4NOOB

Molecular mechanism for self-protection against type vi secretion system in vibrio cholerae
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
95
structure length
95
Chain Sequence
CNDTSGVHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VgrG protein
publication title Molecular mechanism for self-protection against the type VI secretion system in Vibrio cholerae.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Immune system
total genus 33
structure length 95
sequence length 95
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1160 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nooB00
4NSOB 4NSRA 4NOOB
chains in the Genus database with same CATH superfamily
1N75A 2JY7A 2EO2A 4DV0M 4LFAM 2LTUA 3GQ5A 4G4OA 1N77A 2DAKA 4FVMA 3T15A 3TWMA 3THGA 5ITRA 3GLIE 1WIVA 3TQSA 1HR0M 2CE7A 4IBGA 4QNMA 2VQFM 1HJPA 2DZNB 1NNJA 5E6JA 1HQYE 4I81A 2CHQA 1E94E 3Q8XA 1JR3E 1IY0A 3R8FA 4OU7A 1XXHB 1PJIA 2WSEF 1PJTA 2RKOA 2YFQA 4QNRA 1ZAEA 1Z5CA 2FNAA 3JR4A 3U61A 3T38A 5FTLA 4REZA 4DV2M 1IXRC 3I4YA 1NNUC 4D81A 1Z5BA 2L7IA 2XFSA 3OTOM 1MJGM 3HWSA 2UUCM 3C3EA 3DOAA 2DWZB 3GPXA 3KS8A 4TUWA 1A5TA 3HX3A 4GMQA 1SXJD 3UMMA 3PNYA 5EXTA 1IN8A 2AHMA 3BBZA 3U5ZA 1QQWA 4WURA 4M9SA 2QPAA 1W5SA 2ZTCA 5DNYA 1NY5A 2ZAMA 2HKJA 1R4GA 4DR5M 1XXHE 3HHXA 2DAMA 3UK6A 2JZ1A 5IREB 2OO9A 1L1ZA 1PM5A 1Q39A 4BLCA 1GL7A 4DUYM 4JI4M 3J7BA 2VIIA 5EXSA 1V34A 2R44A 1NO1A 2D7EA 3TWLA 1G41A 3HJQA 2KZUA 2K9DA 2J7NA 1OQYA 2VF8A 3GPUA 4LJ6A 1XNRM 1ORYB 1GKIA 3K8ZA 2XH9A 2QQ8A 2XSZA 1IXSA 2F5NA 2DAEA 4L16A 3GQ4A 2M60A 4IBIA 3TPZA 2N35A 1YE9A 4GKJM 2JY5A 2LH0A 4P16A 4FWHA 5ITXA 2LHCA 2LWXA 4RKUF 4JXJA 3U61B 2DZOB 3I4VA 2CV2A 1PGYA 3CTWB 3SBJA 3DFZA 4IBDA 4DV5M 4QHTA 2EJSA 2DAGA 1TTEA 2C99A 1ZV1A 4JN6A 3UGJA 1V92A 4G4RA 4DR1M 2C5RA 4B3TM 1IFYA 5EJCA 1VDLA 4M0DA 4IBJA 3E21A 5ITTA 4PD2A 3MMPA 3H4MA 3U6EA 4JI5M 3L25A 1IXZA 3U5ZB 1DGGA 2HL7A 4NC6A 4HEOA 1GLNA 4NRVA 4DR4M 4LJAA 4UN2B 3RFWA 2R65A 3GLIA 2HCBA 3FRHA 4LF8M 2KW0A 2Z4SA 4M0WA 2MROB 4DV7M 4MGIE 1X37A 1QAMA 2LVOC 3NBIA 2XFTA 3GRRA 2Y0TA 3GRUA 3HKPA 3K9OA 2H5XA 4W5WA 1Z5AA 2WZJA 3W67A 4NSOB 2C9OA 1SXJC 5EXPA 4BBAA 3A42A 1IXSB 3SMSA 2CFOA 3T6PA 3GLHA 3I51A 5FSWA 1TDZA 1J09A 1CUKA 4ANRA 1YSYA 2YNMD 3KOYE 2ZANA 4AQYM 5LMNM 3FYCA 3NWLA 4LJ8A 1QYRA 3GLFE 5JI2E 1D0MA 1G71A 2X49A 8CATA 1JQJC 3T1YM 5LMUM 1VEGA 2FFJA 3MJ5A 3KOZE 3PFIA 1N36M 2CP8A 3D8BA 3KW6A 1Q3CA 3VDPA 3VFDA 3HU3A 3L29A 2QHOB 2YQZA 3HY5A 1T43A 3L2AA 1L8QA 3HGIA 3CF0A 3SAVA 2LNHC 1GVNA 4GITA 2ZTDA 3TL4X 2OPFA 3SASA 2G5GX 1MN3A 3B74A 1OIZA 3GLIB 4D80A 3B7NA 1TH3A 2G8LA 2EKKA 1JB0F 3SAUA 4JI7M 5EP3A 1XMOM 1HQCA 2LVAA 2QP9X 1I94M 4M9XA 1QDRA 1EFUB 4HL4A 3L28A 4QOSA 3HHZA 2KZSA 3F92A 3B7ZA 3HHWA 3GRVA 2O5RA 3Q8GA 4KODA 4IBEA 4LJ4A 4CHTB 2MJ5B 5KQDA 1E9RA 4M9ZA 3J7AS 1IY2A 1G8PA 4LFBM 3LMMA 1VDDA 3CGWA 3ZH9B 1OFHA 3WHKA 1ZMVA 2CV0A 3GLHB 1IBLM 1PJJA 1Y8GA 2D7HA 5EP4A 1DGFA 1Z59A 2DXIA 2C96A 1TH2A 1QDTA 1J7KA 1GO5A 1FNNA 3ZC7B 3C3DA 2KNZA 2R45A 3B7QA 4MGHA 4OX9M 4BB9A 3KP0E 3GRYA 1AIPC 3FUUA 4NXMM 3NBXX 4X64M 2P5TA 1VEJA 3M7GA 3E4RA 3QWLA 3WHLA 4CGYB 1LTMA 3A45A 3PNVA 4KHPM 3C58A 3U6DA 2UXDM 3GLHE 1FJGM 2V1CA 2XSZD 2CUZA 3ZCBB 4AKIA 4MH0E 2MGWA 2B3TA 4P17A 2F4VM 5KPTA 4FCWA 1XHBA 2LVPC 2UU9M 2GNOA 4Z8XA 4NL4H 4JI6M 4LF5M 3R9XB 2LVNC 3FTEA 2O25A 1I4WA 2L4EA 4LJ9A 4KT0F 3QYEA 1YLAA 3K2LA 5H37D 3JR5A 3IHPA 1Z6TA 3FD9A 4LRTA 1OJLA 2X8AA 3J27B 4LCBA 3GLFA 4II7A 1J5EM 1OKSA 2R4JA 4DV6M 1IN4A 2C98A 2R6FA 3KXEC 1WJ7A 2K6BA 4JYAM 2G3QA 4B7HA 1E9SA 3EIEA 2EA0A 4JV5M 5EQTA 4B08A 1TR8A 2BNKA 2XLJA 3GQ3A 1H6UA 1EE8A 3KDSE 3HJSA 3U6QA 5KQ8A 2JNHA 2LXEA 2FOIC 3FUVA 3TWKA 4L6V6 2XZUA 2QBYA 1G3IA 3A46A 3HHYA 2ZBKB 3K9PA 4DR7M 1NV8A 2DVWB 3U60A 5KO3A 1R2YA 1BVSA 2QSFX 1QAOA 1W5TA 2KA6B 3M0EA 2I7PA 3CF6E 1IN6A 3VLFB 1NJFA 3L26A 4GRIA 4QHSA 2HHHM 1QUSA 1IBMM 4ITQA 5KPRA 1QUTA 2RGHA 2JZ0A 1YUBA 2JUJA 2FE8A 3FUTA 4I4LA 3J80S 4QOZC 1TF0B 1QAQA 1XMQM 2J7OA 3AV0A 4B3RM 1DGHA 4IBKA 3VK8A 3GO8A 2CHVA 1NSFA 4G6ZA 4NXNM 3GLFB 4GKKM 3LQRA 1QZMA 3B89A 3W0FA 4DV1M 4AKHA 4B7FA 2FH0A 2DZLA 2K0BX 1K3WA 2M5ZA 7CATA 3SATA 2UXBM 5C1BA 4FD2A 1T6OA 2GQFA 3LVVA 4IJFA 2LBCA 2LHGA 3DZDA 1DO0A 1P3QQ 2LVQD 1WHCA 2R62A 3QAUA 4L15A 5ITYA 1IN5A 2Z7JA 5GKNA 1L2CA 3GLGA 1TGUA 2EKFA 3RGPA 3RE8A 2QBYB 2BWEA 2R4EA 3SC3A 3KSJA 1SG9A 3FTDA 3LVWA 3U6MA 3U60B 4FW9A 4KO8A 4AW4A 3VK7A 1WXQA 2APLA 2FS1A 2QNJA 3FYDA 3H4JA 3AOEA 4LF4M 3VKHA 1DGBA 2HAKA 2XGNA 4CIZA 2UUAM 2VDBB 2XEPA 4K0KM 2Y20A 3IG8A 2QENA 3FUXA 1XB2B 1IBKM 4LZJA 4L4UA 1K82A 1XWIA 4Z6YA 2OOAA 3GPPA 4I5SA 1IM2A 4PDGA 4XBOA 4B3MM 1DGHB 1HNWM 4A3VB 2R18A 3KFUG 3AJIB 2HWJA 2JXNA 2DI0A 4PDIA 3FUWA 1N32M 4L8RC 4DR2M 1NVMA 2UXCM 5A2QS 4JI0M 5C18A 1NHWC 1R6BX 3FRIA 1VG5A 4R3DA 4JI8M 4LY6A 4RF0A 1IY1A 1XNQM 3LCVB 3SHFA 3I01M 4MGKE 1DO2A 5DFLA 3ZQJA 2UUBM 2JY6B 4LGYA 4B7GA 5EXXA 5JI3E 4FWGA 3SARA 4F2LA 5IT9S 4XGIA 4GH9A 1QANA 1D2NA 4LZZA 4GHLA 1D0LA 3AOGA 5EP2A 4LF9M 1ZMUA 3J81S 2BJWA 3AOEC 4OW0A 2XZFA 1G59A 1F4IA 2JY8A 5KPZA 1LV7A 5FLXS 3SFZA 2CEAA 4X65M 3U6CA 4RNAA 4IBFA 4RF1A 2ZM6M 2OOBA 3FKEA 4B3SM 3BXWA 3FTFA 5FTKA 2DKLA 4FWDA 1OFIA 4IBBA 4X66M 2L2DA 4FCTA 2Z3XA 5F3WA 1N78A 1MX0A 4L78A 1IN7A 3GLGE 2L09A 2L7HA 5BPVA 4LFCM 2DNAA 2ERCA 4LF6M 2KRUA 2DWMA 3AL0C 2CWBA 4LRSA 3U6LA 2KDLA 1QZEA 2C9CA 4CJ6A 4FCVA 5L8RF 1RU3A 1R2ZA 2R46A 1L1TA 4IJEA 3FE3A 1PJSA 3KVWA 2NQ8C 3IG5A 4IBCA 3W68A 1S3SA 1NV9A 3LCUA 4JI1M 2J5YA 3SMPA 3CF2A 2DHYA 4NSRA 1HNZM 1HT1E 5E26A 2MR9A 4AKGA 2R0IA 2WSCF 2E5LM 4AI6A 2F5PA 2CV1A 3E46A 1WR1B 2K47A 4MM3B 3BOSA 2KEBA 3HU1A 1IQPA 4HLQA 2JA2A 2X4AA 5ITQA 1DV0A 4XK8F 4F1IA 2Y0QA 3FTCA 1PRBA 1QVRA 2XF3A 4LJ5A 2F5OA 1N33M 2L6OA 1GJTA 1L2BA 1VQ1A 4I8OA 2JP7A 4MGYE 2A5YB 3HU2A 3ILKA 5EP1A 4GEWA 4JI3M 1C7YA 3MHVC 2F5SA 1V33A 3QYBA 2VF7A 2BWBA 3K1JA 3E9SA 4NOOB 1AUAA 3TE6A 3U6PA 3D8LA 3SAWA 4LG2A 2YR0A 1SXJA 1OIPA 1NHGC 1JR3D 1WGLA 3HZJA 2OQ4A 1MU5A 5ITUA 2JWSA 3U6OA 3UJNA 3HJ8A 2Y21A 2QCUA 2ZAOA 3PVSA 4G3OA 4GIPA 3PXGA 3KOXE 3RGSA 1C1KA 4WP2A 4ZPXA 1R7RA 1WGNA 3VDUA 2KNAA 2EUCA 4Y28F 4DV3M 3KP1E 3B9PA 3MK6A 1Q3BA 3U6SA 1N34M 4NRWA 2Q2EB 4DR6M 5BR8M 2V1UA 1ZMWA 4IIWA 5DYGA 3IECA 1R5LA 5FTJA 4AG5A 1G4AE 3LQQA 1UM8A 4OVZA 5FTNA 2V6ZM 4GHAA 3VKGA 1ZQ9A 3UZUA 3EIHA 3KSXA 4G4NA 1NJGA 2Z4RA 2KHHA 1HT2E 2D7GA 3LW5F 3J2PB 1JR3A 2QZ4A 2RGOA 3W0LB 3SYKA 3AKZA 4PCZA 1E32A 3GPYA 2DAIA 1NY6A 2BJVA 4DR3M 3M6AA 4R7GA 2CRUA 1OAIA 3C9PA 3V76A 4GC9A 1OTRA 2O01F 4LJ7A 5FTMA 2DWLA 4MGZE 3AFHA 4Q7JA 1SXJB 2DWNA 2F5QA 4JI2M 2KXEA 2MH8A 5DYIA 3A98B 1KSFX 4DUZM 3K92A 4YY3M 1XXHA 4PT5A 4S12A 1HNXM 2W82A 4EIWA 1VEKA 5IWAM 4CISA 4MB7A 2DHRA 4DV4M 1GABA 2Z8YM 4D82A 4G4QA 3I04M 4AG6A 4X62M 3L27A 2L4FA 4KLNA 1GL6A 3SHGB 3KOWE 1XC8A 1TH4A 5IZ7D 1D0KA 3GP1A 1KFVA 3DA1A 2RRUA 4R71A 1SXJE 3GLGB 1L2DA 4OVZB 5ITXE 4YHHM 4DBGB 1KYIA 3JAMS 1PJQA 1Q02A 3SYLA 1T3TA 1OAOC 1UFZA 4WW0A 2DENA 2VQEM 3KS4A 3T1HM 2H1RA 2CHGA 4LF7M 4LGMA 4AZFA 1K3XA 2KNVA 1TDHA 2KRKA 1GJSA 4GC5A 2WSFF 2I7NA 1EIJA
chains in the Genus database with same CATH topology
1N75A 2EO2A 4DV0M 4LFAM 4G4OA 3GQ5A 1N77A 4FVMA 3T15A 3TWMA 3THGA 5ITRA 3TQSA 1HR0M 2CE7A 4IBGA 4QNMA 2VQFM 2DZNB 1NNJA 5E6JA 1HQYE 4I81A 2CHQA 1E94E 3Q8XA 1IY0A 3R8FA 4OU7A 1XXHB 1PJIA 2RKOA 2YFQA 4QNRA 1ZAEA 1Z5CA 2FNAA 3JR4A 3U61A 3T38A 5FTLA 4REZA 4DV2M 1IXRC 3I4YA 1NNUC 4D81A 1Z5BA 2L7IA 2XFSA 3OTOM 3HWSA 2UUCM 3DOAA 2DWZB 3GPXA 3KS8A 4TUWA 4GMQA 1SXJD 3UMMA 3PNYA 5EXTA 1IN8A 2AHMA 3U5ZA 1QQWA 4WURA 4M9SA 2QPAA 1W5SA 5DNYA 1NY5A 2ZAMA 2HKJA 4DR5M 3HHXA 3UK6A 5IREB 1L1ZA 1PM5A 1Q39A 4BLCA 1GL7A 4DUYM 4JI4M 3J7BA 2VIIA 5EXSA 2D7EA 3TWLA 1G41A 3HJQA 2KZUA 3GPUA 2J7NA 4LJ6A 1XNRM 1ORYB 1GKIA 3K8ZA 2XH9A 2XSZA 2F5NA 4L16A 3GQ4A 2M60A 4IBIA 3TPZA 1YE9A 4GKJM 2LH0A 4P16A 4FWHA 5ITXA 2LWXA 3U61B 4JXJA 2DZOB 3I4VA 2CV2A 3CTWB 3SBJA 3DFZA 4IBDA 4DV5M 4QHTA 4JN6A 2C99A 3UGJA 4G4RA 2C5RA 4DR1M 4B3TM 5EJCA 4M0DA 4IBJA 5ITTA 4PD2A 3H4MA 3U6EA 4JI5M 3L25A 1IXZA 3U5ZB 1DGGA 2HL7A 1GLNA 4NRVA 4DR4M 4LJAA 3RFWA 2R65A 3GLIA 2HCBA 4LF8M 2KW0A 2Z4SA 4M0WA 4DV7M 4MGIE 1X37A 1QAMA 3NBIA 2XFTA 3GRRA 2Y0TA 3GRUA 3HKPA 4W5WA 1Z5AA 4NSOB 2C9OA 1SXJC 5EXPA 4BBAA 3A42A 1IXSB 3SMSA 2CFOA 3GLHA 3I51A 5FSWA 1TDZA 1J09A 1YSYA 2YNMD 3KOYE 2ZANA 4AQYM 5LMNM 3FYCA 3NWLA 4LJ8A 1QYRA 5JI2E 2X49A 8CATA 1JQJC 3T1YM 5LMUM 2FFJA 3MJ5A 3KOZE 3PFIA 1N36M 3D8BA 3VFDA 3KW6A 1Q3CA 3VDPA 3HU3A 3L29A 2YQZA 3L2AA 1L8QA 3HGIA 3CF0A 2LNHC 1GVNA 4GITA 3TL4X 2OPFA 3SASA 2G5GX 3SAVA 3GLIB 4B3SM 4D80A 3SAUA 1TH3A 2G8LA 4JI7M 5EP3A 1XMOM 1HQCA 2QP9X 1I94M 4M9XA 4HL4A 3L28A 4QOSA 3HHZA 2KZSA 3HHWA 3GRVA 2O5RA 4KODA 4IBEA 4LJ4A 4CHTB 5KQDA 1E9RA 4M9ZA 3J7AS 1IY2A 1G8PA 4LFBM 3LMMA 1VDDA 3ZH9B 1OFHA 3WHKA 2CV0A 3GLHB 1IBLM 1PJJA 2D7HA 5EP4A 1DGFA 1Z59A 2DXIA 2C96A 1TH2A 1J7KA 1FNNA 3ZC7B 2R45A 4MGHA 4OX9M 4BB9A 3KP0E 3GRYA 3FUUA 4NXMM 4X64M 2P5TA 3M7GA 3E4RA 3QWLA 3WHLA 4CGYB 3A45A 3PNVA 4KHPM 3C58A 3U6DA 2UXDM 1FJGM 2V1CA 2XSZD 2CUZA 3ZCBB 4AKIA 4MH0E 2F4VM 5KPTA 4FCWA 1XHBA 2UU9M 4Z8XA 4NL4H 4JI6M 4LF5M 3R9XB 3FTEA 1I4WA 4LJ9A 5H37D 3K2LA 3JR5A 1Z6TA 3FD9A 4LRTA 1OJLA 2X8AA 3J27B 4LCBA 3GLFA 4II7A 1J5EM 4DV6M 2R4JA 1IN4A 2C98A 3KXEC 4JYAM 4B7HA 1E9SA 3EIEA 2EA0A 4JV5M 5EQTA 4B08A 2BNKA 2XLJA 3GQ3A 1H6UA 1EE8A 3KDSE 3HJSA 3U6QA 5KQ8A 2LXEA 2FOIC 3FUVA 3TWKA 2XZUA 2QBYA 1G3IA 3A46A 3HHYA 2ZBKB 4DR7M 2DVWB 3U60A 5KO3A 1R2YA 1QAOA 1W5TA 2KA6B 3M0EA 2I7PA 3CF6E 1IN6A 3VLFB 1NJFA 3L26A 4GRIA 4QHSA 2HHHM 4ITQA 1IBMM 5KPRA 2RGHA 1YUBA 3FUTA 2FE8A 4I4LA 3J80S 4QOZC 1QAQA 1XMQM 2J7OA 3AV0A 4B3RM 1DGHA 4IBKA 3VK8A 3GO8A 2CHVA 1NSFA 4G6ZA 4NXNM 3GLFB 4GKKM 3LQRA 1QZMA 3W0FA 4DV1M 4AKHA 4B7FA 1K3WA 2M5ZA 7CATA 3SATA 2UXBM 5C1BA 4FD2A 3LVVA 4IJFA 3DZDA 1DO0A 2R62A 5ITYA 3QAUA 4L15A 1IN5A 2Z7JA 5GKNA 1L2CA 3GLGA 1TGUA 3RGPA 3RE8A 2QBYB 2R4EA 3SC3A 3KSJA 3FTDA 3LVWA 3U6MA 3U60B 4FW9A 4KO8A 4AW4A 3VK7A 1WXQA 3FYDA 3AOEA 4LF4M 3VKHA 1DGBA 2XGNA 2UUAM 2XEPA 4K0KM 2Y20A 3IG8A 2QENA 3FUXA 1IBKM 4LZJA 4L4UA 1K82A 1XWIA 4Z6YA 3GPPA 4I5SA 1IM2A 4PDGA 4XBOA 4B3MM 1DGHB 1HNWM 4A3VB 2R18A 3KFUG 3AJIB 4PDIA 3FUWA 1N32M 4L8RC 4DR2M 1NVMA 2UXCM 5A2QS 4JI0M 5C18A 1NHWC 1R6BX 4R3DA 4JI8M 4LY6A 4RF0A 1IY1A 1XNQM 3SHFA 4MGKE 1DO2A 2UUBM 4LGYA 4B7GA 5EXXA 5JI3E 4FWGA 3SARA 5IT9S 4XGIA 4GH9A 1QANA 1D2NA 4LZZA 4GHLA 3AOGA 5EP2A 4LF9M 3J81S 2BJWA 3AOEC 4OW0A 2XZFA 1G59A 5KPZA 1LV7A 5FLXS 3SFZA 2CEAA 4X65M 3U6CA 4RNAA 4IBFA 4RF1A 2ZM6M 3FKEA 3FTFA 5FTKA 4FWDA 1OFIA 4IBBA 4X66M 2Z3XA 4FCTA 5F3WA 1N78A 1MX0A 4L78A 1IN7A 2L09A 2L7HA 5BPVA 4LFCM 2ERCA 4LF6M 2KRUA 2DWMA 3AL0C 4LRSA 3U6LA 2C9CA 4FCVA 1R2ZA 2R46A 1L1TA 4IJEA 3KVWA 2NQ8C 3IG5A 4IBCA 1S3SA 4JI1M 3SMPA 3CF2A 4NSRA 1HNZM 1HT1E 5E26A 4AKGA 2E5LM 4AI6A 2F5PA 2CV1A 4MM3B 2K47A 3BOSA 2KEBA 3HU1A 1IQPA 4HLQA 2JA2A 2X4AA 5ITQA 2Y0QA 3FTCA 1QVRA 2XF3A 4LJ5A 2F5OA 1N33M 2L6OA 1L2BA 4I8OA 4MGYE 2A5YB 3HU2A 3ILKA 5EP1A 4JI3M 3MHVC 2F5SA 3K1JA 3E9SA 4NOOB 3TE6A 3U6PA 3D8LA 3SAWA 4LG2A 2YR0A 1SXJA 1NHGC 1JR3D 2OQ4A 1MU5A 5ITUA 3U6OA 3UJNA 3HJ8A 2ZAOA 2Y21A 2QCUA 3PVSA 4GIPA 3PXGA 3KOXE 3RGSA 1C1KA 4ZPXA 1R7RA 3VDUA 2EUCA 4DV3M 3KP1E 3B9PA 3MK6A 1Q3BA 3U6SA 1N34M 4NRWA 2Q2EB 4DR6M 5BR8M 2V1UA 4IIWA 5DYGA 5FTJA 4AG5A 1G4AE 3LQQA 1UM8A 4OVZA 5FTNA 2V6ZM 4GHAA 3VKGA 1ZQ9A 3UZUA 3EIHA 3KSXA 4G4NA 1NJGA 2Z4RA 1HT2E 2D7GA 3J2PB 1JR3A 2QZ4A 2RGOA 3W0LB 3SYKA 3AKZA 4PCZA 1E32A 3GPYA 1NY6A 2BJVA 4DR3M 3M6AA 4R7GA 4GC9A 5FTMA 4LJ7A 2DWLA 4MGZE 3AFHA 2DWNA 1SXJB 2F5QA 4JI2M 2KXEA 5DYIA 3A98B 1KSFX 4DUZM 3K92A 4YY3M 1XXHA 4PT5A 4S12A 1HNXM 2W82A 4EIWA 5IWAM 4CISA 4MB7A 2DHRA 4DV4M 4D82A 4G4QA 4AG6A 4X62M 3L27A 4KLNA 1GL6A 3SHGB 3KOWE 1XC8A 1TH4A 5IZ7D 3GP1A 1KFVA 3DA1A 3GLGB 1SXJE 1L2DA 4OVZB 5ITXE 4YHHM 1KYIA 3JAMS 3SYLA 1T3TA 4WW0A 2VQEM 3KS4A 3T1HM 2H1RA 2CHGA 4LF7M 4LGMA 4AZFA 1K3XA 1TDHA 2KRKA 4GC5A 2I7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NSO B;  4NSR A;  4NOO B; 
#chains in the Genus database with same CATH topology
 1N75 A;  2JY7 A;  2EO2 A;  4DV0 M;  4LFA M;  2LTU A;  3GQ5 A;  4G4O A;  1N77 A;  2DAK A;  4FVM A;  3T15 A;  3TWM A;  3THG A;  5ITR A;  3GLI E;  1WIV A;  3TQS A;  1HR0 M;  2CE7 A;  4IBG A;  4QNM A;  2VQF M;  1HJP A;  2DZN B;  1NNJ A;  5E6J A;  1HQY E;  4I81 A;  2CHQ A;  1E94 E;  3Q8X A;  1JR3 E;  1IY0 A;  3R8F A;  4OU7 A;  1XXH B;  1PJI A;  2WSE F;  1PJT A;  2RKO A;  2YFQ A;  4QNR A;  1ZAE A;  1Z5C A;  2FNA A;  3JR4 A;  3U61 A;  3T38 A;  5FTL A;  4REZ A;  4DV2 M;  1IXR C;  3I4Y A;  1NNU C;  4D81 A;  1Z5B A;  2L7I A;  2XFS A;  3OTO M;  1MJG M;  3HWS A;  2UUC M;  3C3E A;  3DOA A;  2DWZ B;  3GPX A;  3KS8 A;  4TUW A;  1A5T A;  3HX3 A;  4GMQ A;  1SXJ D;  3UMM A;  3PNY A;  5EXT A;  1IN8 A;  2AHM A;  3BBZ A;  3U5Z A;  1QQW A;  4WUR A;  4M9S A;  2QPA A;  1W5S A;  2ZTC A;  5DNY A;  1NY5 A;  2ZAM A;  2HKJ A;  1R4G A;  4DR5 M;  1XXH E;  3HHX A;  2DAM A;  3UK6 A;  2JZ1 A;  5IRE B;  2OO9 A;  1L1Z A;  1PM5 A;  1Q39 A;  4BLC A;  1GL7 A;  4DUY M;  4JI4 M;  3J7B A;  2VII A;  5EXS A;  1V34 A;  2R44 A;  1NO1 A;  2D7E A;  3TWL A;  1G41 A;  3HJQ A;  2KZU A;  2K9D A;  2J7N A;  1OQY A;  2VF8 A;  3GPU A;  4LJ6 A;  1XNR M;  1ORY B;  1GKI A;  3K8Z A;  2XH9 A;  2QQ8 A;  2XSZ A;  1IXS A;  2F5N A;  2DAE A;  4L16 A;  3GQ4 A;  2M60 A;  4IBI A;  3TPZ A;  2N35 A;  1YE9 A;  4GKJ M;  2JY5 A;  2LH0 A;  4P16 A;  4FWH A;  5ITX A;  2LHC A;  2LWX A;  4RKU F;  4JXJ A;  3U61 B;  2DZO B;  3I4V A;  2CV2 A;  1PGY A;  3CTW B;  3SBJ A;  3DFZ A;  4IBD A;  4DV5 M;  4QHT A;  2EJS A;  2DAG A;  1TTE A;  2C99 A;  1ZV1 A;  4JN6 A;  3UGJ A;  1V92 A;  4G4R A;  4DR1 M;  2C5R A;  4B3T M;  1IFY A;  5EJC A;  1VDL A;  4M0D A;  4IBJ A;  3E21 A;  5ITT A;  4PD2 A;  3MMP A;  3H4M A;  3U6E A;  4JI5 M;  3L25 A;  1IXZ A;  3U5Z B;  1DGG A;  2HL7 A;  4NC6 A;  4HEO A;  1GLN A;  4NRV A;  4DR4 M;  4LJA A;  4UN2 B;  3RFW A;  2R65 A;  3GLI A;  2HCB A;  3FRH A;  4LF8 M;  2KW0 A;  2Z4S A;  4M0W A;  2MRO B;  4DV7 M;  4MGI E;  1X37 A;  1QAM A;  2LVO C;  3NBI A;  2XFT A;  3GRR A;  2Y0T A;  3GRU A;  3HKP A;  3K9O A;  2H5X A;  4W5W A;  1Z5A A;  2WZJ A;  3W67 A;  4NSO B;  2C9O A;  1SXJ C;  5EXP A;  4BBA A;  3A42 A;  1IXS B;  3SMS A;  2CFO A;  3T6P A;  3GLH A;  3I51 A;  5FSW A;  1TDZ A;  1J09 A;  1CUK A;  4ANR A;  1YSY A;  2YNM D;  3KOY E;  2ZAN A;  4AQY M;  5LMN M;  3FYC A;  3NWL A;  4LJ8 A;  1QYR A;  3GLF E;  5JI2 E;  1D0M A;  1G71 A;  2X49 A;  8CAT A;  1JQJ C;  3T1Y M;  5LMU M;  1VEG A;  2FFJ A;  3MJ5 A;  3KOZ E;  3PFI A;  1N36 M;  2CP8 A;  3D8B A;  3KW6 A;  1Q3C A;  3VDP A;  3VFD A;  3HU3 A;  3L29 A;  2QHO B;  2YQZ A;  3HY5 A;  1T43 A;  3L2A A;  1L8Q A;  3HGI A;  3CF0 A;  3SAV A;  2LNH C;  1GVN A;  4GIT A;  2ZTD A;  3TL4 X;  2OPF A;  3SAS A;  2G5G X;  1MN3 A;  3B74 A;  1OIZ A;  3GLI B;  4D80 A;  3B7N A;  1TH3 A;  2G8L A;  2EKK A;  1JB0 F;  3SAU A;  4JI7 M;  5EP3 A;  1XMO M;  1HQC A;  2LVA A;  2QP9 X;  1I94 M;  4M9X A;  1QDR A;  1EFU B;  4HL4 A;  3L28 A;  4QOS A;  3HHZ A;  2KZS A;  3F92 A;  3B7Z A;  3HHW A;  3GRV A;  2O5R A;  3Q8G A;  4KOD A;  4IBE A;  4LJ4 A;  4CHT B;  2MJ5 B;  5KQD A;  1E9R A;  4M9Z A;  3J7A S;  1IY2 A;  1G8P A;  4LFB M;  3LMM A;  1VDD A;  3CGW A;  3ZH9 B;  1OFH A;  3WHK A;  1ZMV A;  2CV0 A;  3GLH B;  1IBL M;  1PJJ A;  1Y8G A;  2D7H A;  5EP4 A;  1DGF A;  1Z59 A;  2DXI A;  2C96 A;  1TH2 A;  1QDT A;  1J7K A;  1GO5 A;  1FNN A;  3ZC7 B;  3C3D A;  2KNZ A;  2R45 A;  3B7Q A;  4MGH A;  4OX9 M;  4BB9 A;  3KP0 E;  3GRY A;  1AIP C;  3FUU A;  4NXM M;  3NBX X;  4X64 M;  2P5T A;  1VEJ A;  3M7G A;  3E4R A;  3QWL A;  3WHL A;  4CGY B;  1LTM A;  3A45 A;  3PNV A;  4KHP M;  3C58 A;  3U6D A;  2UXD M;  3GLH E;  1FJG M;  2V1C A;  2XSZ D;  2CUZ A;  3ZCB B;  4AKI A;  4MH0 E;  2MGW A;  2B3T A;  4P17 A;  2F4V M;  5KPT A;  4FCW A;  1XHB A;  2LVP C;  2UU9 M;  2GNO A;  4Z8X A;  4NL4 H;  4JI6 M;  4LF5 M;  3R9X B;  2LVN C;  3FTE A;  2O25 A;  1I4W A;  2L4E A;  4LJ9 A;  4KT0 F;  3QYE A;  1YLA A;  3K2L A;  5H37 D;  3JR5 A;  3IHP A;  1Z6T A;  3FD9 A;  4LRT A;  1OJL A;  2X8A A;  3J27 B;  4LCB A;  3GLF A;  4II7 A;  1J5E M;  1OKS A;  2R4J A;  4DV6 M;  1IN4 A;  2C98 A;  2R6F A;  3KXE C;  1WJ7 A;  2K6B A;  4JYA M;  2G3Q A;  4B7H A;  1E9S A;  3EIE A;  2EA0 A;  4JV5 M;  5EQT A;  4B08 A;  1TR8 A;  2BNK A;  2XLJ A;  3GQ3 A;  1H6U A;  1EE8 A;  3KDS E;  3HJS A;  3U6Q A;  5KQ8 A;  2JNH A;  2LXE A;  2FOI C;  3FUV A;  3TWK A;  4L6V 6;  2XZU A;  2QBY A;  1G3I A;  3A46 A;  3HHY A;  2ZBK B;  3K9P A;  4DR7 M;  1NV8 A;  2DVW B;  3U60 A;  5KO3 A;  1R2Y A;  1BVS A;  2QSF X;  1QAO A;  1W5T A;  2KA6 B;  3M0E A;  2I7P A;  3CF6 E;  1IN6 A;  3VLF B;  1NJF A;  3L26 A;  4GRI A;  4QHS A;  2HHH M;  1QUS A;  1IBM M;  4ITQ A;  5KPR A;  1QUT A;  2RGH A;  2JZ0 A;  1YUB A;  2JUJ A;  2FE8 A;  3FUT A;  4I4L A;  3J80 S;  4QOZ C;  1TF0 B;  1QAQ A;  1XMQ M;  2J7O A;  3AV0 A;  4B3R M;  1DGH A;  4IBK A;  3VK8 A;  3GO8 A;  2CHV A;  1NSF A;  4G6Z A;  4NXN M;  3GLF B;  4GKK M;  3LQR A;  1QZM A;  3B89 A;  3W0F A;  4DV1 M;  4AKH A;  4B7F A;  2FH0 A;  2DZL A;  2K0B X;  1K3W A;  2M5Z A;  7CAT A;  3SAT A;  2UXB M;  5C1B A;  4FD2 A;  1T6O A;  2GQF A;  3LVV A;  4IJF A;  2LBC A;  2LHG A;  3DZD A;  1DO0 A;  1P3Q Q;  2LVQ D;  1WHC A;  2R62 A;  3QAU A;  4L15 A;  5ITY A;  1IN5 A;  2Z7J A;  5GKN A;  1L2C A;  3GLG A;  1TGU A;  2EKF A;  3RGP A;  3RE8 A;  2QBY B;  2BWE A;  2R4E A;  3SC3 A;  3KSJ A;  1SG9 A;  3FTD A;  3LVW A;  3U6M A;  3U60 B;  4FW9 A;  4KO8 A;  4AW4 A;  3VK7 A;  1WXQ A;  2APL A;  2FS1 A;  2QNJ A;  3FYD A;  3H4J A;  3AOE A;  4LF4 M;  3VKH A;  1DGB A;  2HAK A;  2XGN A;  4CIZ A;  2UUA M;  2VDB B;  2XEP A;  4K0K M;  2Y20 A;  3IG8 A;  2QEN A;  3FUX A;  1XB2 B;  1IBK M;  4LZJ A;  4L4U A;  1K82 A;  1XWI A;  4Z6Y A;  2OOA A;  3GPP A;  4I5S A;  1IM2 A;  4PDG A;  4XBO A;  4B3M M;  1DGH B;  1HNW M;  4A3V B;  2R18 A;  3KFU G;  3AJI B;  2HWJ A;  2JXN A;  2DI0 A;  4PDI A;  3FUW A;  1N32 M;  4L8R C;  4DR2 M;  1NVM A;  2UXC M;  5A2Q S;  4JI0 M;  5C18 A;  1NHW C;  1R6B X;  3FRI A;  1VG5 A;  4R3D A;  4JI8 M;  4LY6 A;  4RF0 A;  1IY1 A;  1XNQ M;  3LCV B;  3SHF A;  3I01 M;  4MGK E;  1DO2 A;  5DFL A;  3ZQJ A;  2UUB M;  2JY6 B;  4LGY A;  4B7G A;  5EXX A;  5JI3 E;  4FWG A;  3SAR A;  4F2L A;  5IT9 S;  4XGI A;  4GH9 A;  1QAN A;  1D2N A;  4LZZ A;  4GHL A;  1D0L A;  3AOG A;  5EP2 A;  4LF9 M;  1ZMU A;  3J81 S;  2BJW A;  3AOE C;  4OW0 A;  2XZF A;  1G59 A;  1F4I A;  2JY8 A;  5KPZ A;  1LV7 A;  5FLX S;  3SFZ A;  2CEA A;  4X65 M;  3U6C A;  4RNA A;  4IBF A;  4RF1 A;  2ZM6 M;  2OOB A;  3FKE A;  4B3S M;  3BXW A;  3FTF A;  5FTK A;  2DKL A;  4FWD A;  1OFI A;  4IBB A;  4X66 M;  2L2D A;  4FCT A;  2Z3X A;  5F3W A;  1N78 A;  1MX0 A;  4L78 A;  1IN7 A;  3GLG E;  2L09 A;  2L7H A;  5BPV A;  4LFC M;  2DNA A;  2ERC A;  4LF6 M;  2KRU A;  2DWM A;  3AL0 C;  2CWB A;  4LRS A;  3U6L A;  2KDL A;  1QZE A;  2C9C A;  4CJ6 A;  4FCV A;  5L8R F;  1RU3 A;  1R2Z A;  2R46 A;  1L1T A;  4IJE A;  3FE3 A;  1PJS A;  3KVW A;  2NQ8 C;  3IG5 A;  4IBC A;  3W68 A;  1S3S A;  1NV9 A;  3LCU A;  4JI1 M;  2J5Y A;  3SMP A;  3CF2 A;  2DHY A;  4NSR A;  1HNZ M;  1HT1 E;  5E26 A;  2MR9 A;  4AKG A;  2R0I A;  2WSC F;  2E5L M;  4AI6 A;  2F5P A;  2CV1 A;  3E46 A;  1WR1 B;  2K47 A;  4MM3 B;  3BOS A;  2KEB A;  3HU1 A;  1IQP A;  4HLQ A;  2JA2 A;  2X4A A;  5ITQ A;  1DV0 A;  4XK8 F;  4F1I A;  2Y0Q A;  3FTC A;  1PRB A;  1QVR A;  2XF3 A;  4LJ5 A;  2F5O A;  1N33 M;  2L6O A;  1GJT A;  1L2B A;  1VQ1 A;  4I8O A;  2JP7 A;  4MGY E;  2A5Y B;  3HU2 A;  3ILK A;  5EP1 A;  4GEW A;  4JI3 M;  1C7Y A;  3MHV C;  2F5S A;  1V33 A;  3QYB A;  2VF7 A;  2BWB A;  3K1J A;  3E9S A;  4NOO B;  1AUA A;  3TE6 A;  3U6P A;  3D8L A;  3SAW A;  4LG2 A;  2YR0 A;  1SXJ A;  1OIP A;  1NHG C;  1JR3 D;  1WGL A;  3HZJ A;  2OQ4 A;  1MU5 A;  5ITU A;  2JWS A;  3U6O A;  3UJN A;  3HJ8 A;  2Y21 A;  2QCU A;  2ZAO A;  3PVS A;  4G3O A;  4GIP A;  3PXG A;  3KOX E;  3RGS A;  1C1K A;  4WP2 A;  4ZPX A;  1R7R A;  1WGN A;  3VDU A;  2KNA A;  2EUC A;  4Y28 F;  4DV3 M;  3KP1 E;  3B9P A;  3MK6 A;  1Q3B A;  3U6S A;  1N34 M;  4NRW A;  2Q2E B;  4DR6 M;  5BR8 M;  2V1U A;  1ZMW A;  4IIW A;  5DYG A;  3IEC A;  1R5L A;  5FTJ A;  4AG5 A;  1G4A E;  3LQQ A;  1UM8 A;  4OVZ A;  5FTN A;  2V6Z M;  4GHA A;  3VKG A;  1ZQ9 A;  3UZU A;  3EIH A;  3KSX A;  4G4N A;  1NJG A;  2Z4R A;  2KHH A;  1HT2 E;  2D7G A;  3LW5 F;  3J2P B;  1JR3 A;  2QZ4 A;  2RGO A;  3W0L B;  3SYK A;  3AKZ A;  4PCZ A;  1E32 A;  3GPY A;  2DAI A;  1NY6 A;  2BJV A;  4DR3 M;  3M6A A;  4R7G A;  2CRU A;  1OAI A;  3C9P A;  3V76 A;  4GC9 A;  1OTR A;  2O01 F;  4LJ7 A;  5FTM A;  2DWL A;  4MGZ E;  3AFH A;  4Q7J A;  1SXJ B;  2DWN A;  2F5Q A;  4JI2 M;  2KXE A;  2MH8 A;  5DYI A;  3A98 B;  1KSF X;  4DUZ M;  3K92 A;  4YY3 M;  1XXH A;  4PT5 A;  4S12 A;  1HNX M;  2W82 A;  4EIW A;  1VEK A;  5IWA M;  4CIS A;  4MB7 A;  2DHR A;  4DV4 M;  1GAB A;  2Z8Y M;  4D82 A;  4G4Q A;  3I04 M;  4AG6 A;  4X62 M;  3L27 A;  2L4F A;  4KLN A;  1GL6 A;  3SHG B;  3KOW E;  1XC8 A;  1TH4 A;  5IZ7 D;  1D0K A;  3GP1 A;  1KFV A;  3DA1 A;  2RRU A;  4R71 A;  1SXJ E;  3GLG B;  1L2D A;  4OVZ B;  5ITX E;  4YHH M;  4DBG B;  1KYI A;  3JAM S;  1PJQ A;  1Q02 A;  3SYL A;  1T3T A;  1OAO C;  1UFZ A;  4WW0 A;  2DEN A;  2VQE M;  3KS4 A;  3T1H M;  2H1R A;  2CHG A;  4LF7 M;  4LGM A;  4AZF A;  1K3X A;  2KNV A;  1TDH A;  2KRK A;  1GJS A;  4GC5 A;  2WSF F;  2I7N A;  1EIJ A; 
#chains in the Genus database with same CATH homology
 1N75 A;  2EO2 A;  4DV0 M;  4LFA M;  4G4O A;  3GQ5 A;  1N77 A;  4FVM A;  3T15 A;  3TWM A;  3THG A;  5ITR A;  3TQS A;  1HR0 M;  2CE7 A;  4IBG A;  4QNM A;  2VQF M;  2DZN B;  1NNJ A;  5E6J A;  1HQY E;  4I81 A;  2CHQ A;  1E94 E;  3Q8X A;  1IY0 A;  3R8F A;  4OU7 A;  1XXH B;  1PJI A;  2RKO A;  2YFQ A;  4QNR A;  1ZAE A;  1Z5C A;  2FNA A;  3JR4 A;  3U61 A;  3T38 A;  5FTL A;  4REZ A;  4DV2 M;  1IXR C;  3I4Y A;  1NNU C;  4D81 A;  1Z5B A;  2L7I A;  2XFS A;  3OTO M;  3HWS A;  2UUC M;  3DOA A;  2DWZ B;  3GPX A;  3KS8 A;  4TUW A;  4GMQ A;  1SXJ D;  3UMM A;  3PNY A;  5EXT A;  1IN8 A;  2AHM A;  3U5Z A;  1QQW A;  4WUR A;  4M9S A;  2QPA A;  1W5S A;  5DNY A;  1NY5 A;  2ZAM A;  2HKJ A;  4DR5 M;  3HHX A;  3UK6 A;  5IRE B;  1L1Z A;  1PM5 A;  1Q39 A;  4BLC A;  1GL7 A;  4DUY M;  4JI4 M;  3J7B A;  2VII A;  5EXS A;  2D7E A;  3TWL A;  1G41 A;  3HJQ A;  2KZU A;  3GPU A;  2J7N A;  4LJ6 A;  1XNR M;  1ORY B;  1GKI A;  3K8Z A;  2XH9 A;  2XSZ A;  2F5N A;  4L16 A;  3GQ4 A;  2M60 A;  4IBI A;  3TPZ A;  1YE9 A;  4GKJ M;  2LH0 A;  4P16 A;  4FWH A;  5ITX A;  2LWX A;  3U61 B;  4JXJ A;  2DZO B;  3I4V A;  2CV2 A;  3CTW B;  3SBJ A;  3DFZ A;  4IBD A;  4DV5 M;  4QHT A;  4JN6 A;  2C99 A;  3UGJ A;  4G4R A;  2C5R A;  4DR1 M;  4B3T M;  5EJC A;  4M0D A;  4IBJ A;  5ITT A;  4PD2 A;  3H4M A;  3U6E A;  4JI5 M;  3L25 A;  1IXZ A;  3U5Z B;  1DGG A;  2HL7 A;  1GLN A;  4NRV A;  4DR4 M;  4LJA A;  3RFW A;  2R65 A;  3GLI A;  2HCB A;  4LF8 M;  2KW0 A;  2Z4S A;  4M0W A;  4DV7 M;  4MGI E;  1X37 A;  1QAM A;  3NBI A;  2XFT A;  3GRR A;  2Y0T A;  3GRU A;  3HKP A;  4W5W A;  1Z5A A;  4NSO B;  2C9O A;  1SXJ C;  5EXP A;  4BBA A;  3A42 A;  1IXS B;  3SMS A;  2CFO A;  3GLH A;  3I51 A;  5FSW A;  1TDZ A;  1J09 A;  1YSY A;  2YNM D;  3KOY E;  2ZAN A;  4AQY M;  5LMN M;  3FYC A;  3NWL A;  4LJ8 A;  1QYR A;  5JI2 E;  2X49 A;  8CAT A;  1JQJ C;  3T1Y M;  5LMU M;  2FFJ A;  3MJ5 A;  3KOZ E;  3PFI A;  1N36 M;  3D8B A;  3VFD A;  3KW6 A;  1Q3C A;  3VDP A;  3HU3 A;  3L29 A;  2YQZ A;  3L2A A;  1L8Q A;  3HGI A;  3CF0 A;  2LNH C;  1GVN A;  4GIT A;  3TL4 X;  2OPF A;  3SAS A;  2G5G X;  3SAV A;  3GLI B;  4B3S M;  4D80 A;  3SAU A;  1TH3 A;  2G8L A;  4JI7 M;  5EP3 A;  1XMO M;  1HQC A;  2QP9 X;  1I94 M;  4M9X A;  4HL4 A;  3L28 A;  4QOS A;  3HHZ A;  2KZS A;  3HHW A;  3GRV A;  2O5R A;  4KOD A;  4IBE A;  4LJ4 A;  4CHT B;  5KQD A;  1E9R A;  4M9Z A;  3J7A S;  1IY2 A;  1G8P A;  4LFB M;  3LMM A;  1VDD A;  3ZH9 B;  1OFH A;  3WHK A;  2CV0 A;  3GLH B;  1IBL M;  1PJJ A;  2D7H A;  5EP4 A;  1DGF A;  1Z59 A;  2DXI A;  2C96 A;  1TH2 A;  1J7K A;  1FNN A;  3ZC7 B;  2R45 A;  4MGH A;  4OX9 M;  4BB9 A;  3KP0 E;  3GRY A;  3FUU A;  4NXM M;  4X64 M;  2P5T A;  3M7G A;  3E4R A;  3QWL A;  3WHL A;  4CGY B;  3A45 A;  3PNV A;  4KHP M;  3C58 A;  3U6D A;  2UXD M;  1FJG M;  2V1C A;  2XSZ D;  2CUZ A;  3ZCB B;  4AKI A;  4MH0 E;  2F4V M;  5KPT A;  4FCW A;  1XHB A;  2UU9 M;  4Z8X A;  4NL4 H;  4JI6 M;  4LF5 M;  3R9X B;  3FTE A;  1I4W A;  4LJ9 A;  5H37 D;  3K2L A;  3JR5 A;  1Z6T A;  3FD9 A;  4LRT A;  1OJL A;  2X8A A;  3J27 B;  4LCB A;  3GLF A;  4II7 A;  1J5E M;  4DV6 M;  2R4J A;  1IN4 A;  2C98 A;  3KXE C;  4JYA M;  4B7H A;  1E9S A;  3EIE A;  2EA0 A;  4JV5 M;  5EQT A;  4B08 A;  2BNK A;  2XLJ A;  3GQ3 A;  1H6U A;  1EE8 A;  3KDS E;  3HJS A;  3U6Q A;  5KQ8 A;  2LXE A;  2FOI C;  3FUV A;  3TWK A;  2XZU A;  2QBY A;  1G3I A;  3A46 A;  3HHY A;  2ZBK B;  4DR7 M;  2DVW B;  3U60 A;  5KO3 A;  1R2Y A;  1QAO A;  1W5T A;  2KA6 B;  3M0E A;  2I7P A;  3CF6 E;  1IN6 A;  3VLF B;  1NJF A;  3L26 A;  4GRI A;  4QHS A;  2HHH M;  4ITQ A;  1IBM M;  5KPR A;  2RGH A;  1YUB A;  3FUT A;  2FE8 A;  4I4L A;  3J80 S;  4QOZ C;  1QAQ A;  1XMQ M;  2J7O A;  3AV0 A;  4B3R M;  1DGH A;  4IBK A;  3VK8 A;  3GO8 A;  2CHV A;  1NSF A;  4G6Z A;  4NXN M;  3GLF B;  4GKK M;  3LQR A;  1QZM A;  3W0F A;  4DV1 M;  4AKH A;  4B7F A;  1K3W A;  2M5Z A;  7CAT A;  3SAT A;  2UXB M;  5C1B A;  4FD2 A;  3LVV A;  4IJF A;  3DZD A;  1DO0 A;  2R62 A;  5ITY A;  3QAU A;  4L15 A;  1IN5 A;  2Z7J A;  5GKN A;  1L2C A;  3GLG A;  1TGU A;  3RGP A;  3RE8 A;  2QBY B;  2R4E A;  3SC3 A;  3KSJ A;  3FTD A;  3LVW A;  3U6M A;  3U60 B;  4FW9 A;  4KO8 A;  4AW4 A;  3VK7 A;  1WXQ A;  3FYD A;  3AOE A;  4LF4 M;  3VKH A;  1DGB A;  2XGN A;  2UUA M;  2XEP A;  4K0K M;  2Y20 A;  3IG8 A;  2QEN A;  3FUX A;  1IBK M;  4LZJ A;  4L4U A;  1K82 A;  1XWI A;  4Z6Y A;  3GPP A;  4I5S A;  1IM2 A;  4PDG A;  4XBO A;  4B3M M;  1DGH B;  1HNW M;  4A3V B;  2R18 A;  3KFU G;  3AJI B;  4PDI A;  3FUW A;  1N32 M;  4L8R C;  4DR2 M;  1NVM A;  2UXC M;  5A2Q S;  4JI0 M;  5C18 A;  1NHW C;  1R6B X;  4R3D A;  4JI8 M;  4LY6 A;  4RF0 A;  1IY1 A;  1XNQ M;  3SHF A;  4MGK E;  1DO2 A;  2UUB M;  4LGY A;  4B7G A;  5EXX A;  5JI3 E;  4FWG A;  3SAR A;  5IT9 S;  4XGI A;  4GH9 A;  1QAN A;  1D2N A;  4LZZ A;  4GHL A;  3AOG A;  5EP2 A;  4LF9 M;  3J81 S;  2BJW A;  3AOE C;  4OW0 A;  2XZF A;  1G59 A;  5KPZ A;  1LV7 A;  5FLX S;  3SFZ A;  2CEA A;  4X65 M;  3U6C A;  4RNA A;  4IBF A;  4RF1 A;  2ZM6 M;  3FKE A;  3FTF A;  5FTK A;  4FWD A;  1OFI A;  4IBB A;  4X66 M;  2Z3X A;  4FCT A;  5F3W A;  1N78 A;  1MX0 A;  4L78 A;  1IN7 A;  2L09 A;  2L7H A;  5BPV A;  4LFC M;  2ERC A;  4LF6 M;  2KRU A;  2DWM A;  3AL0 C;  4LRS A;  3U6L A;  2C9C A;  4FCV A;  1R2Z A;  2R46 A;  1L1T A;  4IJE A;  3KVW A;  2NQ8 C;  3IG5 A;  4IBC A;  1S3S A;  4JI1 M;  3SMP A;  3CF2 A;  4NSR A;  1HNZ M;  1HT1 E;  5E26 A;  4AKG A;  2E5L M;  4AI6 A;  2F5P A;  2CV1 A;  4MM3 B;  2K47 A;  3BOS A;  2KEB A;  3HU1 A;  1IQP A;  4HLQ A;  2JA2 A;  2X4A A;  5ITQ A;  2Y0Q A;  3FTC A;  1QVR A;  2XF3 A;  4LJ5 A;  2F5O A;  1N33 M;  2L6O A;  1L2B A;  4I8O A;  4MGY E;  2A5Y B;  3HU2 A;  3ILK A;  5EP1 A;  4JI3 M;  3MHV C;  2F5S A;  3K1J A;  3E9S A;  4NOO B;  3TE6 A;  3U6P A;  3D8L A;  3SAW A;  4LG2 A;  2YR0 A;  1SXJ A;  1NHG C;  1JR3 D;  2OQ4 A;  1MU5 A;  5ITU A;  3U6O A;  3UJN A;  3HJ8 A;  2ZAO A;  2Y21 A;  2QCU A;  3PVS A;  4GIP A;  3PXG A;  3KOX E;  3RGS A;  1C1K A;  4ZPX A;  1R7R A;  3VDU A;  2EUC A;  4DV3 M;  3KP1 E;  3B9P A;  3MK6 A;  1Q3B A;  3U6S A;  1N34 M;  4NRW A;  2Q2E B;  4DR6 M;  5BR8 M;  2V1U A;  4IIW A;  5DYG A;  5FTJ A;  4AG5 A;  1G4A E;  3LQQ A;  1UM8 A;  4OVZ A;  5FTN A;  2V6Z M;  4GHA A;  3VKG A;  1ZQ9 A;  3UZU A;  3EIH A;  3KSX A;  4G4N A;  1NJG A;  2Z4R A;  1HT2 E;  2D7G A;  3J2P B;  1JR3 A;  2QZ4 A;  2RGO A;  3W0L B;  3SYK A;  3AKZ A;  4PCZ A;  1E32 A;  3GPY A;  1NY6 A;  2BJV A;  4DR3 M;  3M6A A;  4R7G A;  4GC9 A;  5FTM A;  4LJ7 A;  2DWL A;  4MGZ E;  3AFH A;  2DWN A;  1SXJ B;  2F5Q A;  4JI2 M;  2KXE A;  5DYI A;  3A98 B;  1KSF X;  4DUZ M;  3K92 A;  4YY3 M;  1XXH A;  4PT5 A;  4S12 A;  1HNX M;  2W82 A;  4EIW A;  5IWA M;  4CIS A;  4MB7 A;  2DHR A;  4DV4 M;  4D82 A;  4G4Q A;  4AG6 A;  4X62 M;  3L27 A;  4KLN A;  1GL6 A;  3SHG B;  3KOW E;  1XC8 A;  1TH4 A;  5IZ7 D;  3GP1 A;  1KFV A;  3DA1 A;  3GLG B;  1SXJ E;  1L2D A;  4OVZ B;  5ITX E;  4YHH M;  1KYI A;  3JAM S;  3SYL A;  1T3T A;  4WW0 A;  2VQE M;  3KS4 A;  3T1H M;  2H1R A;  2CHG A;  4LF7 M;  4LGM A;  4AZF A;  1K3X A;  1TDH A;  2KRK A;  4GC5 A;  2I7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...