4NOOB

Molecular mechanism for self-protection against type vi secretion system in vibrio cholerae
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
95
structure length
95
Chain Sequence
b'CNDTSGVHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VgrG protein
publication title Molecular mechanism for self-protection against the type VI secretion system in Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Immune system
total genus 33
structure length 95
sequence length 95
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1160 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nooB00
4NSOB 4NOOB 4NSRA
chains in the Genus database with same CATH superfamily
2LBCA 1NY6A 3LVVA 4LJ7A 1E32A 2JZ1A 1WGNA 4L6V6 1OJLA 5EXTA 4BBAA 4LG2A 4LGYA 1DV0A 4B7GA 3GLHE 4QHTA 2FS1A 5C1BA 1Q3BA 2JNHA 1Z59A 3FTEA 3SAVA 1LV7A 1WR1B 1XMOM 1EFUB 3H4JA 3TE6A 1IXSA 3TWLA 2AHMA 1XMQM 3HJQA 2LWXA 3UGJA 2HHHM 4LFAM 3GP1A 2UXCM 2C99A 3U6CA 1V33A 1T6OA 2QENA 2R44A 2I7PA 2OOAA 4WP2A 3I51A 3ZH9B 2DAGA 2OPFA 2ZTCA 3TWKA 2DWMA 2QPAA 3ZC7B 3GQ5A 4MH0E 2CV1A 5KPZA 4OX9M 5F3WA 4CJ6A 1OTRA 3GQ3A 2DAMA 2KW0A 3BOSA 1JR3A 4DV1M 3SAUA 2I7NA 3AJIB 2XH9A 3HZJA 1Q02A 4QOZC 1IBMM 4AKHA 1PM5A 1E9SA 1YLAA 4IBJA 1IN6A 2R4JA 4KO8A 1TGUA 5IWAM 1K3XA 2FOIC 3CF2A 2H5XA 4LJ8A 4Q7JA 2MH8A 4GKKM 2A5YB 4GEWA 1OFIA 3WHKA 2LH0A 1HQCA 4L15A 3ZQJA 3AV0A 4G4RA 1OAOC 4BLCA 3E9SA 3U5ZB 1EE8A 3WHLA 2C9OA 3FRIA 1OIZA 1GLNA 4LY6A 3J2PB 4FCVA 3CTWB 1TDZA 2KNVA 2R45A 3W0FA 3K8ZA 3GLFE 3KS4A 3VKHA 2GNOA 3KVWA 4MGKE 3L26A 4IJEA 1ZMUA 2J7NA 3D8LA 1SXJD 1TF0B 2L7HA 2DAIA 3UZUA 4B3SM 1OIPA 1OAIA 3L29A 1KYIA 3U60B 1N33M 3FUWA 3KOWE 4LCBA 3AOEA 1ZAEA 2Q2EB 5ITRA 3EIEA 1L1ZA 3HY5A 4WURA 1J09A 1WXQA 2LVAA 3PXGA 3J81S 2MJ5B 3J7AS 4GHAA 5FTKA 4JYAM 4IBBA 4LF7M 1QDTA 3Q8XA 2ZAOA 4LRTA 2BWEA 3B89A 2G3QA 5ITTA 2DAEA 3GLIE 4XGIA 2E5LM 3UJNA 4DR4M 2XF3A 3FUXA 4JI7M 2O01F 3QAUA 4DUZM 1TR8A 5FLXS 3U6DA 3DA1A 4ZPXA 1GO5A 1L1TA 4M9ZA 1IN7A 1G3IA 3FD9A 1HT2E 2J5YA 1XC8A 4B3TM 4NRVA 4KHPM 2CV0A 1E9RA 4IBEA 4MGYE 5EP1A 3GQ4A 2RKOA 3QYEA 4NXNM 3PNYA 4AKIA 2D7GA 1ZQ9A 3VKGA 4F1IA 3AFHA 3NWLA 1TH3A 2YFQA 1NVMA 3SAWA 3U60A 3SARA 1W5SA 1QZEA 2RGOA 3IG8A 3SBJA 1IQPA 4M9XA 3TL4X 3W0LB 3SMSA 3LCVB 3MHVC 1VQ1A 2D7HA 5EXPA 4DR3M 3AL0C 1WHCA 1L2DA 4R7GA 2DI0A 3CGWA 4I5SA 1P3QQ 1JR3E 2LXEA 4DV5M 1FNNA 1UM8A 2VDBB 3HJ8A 3KSJA 4KLNA 1D0MA 2JUJA 4ITQA 2L09A 1F4IA 1YSYA 1NJFA 4II7A 1NV9A 2ZBKB 1HQYE 4RF1A 3SFZA 2NQ8C 3EIHA 2QP9X 3TPZA 4AW4A 1IN8A 1QVRA 3HWSA 4FD2A 3Q8GA 1GL6A 1ZMWA 1VDDA 2ZANA 2QBYB 1L8QA 3I04M 4DR6M 4B08A 2JA2A 1IBLM 4GKJM 5IREB 4GH9A 3FYDA 2DKLA 2XFTA 2Y21A 3THGA 1DGGA 2WZJA 3KOXE 4PT5A 1DGFA 1MX0A 1QANA 2JY7A 4M0WA 1NNJA 1IY0A 4K0KM 1VEKA 3I01M 3IHPA 3MK6A 2K47A 2C96A 5EP3A 2JY6B 4X65M 3GPUA 1JR3D 2Y0TA 2LHGA 3GRYA 4P17A 5DYGA 1XWIA 4JXJA 2JXNA 3UK6A 4DV2M 4LZJA 1GJTA 4AZFA 4AG6A 1HNWM 2XSZD 3PNVA 2FNAA 2VQFM 1WGLA 3T1HM 3FTFA 2R4EA 4FCWA 1PRBA 2X49A 3K9OA 1E94E 2BJVA 1W5TA 4DR1M 1G41A 1S3SA 3U6MA 3KFUG 4TUWA 3B7QA 3FUUA 1N32M 3R9XB 4JI4M 4B3RM 4MGIE 1N78A 4MGHA 4IIWA 4Z8XA 3SHGB 2Y20A 4IBGA 4IBCA 4IJFA 2CHQA 4OW0A 4I8OA 2UUBM 2OQ4A 5E26A 4CHTB 4D82A 2Z4SA 4LJ4A 3A42A 5E6JA 4DV0M 3FTCA 1IXRC 1N75A 5JI2E 5BPVA 3HU2A 4LJAA 1IFYA 2KRUA 2XFSA 1IY1A 1NY5A 4OVZB 2DWLA 2QNJA 1HR0M 4DR5M 3M7GA 3I4YA 4MM3B 2F5NA 4GRIA 1IN4A 1GABA 3B7NA 2Y0QA 3AOEC 2B3TA 4AKGA 4LF6M 1PJSA 4GC5A 4WW0A 2R65A 3RGPA 3HHYA 7CATA 2XLJA 3BBZA 4AG5A 1G59A 4LF4M 2XZUA 3HHXA 5LMUM 3E46A 3SC3A 2DWZB 4LGMA 2L4FA 2R6FA 4CISA 4G4NA 1I4WA 2W82A 2VF7A 2R0IA 4NXMM 4FVMA 4LJ5A 1TH4A 3J80S 5EXXA 1R6BX 2KZSA 3AKZA 2K0BX 1L2CA 3SYLA 2KZUA 2HCBA 4JV5M 3VDUA 4HL4A 3TQSA 3A98B 1AUAA 3GRUA 4L8RC 5FSWA 4IBIA 5GKNA 1NV8A 4X66M 4QNMA 2QQ8A 1SXJB 1MN3A 1G4AE 3K9PA 4OVZA 4DR7M 2DHRA 3AOGA 4B3MM 3NBXX 5ITQA 2LNHC 4R71A 2XGNA 1H6UA 1AIPC 2DZOB 2J7OA 5DYIA 3GPYA 4I4LA 1L2BA 5LMNM 3LQRA 2UXDM 2ERCA 1Y8GA 2LVNC 5ITXA 3U6LA 3FTDA 1NSFA 4XBOA 3U5ZA 3SATA 2UUAM 1QAOA 3U6OA 1G8PA 2HKJA 1R5LA 2R18A 5KPRA 5IZ7D 1NNUC 4D81A 4NRWA 1PJTA 2P5TA 2KNZA 5KO3A 1C7YA 1NHGC 2VF8A 4G6ZA 3T6PA 4PDIA 4JI2M 2M60A 2FE8A 3QYBA 4JN6A 1DO0A 3M6AA 2RRUA 2CHVA 3C3EA 3U61B 4NC6A 4RF0A 2EKKA 4KODA 1K3WA 3VFDA 3KS8A 1T43A 2EO2A 2ZAMA 4ANRA 3MMPA 3B74A 1FJGM 2CFOA 3GLGB 3TWMA 5FTLA 4YHHM 1D0KA 1XXHB 1T3TA 4OU7A 1SXJA 2DAKA 4GHLA 2JY8A 3W68A 4DV6M 5EXSA 1ORYB 2UU9M 1N34M 2Z4RA 3I4VA 3GRVA 4X62M 1Z5BA 1IBKM 4LFBM 3VK7A 4UN2B 3IECA 5EP4A 2CRUA 1GKIA 1DGBA 2KXEA 4XK8F 4PDGA 2EKFA 4QHSA 2F5SA 3JR4A 3KDSE 2WSEF 2FFJA 2MROB 4JI0M 2KNAA 2C98A 2WSFF 3LCUA 3J27B 4G3OA 3RE8A 3OTOM 4JI3M 4AQYM 1R2YA 3JAMS 2R46A 2LHCA 2OOBA 2F4VM 1MU5A 4NSRA 4IBFA 1VEGA 4FWDA 4CGYB 8CATA 3BXWA 1IXSB 1N36M 3KOYE 3CF0A 2G8LA 1HNXM 4DV3M 4L16A 4MB7A 4DV7M 2YNMD 3VLFB 3SASA 4P16A 3HU3A 3L28A 3K2LA 3SMPA 1LTMA 3KSXA 2CEAA 3FUVA 3F92A 1PGYA 4LJ9A 4DBGB 3GLGA 1SG9A 1XXHA 2QSFX 2F5PA 3L2AA 5L8RF 2OO9A 4GITA 4L4UA 4YY3M 2Z7JA 1HJPA 3T38A 1CUKA 3KW6A 4RKUF 4LF8M 3FUTA 4QNRA 2G5GX 2HL7A 3HU1A 3HX3A 1KFVA 3SHFA 4FCTA 4S12A 3KXEC 1OFHA 1QZMA 2XEPA 2DENA 4M0DA 2F5OA 2VIIA 1XNRM 2VQEM 5C18A 2Z3XA 3A46A 1I94M 4IBDA 4Y28F 3CF6E 2QBYA 2ZTDA 5ITXE 2V1CA 1WJ7A 3IG5A 2MGWA 1KSFX 3LMMA 1VG5A 4JI5M 2ZM6M 4JI6M 4EIWA 2CHGA 1DGHB 2C5RA 1GL7A 3HGIA 4FWGA 2JY5A 4DUYM 4BB9A 1IY2A 3GRRA 2F5QA 1NO1A 3MJ5A 3HHWA 3U6PA 2DNAA 3GLHB 1J5EM 2L4EA 1D0LA 1VEJA 2DXIA 1IM2A 4GMQA 2D7EA 4X64M 1YUBA 2V6ZM 2C9CA 2HAKA 4NSOB 5KQDA 2UXBM 1Z5AA 1C1KA 3FE3A 1EIJA 2L7IA 2KHHA 2L6OA 2XZFA 3KP1E 3DFZA 5BR8M 3A45A 1SXJE 5A2QS 5EP2A 2QHOB 1GJSA 1QAMA 4A3VB 3W67A 3L25A 2XSZA 1QAQA 2YR0A 3NBIA 4LJ6A 4F2LA 4CIZA 2K6BA 4HLQA 4LF9M 1JQJC 3LW5F 5EJCA 2UUCM 5FTMA 1V34A 2Z8YM 2YQZA 3C3DA 3GPPA 3C9PA 4DV4M 4R3DA 4NL4H 2GQFA 2CV2A 1NJGA 1X37A 1ZMVA 1DGHA 2CP8A 4HEOA 4KT0F 3K92A 3PVSA 4L78A 3T1YM 1R2ZA 3ZCBB 4FWHA 2DZLA 1TH2A 1PJQA 3GLHA 3M0EA 3U6SA 1BVSA 2JWSA 2LTUA 1OQYA 1WIVA 2WSCF 1J7KA 4B7HA 1QDRA 3FRHA 1SXJC 3RFWA 2QZ4A 3ILKA 3T15A 4PD2A 2BJWA 1R4GA 4GIPA 3GLGE 3U6EA 5KQ8A 2O5RA 3KOZE 3U6QA 1XXHE 1PJJA 2KEBA 5FTJA 3VDPA 4B7FA 3GLFB 2X4AA 1IN5A 5H37D 2QCUA 5ITUA 1IXZA 4D80A 3HJSA 1Z5CA 2N35A 3RGSA 5DFLA 3H4MA 5JI3E 4G4QA 2LVOC 2H1RA 2DHYA 2KRKA 4AI6A 3HKPA 1JB0F 1V92A 2EJSA 3B7ZA 1Z6TA 4MGZE 3KP0E 2LVPC 4REZA 3D8BA 1PJIA 1R7RA 2L2DA 1ZV1A 1Q39A 2DWNA 5DNYA 1XHBA 1K82A 1NHWC 1OKSA 4IBKA 3GO8A 3E4RA 3C58A 1QUTA 3FKEA 1QUSA 4W5WA 3GLIB 3DZDA 3K1JA 4PCZA 1QYRA 5KPTA 4Z6YA 4GC9A 3L27A 3FYCA 4JI8M 1TTEA 2LVQD 3LQQA 1TDHA 4FW9A 2JZ0A 3B9PA 2BWBA 3QWLA 1GVNA 1N77A 3E21A 4LF5M 1HT1E 1G71A 1XB2B 3UMMA 2EA0A 4JI1M 3HHZA 3DOAA 3V76A 3GLFA 3J7BA 5ITYA 2V1UA 1UFZA 2O25A 3GPXA 1MJGM 1RU3A 4I81A 3U61A 2APLA 1A5TA 1Q3CA 2CUZA 1D2NA 2KDLA 1HNZM 2X8AA 3LVWA 1DO2A 2JP7A 4NOOB 2BNKA 1YE9A 2KA6B 2EUCA 4M9SA 2CE7A 3R8FA 1QQWA 3VK8A 3PFIA 4LRSA 4QOSA 4RNAA 5FTNA 2HWJA 4LZZA 4G4OA 2CWBA 2FH0A 2K9DA 2R62A 2M5ZA 1XNQM 1VDLA 2DVWB 4LFCM 5IT9S 5EQTA 2DZNB 3JR5A 2MR9A 4DR2M 2RGHA 3SYKA 3GLIA
chains in the Genus database with same CATH topology
1NY6A 3LVVA 4LJ7A 1E32A 1OJLA 5EXTA 4BBAA 4LG2A 4LGYA 4B7GA 4QHTA 5C1BA 1Q3BA 1Z59A 3FTEA 3SAVA 1LV7A 1XMOM 3TE6A 3TWLA 2AHMA 1XMQM 3HJQA 2LWXA 3UGJA 2HHHM 4LFAM 3GP1A 2UXCM 2C99A 3U6CA 2QENA 2I7PA 3ZH9B 3I51A 2OPFA 3TWKA 2DWMA 2QPAA 3ZC7B 3GQ5A 4MH0E 2CV1A 5KPZA 4OX9M 5F3WA 3GQ3A 2KW0A 3SAUA 3BOSA 1JR3A 4DV1M 2I7NA 3AJIB 2XH9A 4QOZC 4AKHA 1IBMM 1PM5A 1E9SA 4IBJA 1IN6A 2R4JA 4KO8A 1TGUA 5IWAM 1K3XA 2FOIC 3CF2A 4LJ8A 4GKKM 2A5YB 1OFIA 3WHKA 2LH0A 1HQCA 4L15A 3AV0A 4G4RA 4BLCA 3E9SA 3U5ZB 1EE8A 3WHLA 2C9OA 1GLNA 4LY6A 3J2PB 4FCVA 3CTWB 1TDZA 3VKHA 2R45A 3W0FA 3K8ZA 3KS4A 3KVWA 4MGKE 3L26A 4IJEA 2J7NA 3D8LA 1SXJD 2L7HA 3UZUA 4B3SM 3L29A 1KYIA 3U60B 1N33M 3FUWA 3KOWE 4LCBA 3AOEA 1ZAEA 2Q2EB 5ITRA 3EIEA 1L1ZA 4WURA 1J09A 1WXQA 3PXGA 3J81S 3J7AS 4GHAA 5FTKA 4JYAM 4IBBA 4LF7M 3Q8XA 2ZAOA 4LRTA 5ITTA 2E5LM 4XGIA 3UJNA 4DR4M 2XF3A 3FUXA 4JI7M 3QAUA 4DUZM 3U6DA 5FLXS 3DA1A 4ZPXA 1L1TA 4M9ZA 1IN7A 1G3IA 3FD9A 1HT2E 4B3TM 1XC8A 4KHPM 4NRVA 2CV0A 1E9RA 4IBEA 4MGYE 5EP1A 3GQ4A 2RKOA 4NXNM 3PNYA 4AKIA 2D7GA 1ZQ9A 3VKGA 3AFHA 3NWLA 1TH3A 2YFQA 1NVMA 3SAWA 3U60A 3SARA 3IG8A 1W5SA 2RGOA 3SBJA 1IQPA 4M9XA 3TL4X 3W0LB 3SMSA 3MHVC 2D7HA 5EXPA 4DR3M 3AL0C 1L2DA 4R7GA 4I5SA 2LXEA 4DV5M 1FNNA 1UM8A 3HJ8A 3KSJA 4KLNA 4ITQA 2L09A 1YSYA 1NJFA 4II7A 2ZBKB 1HQYE 4RF1A 3SFZA 2NQ8C 3EIHA 2QP9X 3TPZA 4AW4A 1IN8A 1QVRA 3HWSA 4FD2A 1GL6A 1VDDA 2ZANA 2QBYB 1L8QA 4DR6M 4B08A 2JA2A 1IBLM 4GKJM 5IREB 4GH9A 3FYDA 2XFTA 2Y21A 3THGA 1DGGA 3KOXE 4PT5A 1DGFA 1MX0A 1QANA 4M0WA 1NNJA 1IY0A 4K0KM 3MK6A 2K47A 2C96A 5EP3A 4X65M 3GPUA 1JR3D 2Y0TA 3GRYA 5DYGA 1XWIA 4JXJA 4DV2M 3UK6A 4LZJA 4AZFA 1HNWM 4AG6A 2XSZD 3PNVA 2FNAA 2VQFM 3T1HM 3FTFA 2R4EA 4FCWA 2X49A 4DR1M 1E94E 2BJVA 1W5TA 1G41A 1S3SA 3KFUG 4TUWA 3FUUA 1N32M 4JI4M 4B3RM 4MGIE 1N78A 4MGHA 4IIWA 4Z8XA 3SHGB 2Y20A 4IBGA 4IBCA 4IJFA 2CHQA 4OW0A 4I8OA 2UUBM 2OQ4A 5E26A 4CHTB 4D82A 2Z4SA 4LJ4A 3A42A 5E6JA 4DV0M 3FTCA 1IXRC 1N75A 5JI2E 5BPVA 3HU2A 4LJAA 2KRUA 2XFSA 1IY1A 1NY5A 4OVZB 2DWLA 1HR0M 4DR5M 3M7GA 3I4YA 4MM3B 2F5NA 4GRIA 1IN4A 2Y0QA 3AOEC 4AKGA 4LF6M 4GC5A 4WW0A 2R65A 3RGPA 3HHYA 7CATA 2XLJA 4AG5A 1G59A 4LF4M 2XZUA 3HHXA 5LMUM 3SC3A 2DWZB 4LGMA 4CISA 4G4NA 1I4WA 2W82A 4NXMM 4FVMA 4LJ5A 1TH4A 3J80S 5EXXA 1R6BX 2KZSA 3AKZA 1L2CA 3SYLA 2KZUA 2HCBA 4JV5M 3VDUA 4HL4A 3TQSA 3A98B 3GRUA 4L8RC 5FSWA 4IBIA 5GKNA 4X66M 4QNMA 1SXJB 1G4AE 4OVZA 4DR7M 2DHRA 3AOGA 4B3MM 5ITQA 2LNHC 2XGNA 1H6UA 2DZOB 2J7OA 5DYIA 3GPYA 4I4LA 1L2BA 5LMNM 3LQRA 2UXDM 2ERCA 5ITXA 3U6LA 3FTDA 1NSFA 4XBOA 3U5ZA 3SATA 2UUAM 1QAOA 3U6OA 1G8PA 2HKJA 2R18A 5KPRA 5IZ7D 1NNUC 4D81A 4NRWA 2P5TA 5KO3A 1NHGC 4G6ZA 4PDIA 4JI2M 2M60A 2FE8A 4JN6A 1DO0A 3M6AA 2CHVA 3U61B 4RF0A 4KODA 1K3WA 3VFDA 3KS8A 2EO2A 2ZAMA 1FJGM 2CFOA 3GLGB 3TWMA 5FTLA 4YHHM 1XXHB 1T3TA 4OU7A 1SXJA 4GHLA 4DV6M 5EXSA 1ORYB 2UU9M 1N34M 2Z4RA 3I4VA 3GRVA 4X62M 1Z5BA 1IBKM 4LFBM 3VK7A 5EP4A 1GKIA 1DGBA 2KXEA 2F5SA 4PDGA 4QHSA 3JR4A 3KDSE 2FFJA 4JI0M 2C98A 4AQYM 3RE8A 3J27B 3OTOM 4JI3M 1R2YA 3JAMS 2R46A 2F4VM 1MU5A 4NSRA 4IBFA 4FWDA 4CGYB 8CATA 1IXSB 1N36M 3KOYE 3CF0A 2G8LA 1HNXM 4DV3M 4L16A 4MB7A 4DV7M 2YNMD 3VLFB 3SASA 4P16A 3HU3A 3L28A 3K2LA 3SMPA 3GLGA 3KSXA 2CEAA 3FUVA 3R9XB 4LJ9A 2F5PA 1XXHA 3L2AA 4GITA 4L4UA 4YY3M 2Z7JA 3T38A 3KW6A 4LF8M 3FUTA 4QNRA 2G5GX 2HL7A 3HU1A 1KFVA 3SHFA 4FCTA 4S12A 3KXEC 1OFHA 1QZMA 2XEPA 4M0DA 2F5OA 2VIIA 1XNRM 2VQEM 5C18A 2Z3XA 3A46A 1I94M 4IBDA 3CF6E 2QBYA 5ITXE 2V1CA 3IG5A 1KSFX 3LMMA 4JI5M 2ZM6M 4JI6M 4EIWA 2CHGA 1DGHB 2C5RA 1GL7A 3HGIA 4FWGA 4DUYM 4BB9A 1IY2A 3GRRA 2F5QA 3MJ5A 3HHWA 3U6PA 3GLHB 1J5EM 2DXIA 1IM2A 4GMQA 2D7EA 4X64M 1YUBA 2V6ZM 2C9CA 4NSOB 5KQDA 2UXBM 1Z5AA 1C1KA 2L7IA 2L6OA 2XZFA 3KP1E 3DFZA 5BR8M 3A45A 1SXJE 5A2QS 5EP2A 1QAMA 4A3VB 3L25A 2XSZA 1QAQA 2YR0A 3NBIA 4LJ6A 4HLQA 4LF9M 1JQJC 5EJCA 2UUCM 5FTMA 2YQZA 4DV4M 3GPPA 4R3DA 4NL4H 2CV2A 1NJGA 1X37A 1DGHA 3T1YM 3K92A 3PVSA 4L78A 1R2ZA 3ZCBB 4FWHA 1TH2A 3GLHA 3M0EA 3U6SA 1J7KA 4B7HA 1SXJC 3RFWA 2QZ4A 3ILKA 3T15A 4PD2A 2BJWA 4GIPA 3U6EA 5KQ8A 2O5RA 3KOZE 3U6QA 1PJJA 2KEBA 5FTJA 3VDPA 4B7FA 3GLFB 2X4AA 1IN5A 5H37D 2QCUA 5ITUA 1IXZA 4D80A 3HJSA 1Z5CA 3RGSA 3H4MA 5JI3E 4G4QA 2H1RA 2KRKA 4AI6A 3HKPA 1Z6TA 4MGZE 3KP0E 4REZA 3D8BA 1PJIA 1R7RA 1Q39A 2DWNA 5DNYA 1XHBA 1K82A 1NHWC 4IBKA 3GO8A 3E4RA 3C58A 3FKEA 3GLIB 4W5WA 3DZDA 3K1JA 4PCZA 1QYRA 5KPTA 4Z6YA 4GC9A 3L27A 3FYCA 4JI8M 3LQQA 1TDHA 4FW9A 3B9PA 3QWLA 1GVNA 1N77A 4LF5M 1HT1E 3UMMA 2EA0A 4JI1M 3HHZA 3DOAA 3GLFA 3J7BA 5ITYA 2V1UA 3GPXA 4I81A 3U61A 1Q3CA 2CUZA 1D2NA 1HNZM 2X8AA 3LVWA 1DO2A 4NOOB 2BNKA 1YE9A 2KA6B 2EUCA 4M9SA 2CE7A 3R8FA 1QQWA 3VK8A 3PFIA 4LRSA 4QOSA 4RNAA 5FTNA 4LZZA 4G4OA 2R62A 2M5ZA 1XNQM 5IT9S 2DVWB 4LFCM 5EQTA 2DZNB 3JR5A 3U6MA 4DR2M 2RGHA 3SYKA 3GLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NSO B;  4NOO B;  4NSR A; 
#chains in the Genus database with same CATH topology
 2LBC A;  1NY6 A;  3LVV A;  4LJ7 A;  1E32 A;  2JZ1 A;  1WGN A;  4L6V 6;  1OJL A;  5EXT A;  4BBA A;  4LG2 A;  4LGY A;  1DV0 A;  4B7G A;  3GLH E;  4QHT A;  2FS1 A;  5C1B A;  1Q3B A;  2JNH A;  1Z59 A;  3FTE A;  3SAV A;  1LV7 A;  1WR1 B;  1XMO M;  1EFU B;  3H4J A;  3TE6 A;  1IXS A;  3TWL A;  2AHM A;  1XMQ M;  3HJQ A;  2LWX A;  3UGJ A;  2HHH M;  4LFA M;  3GP1 A;  2UXC M;  2C99 A;  3U6C A;  1V33 A;  1T6O A;  2QEN A;  2R44 A;  2I7P A;  2OOA A;  4WP2 A;  3I51 A;  3ZH9 B;  2DAG A;  2OPF A;  2ZTC A;  3TWK A;  2DWM A;  2QPA A;  3ZC7 B;  3GQ5 A;  4MH0 E;  2CV1 A;  5KPZ A;  4OX9 M;  5F3W A;  4CJ6 A;  1OTR A;  3GQ3 A;  2DAM A;  2KW0 A;  3BOS A;  1JR3 A;  4DV1 M;  3SAU A;  2I7N A;  3AJI B;  2XH9 A;  3HZJ A;  1Q02 A;  4QOZ C;  1IBM M;  4AKH A;  1PM5 A;  1E9S A;  1YLA A;  4IBJ A;  1IN6 A;  2R4J A;  4KO8 A;  1TGU A;  5IWA M;  1K3X A;  2FOI C;  3CF2 A;  2H5X A;  4LJ8 A;  4Q7J A;  2MH8 A;  4GKK M;  2A5Y B;  4GEW A;  1OFI A;  3WHK A;  2LH0 A;  1HQC A;  4L15 A;  3ZQJ A;  3AV0 A;  4G4R A;  1OAO C;  4BLC A;  3E9S A;  3U5Z B;  1EE8 A;  3WHL A;  2C9O A;  3FRI A;  1OIZ A;  1GLN A;  4LY6 A;  3J2P B;  4FCV A;  3CTW B;  1TDZ A;  2KNV A;  2R45 A;  3W0F A;  3K8Z A;  3GLF E;  3KS4 A;  3VKH A;  2GNO A;  3KVW A;  4MGK E;  3L26 A;  4IJE A;  1ZMU A;  2J7N A;  3D8L A;  1SXJ D;  1TF0 B;  2L7H A;  2DAI A;  3UZU A;  4B3S M;  1OIP A;  1OAI A;  3L29 A;  1KYI A;  3U60 B;  1N33 M;  3FUW A;  3KOW E;  4LCB A;  3AOE A;  1ZAE A;  2Q2E B;  5ITR A;  3EIE A;  1L1Z A;  3HY5 A;  4WUR A;  1J09 A;  1WXQ A;  2LVA A;  3PXG A;  3J81 S;  2MJ5 B;  3J7A S;  4GHA A;  5FTK A;  4JYA M;  4IBB A;  4LF7 M;  1QDT A;  3Q8X A;  2ZAO A;  4LRT A;  2BWE A;  3B89 A;  2G3Q A;  5ITT A;  2DAE A;  3GLI E;  4XGI A;  2E5L M;  3UJN A;  4DR4 M;  2XF3 A;  3FUX A;  4JI7 M;  2O01 F;  3QAU A;  4DUZ M;  1TR8 A;  5FLX S;  3U6D A;  3DA1 A;  4ZPX A;  1GO5 A;  1L1T A;  4M9Z A;  1IN7 A;  1G3I A;  3FD9 A;  1HT2 E;  2J5Y A;  1XC8 A;  4B3T M;  4NRV A;  4KHP M;  2CV0 A;  1E9R A;  4IBE A;  4MGY E;  5EP1 A;  3GQ4 A;  2RKO A;  3QYE A;  4NXN M;  3PNY A;  4AKI A;  2D7G A;  1ZQ9 A;  3VKG A;  4F1I A;  3AFH A;  3NWL A;  1TH3 A;  2YFQ A;  1NVM A;  3SAW A;  3U60 A;  3SAR A;  1W5S A;  1QZE A;  2RGO A;  3IG8 A;  3SBJ A;  1IQP A;  4M9X A;  3TL4 X;  3W0L B;  3SMS A;  3LCV B;  3MHV C;  1VQ1 A;  2D7H A;  5EXP A;  4DR3 M;  3AL0 C;  1WHC A;  1L2D A;  4R7G A;  2DI0 A;  3CGW A;  4I5S A;  1P3Q Q;  1JR3 E;  2LXE A;  4DV5 M;  1FNN A;  1UM8 A;  2VDB B;  3HJ8 A;  3KSJ A;  4KLN A;  1D0M A;  2JUJ A;  4ITQ A;  2L09 A;  1F4I A;  1YSY A;  1NJF A;  4II7 A;  1NV9 A;  2ZBK B;  1HQY E;  4RF1 A;  3SFZ A;  2NQ8 C;  3EIH A;  2QP9 X;  3TPZ A;  4AW4 A;  1IN8 A;  1QVR A;  3HWS A;  4FD2 A;  3Q8G A;  1GL6 A;  1ZMW A;  1VDD A;  2ZAN A;  2QBY B;  1L8Q A;  3I04 M;  4DR6 M;  4B08 A;  2JA2 A;  1IBL M;  4GKJ M;  5IRE B;  4GH9 A;  3FYD A;  2DKL A;  2XFT A;  2Y21 A;  3THG A;  1DGG A;  2WZJ A;  3KOX E;  4PT5 A;  1DGF A;  1MX0 A;  1QAN A;  2JY7 A;  4M0W A;  1NNJ A;  1IY0 A;  4K0K M;  1VEK A;  3I01 M;  3IHP A;  3MK6 A;  2K47 A;  2C96 A;  5EP3 A;  2JY6 B;  4X65 M;  3GPU A;  1JR3 D;  2Y0T A;  2LHG A;  3GRY A;  4P17 A;  5DYG A;  1XWI A;  4JXJ A;  2JXN A;  3UK6 A;  4DV2 M;  4LZJ A;  1GJT A;  4AZF A;  4AG6 A;  1HNW M;  2XSZ D;  3PNV A;  2FNA A;  2VQF M;  1WGL A;  3T1H M;  3FTF A;  2R4E A;  4FCW A;  1PRB A;  2X49 A;  3K9O A;  1E94 E;  2BJV A;  1W5T A;  4DR1 M;  1G41 A;  1S3S A;  3U6M A;  3KFU G;  4TUW A;  3B7Q A;  3FUU A;  1N32 M;  3R9X B;  4JI4 M;  4B3R M;  4MGI E;  1N78 A;  4MGH A;  4IIW A;  4Z8X A;  3SHG B;  2Y20 A;  4IBG A;  4IBC A;  4IJF A;  2CHQ A;  4OW0 A;  4I8O A;  2UUB M;  2OQ4 A;  5E26 A;  4CHT B;  4D82 A;  2Z4S A;  4LJ4 A;  3A42 A;  5E6J A;  4DV0 M;  3FTC A;  1IXR C;  1N75 A;  5JI2 E;  5BPV A;  3HU2 A;  4LJA A;  1IFY A;  2KRU A;  2XFS A;  1IY1 A;  1NY5 A;  4OVZ B;  2DWL A;  2QNJ A;  1HR0 M;  4DR5 M;  3M7G A;  3I4Y A;  4MM3 B;  2F5N A;  4GRI A;  1IN4 A;  1GAB A;  3B7N A;  2Y0Q A;  3AOE C;  2B3T A;  4AKG A;  4LF6 M;  1PJS A;  4GC5 A;  4WW0 A;  2R65 A;  3RGP A;  3HHY A;  7CAT A;  2XLJ A;  3BBZ A;  4AG5 A;  1G59 A;  4LF4 M;  2XZU A;  3HHX A;  5LMU M;  3E46 A;  3SC3 A;  2DWZ B;  4LGM A;  2L4F A;  2R6F A;  4CIS A;  4G4N A;  1I4W A;  2W82 A;  2VF7 A;  2R0I A;  4NXM M;  4FVM A;  4LJ5 A;  1TH4 A;  3J80 S;  5EXX A;  1R6B X;  2KZS A;  3AKZ A;  2K0B X;  1L2C A;  3SYL A;  2KZU A;  2HCB A;  4JV5 M;  3VDU A;  4HL4 A;  3TQS A;  3A98 B;  1AUA A;  3GRU A;  4L8R C;  5FSW A;  4IBI A;  5GKN A;  1NV8 A;  4X66 M;  4QNM A;  2QQ8 A;  1SXJ B;  1MN3 A;  1G4A E;  3K9P A;  4OVZ A;  4DR7 M;  2DHR A;  3AOG A;  4B3M M;  3NBX X;  5ITQ A;  2LNH C;  4R71 A;  2XGN A;  1H6U A;  1AIP C;  2DZO B;  2J7O A;  5DYI A;  3GPY A;  4I4L A;  1L2B A;  5LMN M;  3LQR A;  2UXD M;  2ERC A;  1Y8G A;  2LVN C;  5ITX A;  3U6L A;  3FTD A;  1NSF A;  4XBO A;  3U5Z A;  3SAT A;  2UUA M;  1QAO A;  3U6O A;  1G8P A;  2HKJ A;  1R5L A;  2R18 A;  5KPR A;  5IZ7 D;  1NNU C;  4D81 A;  4NRW A;  1PJT A;  2P5T A;  2KNZ A;  5KO3 A;  1C7Y A;  1NHG C;  2VF8 A;  4G6Z A;  3T6P A;  4PDI A;  4JI2 M;  2M60 A;  2FE8 A;  3QYB A;  4JN6 A;  1DO0 A;  3M6A A;  2RRU A;  2CHV A;  3C3E A;  3U61 B;  4NC6 A;  4RF0 A;  2EKK A;  4KOD A;  1K3W A;  3VFD A;  3KS8 A;  1T43 A;  2EO2 A;  2ZAM A;  4ANR A;  3MMP A;  3B74 A;  1FJG M;  2CFO A;  3GLG B;  3TWM A;  5FTL A;  4YHH M;  1D0K A;  1XXH B;  1T3T A;  4OU7 A;  1SXJ A;  2DAK A;  4GHL A;  2JY8 A;  3W68 A;  4DV6 M;  5EXS A;  1ORY B;  2UU9 M;  1N34 M;  2Z4R A;  3I4V A;  3GRV A;  4X62 M;  1Z5B A;  1IBK M;  4LFB M;  3VK7 A;  4UN2 B;  3IEC A;  5EP4 A;  2CRU A;  1GKI A;  1DGB A;  2KXE A;  4XK8 F;  4PDG A;  2EKF A;  4QHS A;  2F5S A;  3JR4 A;  3KDS E;  2WSE F;  2FFJ A;  2MRO B;  4JI0 M;  2KNA A;  2C98 A;  2WSF F;  3LCU A;  3J27 B;  4G3O A;  3RE8 A;  3OTO M;  4JI3 M;  4AQY M;  1R2Y A;  3JAM S;  2R46 A;  2LHC A;  2OOB A;  2F4V M;  1MU5 A;  4NSR A;  4IBF A;  1VEG A;  4FWD A;  4CGY B;  8CAT A;  3BXW A;  1IXS B;  1N36 M;  3KOY E;  3CF0 A;  2G8L A;  1HNX M;  4DV3 M;  4L16 A;  4MB7 A;  4DV7 M;  2YNM D;  3VLF B;  3SAS A;  4P16 A;  3HU3 A;  3L28 A;  3K2L A;  3SMP A;  1LTM A;  3KSX A;  2CEA A;  3FUV A;  3F92 A;  1PGY A;  4LJ9 A;  4DBG B;  3GLG A;  1SG9 A;  1XXH A;  2QSF X;  2F5P A;  3L2A A;  5L8R F;  2OO9 A;  4GIT A;  4L4U A;  4YY3 M;  2Z7J A;  1HJP A;  3T38 A;  1CUK A;  3KW6 A;  4RKU F;  4LF8 M;  3FUT A;  4QNR A;  2G5G X;  2HL7 A;  3HU1 A;  3HX3 A;  1KFV A;  3SHF A;  4FCT A;  4S12 A;  3KXE C;  1OFH A;  1QZM A;  2XEP A;  2DEN A;  4M0D A;  2F5O A;  2VII A;  1XNR M;  2VQE M;  5C18 A;  2Z3X A;  3A46 A;  1I94 M;  4IBD A;  4Y28 F;  3CF6 E;  2QBY A;  2ZTD A;  5ITX E;  2V1C A;  1WJ7 A;  3IG5 A;  2MGW A;  1KSF X;  3LMM A;  1VG5 A;  4JI5 M;  2ZM6 M;  4JI6 M;  4EIW A;  2CHG A;  1DGH B;  2C5R A;  1GL7 A;  3HGI A;  4FWG A;  2JY5 A;  4DUY M;  4BB9 A;  1IY2 A;  3GRR A;  2F5Q A;  1NO1 A;  3MJ5 A;  3HHW A;  3U6P A;  2DNA A;  3GLH B;  1J5E M;  2L4E A;  1D0L A;  1VEJ A;  2DXI A;  1IM2 A;  4GMQ A;  2D7E A;  4X64 M;  1YUB A;  2V6Z M;  2C9C A;  2HAK A;  4NSO B;  5KQD A;  2UXB M;  1Z5A A;  1C1K A;  3FE3 A;  1EIJ A;  2L7I A;  2KHH A;  2L6O A;  2XZF A;  3KP1 E;  3DFZ A;  5BR8 M;  3A45 A;  1SXJ E;  5A2Q S;  5EP2 A;  2QHO B;  1GJS A;  1QAM A;  4A3V B;  3W67 A;  3L25 A;  2XSZ A;  1QAQ A;  2YR0 A;  3NBI A;  4LJ6 A;  4F2L A;  4CIZ A;  2K6B A;  4HLQ A;  4LF9 M;  1JQJ C;  3LW5 F;  5EJC A;  2UUC M;  5FTM A;  1V34 A;  2Z8Y M;  2YQZ A;  3C3D A;  3GPP A;  3C9P A;  4DV4 M;  4R3D A;  4NL4 H;  2GQF A;  2CV2 A;  1NJG A;  1X37 A;  1ZMV A;  1DGH A;  2CP8 A;  4HEO A;  4KT0 F;  3K92 A;  3PVS A;  4L78 A;  3T1Y M;  1R2Z A;  3ZCB B;  4FWH A;  2DZL A;  1TH2 A;  1PJQ A;  3GLH A;  3M0E A;  3U6S A;  1BVS A;  2JWS A;  2LTU A;  1OQY A;  1WIV A;  2WSC F;  1J7K A;  4B7H A;  1QDR A;  3FRH A;  1SXJ C;  3RFW A;  2QZ4 A;  3ILK A;  3T15 A;  4PD2 A;  2BJW A;  1R4G A;  4GIP A;  3GLG E;  3U6E A;  5KQ8 A;  2O5R A;  3KOZ E;  3U6Q A;  1XXH E;  1PJJ A;  2KEB A;  5FTJ A;  3VDP A;  4B7F A;  3GLF B;  2X4A A;  1IN5 A;  5H37 D;  2QCU A;  5ITU A;  1IXZ A;  4D80 A;  3HJS A;  1Z5C A;  2N35 A;  3RGS A;  5DFL A;  3H4M A;  5JI3 E;  4G4Q A;  2LVO C;  2H1R A;  2DHY A;  2KRK A;  4AI6 A;  3HKP A;  1JB0 F;  1V92 A;  2EJS A;  3B7Z A;  1Z6T A;  4MGZ E;  3KP0 E;  2LVP C;  4REZ A;  3D8B A;  1PJI A;  1R7R A;  2L2D A;  1ZV1 A;  1Q39 A;  2DWN A;  5DNY A;  1XHB A;  1K82 A;  1NHW C;  1OKS A;  4IBK A;  3GO8 A;  3E4R A;  3C58 A;  1QUT A;  3FKE A;  1QUS A;  4W5W A;  3GLI B;  3DZD A;  3K1J A;  4PCZ A;  1QYR A;  5KPT A;  4Z6Y A;  4GC9 A;  3L27 A;  3FYC A;  4JI8 M;  1TTE A;  2LVQ D;  3LQQ A;  1TDH A;  4FW9 A;  2JZ0 A;  3B9P A;  2BWB A;  3QWL A;  1GVN A;  1N77 A;  3E21 A;  4LF5 M;  1HT1 E;  1G71 A;  1XB2 B;  3UMM A;  2EA0 A;  4JI1 M;  3HHZ A;  3DOA A;  3V76 A;  3GLF A;  3J7B A;  5ITY A;  2V1U A;  1UFZ A;  2O25 A;  3GPX A;  1MJG M;  1RU3 A;  4I81 A;  3U61 A;  2APL A;  1A5T A;  1Q3C A;  2CUZ A;  1D2N A;  2KDL A;  1HNZ M;  2X8A A;  3LVW A;  1DO2 A;  2JP7 A;  4NOO B;  2BNK A;  1YE9 A;  2KA6 B;  2EUC A;  4M9S A;  2CE7 A;  3R8F A;  1QQW A;  3VK8 A;  3PFI A;  4LRS A;  4QOS A;  4RNA A;  5FTN A;  2HWJ A;  4LZZ A;  4G4O A;  2CWB A;  2FH0 A;  2K9D A;  2R62 A;  2M5Z A;  1XNQ M;  1VDL A;  2DVW B;  4LFC M;  5IT9 S;  5EQT A;  2DZN B;  3JR5 A;  2MR9 A;  4DR2 M;  2RGH A;  3SYK A;  3GLI A; 
#chains in the Genus database with same CATH homology
 1NY6 A;  3LVV A;  4LJ7 A;  1E32 A;  1OJL A;  5EXT A;  4BBA A;  4LG2 A;  4LGY A;  4B7G A;  4QHT A;  5C1B A;  1Q3B A;  1Z59 A;  3FTE A;  3SAV A;  1LV7 A;  1XMO M;  3TE6 A;  3TWL A;  2AHM A;  1XMQ M;  3HJQ A;  2LWX A;  3UGJ A;  2HHH M;  4LFA M;  3GP1 A;  2UXC M;  2C99 A;  3U6C A;  2QEN A;  2I7P A;  3ZH9 B;  3I51 A;  2OPF A;  3TWK A;  2DWM A;  2QPA A;  3ZC7 B;  3GQ5 A;  4MH0 E;  2CV1 A;  5KPZ A;  4OX9 M;  5F3W A;  3GQ3 A;  2KW0 A;  3SAU A;  3BOS A;  1JR3 A;  4DV1 M;  2I7N A;  3AJI B;  2XH9 A;  4QOZ C;  4AKH A;  1IBM M;  1PM5 A;  1E9S A;  4IBJ A;  1IN6 A;  2R4J A;  4KO8 A;  1TGU A;  5IWA M;  1K3X A;  2FOI C;  3CF2 A;  4LJ8 A;  4GKK M;  2A5Y B;  1OFI A;  3WHK A;  2LH0 A;  1HQC A;  4L15 A;  3AV0 A;  4G4R A;  4BLC A;  3E9S A;  3U5Z B;  1EE8 A;  3WHL A;  2C9O A;  1GLN A;  4LY6 A;  3J2P B;  4FCV A;  3CTW B;  1TDZ A;  3VKH A;  2R45 A;  3W0F A;  3K8Z A;  3KS4 A;  3KVW A;  4MGK E;  3L26 A;  4IJE A;  2J7N A;  3D8L A;  1SXJ D;  2L7H A;  3UZU A;  4B3S M;  3L29 A;  1KYI A;  3U60 B;  1N33 M;  3FUW A;  3KOW E;  4LCB A;  3AOE A;  1ZAE A;  2Q2E B;  5ITR A;  3EIE A;  1L1Z A;  4WUR A;  1J09 A;  1WXQ A;  3PXG A;  3J81 S;  3J7A S;  4GHA A;  5FTK A;  4JYA M;  4IBB A;  4LF7 M;  3Q8X A;  2ZAO A;  4LRT A;  5ITT A;  2E5L M;  4XGI A;  3UJN A;  4DR4 M;  2XF3 A;  3FUX A;  4JI7 M;  3QAU A;  4DUZ M;  3U6D A;  5FLX S;  3DA1 A;  4ZPX A;  1L1T A;  4M9Z A;  1IN7 A;  1G3I A;  3FD9 A;  1HT2 E;  4B3T M;  1XC8 A;  4KHP M;  4NRV A;  2CV0 A;  1E9R A;  4IBE A;  4MGY E;  5EP1 A;  3GQ4 A;  2RKO A;  4NXN M;  3PNY A;  4AKI A;  2D7G A;  1ZQ9 A;  3VKG A;  3AFH A;  3NWL A;  1TH3 A;  2YFQ A;  1NVM A;  3SAW A;  3U60 A;  3SAR A;  3IG8 A;  1W5S A;  2RGO A;  3SBJ A;  1IQP A;  4M9X A;  3TL4 X;  3W0L B;  3SMS A;  3MHV C;  2D7H A;  5EXP A;  4DR3 M;  3AL0 C;  1L2D A;  4R7G A;  4I5S A;  2LXE A;  4DV5 M;  1FNN A;  1UM8 A;  3HJ8 A;  3KSJ A;  4KLN A;  4ITQ A;  2L09 A;  1YSY A;  1NJF A;  4II7 A;  2ZBK B;  1HQY E;  4RF1 A;  3SFZ A;  2NQ8 C;  3EIH A;  2QP9 X;  3TPZ A;  4AW4 A;  1IN8 A;  1QVR A;  3HWS A;  4FD2 A;  1GL6 A;  1VDD A;  2ZAN A;  2QBY B;  1L8Q A;  4DR6 M;  4B08 A;  2JA2 A;  1IBL M;  4GKJ M;  5IRE B;  4GH9 A;  3FYD A;  2XFT A;  2Y21 A;  3THG A;  1DGG A;  3KOX E;  4PT5 A;  1DGF A;  1MX0 A;  1QAN A;  4M0W A;  1NNJ A;  1IY0 A;  4K0K M;  3MK6 A;  2K47 A;  2C96 A;  5EP3 A;  4X65 M;  3GPU A;  1JR3 D;  2Y0T A;  3GRY A;  5DYG A;  1XWI A;  4JXJ A;  4DV2 M;  3UK6 A;  4LZJ A;  4AZF A;  1HNW M;  4AG6 A;  2XSZ D;  3PNV A;  2FNA A;  2VQF M;  3T1H M;  3FTF A;  2R4E A;  4FCW A;  2X49 A;  4DR1 M;  1E94 E;  2BJV A;  1W5T A;  1G41 A;  1S3S A;  3KFU G;  4TUW A;  3FUU A;  1N32 M;  4JI4 M;  4B3R M;  4MGI E;  1N78 A;  4MGH A;  4IIW A;  4Z8X A;  3SHG B;  2Y20 A;  4IBG A;  4IBC A;  4IJF A;  2CHQ A;  4OW0 A;  4I8O A;  2UUB M;  2OQ4 A;  5E26 A;  4CHT B;  4D82 A;  2Z4S A;  4LJ4 A;  3A42 A;  5E6J A;  4DV0 M;  3FTC A;  1IXR C;  1N75 A;  5JI2 E;  5BPV A;  3HU2 A;  4LJA A;  2KRU A;  2XFS A;  1IY1 A;  1NY5 A;  4OVZ B;  2DWL A;  1HR0 M;  4DR5 M;  3M7G A;  3I4Y A;  4MM3 B;  2F5N A;  4GRI A;  1IN4 A;  2Y0Q A;  3AOE C;  4AKG A;  4LF6 M;  4GC5 A;  4WW0 A;  2R65 A;  3RGP A;  3HHY A;  7CAT A;  2XLJ A;  4AG5 A;  1G59 A;  4LF4 M;  2XZU A;  3HHX A;  5LMU M;  3SC3 A;  2DWZ B;  4LGM A;  4CIS A;  4G4N A;  1I4W A;  2W82 A;  4NXM M;  4FVM A;  4LJ5 A;  1TH4 A;  3J80 S;  5EXX A;  1R6B X;  2KZS A;  3AKZ A;  1L2C A;  3SYL A;  2KZU A;  2HCB A;  4JV5 M;  3VDU A;  4HL4 A;  3TQS A;  3A98 B;  3GRU A;  4L8R C;  5FSW A;  4IBI A;  5GKN A;  4X66 M;  4QNM A;  1SXJ B;  1G4A E;  4OVZ A;  4DR7 M;  2DHR A;  3AOG A;  4B3M M;  5ITQ A;  2LNH C;  2XGN A;  1H6U A;  2DZO B;  2J7O A;  5DYI A;  3GPY A;  4I4L A;  1L2B A;  5LMN M;  3LQR A;  2UXD M;  2ERC A;  5ITX A;  3U6L A;  3FTD A;  1NSF A;  4XBO A;  3U5Z A;  3SAT A;  2UUA M;  1QAO A;  3U6O A;  1G8P A;  2HKJ A;  2R18 A;  5KPR A;  5IZ7 D;  1NNU C;  4D81 A;  4NRW A;  2P5T A;  5KO3 A;  1NHG C;  4G6Z A;  4PDI A;  4JI2 M;  2M60 A;  2FE8 A;  4JN6 A;  1DO0 A;  3M6A A;  2CHV A;  3U61 B;  4RF0 A;  4KOD A;  1K3W A;  3VFD A;  3KS8 A;  2EO2 A;  2ZAM A;  1FJG M;  2CFO A;  3GLG B;  3TWM A;  5FTL A;  4YHH M;  1XXH B;  1T3T A;  4OU7 A;  1SXJ A;  4GHL A;  4DV6 M;  5EXS A;  1ORY B;  2UU9 M;  1N34 M;  2Z4R A;  3I4V A;  3GRV A;  4X62 M;  1Z5B A;  1IBK M;  4LFB M;  3VK7 A;  5EP4 A;  1GKI A;  1DGB A;  2KXE A;  2F5S A;  4PDG A;  4QHS A;  3JR4 A;  3KDS E;  2FFJ A;  4JI0 M;  2C98 A;  4AQY M;  3RE8 A;  3J27 B;  3OTO M;  4JI3 M;  1R2Y A;  3JAM S;  2R46 A;  2F4V M;  1MU5 A;  4NSR A;  4IBF A;  4FWD A;  4CGY B;  8CAT A;  1IXS B;  1N36 M;  3KOY E;  3CF0 A;  2G8L A;  1HNX M;  4DV3 M;  4L16 A;  4MB7 A;  4DV7 M;  2YNM D;  3VLF B;  3SAS A;  4P16 A;  3HU3 A;  3L28 A;  3K2L A;  3SMP A;  3GLG A;  3KSX A;  2CEA A;  3FUV A;  3R9X B;  4LJ9 A;  2F5P A;  1XXH A;  3L2A A;  4GIT A;  4L4U A;  4YY3 M;  2Z7J A;  3T38 A;  3KW6 A;  4LF8 M;  3FUT A;  4QNR A;  2G5G X;  2HL7 A;  3HU1 A;  1KFV A;  3SHF A;  4FCT A;  4S12 A;  3KXE C;  1OFH A;  1QZM A;  2XEP A;  4M0D A;  2F5O A;  2VII A;  1XNR M;  2VQE M;  5C18 A;  2Z3X A;  3A46 A;  1I94 M;  4IBD A;  3CF6 E;  2QBY A;  5ITX E;  2V1C A;  3IG5 A;  1KSF X;  3LMM A;  4JI5 M;  2ZM6 M;  4JI6 M;  4EIW A;  2CHG A;  1DGH B;  2C5R A;  1GL7 A;  3HGI A;  4FWG A;  4DUY M;  4BB9 A;  1IY2 A;  3GRR A;  2F5Q A;  3MJ5 A;  3HHW A;  3U6P A;  3GLH B;  1J5E M;  2DXI A;  1IM2 A;  4GMQ A;  2D7E A;  4X64 M;  1YUB A;  2V6Z M;  2C9C A;  4NSO B;  5KQD A;  2UXB M;  1Z5A A;  1C1K A;  2L7I A;  2L6O A;  2XZF A;  3KP1 E;  3DFZ A;  5BR8 M;  3A45 A;  1SXJ E;  5A2Q S;  5EP2 A;  1QAM A;  4A3V B;  3L25 A;  2XSZ A;  1QAQ A;  2YR0 A;  3NBI A;  4LJ6 A;  4HLQ A;  4LF9 M;  1JQJ C;  5EJC A;  2UUC M;  5FTM A;  2YQZ A;  4DV4 M;  3GPP A;  4R3D A;  4NL4 H;  2CV2 A;  1NJG A;  1X37 A;  1DGH A;  3T1Y M;  3K92 A;  3PVS A;  4L78 A;  1R2Z A;  3ZCB B;  4FWH A;  1TH2 A;  3GLH A;  3M0E A;  3U6S A;  1J7K A;  4B7H A;  1SXJ C;  3RFW A;  2QZ4 A;  3ILK A;  3T15 A;  4PD2 A;  2BJW A;  4GIP A;  3U6E A;  5KQ8 A;  2O5R A;  3KOZ E;  3U6Q A;  1PJJ A;  2KEB A;  5FTJ A;  3VDP A;  4B7F A;  3GLF B;  2X4A A;  1IN5 A;  5H37 D;  2QCU A;  5ITU A;  1IXZ A;  4D80 A;  3HJS A;  1Z5C A;  3RGS A;  3H4M A;  5JI3 E;  4G4Q A;  2H1R A;  2KRK A;  4AI6 A;  3HKP A;  1Z6T A;  4MGZ E;  3KP0 E;  4REZ A;  3D8B A;  1PJI A;  1R7R A;  1Q39 A;  2DWN A;  5DNY A;  1XHB A;  1K82 A;  1NHW C;  4IBK A;  3GO8 A;  3E4R A;  3C58 A;  3FKE A;  3GLI B;  4W5W A;  3DZD A;  3K1J A;  4PCZ A;  1QYR A;  5KPT A;  4Z6Y A;  4GC9 A;  3L27 A;  3FYC A;  4JI8 M;  3LQQ A;  1TDH A;  4FW9 A;  3B9P A;  3QWL A;  1GVN A;  1N77 A;  4LF5 M;  1HT1 E;  3UMM A;  2EA0 A;  4JI1 M;  3HHZ A;  3DOA A;  3GLF A;  3J7B A;  5ITY A;  2V1U A;  3GPX A;  4I81 A;  3U61 A;  1Q3C A;  2CUZ A;  1D2N A;  1HNZ M;  2X8A A;  3LVW A;  1DO2 A;  4NOO B;  2BNK A;  1YE9 A;  2KA6 B;  2EUC A;  4M9S A;  2CE7 A;  3R8F A;  1QQW A;  3VK8 A;  3PFI A;  4LRS A;  4QOS A;  4RNA A;  5FTN A;  4LZZ A;  4G4O A;  2R62 A;  2M5Z A;  1XNQ M;  5IT9 S;  2DVW B;  4LFC M;  5EQT A;  2DZN B;  3JR5 A;  3U6M A;  4DR2 M;  2RGH A;  3SYK A;  3GLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...