A 4CM7A 1U8TA 4MWZA 3IIJA 1RSZA 4JGIA 1WNTA 1VFPA 3MJTA 3ENQA 1RE0A 4TMYA 1EJBA 3FFAA 4DPLA 4GX2A 3RSHA 3GJXC 4OM8A 4XTCS 3X2SA 4AWXA 5LA6A 1VE5A 3RYFB 4AJ1A 3VU9B 2IXEA 4RL4A 2PUGA 2VEDA 5IABA 3BF8A 3CWCA 4TMXA 3AR5A 2H3EA 4B0PA 4UTOA 2BFFB 5JD4A 2MSEB 1YULA 5KNCA 4WA7A 4A8JB 2VG8A 1PZHA 4HDRB 4DIFA 1NR7A 1G1AA 2GCIA 2GNAA 3LNCA 3FVQA 5DYIA 4WY2A 1QVWA 3SF0A 1Z0UA 5B1HA 5LZ2A 5J2UA 1YI1A 3OTWA 4Q3DA 3ZJTA 2V6JA 2CBXA 3EAGA 5JQGF 1KEVA 1RYEA 1R88A 4FZ5A 4CR7A 3HNRA 1GAEO 4BNLA 3UV3A 1FVHA 3FDJA 1S2MA 3STTA 1P2UA 1TMKA 3C3YA 3HFGA 5T3UA 4RK0A 1U2DA 1FXSA 3WHKA 3OY7A 4LCEA 1M8GA 1PEDA 4G0XA 1KJIA 1SKMA 3E7XA 3CY6A 2WRZA 5EUMA 4URZR 2OY0A 5E6RA 5ICCA 3NH6A 3PE6A 2Y4NA 5AKHA 2I80A 4PYIA 4DJTA 5CMLA 2WDZA 3MTBA 2B7BA 2VQ3A 1DO0A 5CYPA 5GOZA 4DB4A 3CUVA 2GF9A 2QRGA 2VL7A 1XNGA 3A1TA 1ABEA 2PX4A 4GOLD 3MB5A 3WG9A 4CLHA 1Y5NA 3A1EA 4D1YA 2Z98A 2PE5A 4GMFA 2QQ5A 3U7QA 3OAAA 1NVKA 3OTGA 3PB3A 3VR4D 1G20A 3CPSA 4OIMA 4R9NA 3ZD6A 4F8EA 1YO6A 3F90A 3A4VA 4P35A 1HX7A 3A6GA 1E6UA 2G77B 3OMLA 5C53B 1Q21A 3RUDA 4D5GA 3AFMA 4CIVA 3KJQA 2MSNA 3GXOA 3BWYA 2JCBA 1QS0B 2I4OA 3AHIA 4CRWB 4DUGA 2GKOA 2YWGA 3R40A 2Z9DA 5I7RA 2A9RA 2BBOA 1K6MA 3RAPR 5JBIA 4KEAA 4KP7A 4Q19A 5EYPB 1JZSA 2QD2A 4TROA 4Q01A 4YXWD 1J6UA 4L8VA 1DUVG 2FMTA 3ODGA 4RIEA 1T2UA 2D54A 2R66A 2E6UX 2XAAA 3M6IA 2XE7A 1LX7A 2F48A 2NO0A 2AFIB 3AYXB 3PDJA 4K8RB 4RORA 2OFOA 4HPXB 5IH3A 2Q0QA 3SQOA 3MT0A 4I6JA 5DHUA 4RKQA 3VH1A 4DLYA 3HPRA 2B9SB 2KHZA 1G42A 2PEZA 1Y8RB 2DCMA 2FB9A 1P7YA 1QM5A 2ZIXA 3V7UA 3CV3A 4DQXA 1RRPA 5D3ZA 1T24A 3TB6A 2HXYA 3MHPA 4JT9A 4KG7A 1RPJA 3PLAE 4IM7A 3VU8A 5CX1A 1I50A 3GA7A 3RK0A 1MT0A 2QG6A 1EVJA 1WKCA 1ZGBA 3G8AA 3I04M 3LQRA 3NAMA 3Q2IA 3NANA 4N6GA 3ZV5A 3FNHA 2X40A 4ZC8A 3KJIA 1XWIA 2NZWA 1VRCA 1Q5PA 5DIZA 5GV7A 1SUWA 1QIEA 3KFLA 1PU2A 5LNK6 2CUNA 5AWFC 5JSKA 1H2EA 2SBTA 3D7LA 4GKBA 5THXA 4O8CA 1RHQA 3K0FA 4JQCA 3STUA 2Q3LA 5JEEA 4FW8A 1LW6E 2DQSA 2BM1A 5GQSA 2XKKA 5LMCA 1OUMA 3KELA 1MXFA 5FCDA 1U0FA 1TO2E 4IAOA 3GFTA 3GAZA 3AVVA 1J8FA 3DWGA 4WCFA 2EGHA 2I6UA 4PC1A 1SULA 3GWZA 2VJBA 3HJAA 1G18A 2AI3A 4RVDA 4YUVA 1WXGA 3T35A 1K8QA 5EHZA 5L7WA 3L82B 2PUVA 3A1NA 2WD8A 5FL3A 1AGNA 4G1CA 2PXHA 3SG0A 4KXLA 5CG1A 4AULA 3O21A 2Q07A 1GQSA 2Z1NA 1DQPA 2GJSA 3VMMA 1I32A 5JZMA 3HJFA 3OU7A 3RFVA 5FLKA 5B5SA 1NQVA 2FWNA 5DASA 3TOZA 2FZ5A 1W5TA 2LIPA 4CEHB 4HRAA 4P4UA 3V5NA 4MUGA 2V7BA 4QZVA 1TQHA 2G9QA 2Y1GA 3HVKA 4JMLA 3HKBA 3BRQA 3ABOB 3SAJA 1YUBA 1L1QA 4URYR 1P29A 5IHPA 3WHIA 4L15A 2GK4A 1ZW1A 1PTJA 3NYQA 3SIPA 3DQZA 4E51A 5A3JA 3ZVKA 4LF8B 3VDXA 4BP9A 2Y27A 1P8JA 3RS2A 1EZ4A 2QRVB 5DE3A 2V7EA 3PUIA 5AI4A 5E6SA 3VR2D 2QK4A 4KPGA 1COWA 3RD5A 1ZVQA 4FEAA 1FTGA 2BMJA 3PNYA 2CVZA 3RUCA 1EWVA 3A6HA 4MGYR 3RU3A 1XD2A 2YXBA 1A97A 2DPGA 1ODIA 2JIBA 2LKDA 3VPBA 4RPHA 3ZDXB 3AGPA 1XZCA 3MB8A 4ZKEA 5AVSA 1G5HA 3VUEA 3P0IA 4LCBA 4D4LA 4TWBA 3THRA 1LBSA 3RIGA 1AX9A 3O4JA 5CA1A 1XZDA 3K35A 1CUHA 3H5NA 1NL3A 3KZVA 4UMVA 5K7SA 2ACKA 2C3YA 4DBZA 2P68A 3F3KA 1DXYA 2P9YA 3MTGA 2GN6A 1Y4DE 4MPRA 2NQ2C 4DCNA 1O77A 3IBCA 1YWGO 2BV3A 4AJNA 2JGDB 4P4GA 4XDHA 1P0CA 4DSOA 4ZVOA 4YUXA 2O5EA 4LRTB 3RVBA 3TTWA 2BRUC 3KV1A 2JJMA 1SEVA 5ULLA 1UEXC 1UK8A 3OFVA 1IOVA 2PKXA 4HGPA 3CTPA 3UPUA 4W6QA 3H5IA 1SIOA 1YOBA 3GLIE 4PZLA 4KLRA 4YRJA 1E0AA 3V7NA 1BROA 4BXOB 4HVAA 3S2ZA 2DBVO 3VX4A 5BSVA 4OQFA 2QTGA 2C2MA 1YF3A 4B3BA 2CLMB 4PNZA 3RJZA 4D97A 4ZXFA 1FMJA 1S2GA 2QU7A 4IKPA 4YCLA 2DXIA 2Q9UA 3W6UA 1J22A 1KYXA 2X0KA 3UCXA 1AKWA 1ADJA 1RQPA 3RAJA 1ODCA 1Z75A 3RVRA 3GZNA 3V42A 4DHEA 1BFUA 1PS0A 1R5JA 1RYYA 2EFJA 1PYDA 3C3WA 3WZ2A 4BO0A 3SQNA 2BUAA 3PPYA 3DLHA 4BJ1A 1BZYA 2E5LB 2DFDA 4K6HA 5JD3A 1AM4D 1TEZA 3QZUA 1R6DA 4BGUA 4S2EA 5I7FA 3QQ5A 2NU7A 4FXPA 1J39A 2GF0A 3F78A 5A1JA 4KRFA 5T4FA 2C8JA 1J1IA 2OYSA 1CKEA 5DM2A 1EDZA 4JUFA 4KXVA 1X80A 1BS2A 3IUQA 3AETB 2A3NA 4OHVA 2VRCD 1EFCA 3SHVA 3VPGA 2A9KA 2ZR9A 4Z3DA 2XZLA 1G8GA 5FJJA 4RS3A 4JBWA 4ZVNA 1RJ9B 3GDFA 1J97A 3LX4A 3RV3A 1HR0B 2QX9A 2DFLA 1I1NA 1CUBA 2EBFX 2JHCA 2WG2A 1HQKA 3OIFA 3PPXA 4RIGA 3SOPA 4BMNA 3ZD7A 1HQCA 4L5JA 1D2EA 4YUYA 3CBGA 1I94B 3N6XA 4G0VA 4PYRA 4W5JA 3C4JA 3VR1A 2JA5A 3AEKA 3LNTA 4RF2A 2FMKA 1YH3A 4YLYA 2EZUA 2XB2A 4I9GA 3M4YA 3G5AA 3TNJA 2XNKA 1PN3A 3SC2A 1V9LA 2ZYSA 1YB1A 5H82A 4NWIA 1VJTA 2V5AA 3BWMA 4C01A 1A4XA 4KE8A 2BJVA 4F4IA 3OZWA 3WRXA 2OCYC 3K6JA 8AT1A 2WWGA 4N41A 3A11A 3E27A 3ZGVA 4WASA 4GM0A 1Z5WA 5F1YA 4UC0A 3NDIA 1ZGHA 5TQ2A 3E35A 1W73A 4NABA 1Y1LA 1U5BB 4TYMA 3LKDA 1ZM2A 4QJBA 4DLBA 4RWEA 4HRYA 4CLRA 1ENYA 4IG4A 5H3HA 4AZ0B 1C2YA 3CUSA 3OHSX 2J33A 4CU5A 1WY5A 1ZA2A 3EVZA 1WKVA 2C94A 1ZMBA 3KBOA 3ORHA 1D09A 3VR5D 2Q1YA 1HRKA 4S0XA 5CH8A 2GYYA 2Z3WA 3DU5A 3AESA 1HDIA 1Y6JA 3I5XA 521PA 1JKJA 5AOCA 4FFVA 4ZKDA 4OSEA 3F5SA 3VO1A 1E1RD 1AHPA 1DJLA 4FOSA 2KW5A 3GJRA 3OE7A 4AMBA 4XYBA 1A36A 1VJ1A 2I71A 3HNOA 1C9JA 1NOJA 3F4LA 3KTFA 1T9BA 4HS9A 4C2AA 1TZJA 3BUSA 3RTGA 4EVSA 1J21A 4RTQA 3BD6A 3CMCO 4IGAA 4KNVA 3OWXA 1MAWA 1UC5B 3OCXA 1KEKA 3ADCA 2YOGA 3BM5A 1AJEA 4UZFA 4DEVA 4M98A 2CVPA 2CL5A 3C0KA 2P9JA 4RZ2A 3IUPA 4FNOA 2JGAA 1RPNA 2FPGB 1ZXLA 2O0JA 4AVYA 1XTIA 1C1HA 1ODJA 1UEJA 1GUYA 4D8XA 2ZT6A 4FCVA 4A8JC 3M5CA 4WGGA 2RGDA 3BQMB 1RWXA 3PS9A 4K88A 2GPBA 1I13A 5KU1A 1EPUA 1NW8A 1OLSB 5DH9A 3GTQA 3BZUA 5ALZA 4DGSA 5ALPA 2ZR8A 4Q6WA 3SD7A 5LQCA 4IP9A 1J5XA 3EVNA 4FC7A 3ABRB 4NAHA 4TTSA 2P4UA 1BYUA 4FLMA 5GV8A 4EFLA 2N9UA 4S2UA 3JARB 1Y6FA 3PJEA 4DY4A 2XBLA 1A9PA 3Q0TA 4TXNA 4X91A 1A76A 4ZJPA 4HNVA 5B64A 3L1KA 3L8FA 4LXGA 4RQBA 3ELDA 4G5FA 1JU4A 1Q1GA 4Q7KA 5ALMA 1C8LA 3OOWA 3TKLA 4MKXA 3WKBA 5FX2A 2IVFA 2P6UA 4AF8A 3QWIA 1OMOA 1NZFA 1FJ2A 2VDOB 3FFXA 4MKZA 5C0OE 3PC6A 2WM9B 4PNHA 2YWDA 4X3CA 1T6NA 2H08A 3KD2A 2XT0A 3E84A 3G6WA 1SAYA 3FKQA 3FWZA 4WEOA 3ENVA 4L3WA 2QAGB 3FDIA 4WOCA 1FMTA 4B84A 3CZCA 3EEFA 1L5GB 4KX3A 3S5JA 3RJ9A 2BEVA 2H00A 1Y7LA 1I6LA 4TVBA 2BBTA 4QNNA 2WY2D 1ECPA 5JV5A 4QOSA 5HUQA 2YC2C 5JAIA 3FYUB 4FEEA 3ESCA 5EHNA 4AQYB 1QGAA 3W6OA 1XU9A 4BO5A 2YNMD 1G41A 3L0PA 4EECA 1TMGE 5ERXA 1CRWG 5DHFA 3NOQA 3NWJA 4NECA 3AR9A 5L51A 1RI2A 2IDKA 3HXPA 1GU0A 3EEIA 3QMPA 4Y1FA 2JA2A 5CTJA 4DARA 5DBGA 3QA9A 3VJRA 1D6JA 2JVKA 2RHJA 3U61B 2JLCA 5CCDA 3H0GA 3K0KA 4QUEA 2GX6A 3ADKA 4GBGA 1ZVMA 1HH4A 1IHUA 1GL6A 1IB6A 2XKAA 5DLQC 2PS3A 4RQTA 2BFEB 4DADA 3DLIA 3OY2A 1T6ZA 2B2CA 3GW8A 3QYAA 4AZWA 3R7WA 4KMMA 5LQUA 2VP9A 1GA6A 3ECAA 3KX2A 2UZ0A 4HWTA 2AFHE 1DTWA 4X92A 4XM0A 3ST7A 5JNLA 3SKVA 5FEMA 1I7QB 5JNTA 3THOA 4KODA 1FSPA 5JTTA 4NV1A 1TYAE 5LMNB 3QU9A 2PJZA 2YVAA 3L6DA 5AVXA 1KAGA 4BFVA 5IKPA 1JPUA 2IKSA 4L8YA 3ZR4B 1K7SN 1NVUQ 2F64A 2ODPA 1T8IA 1XC7A 3GN1A 1FQJA 5KS2A 3F73A 3GEPA 3RU7A 1OZAA 4B6QA 3BORA 4RHUA 4A0GA 2WT4A 3EOAI 3OCCA 1B8OA 4RD4A 3O8CA 5KQLA 2ZJFA 5B2ZA 1SCQA 4BFWA 2W70A 3UXMA 2FPKA 4IIGA 1W4BA 2J3EA 1RPTA 1GQYA 5DM0A 1O8BA 4F7DA 4JT2A 1GM5A 2IY8A 1NIJA 5JCJD 1QCZA 3FUUA 5EUCA 2OV6A 4M21A 2NG1A 4HEQA 3KBBA 1KDVA 1TQ8A 1TPYA 3TQSA 3K53A 1H3NA 2HJHA 4C7OB 1Y9AA 3VVBA 2OV1A 1EBBA 2QD4A 3V1LA 1Z18A 3GEMA 3DLPX 1N7JA 2QX7A 1KS2A 4AMGA 5JASA 3BYZA 1QYRA 4JS0A 4D8TA 1DBQA 1L3BA 1SWWA 1TWGA 2OORC 4JGBA 4PW0A 4W63A 3DDZX 2ONCA 5ALXA 4CG0A 1Q77A 1S6YA 2ZRPA 1F6DA 2VEOA 3ANTA 4QL3A 4ZT7A 2QR3A 1H6AA 4HGZA 3WRWA 4ZAWA 5A04A 5EJ5A 3M5WA 1XAGA 5B1DA 3NFRA 4H7DA 1WW2A 1NNSA 4AYXA 1HE5A 5EXSA 1FFGA 2G5GX 3I45A 2GVDC 2CDAA 3VKHA 4N6OA 4PTZA 2G04A 2ZATA 1FNMA 1QQTA 1WSWA 3KHTA 3VKVA 5K3AA 3H75A 5IP5A 4KITB 4H6VA 2NU6A 4JBYA 5L3QB 1JWLA 1FFAA 3H0KA 1NRJB 1XTZA 3QYJA 4M0KA 4YN3A 4G84A 3C8UA 3OM0A 1E2GA 1ESZA 2GYVA 3ENKA 4BB0A 3OHPA 2QRKA 4E5YA 1ZXBA 2NW6A 2ZI7A 3WOVA 1QP8A 5B7PA 5FR1A 3KQHA 4RVGA 4I2VA 1M72A 1H8EA 3CLUC 4UTPA 2JA1A 1PDWA 1BN7A 3BWVA 2GCGA 4QDOA 2C99A 4TTQA 4BS9A 4DJ5X 4D9NA 4MQFB 4U2GA 2H07A 3OX2A 4OHXA 2W6QA 2X0RA 2GEDA 3TQTA 3ZBUA 2NTNA 1E2KA 4WZZA 2OV4A 2SCUA 3FOAA 4Z9YA 1MDFA 2O7NA 4NBTA 4KSBA 1RIFA 3NIWA 1L5QA 1D5CA 1B8NA 4JJKA 1SVLA 1Y1TA 4Q0MA 1LNSA 5LD2B 4Y6QA 3TQCA 1L1EA 4MVJE 4XQGA 1NBMD 1YR3A 2PO5A 3N3BC 4YS6A 1DV2A 3LI2A 2B9VA 3TRFA 4H27A 1IH8A 5CXSA 1CZHA 1GVHA 1TVEA 5KAPA 4XH9B 3OPVA 3NV7A 4P6VF 4EHAA 2PWYA 3PHLA 4MI9A 4LF9B 4BO2A 2QTFA 1CZUA 1DEHA 1G64A 1UMCB 2C4VA 3OURA 3QLUC 5CPFA 1HSOA 1EWRA 4B48A 1GJRA 5AVQA 3T5PA 4OREX 2C2OA 1GLNA 1EUDB 3CUTA 4GMHA 5JNVA 4J9VA 2Q4RA 5DFAA 4MR7B 4DRZA 3QV1A 4TMKA 1O3YA 5EXEA 5LKRA 4EA6A 2GI4A 3F49S 1B74A 1CY7A 1W19A 1KJYA 5KB3A 2Q3HA 2JAQA 4GI5A 1FRVA 5TEVA 3MC1A 1UBJS 2XGGA 1UC8A 1K66A 2ONKA 5BN4A 3FKIA 3NGLA 1DKUA 3D3QA 1W9MA 4DA7A 4EGQA 4ZCSA 3GMIA 4DBLC 3RAFC 3W5AA 3TPFA 4HG2A 3ROMA 3JQ6A 2IF2A 1WPXA 3VAYA 2CNNA 3W79A 2WJVA 4I0WB 2DTXA 3EULA 2RJ3A 3T7IA 2Q9CA 4B83A 1P0QA 4PSKA 1XRSB 1YFLA 4RXTA 3GDGA 3S1LA 4M0MA 2CE2X 3ND9A 4RC9A 1GSIA 2IXGA 5IBQA 5BVHA 3HRIA 3KVYA 1W4CA 3U40A 1IAVA 2UZ1B 3KEQA 5LUBA 5I01A 2M6RA 4Q66C 2X7XA 3ITKA 3KPJA 1ZMTA 4HXGA 1KFKB 2WYIA 3CSSA 2KM1A 4MKIA 1GR1A 2MYNA 3C6XA 5BT9A 1KRWA 4PTYA 4J4BA 3HP7A 4MWCA 5AP9A 4C4ZA 3TMYA 2YXEA 3LY8A 3OSUA 5TQJA 5D84A 1S2OA 1G5FA 5IM4A 1SXIA 3D2BA 1IZ0A 2QROA 1Z7BA 3EBLA 1T35A 3F5FA 4HGOA 1MEOA 3K6SA 2GEJA 2YS6A 1S2IA 2BZSA 3AR8A 4H6PA 3U4AA 3ZE9A 4JLSA 4F06A 5L9AA 4KR3A 2HADA 1PR3A 2WNHA 3MBOA 3PFIA 4HNAB 2VQEB 2ZS8A 1MRZA 1EMDA 4QECA 1K08A 5LB4A 3E03A 3ETLA 3KKQA 4J43A 3ZZTA 4X7BA 1YA6A 2Z2KA 4MB0A 1G5TA 2XCIA 2PQMA 4QEDA 3NTUA 1E9BA 1W46A 4Q1FA 2Z9CA 3ZOZA 3G5TA 3C7TA 5CLQA 1FB5A 2WPNA 1SQFA 2C2WA 2JFHA 5I8PA 1JVNA 1NR5A 1AB6A 3RIHA 3AUXA 5FOSA 4O02B 4ESHA 2ZQ5A 1VL0A 2DCUA 5DLPA 1S3GA 4JI7B 2MYPA 1D5WA 3ED5A 3B53X 4F1WA 4F4HA 3RB8A 3LZDA 4B3SB 4P38A 1BOOA 5GY7A 3TSCA 4A6PA 2EX1A 1UP6A 3IUJA 5A4AA 3ZY6A 1JEQB 4ND5A 4D26A 1NXWA 1VPEA 1ZMOA 3C70A 4GEKA 4P84A 3NYWA 4GAEA 3QTLA 4NOJA 3Q7PA 3SR0A 2BSXA 1ORVA 3G2MA 1THTA 1GE9A 4QUGA 1BCRA 1DLJA 4G4JA 5C7OO 4A0QA 1FU8A 2P9QA 3WYGA 3UJPA 4TUYA 5KNBD 3LCRA 2GBLA 2AL7A 3EF1A 3MJSA 1BVHA 5T8KA 3ZCQA 4PLGA 1WCIA 3N3AC 3U4HA 4BGVA 1C50A 1TW3A 2P4QA 2ZSIA 4R84A 3OZRA 5CB0A 3Q15C 2ZETA 2DY1A 1M2OB 5K8CA 4N01A 1XV5A 2JJ1D 1YQTA 3BKXA 3ZU3A 5IJWA 3PR3A 4CEIB 1GZSA 1GG5A 2DQKA 5DO9A 4WZBA 5K9ZA 3P26A 4O2AB 5COAA 4OU5A 3HYSA 1MT3A 3O4RA 1Z15A 2ODTX 4ZCPA 3WP0A 3ZWVA 3ZXXA 1ZUHA 4A8HA 4D3YA 1KU6A 4FI3C 3DXZA 4D44A 1KIFA 1ISEA 2O1WA 4YRFA 2FP4A 3C3DA 2OV8A 3B13B 1MKYA 4RTPA 4LJ7A 2XCUA 1PT8A 1X74A 2RAFA 3NBQA 4TYNA 1WF3A 2YYSA 1QUFA 2PR7A 4FEYA 3WDKA 1W85B 3KOZA 3C5WP 1V3QE 2A78A 3NIDB 1IZZA 1GCOA 2IXFA 1I3KA 2W93A 2XUDA 3P4YA 3EG9B 5FOTA 4D3DA 3A6PC 3VOAA 1YBVA 2R65A 1Q7GA 3IO3A 5D3KA 2TSYB 5HW0A 3UW1A 1Y5MA 2WJ6A 5A3SA 2YQ4A 4MVCA 2IHNA 2WP0A 3FMPB 3PWTA 3ECCA 4N6NA 4ZV9A 2HDHA 1UPTA 2EYQA 2QI9C 1BH2A 4Q1AA 2QUJA 4QARA 2E4WA 4MRPA 1XJQA 3ZK9A 1TA9A 3LPCA 4YGXB 3E5NA 2HIGA 3UHPA 5CA0B 1Q57A 1UT8A 3JVIA 1NW7A 1JHVA 4CLOB 1Z6AA 3L8DA 1DKOA 5J5AA 4RQAA 4ZVQA 3SF8A 2QTCA 3SP1A 4WZAA 2BKVA 4YMVA 1YQXA 4C0SA 1JYFA 4TV8B 5C7YA 4WI1A 1A2BA 1LJ8A 2QAGC 2ZSEA 4YQZA 5CRIA 1J5PA 1XRRA 3MJ4A 3FSGA 2AG8A 5DCYA 2G76A 3VYTB 3X1MA 1KZ7B 2D1FA 3PHJA 5ESRA 1JFFB 1P1CA 3BC1A 3JATB 3UHJA 3L93A 1ZHOA 4OYYA 3PD7A 4F5WA 1QGUB 1X1DA 4PXSA 4US1R 4C4XA 5EWLA 3EXFA 3GQBA 4MIOA 5JIBA 4MINA 3UAXA 2BIFA 2A9PA 3GAMA 5DNVA 1APBA 2ZT5A 3HKZA 4D5EA 4FYDA 1VG9B 3AR2A 5THQA 3SHFA 4H4DA 4J8PA 2BYTA 4O2AF 1FDTA 2R9VA 5KWJA 3L0BA 3O2NA 1MC5A 1T1SA 2A5YB 4P54A 1KBQA 2O2XA 2PKYX 1ZD3A 3C5CA 2WQ7A 3EQ2A 5FNVA 3TCXB 3D7NA 4QVGA 1HDYA 2VJNA 3IP7A 1QNLA 1B7GO 1KF0A 1EHYA 2N75A 2QXTA 3IAFA 3IS3A 1NC3A 3OLQA 1K1EA 3R3SA 3UTCA 1FS4A 4ZOLB 2ZVDA 3IEMA 1FS5A 1MDBA 2Q62A 1D1QA 4BNYA 4BDSA 2XMQA 4EKGA 3JQFA 2EW2A 4MVJH 5JW6A 3CVJA 5A4IS 5F5NA 1Q74A 3MUFA 3X1KA 2GVNA 3M83A 2BFOA 1DEKA 3A4LA 3HBJA 2QSYA 1I7NA 1E2BA 3FTPA 4BV2A 3BWDD 4QU0A 2PDAA 4EX7A 1XKXA 1RHMA 3GZJA 3CE9A 3V55A 3FPGA 4KDFA 3OZ7A 4ENUA 1H4TA 3AERA 2KLBA 1TL8A 4P22A 1X1SA 4MS4A 5CA0F 1USGA 2ZI3A 1E2DA 2VRWA 3DR5A 2GCOB 2Q5CA 4G97A 2C0PA 4QIHA 2JLUA 3FX2A 3KB6A 3QNWA 2NLOA 2WT9A 5EZ5A 1H93A 3IEIA 4ZVSA 1K3TA 1UBFA 1WHTB 3HCNA 2JIRA 4L95C 4PLYA 1AGPA 4PSUA 4N7JA 4TV8F 2I7TA 4OOEA 3UMFA 5E1MA 3H5WA 4M22A 2PSDA 2HDOA 4E12A 3T5MA 4YCSA 2DX7A 3FNBA 1IRXA 1DJPA 1M1YE 2Q8NA 5TMPA 2GMWA 4IIHA 4OJYA 2B20A 4A6DA 3V3TA 1W88B 2Q3MA 4DVJA 3BMNA 1RFLA 5KYWA 2PKCA 1TWAA 5C8YA 3SZMA 3QX7A 1H0KA 5IZCA 1SCUB 4DT1B 2JI6A 2EERA 2AG5A 4DMUB 1Z4QA 2JKZA 5FBVB 2QWXA 4I9UA 2OQRA 5ALGA 3DE6X 1JG1A 4G2TA 1P2SA 4YJ2F 4QXAA 1WQHA 1OFUA 1DJNA 5AMXA 1IQUA 4R6XA 2QJOA 4LJ5A 4LZJA 1G60A 2QN2A 2YWFA 5EL0A 5ELMA 3FDZB 4TYWA 3FNFA 3VPXA 5IKOA 5MN4A 2J9YB 3K5PA 5JCXA 5H70A 5B30A 3VTFA 4YHBA 4ZOLF 1WMSA 1JHUA 3A4NA 1JHPA 2GEKA 3IQZA 4DV1B 3DFFA 3O91A 3P0RA 1W4RA 2NXJA 3NFYA 4OHCA 3B70A 2O3TA 3F96A 4PSAA 4M8KA 1R8QA 4R8LA 4F3NA 2OKGA 1TWHA 3COPA 5CT4A 3CRW1 3HA3A 2GHQA 3P8ZA 4GKVA 1LTHR 3BBPA 3BJZA 1L8XA 4IIDA 4EJ2A 1N5JA 5IAAA 1WL8A 1WD5A 3OO0A 2GO7A 4RNCA 1DI0A 3K20A 2HQOA 4EA8A 2B6HA 2XWSA 5KSYA 2GAOA 2ZYWX 1WUHS 3E9EA 1I33A 2BGKA 1BJRE 4DIOA 1C9DB 1P4AA 2Y0CA 3G8BA 1TLLA 3OOYA 4HLUC 3AZPA 5K3FB 3SC3A 5KTOA 4QYIB 4F8YA 3C16C 3E4DA 1RXUA 2OG1A 3FLBA 4OQXA 2O2YA 1A82A 3UBTA 2BGNA 2OHHA 3A1FA 1UJCA 3DCIA 4EGJA 2WU0A 4M9CA 3ZI0A 3GT4A 4M2LA 3HLYA 1I2AA 4OBEA 2JZNA 3A6LA 1S3IA 2I22A 4KQIA 3FHTA 4RLQA 4KIJA 4OGLA 3NRBA 4QBKA 1E58A 4FYJA 4E5PA 4S04A 3VH3A 1I7DA 4Z0PA 3FBTA 4DQ0A 3FLAA 5BUQA 5DOVA 2JDID 4RTLA 5F12A 4QU9A 3OC6A 4YJHB 4O5AA 1PYGA 1KDRA 1DOHA 4B7CA 1QJ4A 1ICEA 3K9QO 2XUFA 2JIMA 3AFHA 3EVDA 4X64B 4KREA 2BCEA 3ZNOA 3GP8A 3LUJA 5F98A 1Q1EA 4KBYA 1J7JA 2PCJA 4DR3B 2B30A 1JQJC 3OKPA 3AHEA 4IIBA 3L84A 1KOFA 3G0OA 4AZ0A 2Z8XA 1N6LA 2EOAA 3Q1LA 3IHTA 5KIAA 3FPEA 4MUKA 3DPIA 3LBHA 1B3BA 1QO0D 5K8VA 2YINC 3I9V6 4GDFA 3WLMA 3NIGB 2GZ2A 4BLRA 3G1UA 1V71A 1WMEA 3DH0A 4KYUA 4TTAA 2VDNB 1VMIA 2XMSA 4E1BA 1U0BB 5EE5B 9GPBA 3ZW8A 1Y9JA 4QDTA 1P61B 3MEQA 4EG4A 2GAFA 1VSUA 1C30A 3H4TA 2FW0A 4HLQB 4OAPA 4TXJA 4JYMA 2JFVA 3MJHA 4IJ5A 3DV9A 5BSEA 5H16A 1CQIA 1J1ZA 1JECA 1LWNA 3HVIA 4RMIA 4YQYA 1Q17A 1U6KA 2BGMA 1LI7A 3H16A 3JYQA 2CD7A 2XD4A 4MCHA 3UK7A 2GTHA 1RLIA 4GGOA 2QTVB 1JHQA 1NY6A 3G9QA 4I81A 2P2LA 4ARUA 1UMKA 5JS7A 1PX0A 1UBOS 2PGDA 3PEFA 1Z13A 4FD2A 4NNPA 3L0YA 4GW3A 1D0SA 1PR5A 1EFTA 1ZEJA 5ESWA 5A6SB 1XLTC 1CP2A 1JEOA 4H15A 4AICA 4DXAA 4UFOA 3T7KA 2IW3A 4BAZA 3ER8A 2XW6A 3CLSC 4DDHA 2P2DA 4K1LA 4TKUA 3ZWDA 2QLMA 3PPVA 1KPHA 3GIWA 2AHOA 4JVSB 4KR6A 2XVAA 4B76A 5EIAA 3OTOB 5T67A 5D8DA 1V43A 3M3PA 3NBUA 4PLHA 2A67A 5I5EA 1EHIA 2EX4A 3H9JA 1AHHA 2XCTB 2L0XA 3AL3A 1EQAA 4UU7A 1HE8B 2R6ZA 4QT4A 3QE3A 4V0OA 3FYCA 1H9BA 1RAEA 4MVJM 4Y9UA 1PLKA 2ID8A 5HFJA 4COKA 3LD9A 2HL6A 1ZN8A 1AHIA 4XEUA 3RC7A 3U4DA 1BW9B 2Q6VA 2XYHA 3E0XA 3KEFA 1NLMA 2NVWA 1TZMA 3U7EB 1LV8A 4EB6A 3GQVA 4EO9A 4A91A 3UAYA 1F8FA 1Y1QA 4S05A 1HFJA 3KR9A 3ROTA 1F2VA 2H65A 4MDEA 1FSGA 4YCMA 1YZVA 3F3MA 4AWBA 2GK7A 3PJDA 4ZHQA 2C2ZA 5J23A 2FMHA 3J81A 5SY4A 1I1QB 3VAZA 2X4IA 4P0TA 3QVWA 3WYNA 1EVEA 3THSA 3VU0A 1AKVA 3LQFA 1JYEA 3FCAA 2H57A 4MJ3A 1JPJA 3RYIB 3TL6A 5BUSA 4CF5A 4KXXA 3KKMA 3L43A 3K9NA 1IOWA 4KX5A 3ULKA 3V2GA 1U8UA 3N2IA 5DYTA 5CT8A 4Y2PA 1NNI1 2NZXA 2Z30A 3AU9A 3TLMA 4MGZR 3ZCUA 3FI0A 1THMA 3JQQA 4JI2B 1QH1A 2XX3A 1GITA 4UBOA 2PRZA 2IEGA 2OUIA 2A58A 4KYVA 4D8YA 1GCGA 2BGTA 4JOBA 1XRLA 1NBHA 3REGA 4MP8A 3WS7A 1FYDA 1ZZGA 1XKTA 5LYJB 2H5LA 1EB8A 3VU1A 1K4KA 2OHOA 1DIOB 1N75A 3DE5X 2V1UA 3TMAA 2CJYA 2ZUFA 1VSTA 2B5WA 3GUYA 3QVOA 2C5BA 5FUMA 2P91A 5D1HA 4NLLA 2VNSA 4ZO9A 2XOKD 3BOSA 3GHYA 3NJ8A 3QTTA 3ER9A 3PX7A 1KZYC 1XRNA 2AJDA 4CQLB 4R2MA 3OOEA 2C31A 2WWXA 4Q9HA 4YA6A 2FUG6 3I4LA 4KUEA 4HQ6A 1H2WA 3LHFA 4G5YA 2GA9A 1VG1A 1TJPB 2FN3A 3EOZA 3PFHA 9LDTA 5IULC 4KFCA 1U8CB 4NDZA 1A7UA 1C9NA 1NA5A 2Y1LA 3ILHA 3P9RA 4XD7A 4KN8A 4BGDA 5JWOA 1NPTO 4B3CA 3GJ7A 3QEBZ 3LCCA 4GOMD 3CUEF 3ILVA 4B45A 2LBPA 1L8QA 3LQKA 4AZ3B 5JT1A 4DLXA 4W5TA 4U8GA 1AN0A 5K20A 5ARCA 3CTMA 4LNAA 4HDMA 5KNCD 3R8FA 3L6CA 5HK9A 3H3FA 1YC5A 1K6EA 1MX1A 3HFJA 3GYBA 4YRCA 2ZI4A 1G6OA 1CPYA 2PU7A 1YR8A 4TN5A 3B36A 5F2KA 2GJKA 1DLIA 2R44A 2IUTA 1BGVA 3I9V1 1WQ1R 2YZNA 1VXRA 2Z8YA 4ZAZA 5ER6A 1JFLA 1KZ9A 4BNZA 2ZI9A 2YVUA 4HUJA 1M73E 4TT3A 4D9IA 4KQGA 1NH3A 3TEFA 2ZUDA 2E0IA 2V7GA 1LFAA 3GZTB 1T15A 3PC7A 2CB0A 3V1KA 1EG7A 1R6VA 3VSBA 2OO3A 2ZM5A 4X41A 3TR0A 4NOMA 3OJCA 3SQWA 4GQAA 2IE8A 3GROA 2X15A 5EZQA 1XRQA 3BTVA 3OWOA 4BQRA 5ICMA 3CCFA 2Q5FA 4R3WA 4AJ4A 2JVJA 5JC1A 1R9TA 3GTOA 4RO0A 4BX9A 2HY7A 4TXMA 1B73A 4DA6A 5LYJF 2WPDA 4PRYA 4DMKA 5KKCA 1HNZB 3OQMA 2CNLA 2OM6A 3GUVA 3N0XA 4PN3A 3AVUA 4HAXA 1XVTA 3EIXA 1HV8A 1T0HB 3FF1A 2ZFUA 3AX6A 1TK2A 3JWJA 3MYRA 4YRDA 5KQMA 1VKJA 3CVYA 3T99A 1PL0A 1AV7A 4AKTA 4REQA 5TIIA 1VKOA 4Q24A 5D6NA 4ALIA 2XVYA 3G23A 3ESDA 1QOPB 1RZVA 2QQ0A 3I01A 3KU4A 3B51X 3CXRA 2GPAA 4HEA6 1CUUA 2CXTA 1RBYA 5D7NA 1ZDMA 1PS8A 4V0KA 3W1VA 1T4DA 2CLIB 1OFVA 5P8WA 2IHYA 2H2WA 4NS1A 4ENTA 3WK4A 5MF6A 3GV0A 4YRBA 3Q3JB 5AR1A 4B80A 1A8QA 4LEIA 3AVXA 5BOVA 2I8CA 5DN6A 2XRYA 1XZEA 2EEZA 2VDRB 3HABA 1QG4A 1DKQA 2Y77A 3GCZA 5BXYA 5HM8A 2KSQA 4L27A 3TW8A 5FT9A 4EHKA 2EW1A 1G8MA 3ZV7A 4CE6A 2VFAA 1M7GA 3UXYA 4R1LA 1I2BA 2XAUA 1V6AA 2B99A 3PVZA 3D6MA 2JARA 2I4IA 5DXJA 3VKUA 2NO7A 4OHUA 5ADVA 4QUDA 1M34A 1Q0LA 1OX4A 2Q7DA 1NUSA 4ED9A 3HJUA 1KMHA 1P45A 1U31A 2JAWA 2PL1A 2XYQA 5KVCA 1JQEA 3QXJA 3TF5A 5CYFA 4IJVA 3VR4H 2IZ7A 1XCBA 4HO1X 4PCAA 3VKGA 4MR9A 2JLVA 1G63A 3KE9A 2CXXA 1XCOA 3EPPA 4TWJA 1ZITA 5FPQA 2LCIA 3OJOA 2QQFA 5D5QA 2YCBA 2NZVG 3FUVA 2QR5A 3Q7RA 4WHMA 1RWPA 5KOHA 1K2VN 3HDGA 2VJCA 3LPAA 3EIOA 1KXJA 3SXUB 2ICAA 3C1OA 4IHKA 4RK6A 2RIRA 2OXRA 3I2GA 4GYJA 4M4SA 1NG9A 5L4NA 1SURA 3SNKA 5I7AA 1BC5A 1UT5A 3VDQA 1ODKA 1RYDA 1ZUNA 2VBIA 3EUWA 5BURA 3GLTA 4DCGA 3T7AA 1OLUA 4OJMX 4QOIA 3DVAA 2WMDA 3HYRA 3K59A 3EZGA 4BNDB 3VPAA 4X60A 1XP5A 3KQYA 4IO0A 2I3AA 1XK7A 1L7OA 1LS6A 1RHUA 2J85A 2O14A 2P1DA 3DT6A 1NVGA 3M4JA 4ZEWA 4D8VA 4QGSA 1Y3BE 5INTA 1UPBA 3M70A 4PU0A 2DZDA 4TZTA 1O94C 3TPZA 3TTYA 1U99A 1PZNA 4N0PA 3ZXSA 4QFBA 3TL3A 4C6HA 3I0ZA 4UTNA 1M0EA 3WXBA 4W82A 2OG2A 3TH5A 1PYOA 4UVIA 2VP3A 3KYBA 3HKCA 4M8NE 1GFWA 3GMDA 2E4UA 3HDJA 3LT4A 5BNIA 4EYEA 2YIMA 1RAAA 5LLSA 3OLYA 4HDSB 3RVPA 4CL0A 2LCFA 4R2XA 3RBZA 1GFSA 3E82A 4DMMA 1XXHA 3GTPA 1DC6A 4W6ZA 5LZ4A 3H9QA 5GMOA 1S89A 4IWXA 4M1OA 3Q40A 2WD9A 4PBTA 1Q7TA 3BXXA 5DV9A 3Q6IA 5BYAA 3D8TA 1E5LA 4OKIA 3OM1A 4X1KA 1SD2A 1X70A 3AUFA 4COOA 5KEIA 1COWD 5AW7A 1GGEA 2VKQA 2EDCA 2ZJ2A 3Q3HA 4Y2JA 1S02A 3ZCPA 4QDKA 2VQ6A 4AJIA