4NOYA

Crystal structure of listeria monocytogenes hfq f43w
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNWTVLLDVEGKQQLVFKHAISTFSPQKNVALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein Hfq
publication title Recognition of U-rich RNA by Hfq from the Gram-positive pathogen Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Rna binding protein
total genus 16
structure length 73
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4noyA00
3HFOA 5DY9A 4C92G 5GAMd 3PGGA 3V8LA 2DVEA 4M75E 5GMKj 2I2LA 1Y96B 3JB9H 4XTWA 2K57A 2RD1A 3RERA 5GANe 4C8QF 3JCMJ 4J6XA 2RA2A 5LJ5h 3V8KA 4C92F 4J6YA 1WQ7A 4C92D 4EMKA 5GAN3 4M7AE 4M7AB 4M7AC 5GAMh 1B34A 5GMKe 4M7AG 4M77F 5CAIA 3JB9J 4JRIA 1I5LA 3RIRA 2JN0A 4M7DF 2QTXA 1U1SA 4M75B 3V7RA 3BY7A 3JCMf 5GAOp 2CGHA 5GAOr 4Y91A 3BW1A 4XTXA 1YCYA 3HFNA 3RKXA 5GANf 3JCMd 1JBMA 4M7AD 5GAN5 1HXDA 5LJ3e 3QHSA 5GANd 5GAN7 4J5YA 4XU1A 4EMKC 5GAN8 4C92C 2VXFA 4EMKB 4V2SA 2YLCA 4EMGA 4M78A 4WF2A 3JCMX 3JCMQ 1B34B 3M4GA 3JCMh 5I21A 4RCBA 4PJOA 5GAOq 3FB9A 4C8QE 4XU3A 3QUIA 3QO3A 3V7CA 4F7UF 3JCMb 3SB2A 2DXTA 4M78E 3RKWA 4JUVA 1LOJA 2DKGA 5LJ3f 2VC8A 3L2ZA 2DEQA 5LJ5g 4PJOE 4X9CA 5GAMg 3SWNA 2FB7A 4M75C 5LJ3j 3RESA 1M8VA 4PNOA 3JB9I 2DJZA 4M75G 1N9RA 2E1HA 2HNIA 4NL2A 3VU3C 4HA8A 4NL3A 2Y90A 4M7AF 1KQ2A 4M78B 2ZGWA 2RB6A 4MMKA 1WQWA 4PJOC 4EMHA 4PJOB 3INZA 4JLIA 4PJOG 4M75F 4M75D 3JCMc 4C8QA 4F7UA 3AHUA 4RCCA 4NOYA 2YLBA 3FIFA 4C92A 5LJ5e 1WNLA 5GAN2 5GAOm 1MGQA 3QSUA 4XTZA 5GAMe 3RUXA 3EFRA 4M77A 4XU2A 3SWNB 3JCMg 4F7UE 5GAN4 4PJOD 5GANh 2E65A 4M7DA 4C92E 1LJOA 4HT8A 5GANg 4N0AA 4XTUA 2DZ9A 1HK9A 3BFMA 4M77E 2E64A 1U1TA 5GMKh 4M7DE 5LJ3d 4A53A 1D3BA 4F7UG 4DQ2A 4J6WA 2EJGA 4JRKA 2DZCA 3RKYA 2DXUA 4X9DA 4C8QC 3JCMW 4C8QB 3JCMV 1X01A 4M78C 4XTYA 2VXEA 3BDUA 2EAYA 4C8QG 4C92B 5GMKm 5LJ5j 1BIBA 3L1AA 4M78G 4M77C 5GAMj 3V8JA 5LJ3h 4M77B 1M5Q1 3JCMe 1H641 4XTVA 2EJFA 5GAOn 4M77G 5LJ3g 4M7DC 4M7DB 3EFSA 5GAN6 4N0AC 4M7DG 1I8FA 4C8QD 5GMKi 3JB9G 3HSBA 2EJ9A 4OP0A 5GAOl 2DTIA 4M78F 2RM4A 1TH7A 4M78D 3SWNC 4QVCA 4HT9A 1LNXA 4PJOF 1D3BB 1Y96A 1WPYA 4M77D 2E10A 4QVDA 1KQ1A 3JCMP 2YHTA 3JB9F 2FYKA 4A54A 3JB9D 4M7DD 4XU0A 4XQ3A 1I81A 1BIAA 4M7AA 2DTHA 2E41A 2DTOA 5LJ5f 3V7SA 4MMLA 2EWNA 1I4K1 3GIBA 4M75A 4F7UB 5GANj 1N9SA 5GAMf 3FJPA 5GMKl 1JRIA 5LJ5d
chains in the Genus database with same CATH superfamily
3OYDA 2ENMA 1ZA1B 5KYYB 2G3RA 3PGGA 5KCHA 1WJQA 1K76A 2I2LA 1YIJA 1NEGA 4A63B 1O9SA 3JCMJ 3PFSA 2XKOC 2KROA 3ULRB 4CI0C 1BK2A 1J3TA 1K9MR 4N4GA 3JB9J 2JJ9A 5C6SA 5GAOp 1KQSS 1RI0A 2BZ8A 5GAN5 1NEBA 4OGCA 4KH1B 4E7JA 1B34B 3EG2A 1QCNA 2RI3A 2CP7A 3H0FA 2QDYB 5I2MA 1KHIA 4HCBA 2HBPA 4J7FA 2NUTA 3OS0A 4TVRA 2FPFA 1YJWA 1Z9QA 1MUZA 5IHIA 2LC4A 4CC7A 3CCJT 1T3SA 1PD1A 1VQ8A 1WQWA 2NUZA 2CH4W 5GJVB 3I56T 1NPRA 2VV5A 2JS0A 5CQYA 1PCXA 3MP8A 3EHQA 3OYBA 5GAMe 5GAN4 2AKKA 2DL3A 5IHNA 1FMKA 2MMPA 2QG9B 2E3IA 1U1TA 3EGUA 5IHKA 4A53A 4M7DE 1U06A 2LTOA 4JRKA 4Y28E 1BI2A 3JCMW 4J9EA 2K4YA 4C5HA 1AT1B 3A8GB 5CCAA 1UGQB 2XK0A 1VQ4Q 1HJDA 2YUOA 1RAFB 3C12A 4AT1B 1BI0A 4DOVA 3HSBA 3QPHA 4B6MA 1QQJA 4HKEA 3OA6A 2DVJA 3LW5E 3CCVA 2H3JA 2EFIA 2V8IA 3VS1A 2PUKB 1HSQA 3OS5A 2JM9A 4J9GA 3V7SA 1ARKA 4J9DA 3M5AA 1SSHA 2QQRA 2PUOB 2VWFA 4QKUA 3SFMA 2JOYA 4E6RA 4NS5A 1VQ9T 2RA2A 2KVQG 2O31A 4JS5A 1KJWA 3CCSA 2OTLA 1DJ7B 4XK8E 1W70A 2D6FA 1K0XA 2MK5A 1VQMQ 2JMAA 4ESRA 2A3LA 4C0ZA 2H8HA 2EGCA 1VQPA 4O6JA 1G83A 1PSFA 1ZUUA 1YI2T 2DL8A 5CKEA 1CSKA 4C0FA 4RCBA 2B86A 4JLGA 3V7CA 2F69A 2HAXA 5EC7A 4PJOE 3NTHA 1MV0B 1YNZA 3OS2A 2KR3A 2G6FX 5CQXA 3GBQA 5J39A 4B9WA 5FU6C 3I5RA 3S6WA 1D1CA 3E9GA 2CT3A 2RNAA 4C92A 4L5GA 1ZUYA 5I22A 4M77A 1YWPA 1BU1A 2E65A 4ZTFA 2OTJA 4C0DB 4MZMA 4ZNXA 1BCOA 2D0QB 2M16A 4E7ZA 1OQKA 4KGXB 4R56A 1Q82C 1IZ6A 2KYBA 2L3RA 2C06A 4HT9A 3T9NA 3KUFA 1AWOA 3NFCA 1Y57A 4A54A 5KCOA 2DYIA 2DJQA 2M51A 4R55A 5FU7C 2RHYA 1K4US 2FZGB 3CCLA 1MNDA 1YITA 1N9SA 1JRIA 1W1FA 3LH5A 3M54A 2FRYA 2EQUA 1WX6A 4C92F 3CMAA 1RAIB 3E9FA 2HEQA 1TS9A 4M77F 4JRIA 3HPWA 2JMCA 4OGEA 3BY7A 1FX7A 2CS7A 2CGHA 3TSWA 3MKDA 1YCYA 1JJ2A 4OMMA 1YJ9T 1VQ6Q 2CP2A 1UHFA 1KFZA 5GAN8 3EH1A 3HP9A 4WF2A 5I21A 1VQLA 1OI1A 2EKHA 4IUTA 4PLLA 5FWBA 3FB9A 3N5BB 4J9IA 3ZFJA 3ZEHA 1JO8A 2AKLA 3OYAA 5A2QE 3M0TA 2KXCA 4GY5A 3DLMA 3SWNA 2DF6A 3VUZA 4PNOA 3JB9I 2YRDA 2ROLA 4OMFB 2HBWA 2YSQA 3C0CA 1AVZC 4EIKA 3REAB 2RHXA 4PJJA 1BI1A 4FIBA 2NUTB 5KYWA 2DMOA 4RTVA 4JS4A 2DD5A 5DLOA 1BYMA 3A8OB 5GANg 4XTUA 2DZ9A 2E64A 2FZCB 4RG8A 1D1BA 2PQWA 4X9DA 3HHTB 1Y0MA 4FW1A 2BTTA 3UWNA 2DBKA 3SDZA 5LJ3h 1U8RA 1QVFA 4M7DG 5GAOl 1WDXA 2KAFA 4A4GA 2B8AA 3GOXA 3ZL7C 1PSEA 1X75C 5AYFA 1TWBA 3JB9D 3VJPA 2KBTA 2ZZDA 2A7YA 1VOMA 1BIAA 4DA4A 3JAME 2BKDN 1VQOT 1VQ7T 2RQTA 1GFCA 1M90U 4C92G 3LGLA 9ATCB 4MDWA 1PHTA 4XTWA 2LNHB 2NYSA 2CZ7B 3PT9A 2WSFE 4Z89A 4RTWA 2VGNA 4KUDK 1KD1R 2IIMA 3C94A 2LJ3A 2X4JA 3GNFB 1OULA 1F1BB 1QVFS 3MO8A 3I9QA 4J5YA 2EPDA 4CC3A 1AHJB 2JVVA 2XDPA 2FO0A 2JM8A 3OYJA 1VQ4A 2DKGA 2HCKA 1VIFA 3H0HA 2ZPFB 4C5GA 3QWXX 2K2VA 2WSCE 4C5IA 2KT8A 2NWMA 5D6XA 1U3OA 4JLIA 4PJOG 3OS1A 3QJYA 2DL7A 3L2UA 1MV3A 3CCUQ 5GAOm 3QSUA 4XTZA 1UEBA 3QG1A 1ZSGA 1ZUKA 3JV3A 3VRYA 3G4SQ 1LJOA 1XTDA 2RH2A 3CC2T 2AHJB 1Z9ZA 2EBPA 5A0DA 5LJ3d 1SRMA 3E2UA 2F2XA 1UECA 4C8QG 4C92B 1VQMA 3CXCA 5A0LA 3MP1A 4M77B 3PMIA 1TTHB 2BE7D 2LZ6B 4C0GA 3G71Q 2DX1A 1N8RU 4AG1C 2QYZA 2QTVA 5KYUA 3TEEA 2LCCA 2ZCFB 2PVOB 1TUCA 3JCMP 3QJ6A 4XU0A 3I55Q 4KT0E 4RTUA 1B7TA 3CMEQ 1PWTA 4BB7A 4LDWA 4J7IA 1M1KC 2RJFA 1OX8A 2SRCA 5GMKj 3A98A 4JRPA 2A08A 3GF5A 3META 4WCIA 3M55A 2EQMA 1Q86U 1MMAA 1D1AA 1I1JA 3CXCS 3RKXA 4EDUA 2AT1B 4YTLA 5C0MA 1QVGP 3M4YA 1GCQA 5LJ5g 2DXBA 5CR2A 5LJ3j 2LP5A 4HA8A 3CBPA 1OYXA 2CUBA 2PVGB 1SSFA 2EYZA 4D8DA 2J05A 1YJNQ 3CC7Q 3CCMQ 1M1GA 4JRQA 1LPLA 1YIJT 1A0NB 1D0XA 3TCJA 2DIQA 1WHMA 1MGQA 3OYIA 1Q81R 3O8VA 2HQHA 3SWNB 3JCMg 3NHNA 2OAWA 1MHNA 3A8LB 2EIFA 2LMJA 2KDSA 2LNVA 3A1PA 1K8AR 1D09B 2ECZA 1BI3A 1SKUB 3JRZA 5KE2A 4IUPA 1X01A 1RAGB 4M78C 1Q81U 3H6ZA 5KYWB 1K73C 4BD3A 3P8BB 3M0PA 3WVEB 2P0KA 1GFDA 1VQ6A 4M78D 1Y96A 1OEBA 2Y4XA 1YP5A 2YHTA 3ER0A 4XQ3A 3CD6Q 1YJWT 4DEYA 3OY9A 2AK5A 1YI2Q 1KC8U 4K11A 2CZ0B 3CC4Q 2DYBA 4IURA 1OU8A 3PIOA 1KQSA 3UATA 1VQ8T 4M7AE 3A8MB 3H41A 2JTFA 3QKJA 2V26A 1P92A 3V8LA 2FHDA 2K2MA 2DIGA 3H9NA 3OYCA 3UDCA 4J6YA 2ZPGB 2YXYA 4CC4B 5IXFA 5GAN3 1AWXA 1T0JA 1WHGA 2JN0A 4FYYB 2O9SA 1WIEA 1Q7YR 2EQKA 4KRTA 5D6YA 3A8HB 4Y91A 1NJIC 1TG0A 1HXDA 2RK1A 4WTOB 1TOVA 5GANd 5GAN7 5CVIA 2E4HA 2HSPA 1VYVA 1PKTA 1GRIA 3UT1A 1G3SA 3OYHA 3GPLA 4FSSA 1Q7YU 3QUIA 4BUGA 1HYOA 4M78E 1LOJA 4KGVB 1W6XA 4X1VA 4HVWA 4M75C 1M8VA 2RQWA 2X4WA 1W4SA 3J81E 2X3WD 3TVTA 1SHGA 1BKBA 1RACB 1WYXA 2QXFA 1UUEA 3U23A 2GTJA 4M75D 1V76A 4F7UA 1K9AA 4JJNK 1UB4A 4OMLA 4O5VA 1AZGB 3RUXA 3EFRA 4LUDA 1WJSA 2KK4A 1ZSZA 3CCST 2OTLT 3HTRA 5DM7R 1TU0B 4HCKA 3RKYA 3OMCA 1VQPT 1QCFA 2EAYA 2E5KA 4M77C 2V8JA 1RL2A 4QQGA 4XTVA 2RMOA 1YHQQ 3OYMA 4A4HA 1IREB 2L89A 5ECAA 3G6ET 1K9MC 2QA4Q 2DTIA 1SRLA 2K3YA 5IXBA 4M77D 3MEWA 4KULA 1X6BA 4DOWA 1GBRA 2K9GA 2DETA 2JW4A 2DTOA 5FW9A 5GANj 1LVKA 2LVMA 3HFOA 1EZZB 5KYUB 2QI2A 4M75E 2QEXQ 3TSZA 3JB9H 4C5EA 2K6DA 3M59A 2DA9A 5LJ5h 3THKA 4EMKA 1IO6A 2MI6A 2OTJT 3TREA 1S72Q 3CCUA 4QQDA 2DERA 3G4SA 2A37A 1UDLA 1G5VA 4LE9A 3HFNA 5GANf 3CCQQ 1VQKQ 2O01E 3S3MA 2LJ1A 2COYA 3RBBB 1JU5C 7AT1B 4V2SA 1GBQA 1OOTA 3M4GA 3JCMh 3NGPA 3EHRA 2GF7A 2RF0A 2DXTA 5EG2A 1RAEB 1M8MA 3EG1A 3G71A 3L2ZA 5CKFA 1RADB 1N6AA 3VKIA 1X43A 3MCAB 1ZBXA 3CCLT 3I55A 3FC3A 3MEAA 3CMEA 4RCCA 2LX9A 3VS6A 2YUPA 2R57A 3CMAT 4E7KA 2JS2A 4M7DA 2HKNA 5J3BA 3LGFA 1VQ7Q 2EGAA 5KYXA 3NPFA 2YRCA 1TUGB 2D0NA 2ED0A 4ZGDB 1WJRA 4D6WA 5HK0A 4OB1B 2KSSA 4RTTA 2P4RA 5GAOn 2CZ6B 1VQLT 4OP0A 5L23A 3UA6A 2FPEA 1VQNQ 5I2SA 3Q1JA 4QVDA 2X51A 1Q82U 1YBYA 2PNIA 2DTHA 2LX7A 2DK3A 2Z0WA 4GLKA 5AT1B 1UJ0A 2EYQA 3LYIA 4F7UG 5LJ5d 2XDBA 1UJYA 2HL5C 1Y96B 1NYGA 1YJNA 3CC7A 3V8KA 2K3XA 3CCMA 4QVZA 2CYZB 1NE8A 4M7AG 4M7DF 3QYHB 3D7SB 2IPOB 5GAOr 3BW1A 3JCMd 3G1JA 5IH2A 4ELZC 5LJ3e 4XAXB 1WHJA 1UHCA 3ASKA 3JCMX 2YWWA 5CIUA 1SPKA 5D7UA 2LT1A 4PJOA 2GCXA 3CQTA 2X4YA 2J7IA 1SG5A 4JUVA 2GNCA 2DEQA 1WFWA 2CP0A 5FRMA 2FB7A 2CP6A 1C6VX 1IXDA 1N9RA 3CCEQ 2DEUA 3EFOA 2AZSA 2P0QA 3CD6A 2ZGWA 3EG3A 2CT4A 2RHUA 3I5SA 3VYGA 1VQ5Q 4HVVA 2RJCA 1YI2A 4C8QA 3CC4A 1JJ2P 2K5LA 3E1SA 3CPWP 4XU2A 3MEUA 2ZPHB 2KEAA 4N0AA 1ZX6A 2PZ1A 1HK9A 1H3HA 5GMKh 2A36A 3TQ7P 2HL3A 5CKDA 2PVDB 4RTXA 2CKKA 1ZQ1A 5LJ5j 4MZTA 1M9SA 2O9VA 1IHVA 1I0CA 1XOVA 1YWOA 3BE3A 1ZSZB 2ROTA 2J6KA 4EPCA 2QGGA 2HSEB 4PJOF 1VQ4T 2FRWA 5HCKA 1NYFA 4HCZA 2FYKA 2MOXA 3L2WA 2BZYA 4BI8B 3A5ZB 1RLQC 5FWCA 3LWHA 5LJ5f 3VV0A 1U5SA 1BBZA 5KH6A 2KXDA 2KI7A 2KT1A 5D6WA 3RERA 4C8QF 3PVLA 3TU4K 4Z02A 1M90R 4CC2A 3CEYA 4MZPA 3QDFA 4DBRA 2DBMA 2OI3A 3JCMf 2EQIA 4HXJA 2EYXA 2CUDA 1VQMT 2OJ2A 2ZPEB 2FPDA 1UG1A 4EMKB 3PMTA 4JJCA 4B9XA 4J9HA 3DKMA 4J83A 1YHQA 2LDMA 3CCRQ 6AT1B 4RTYA 2QA4A 3VS0A 2JXBA 3G7ZA 4QT7A 1X2KA 2XHCA 2KNBB 2J06A 4NL2A 1K1ZA 4MMKA 3JCMc 2MF2A 4BI4A 3WVDB 5I11A 1SF9A 1VA7A 2FVUA 3GLXA 1LCKA 2QEXA 5M9OA 4VUBA 2L3QA 2SEMA 2RK2A 1QP3A 1OV3A 2CSIA 4J8OA 3OB9A 2LRQA 1W2BP 1N27A 1S72A 4OMOA 1T3LA 4XTYA 4ANJA 3E19A 1BIBA 1VQKA 3CCQA 1T0HA 4M7DB 3O5ZA 5KYXB 4GLMA 3F70A 1VYTA 4KUIA 1KG1A 4LDXA 2QK0A 4C0DC 1KD1C 2LQKA 1N8RR 2DILA 2CREA 4LD9K 2EWNA 2COZA 1NM7A 3QDRB 4BY6B 1NPPA 4PL6A 2RJEA 4GBQA 4Z8AA 3ME9A 2CH4A 3URGA 2QASA 1TXQA 4IIMA 4JZ3A 3V7RA 1M1KU 2M1HA 1VQ7A 4FYXB 2BE9B 3L42A 1PKSA 3QYGB 3OYLA 1Q86R 1X27A 2JTEA 2YUQA 2EVRA 3RDVA 3LLRA 1VQ6T 2RQUA 2ZPIB 4IIOA 4FU6A 4RKUE 5GAOq 4OMNA 1WGSA 1OZ2A 3JCMb 2F2WA 4FM4B 2VC8A 2OAUA 3CCJQ 3OSVA 2GQVA 4FT2A 2JZ2A 1VQNA 4PJMA 1AEYA 2H3EB 2M9UA 2FG0A 2HMAA 3I56Q 1M30A 1B3QA 1WI7A 3G6EQ 4PJOB 4ORZA 5FRNA 1M2VA 1WXTA 2KMTA 4CRIA 4NOYA 1CKAA 3VS5A 1JQQA 2LQNA 5GANh 2EQJA 2PTKA 3EFOB 4J9FA 1QWEA 4AG2C 3RMSA 4J6WA 3HRTA 2BUDA 1KHCA 2V8KA 4C8QB 4ZGEB 3OW2P 4LUEA 3OBWA 1QVGA 2F2VA 2E12A 1ZSZC 5GAN6 1V1CA 2PU9B 2DD4A 2R58A 5GMKi 3SHWA 4MDXA 4E47A 2HDAA 3JB9F 4HVUA 2K7AA 2XI9A 2E41A 4DEXA 4FCYA 3FEOA 2ABLA 3R6OA 1XJWB 2W10A 1V29B 3P8HA 1VQ9Q 3CCEA 1KC8R 1VQ5A 2VYTA 1YN8A 3RIRA 1U1SA 4FSXA 5CKBA 3M56A 1NLPC 2X4XA 3LWIA 5GJWB 1QVGS 3PE0A 4X34A 2IVWA 3QHSA 1X2QA 2XG8D 4EMKC 4EMGA 3LX7A 1KQSP 4RG2A 3FLGA 4JDSA 4XU3A 3SB2A 3KBGA 3DB4A 4E2FB 1K8AC 2RPNA 1NJIU 5GAMg 4A4KA 2ATCB 3L2RA 3VRZA 4NL3A 1BB9A 3M53A 1JB0E 1RAAB 3NTKA 3INZA 2D8JA 3VYHB 5LJ5e 2A0FB 1Y71A 2O2OA 3EG9A 2VGMA 4FYWB 4II1A 1AD5A 1EIFA 2J6OA 3CCVT 1MMNA 3OSSC 5FU7B 3G4ST 2XICA 4IUQA 1UTIA 2BZXA 2M0YA 1M3BA 3JCMe 3EGXA 4FYVB 2IG0A 4M7DC 3JB9G 2LQ8A 2L0AA 1IB8A 2RI5A 2J6FA 4QVCA 3DB3A 3G71T 1Q7YC 4M7DD 2XMFA 2O4XA 4M7AA 1ABQA 3CCRA 1X6GA 3X26B 2YT6A 2M0OA 3HRSA 3I55T 2DNUA 4BY6C 4C92C 4ZN1A 1K9MU 3M58A 2LT4A 3CMET 4DBHA 4M4ZA 3PNWC 1RABB 1G3YA 1G2BA 2RD1A 1I5OB 2EW3A 4C92D 2C0IA 2X9HA 5CAIA 2KGTA 1PRMC 1UFFA 2QTXA 1YJ9Q 1AZEA 3M0RA 1YFNA 1VYUA 2NLUA 4JJBA 4ATOA 8ATCB 2BIVA 1IRXA 3RMQA 4BE0A 1M2OA 2DLPA 4M78A 1QLYA 2I0NA 2WSEE 3M0UA 4PLIA 3KFVA 4F7UF 4AFSC 2E5QA 1M1FA 3DLLA 2XIDA 1M3CA 1E6HA 2DJZA 2EGEA 2V1RA 4OVAA 1QCOA 2W0ZA 2O88A 4M7AF 3BDLA 4PJOC 1G8XA 2QQBA 4L59A 2MWOA 1E6GA 2QAZA 1X6OA 2YLBA 5GAN2 3UPUA 2QGFB 1YJNT 3CC7T 4FW2A 4Z88A 3CCMT 4PJOD 2HQXA 3FJ5A 4C92E 2QQSA 3OYNA 2DL4A 4BDYA 3BFMA 4M77E 3CBMA 1D3BA 1M2VB 4AFUC 1OZ3A 4C8QC 1EX4A 4IKFA 1YITT 2YUNA 2JT4A 1QVPA 1R0BG 2AIRB 4JPBW 4F16A 5LJ3g 2ED1A 2HQEA 4N0AC 4E7IA 2MIOA 4LDYA 4C8QD 4M78F 3SWNC 3EG0A 2GGRA 2X3XD 1M4ZA 5LL6S 1D0ZA 2CP5A 1VQOQ 3FRNA 1OU9A 4F14A 1E7OA 3CCJA 4M75A 1ZA2B 4E7SA 3CD6T 3SEMA 3JCMQ 5HY6A 1QP2A 2VB6A 2KRSA 1Q82R 3H8ZA 2LCLA 3ZBDA 1K0SA 1GCPA 3I56A 3CC4T 1IHWA 1UGRB 3G6EA 1G3TA 1UE9A 2K57A 4RMOA 4KGZB 1PD0A 5J26A 4OB2B 3C95A 3HL8A 2MCNA 3MPUB 4J9CA 5GAMh 1UGPB 5GMKe 3VS4A 1FMVA 4OF1A 3C4SA 2K5IA 2C0OA 1OX9A 3J7AF 2E70A 3MHXA 1S1NA 3MEVA 4N4HA 1QWFA 2VXFA 2P0PA 1O75A 1PNJA 5KE3A 1TUDA 3QZ5B 4C8QE 4F04B 1IGQA 3NTIA 4AMCA 1H92A 2F1LA 1JXMA 1CKBA 4X9CA 2XDDA 2R5MA 2E6NA 1QW1A 4LN2A 2Y90A 2XD0A 1QMCA 1EFNA 4KH0B 2Y4YA 4RTZA 1GL5A 2HD0A 4BDZA 4M75F 3HRUA 2RQRA 2RQVA 3AHUA 1UGVA 1QKXA 3CC2Q 1VQ9A 2WACA 2L8DA 8AT1B 3OMGA 3MP6A 2V1QA 4HT8A 1M27C 2CSQA 4QW2A 4ZN3A 2RHZA 1PG5B 2EJGA 2EYYA 4PK4A 1KIKA 2A28A 2C0TA 3OBYA 3RNJA 2RHIA 1H8KA 2DRKA 3L2VA 4M78G 3V8JA 3EG9B 4RUGA 1PRLC 3EFSA 3OQ5A 2RM4A 1TH7A 3VS2A 1YHQT 3H0IA 2FEIA 2D9TA 1KQ1A 4AFZC 1ABOA 2QA4T 4LDUA 1G3WA 1M3AA 3EGXB 5FROA 4KBMB 1I4K1 3GIBA 2X35A 4F7UB 3CPWA 3QIIA 1RAHB 2L3SA 2CZ1B 5DY9A 5GAMd 1PC0A 2YDLA 1Y7XA 2L5QA 2O4XB 3OYFA 2GFAA 2EYWA 4M7AB 2QEXT 2DXCA 2COWA 2DFUA 5FLXE 2LCSA 1R0CB 2RN8A 3LH0A 4BE1A 2YRVA 1HD3A 1S72T 2NUPA 5CO7A 5DLQE 4A4FA 1NLOC 2GBQA 2QQAA 2CP3A 3HKSA 4XU1A 1VQKT 3CCQT 2YLCA 3S3NA 3EH2A 1WA7A 2MPXC 3MJXA 1MNEA 3RKWA 2OX7A 1QVFP 1ACMB 1FYNA 3OYKA 1NZ9A 3FDRA 1JJ2S 3WXMB 5CKHA 1R8OB 4IUUA 4M75G 3CPWS 1JEGA 5IN1A 3EAEA 4L6V5 2GQIA 1YIJQ 4M78B 2XU8A 3JSCA 1WHLA 1XNIA 1KK7A 2QQ9A 1JXOA 2AZVA 2KYMA 5IT9E 1VIEA 2LJ0A 1Y07A 1ZHIA 4HCCA 2DZCA 2DXUA 5L8RE 3J80E 1YJ9A 2L3PA 2VXEA 3BDUA 5GAMj 3EGDA 1PM3A 2K79A 4M77G 1VUBA 2M02A 4Q5WA 2MAMA 3CPFA 5KYNA 2VVKA 1GCQC 2E6ZA 1M90C 2EJ9A 5KYYA 1YJWQ 1D3BB 1WPYA 2E10A 3PVQA 1VQ8Q 1I81A 2L2PA 1VQNT 2RJDA 3X24B 4MMLA 3QZ9B 1RLPC 3X20B 2QDLA 5GAMf 3M0SA 3OYEA 1X69A 1TSFA 3QXEB 3OYGA 1UGSB 2EKOA 1AOJA 3M57A 5GANe 1KD1U 4J6XA 4A4EA 1MMDA 4BI3A 3X25B 3X28B 3P8DA 1W2BA 2DO3A 1B34A 2E3HA 4M75B 5HK3A 1XQHA 2KE9A 4LDVA 3R6NA 3PTAA 3CBOA 2K5FA 1JBMA 2DRMA 4AFQC 1WXUA 3SD4A 1B07A 1M1KR 3CCVQ 1BCMA 1RI9A 1SEMA 3CXCP 1Q95G 4F17A 1KSWA 3GNGA 1QKWA 4LNPA 1FXXA 2RI2A 4PKCC 2R5AA 4DBFA 3OYYA 1WHHA 3RESA 3VS7A 3GP8A 4Y92A 2E1HA 4UC4A 3VU3C 1VQOA 1GXIE 1KQ2A 4OB3B 4QQ6A 4R0KA 3RR6A 3CCET 3CCSQ 2OTLQ 2KY9A 1W2BS 1VQ5T 2JTMA 3IQLA 2RO0A 4PFZA 5HKCA 1N8RC 2FL7A 3PIPA 3VS3A 1NG2A 1VQPQ 1WZOA 3JCMV 4IUVA 4OMPA 1C0MA 3QWYA 2DL5A 1M5Q1 3M9QA 3QBYA 3UF4A 1H641 4DBQA 2P4TA 2K3BA 2CDTA 1I8FA 2P84A 4E7LA 1MMGA 1WXBA 2F5KA 4PJNA 2D8HA 2ZAEA 2GTOA 2HZYA 1H3ZA 4P5NA 2VKNA 1Q86C 5GMKl 2DM1A 1WLPB 1FWZA 2DVEA 2OTJQ 1K73R 2ESWA 4BACA 4PFPA 2MYSA 2KRMA 1WQ7A 4M7AC 4OMQA 4FT4A 1I5LA 1AWJA 3CC2A 3OW2A 1WHKA 2D1XA 5A0GA 4LXCA 4XTXA 4LD6A 1K73U 4M7AD 2DE0X 1NBEB 1C1AA 4ME7A 4JZ4A 2GFUA 1I07A 3VUBA 2ZPBB 4D8KA 2JNGA 3QO3A 2LQWA 5LJ3f 3I35A 3CCLQ 2NUPB 1YITQ 3CCRT 2HNIA 1FMWA 3REBB 4FL6A 2FZKB 3S3OA 2RB6A 1NJIR 4EMHA 2VUBA 4ZTJA 5FU6B 3CMAQ 1SHFA 3UA7A 3FIFA 1K8AU 3KXTA 1Q81C 1WNLA 4F7UE 1IGUA 1R77A 3L2QA 4PFOA 4N4IA 3OW2S 4BE2A 3AT1B 3M0QA 1RUWA 2DAQA 2DPPB 4DQ2A 4ZGJB 1OPKA 5GMKm 2MWPA 1VQLQ 4PJLA 3L1AA 4OB0B 1KC8C 1N5ZA 2JUFA 2EJFA 1ZBJA 2F5TX 4JJDA 1AWWA 4J9BA 1LNXA 2KQWA 2VASA 1D0YA 2HKQB 3NMZC 1YCSB 3CCUT 5IAYA 4ELYC 1OPLA 3EGDB 2KRNA 1ZLMA 4E7HA 3FJPA 5CK9A
chains in the Genus database with same CATH topology
3OYDA 3H8ZA 5KH6A 2G3RA 2LCLA 3PGGA 1WJQA 3ZBDA 5KCHA 5GMKj 3I56A 2I2LA 3CC4T 1YIJA 1UGRB 1O9SA 5D6WA 4JRPA 3G6EA 1G3TA 2K57A 4RMOA 3RERA 4C8QF 3JCMJ 3PFSA 5J26A 2XKOC 4OB2B 3C95A 3HL8A 3TU4K 4Z02A 4CI0C 3GF5A 3META 5GAMh 1UGPB 5GMKe 4N4GA 3JB9J 3CEYA 4MZPA 3M55A 5C6SA 2EQMA 4OF1A 1Q86U 3JCMf 5GAOp 3C4SA 1KQSS 3CXCS 2K5IA 3RKXA 1RI0A 5GAN5 3J7AF 2E70A 3MHXA 1VQMT 2ZPEB 4EDUA 4OGCA 3MEVA 4N4HA 4E7JA 2VXFA 2P0PA 4EMKB 3JCMQ 1O75A 3PMTA 1B34B 2RI3A 4B9XA 3DKMA 5KE3A 2QDYB 3QZ5B 4C8QE 4YTLA 5C0MA 5I2MA 1KHIA 3NTIA 4J83A 1YHQA 2LDMA 2HBPA 4HCBA 3M4YA 4J7FA 5LJ5g 2DXBA 3OS0A 4TVRA 4X9CA 5CR2A 2QA4A 5LJ3j 2XDDA 1YJWA 3G7ZA 2XHCA 2R5MA 2E6NA 4NL2A 2LC4A 4HA8A 3CCJT 1QW1A 1OYXA 2Y90A 2PVGB 3CBPA 2XD0A 1SSFA 4MMKA 1VQ8A 1WQWA 2Y4YA 2HD0A 4BDZA 4M75F 3JCMc 1M1GA 3HRUA 2MF2A 4BI4A 3I56T 4JRQA 1NPRA 2VV5A 3TCJA 3WVDB 1YIJT 3AHUA 2DIQA 5CQYA 3MP8A 1MGQA 2FVUA 3OYBA 5GAMe 3O8VA 2WACA 3OYIA 3SWNB 3JCMg 3GLXA 2L8DA 5GAN4 3OMGA 3MP6A 2QEXA 1MHNA 3A8LB 2EIFA 5M9OA 2MMPA 4VUBA 4HT8A 2KDSA 2LNVA 2RK2A 1QP3A 4QW2A 1U1TA 4ZN3A 4J8OA 3OB9A 2RHZA 4A53A 2LRQA 4M7DE 2LTOA 2EJGA 4JRKA 1BI3A 4Y28E 1N27A 1S72A 1BI2A 3JRZA 3JCMW 5KE2A 3OBYA 4IUPA 1X01A 4M78C 4XTYA 2RHIA 2K4YA 4C5HA 1Q81U 3E19A 3L2VA 1BIBA 3H6ZA 4M78G 1K73C 3V8JA 4BD3A 3P8BB 3A8GB 3WVEB 2P0KA 3CCQA 1VQKA 5CCAA 1UGQB 2XK0A 4M7DB 3EFSA 1VQ6A 3HSBA 3C12A 3OQ5A 1BI0A 4DOVA 3QPHA 3F70A 2RM4A 1TH7A 4M78D 4KUIA 1KG1A 4HKEA 4LDXA 1YHQT 1Y96A 3OA6A 2D9TA 2Y4XA 1KQ1A 3LW5E 2H3JA 2YHTA 4C0DC 3CCVA 1KD1C 2LQKA 2EFIA 3ER0A 4XQ3A 2QA4T 4LDUA 1YJWT 3OY9A 2V8IA 1G3WA 2PUKB 1KC8U 3OS5A 2CZ0B 5FROA 4KBMB 3V7SA 2EWNA 1I4K1 4IURA 4LD9K 3GIBA 2X35A 4F7UB 3CPWA 3QDRB 3QIIA 3PIOA 3M5AA 1KQSA 1VQ8T 4M7AE 4BY6B 3A8MB 2CZ1B 1NPPA 5DY9A 2JTFA 5GAMd 3QKJA 2QQRA 1P92A 3V8LA 4PL6A 2PUOB 3SFMA 2FHDA 2JOYA 1Y7XA 2RJEA 4NS5A 2DIGA 2L5QA 2O4XB 2RA2A 2GFAA 3UDCA 3OYCA 3OYFA 4J6YA 3ME9A 2KVQG 2ZPGB 5GAN3 4M7AB 2QEXT 3URGA 3CCSA 4JS5A 2OTLA 2DXCA 5FLXE 1DJ7B 4XK8E 2JN0A 2D6FA 3V7RA 3LH0A 2EQKA 4BE1A 2YRVA 1M1KU 5D6YA 2A3LA 2M1HA 3A8HB 4Y91A 4C0ZA 1S72T 1NJIC 1VQ7A 5CO7A 1HXDA 2RK1A 3L42A 4O6JA 5DLQE 4A4FA 1VQPA 5GANd 2QQAA 3QYGB 5GAN7 3HKSA 1PSFA 5CVIA 3OYLA 4XU1A 1YI2T 1VQKT 3CCQT 2YLCA 5CKEA 4C0FA 3LLRA 5HY6A 3S3NA 4RCBA 2ZPIB 1VQ6T 3UT1A 1G3SA 4JLGA 4FU6A 4RKUE 5GAOq 3OYHA 3QUIA 3V7CA 1WGSA 3GPLA 4BUGA 1OZ2A 3JCMb 1Q7YU 4M78E 2F69A 3RKWA 4FM4B 1LOJA 2HAXA 4PJOE 2VC8A 3NTHA 2OAUA 3OYKA 3OS2A 1NZ9A 3OSVA 2GQVA 3FDRA 1JJ2S 4M75C 3WXMB 1M8VA 4FT2A 2JZ2A 5CKHA 2X4WA 1VQNA 1R8OB 1W4SA 3FJPA 4IUUA 4M75G 3J81E 3CPWS 1BKBA 5IN1A 3EAEA 4L6V5 2M9UA 5CQXA 4M78B 2QXFA 2XU8A 5J39A 3JSCA 4PJOB 4B9WA 5FRNA 5FU6C 4M75D 1XNIA 2KMTA 4F7UA 2QQ9A 3S6WA 1UB4A 3E9GA 4NOYA 4CRIA 4C92A 4O5VA 4JJNK 4L5GA 3RUXA 3EFRA 4M77A 1WJSA 5IT9E 5GANh 2E65A 4ZTFA 2OTJA 2KK4A 1VIEA 2EQJA 3CCST 2OTLT 4C0DB 4MZMA 5DM7R 1Y07A 2D0QB 1ZHIA 3RMSA 4J6WA 2M16A 3HRTA 4HCCA 2DZCA 3RKYA 2DXUA 2BUDA 1KHCA 2V8KA 4C8QB 4ZGEB 4R56A 3OMCA 5L8RE 3J80E 1Q82C 1YJ9A 1VQPT 2VXEA 2EAYA 3BDUA 3OBWA 5GAMj 4M77C 1QVGA 2V8JA 1IZ6A 1RL2A 4QQGA 4XTVA 4M77G 1VUBA 2E12A 4Q5WA 2MAMA 3OYMA 2L3RA 3CPFA 4A4HA 5GAN6 2C06A 2PU9B 2R58A 2DD4A 2E6ZA 5GMKi 1IREB 2L89A 1M90C 2EJ9A 3G6ET 1K9MC 2DTIA 2K3YA 4HT9A 3T9NA 3KUFA 3NFCA 1D3BB 1WPYA 3MEWA 4KULA 4M77D 2E10A 4DOWA 4MDXA 4E47A 3JB9F 4A54A 5KCOA 1I81A 4R55A 1VQNT 2RJDA 2E41A 2XI9A 5FU7C 2RHYA 3X24B 3FEOA 2DTOA 4MMLA 3QZ9B 3R6OA 3CCLA 3X20B 5GANj 1V29B 1N9SA 3P8HA 5GAMf 1YITA 2LVMA 1JRIA 3M54A 3OYEA 3HFOA 3QXEB 2QI2A 3CCEA 3OYGA 1UGSB 2EKOA 3M57A 4M75E 2EQUA 3JB9H 4C5EA 5GANe 1VQ5A 2VYTA 1KD1U 3M59A 4J6XA 4A4EA 4BI3A 5LJ5h 3X25B 4C92F 3X28B 3E9FA 3P8DA 4EMKA 3CMAA 2MI6A 2DO3A 1W2BA 2OTJT 3TREA 1B34A 4M77F 4JRIA 4QQDA 3HPWA 3CCUA 3RIRA 1U1SA 4FSXA 1XQHA 4M75B 4OGEA 5CKBA 4LDVA 3BY7A 5HK3A 3M56A 3PTAA 1FX7A 2CS7A 2CGHA 3G4SA 3CBOA 1G5VA 2X4XA 1YCYA 3HFNA 5GANf 3LWIA 2K5FA 1JBMA 2O01E 1JJ2A 1QVGS 3S3MA 1YJ9T 4X34A 2IVWA 3QHSA 3SD4A 2XG8D 5GAN8 4V2SA 4EMKC 3HP9A 4EMGA 4WF2A 3LX7A 3M4GA 3JCMh 5I21A 1VQLA 1OI1A 4IUTA 4RG2A 4PLLA 3FLGA 3FB9A 3N5BB 4JDSA 2GF7A 4XU3A 3ZFJA 3SB2A 3GNGA 2DXTA 5EG2A 3ZEHA 3KBGA 3DB4A 1K8AC 1FXXA 5A2QE 3OYAA 3L2ZA 2RI2A 4PKCC 3G71A 1NJIU 4GY5A 5CKFA 2R5AA 1N6AA 5GAMg 3DLMA 3OYYA 3SWNA 3VKIA 4A4KA 3RESA 3VUZA 4PNOA 3JB9I 3GP8A 1VQ9T 3L2RA 2E1HA 4OMFB 4UC4A 3VU3C 4NL3A 3M53A 3MCAB 1JB0E 1ZBXA 1VQOA 3CCLT 1KQ2A 1GXIE 3I55A 3NTKA 3FC3A 3INZA 4OB3B 4QQ6A 3MEAA 3CMEA 3CCET 3VYHB 4RCCA 2RHXA 2KY9A 5LJ5e 1W2BS 1BI1A 2LX9A 4FIBA 1VQ5T 2JTMA 1Y71A 2RO0A 5HKCA 4JS4A 2R57A 3CMAT 4E7KA 2DD5A 5DLOA 4M7DA 1BYMA 3A8OB 5J3BA 2VGMA 3LGFA 4XTUA 5GANg 1N8RC 2FL7A 4II1A 2DZ9A 3PIPA 1EIFA 3CCVT 2E64A 4RG8A 3OSSC 5FU7B 3G4ST 2XICA 4IUQA 2PQWA 4X9DA 4ZGDB 1WJRA 3HHTB 3UWNA 3JCMV 4D6WA 4IUVA 5HK0A 4OB1B 2KSSA 3SDZA 5LJ3h 1M5Q1 3M9QA 3QBYA 3JCMe 1H641 2IG0A 2P4TA 5GAOn 1U8RA 1QVFA 4M7DC 2CZ6B 4M7DG 1I8FA 3JB9G 1VQLT 2LQ8A 4OP0A 5GAOl 2RI5A 2KAFA 4A4GA 4QVCA 2B8AA 5I2SA 3GOXA 1PSEA 3DB3A 4E7LA 1X75C 3G71T 3Q1JA 4QVDA 1Q7YC 4M7DD 5AYFA 2F5KA 3JB9D 2O4XA 3VJPA 1Q82U 1YBYA 2ZZDA 2A7YA 1BIAA 3CCRA 4M7AA 2DTHA 3X26B 4DA4A 1H3ZA 2M0OA 3HRSA 3JAME 2BKDN 2DK3A 4P5NA 1VQOT 1VQ7T 4GLKA 1Q86C 2EYQA 4C92C 3LYIA 4BY6C 4F7UG 5GMKl 5LJ5d 3I55T 4ZN1A 2XDBA 1M90U 4C92G 3M58A 2LT4A 1FWZA 3LGLA 3CMET 1K9MU 4MDWA 2DVEA 3PNWC 1Y96B 4BACA 1G3YA 4XTWA 2RD1A 1YJNA 3CC7A 2CZ7B 3PT9A 2K3XA 3V8KA 4C92D 1WQ7A 3CCMA 4M7AC 4QVZA 2WSFE 2CYZB 2VGNA 4KUDK 1NE8A 4M7AG 4FT4A 5CAIA 1I5LA 3CC2A 4M7DF 2QTXA 3OW2A 3QYHB 5A0GA 5GAOr 3BW1A 4XTXA 3C94A 4LD6A 1K73U 3JCMd 4M7AD 2X4JA 3GNFB 4ELZC 2NLUA 5LJ3e 1QVFS 4ATOA 4XAXB 4ME7A 3MO8A 2BIVA 4J5YA 3RMQA 4BE0A 2GFUA 3ASKA 1AHJB 2JVVA 4M78A 3JCMX 5CIUA 2LT1A 3VUBA 2GCXA 2XDPA 4PJOA 2X4YA 2ZPBB 2WSEE 2JNGA 3QO3A 4PLIA 4F7UF 3OYJA 2E5QA 1VQ4A 4JUVA 2DKGA 5LJ3f 2DEQA 1M1FA 3DLLA 5FRMA 2XIDA 1VIFA 2FB7A 2ZPFB 4C5GA 2DJZA 3CCRT 1N9RA 2HNIA 2K2VA 4FL6A 2P0QA 2WSCE 4OVAA 4C5IA 4M7AF 3S3OA 3BDLA 2ZGWA 3CD6A 2RB6A 2QQBA 2RHUA 3VYGA 5D6XA 4EMHA 4PJOC 4L59A 2VUBA 2MWOA 4JLIA 2RJCA 4PJOG 4ZTJA 1YI2A 5FU6B 4C8QA 3OS1A 1X6OA 3CC4A 3QJYA 1M1KC 2YLBA 3FIFA 1K8AU 3L2UA 3KXTA 1Q81C 2K5LA 1WNLA 3E1SA 5GAN2 5GAOm 3UPUA 1YJNT 4XTZA 3CC7T 3QSUA 1UEBA 3QG1A 4XU2A 4F7UE 3L2QA 3CCMT 4PJOD 2HQXA 3MEUA 4N4IA 4C92E 2ZPHB 3OW2S 1LJOA 2QQSA 4BE2A 4N0AA 3OYNA 1XTDA 2RH2A 3CC2T 2AHJB 4BDYA 1HK9A 3BFMA 4M77E 3CBMA 5GMKh 5A0DA 2DAQA 5LJ3d 5CKDA 1D3BA 2DPPB 4DQ2A 1OZ3A 4ZGJB 2PVDB 4C8QC 2CKKA 1ZQ1A 4C8QG 5GMKm 2MWPA 4C92B 5LJ5j 1VQMA 4MZTA 3CXCA 1M9SA 5A0LA 4IKFA 1YITT 3L1AA 3MP1A 4OB0B 1KC8C 4M77B 2JUFA 3PMIA 1VQ9A 1XOVA 2EJFA 1QVPA 4C0GA 5LJ3g 4E7IA 2HQEA 4N0AC 2F5TX 4LDYA 4C8QD 1N8RU 4EPCA 4M78F 3SWNC 1LNXA 4PJOF 2KQWA 1VQ4T 1M4ZA 2LCCA 2ZCFB 2PVOB 5LL6S 3TEEA 4HCZA 3JCMP 3QJ6A 2FYKA 4XU0A 3FRNA 5IAYA 3L2WA 3CCUT 4BI8B 4KT0E 3A5ZB 4ELYC 3LWHA 5LJ5f 4BB7A 3CCJA 4E7HA 4LDWA 4M75A 3CD6T 4J7IA 2RJFA 5CK9A 3VV0A 1QP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HFO A;  5DY9 A;  4C92 G;  5GAM d;  3PGG A;  3V8L A;  2DVE A;  4M75 E;  5GMK j;  2I2L A;  1Y96 B;  3JB9 H;  4XTW A;  2K57 A;  2RD1 A;  3RER A;  5GAN e;  4C8Q F;  3JCM J;  4J6X A;  2RA2 A;  5LJ5 h;  3V8K A;  4C92 F;  4J6Y A;  1WQ7 A;  4C92 D;  4EMK A;  5GAN 3;  4M7A E;  4M7A B;  4M7A C;  5GAM h;  1B34 A;  5GMK e;  4M7A G;  4M77 F;  5CAI A;  3JB9 J;  4JRI A;  1I5L A;  3RIR A;  2JN0 A;  4M7D F;  2QTX A;  1U1S A;  4M75 B;  3V7R A;  3BY7 A;  3JCM f;  5GAO p;  2CGH A;  5GAO r;  4Y91 A;  3BW1 A;  4XTX A;  1YCY A;  3HFN A;  3RKX A;  5GAN f;  3JCM d;  1JBM A;  4M7A D;  5GAN 5;  1HXD A;  5LJ3 e;  3QHS A;  5GAN d;  5GAN 7;  4J5Y A;  4XU1 A;  4EMK C;  5GAN 8;  4C92 C;  2VXF A;  4EMK B;  4V2S A;  2YLC A;  4EMG A;  4M78 A;  4WF2 A;  3JCM X;  3JCM Q;  1B34 B;  3M4G A;  3JCM h;  5I21 A;  4RCB A;  4PJO A;  5GAO q;  3FB9 A;  4C8Q E;  4XU3 A;  3QUI A;  3QO3 A;  3V7C A;  4F7U F;  3JCM b;  3SB2 A;  2DXT A;  4M78 E;  3RKW A;  4JUV A;  1LOJ A;  2DKG A;  5LJ3 f;  2VC8 A;  3L2Z A;  2DEQ A;  5LJ5 g;  4PJO E;  4X9C A;  5GAM g;  3SWN A;  2FB7 A;  4M75 C;  5LJ3 j;  3RES A;  1M8V A;  4PNO A;  3JB9 I;  2DJZ A;  4M75 G;  1N9R A;  2E1H A;  2HNI A;  4NL2 A;  3VU3 C;  4HA8 A;  4NL3 A;  2Y90 A;  4M7A F;  1KQ2 A;  4M78 B;  2ZGW A;  2RB6 A;  4MMK A;  1WQW A;  4PJO C;  4EMH A;  4PJO B;  3INZ A;  4JLI A;  4PJO G;  4M75 F;  4M75 D;  3JCM c;  4C8Q A;  4F7U A;  3AHU A;  4RCC A;  4NOY A;  2YLB A;  3FIF A;  4C92 A;  5LJ5 e;  1WNL A;  5GAN 2;  5GAO m;  1MGQ A;  3QSU A;  4XTZ A;  5GAM e;  3RUX A;  3EFR A;  4M77 A;  4XU2 A;  3SWN B;  3JCM g;  4F7U E;  5GAN 4;  4PJO D;  5GAN h;  2E65 A;  4M7D A;  4C92 E;  1LJO A;  4HT8 A;  5GAN g;  4N0A A;  4XTU A;  2DZ9 A;  1HK9 A;  3BFM A;  4M77 E;  2E64 A;  1U1T A;  5GMK h;  4M7D E;  5LJ3 d;  4A53 A;  1D3B A;  4F7U G;  4DQ2 A;  4J6W A;  2EJG A;  4JRK A;  2DZC A;  3RKY A;  2DXU A;  4X9D A;  4C8Q C;  3JCM W;  4C8Q B;  3JCM V;  1X01 A;  4M78 C;  4XTY A;  2VXE A;  3BDU A;  2EAY A;  4C8Q G;  4C92 B;  5GMK m;  5LJ5 j;  1BIB A;  3L1A A;  4M78 G;  4M77 C;  5GAM j;  3V8J A;  5LJ3 h;  4M77 B;  1M5Q 1;  3JCM e;  1H64 1;  4XTV A;  2EJF A;  5GAO n;  4M77 G;  5LJ3 g;  4M7D C;  4M7D B;  3EFS A;  5GAN 6;  4N0A C;  4M7D G;  1I8F A;  4C8Q D;  5GMK i;  3JB9 G;  3HSB A;  2EJ9 A;  4OP0 A;  5GAO l;  2DTI A;  4M78 F;  2RM4 A;  1TH7 A;  4M78 D;  3SWN C;  4QVC A;  4HT9 A;  1LNX A;  4PJO F;  1D3B B;  1Y96 A;  1WPY A;  4M77 D;  2E10 A;  4QVD A;  1KQ1 A;  3JCM P;  2YHT A;  3JB9 F;  2FYK A;  4A54 A;  3JB9 D;  4M7D D;  4XU0 A;  4XQ3 A;  1I81 A;  1BIA A;  4M7A A;  2DTH A;  2E41 A;  2DTO A;  5LJ5 f;  3V7S A;  4MML A;  2EWN A;  1I4K 1;  3GIB A;  4M75 A;  4F7U B;  5GAN j;  1N9S A;  5GAM f;  3FJP A;  5GMK l;  1JRI A;  5LJ5 d; 
#chains in the Genus database with same CATH topology
 3OYD A;  2ENM A;  1ZA1 B;  5KYY B;  2G3R A;  3PGG A;  5KCH A;  1WJQ A;  1K76 A;  2I2L A;  1YIJ A;  1NEG A;  4A63 B;  1O9S A;  3JCM J;  3PFS A;  2XKO C;  2KRO A;  3ULR B;  4CI0 C;  1BK2 A;  1J3T A;  1K9M R;  4N4G A;  3JB9 J;  2JJ9 A;  5C6S A;  5GAO p;  1KQS S;  1RI0 A;  2BZ8 A;  5GAN 5;  1NEB A;  4OGC A;  4KH1 B;  4E7J A;  1B34 B;  3EG2 A;  1QCN A;  2RI3 A;  2CP7 A;  3H0F A;  2QDY B;  5I2M A;  1KHI A;  4HCB A;  2HBP A;  4J7F A;  2NUT A;  3OS0 A;  4TVR A;  2FPF A;  1YJW A;  1Z9Q A;  1MUZ A;  5IHI A;  2LC4 A;  4CC7 A;  3CCJ T;  1T3S A;  1PD1 A;  1VQ8 A;  1WQW A;  2NUZ A;  2CH4 W;  5GJV B;  3I56 T;  1NPR A;  2VV5 A;  2JS0 A;  5CQY A;  1PCX A;  3MP8 A;  3EHQ A;  3OYB A;  5GAM e;  5GAN 4;  2AKK A;  2DL3 A;  5IHN A;  1FMK A;  2MMP A;  2QG9 B;  2E3I A;  1U1T A;  3EGU A;  5IHK A;  4A53 A;  4M7D E;  1U06 A;  2LTO A;  4JRK A;  4Y28 E;  1BI2 A;  3JCM W;  4J9E A;  2K4Y A;  4C5H A;  1AT1 B;  3A8G B;  5CCA A;  1UGQ B;  2XK0 A;  1VQ4 Q;  1HJD A;  2YUO A;  1RAF B;  3C12 A;  4AT1 B;  1BI0 A;  4DOV A;  3HSB A;  3QPH A;  4B6M A;  1QQJ A;  4HKE A;  3OA6 A;  2DVJ A;  3LW5 E;  3CCV A;  2H3J A;  2EFI A;  2V8I A;  3VS1 A;  2PUK B;  1HSQ A;  3OS5 A;  2JM9 A;  4J9G A;  3V7S A;  1ARK A;  4J9D A;  3M5A A;  1SSH A;  2QQR A;  2PUO B;  2VWF A;  4QKU A;  3SFM A;  2JOY A;  4E6R A;  4NS5 A;  1VQ9 T;  2RA2 A;  2KVQ G;  2O31 A;  4JS5 A;  1KJW A;  3CCS A;  2OTL A;  1DJ7 B;  4XK8 E;  1W70 A;  2D6F A;  1K0X A;  2MK5 A;  1VQM Q;  2JMA A;  4ESR A;  2A3L A;  4C0Z A;  2H8H A;  2EGC A;  1VQP A;  4O6J A;  1G83 A;  1PSF A;  1ZUU A;  1YI2 T;  2DL8 A;  5CKE A;  1CSK A;  4C0F A;  4RCB A;  2B86 A;  4JLG A;  3V7C A;  2F69 A;  2HAX A;  5EC7 A;  4PJO E;  3NTH A;  1MV0 B;  1YNZ A;  3OS2 A;  2KR3 A;  2G6F X;  5CQX A;  3GBQ A;  5J39 A;  4B9W A;  5FU6 C;  3I5R A;  3S6W A;  1D1C A;  3E9G A;  2CT3 A;  2RNA A;  4C92 A;  4L5G A;  1ZUY A;  5I22 A;  4M77 A;  1YWP A;  1BU1 A;  2E65 A;  4ZTF A;  2OTJ A;  4C0D B;  4MZM A;  4ZNX A;  1BCO A;  2D0Q B;  2M16 A;  4E7Z A;  1OQK A;  4KGX B;  4R56 A;  1Q82 C;  1IZ6 A;  2KYB A;  2L3R A;  2C06 A;  4HT9 A;  3T9N A;  3KUF A;  1AWO A;  3NFC A;  1Y57 A;  4A54 A;  5KCO A;  2DYI A;  2DJQ A;  2M51 A;  4R55 A;  5FU7 C;  2RHY A;  1K4U S;  2FZG B;  3CCL A;  1MND A;  1YIT A;  1N9S A;  1JRI A;  1W1F A;  3LH5 A;  3M54 A;  2FRY A;  2EQU A;  1WX6 A;  4C92 F;  3CMA A;  1RAI B;  3E9F A;  2HEQ A;  1TS9 A;  4M77 F;  4JRI A;  3HPW A;  2JMC A;  4OGE A;  3BY7 A;  1FX7 A;  2CS7 A;  2CGH A;  3TSW A;  3MKD A;  1YCY A;  1JJ2 A;  4OMM A;  1YJ9 T;  1VQ6 Q;  2CP2 A;  1UHF A;  1KFZ A;  5GAN 8;  3EH1 A;  3HP9 A;  4WF2 A;  5I21 A;  1VQL A;  1OI1 A;  2EKH A;  4IUT A;  4PLL A;  5FWB A;  3FB9 A;  3N5B B;  4J9I A;  3ZFJ A;  3ZEH A;  1JO8 A;  2AKL A;  3OYA A;  5A2Q E;  3M0T A;  2KXC A;  4GY5 A;  3DLM A;  3SWN A;  2DF6 A;  3VUZ A;  4PNO A;  3JB9 I;  2YRD A;  2ROL A;  4OMF B;  2HBW A;  2YSQ A;  3C0C A;  1AVZ C;  4EIK A;  3REA B;  2RHX A;  4PJJ A;  1BI1 A;  4FIB A;  2NUT B;  5KYW A;  2DMO A;  4RTV A;  4JS4 A;  2DD5 A;  5DLO A;  1BYM A;  3A8O B;  5GAN g;  4XTU A;  2DZ9 A;  2E64 A;  2FZC B;  4RG8 A;  1D1B A;  2PQW A;  4X9D A;  3HHT B;  1Y0M A;  4FW1 A;  2BTT A;  3UWN A;  2DBK A;  3SDZ A;  5LJ3 h;  1U8R A;  1QVF A;  4M7D G;  5GAO l;  1WDX A;  2KAF A;  4A4G A;  2B8A A;  3GOX A;  3ZL7 C;  1PSE A;  1X75 C;  5AYF A;  1TWB A;  3JB9 D;  3VJP A;  2KBT A;  2ZZD A;  2A7Y A;  1VOM A;  1BIA A;  4DA4 A;  3JAM E;  2BKD N;  1VQO T;  1VQ7 T;  2RQT A;  1GFC A;  1M90 U;  4C92 G;  3LGL A;  9ATC B;  4MDW A;  1PHT A;  4XTW A;  2LNH B;  2NYS A;  2CZ7 B;  3PT9 A;  2WSF E;  4Z89 A;  4RTW A;  2VGN A;  4KUD K;  1KD1 R;  2IIM A;  3C94 A;  2LJ3 A;  2X4J A;  3GNF B;  1OUL A;  1F1B B;  1QVF S;  3MO8 A;  3I9Q A;  4J5Y A;  2EPD A;  4CC3 A;  1AHJ B;  2JVV A;  2XDP A;  2FO0 A;  2JM8 A;  3OYJ A;  1VQ4 A;  2DKG A;  2HCK A;  1VIF A;  3H0H A;  2ZPF B;  4C5G A;  3QWX X;  2K2V A;  2WSC E;  4C5I A;  2KT8 A;  2NWM A;  5D6X A;  1U3O A;  4JLI A;  4PJO G;  3OS1 A;  3QJY A;  2DL7 A;  3L2U A;  1MV3 A;  3CCU Q;  5GAO m;  3QSU A;  4XTZ A;  1UEB A;  3QG1 A;  1ZSG A;  1ZUK A;  3JV3 A;  3VRY A;  3G4S Q;  1LJO A;  1XTD A;  2RH2 A;  3CC2 T;  2AHJ B;  1Z9Z A;  2EBP A;  5A0D A;  5LJ3 d;  1SRM A;  3E2U A;  2F2X A;  1UEC A;  4C8Q G;  4C92 B;  1VQM A;  3CXC A;  5A0L A;  3MP1 A;  4M77 B;  3PMI A;  1TTH B;  2BE7 D;  2LZ6 B;  4C0G A;  3G71 Q;  2DX1 A;  1N8R U;  4AG1 C;  2QYZ A;  2QTV A;  5KYU A;  3TEE A;  2LCC A;  2ZCF B;  2PVO B;  1TUC A;  3JCM P;  3QJ6 A;  4XU0 A;  3I55 Q;  4KT0 E;  4RTU A;  1B7T A;  3CME Q;  1PWT A;  4BB7 A;  4LDW A;  4J7I A;  1M1K C;  2RJF A;  1OX8 A;  2SRC A;  5GMK j;  3A98 A;  4JRP A;  2A08 A;  3GF5 A;  3MET A;  4WCI A;  3M55 A;  2EQM A;  1Q86 U;  1MMA A;  1D1A A;  1I1J A;  3CXC S;  3RKX A;  4EDU A;  2AT1 B;  4YTL A;  5C0M A;  1QVG P;  3M4Y A;  1GCQ A;  5LJ5 g;  2DXB A;  5CR2 A;  5LJ3 j;  2LP5 A;  4HA8 A;  3CBP A;  1OYX A;  2CUB A;  2PVG B;  1SSF A;  2EYZ A;  4D8D A;  2J05 A;  1YJN Q;  3CC7 Q;  3CCM Q;  1M1G A;  4JRQ A;  1LPL A;  1YIJ T;  1A0N B;  1D0X A;  3TCJ A;  2DIQ A;  1WHM A;  1MGQ A;  3OYI A;  1Q81 R;  3O8V A;  2HQH A;  3SWN B;  3JCM g;  3NHN A;  2OAW A;  1MHN A;  3A8L B;  2EIF A;  2LMJ A;  2KDS A;  2LNV A;  3A1P A;  1K8A R;  1D09 B;  2ECZ A;  1BI3 A;  1SKU B;  3JRZ A;  5KE2 A;  4IUP A;  1X01 A;  1RAG B;  4M78 C;  1Q81 U;  3H6Z A;  5KYW B;  1K73 C;  4BD3 A;  3P8B B;  3M0P A;  3WVE B;  2P0K A;  1GFD A;  1VQ6 A;  4M78 D;  1Y96 A;  1OEB A;  2Y4X A;  1YP5 A;  2YHT A;  3ER0 A;  4XQ3 A;  3CD6 Q;  1YJW T;  4DEY A;  3OY9 A;  2AK5 A;  1YI2 Q;  1KC8 U;  4K11 A;  2CZ0 B;  3CC4 Q;  2DYB A;  4IUR A;  1OU8 A;  3PIO A;  1KQS A;  3UAT A;  1VQ8 T;  4M7A E;  3A8M B;  3H41 A;  2JTF A;  3QKJ A;  2V26 A;  1P92 A;  3V8L A;  2FHD A;  2K2M A;  2DIG A;  3H9N A;  3OYC A;  3UDC A;  4J6Y A;  2ZPG B;  2YXY A;  4CC4 B;  5IXF A;  5GAN 3;  1AWX A;  1T0J A;  1WHG A;  2JN0 A;  4FYY B;  2O9S A;  1WIE A;  1Q7Y R;  2EQK A;  4KRT A;  5D6Y A;  3A8H B;  4Y91 A;  1NJI C;  1TG0 A;  1HXD A;  2RK1 A;  4WTO B;  1TOV A;  5GAN d;  5GAN 7;  5CVI A;  2E4H A;  2HSP A;  1VYV A;  1PKT A;  1GRI A;  3UT1 A;  1G3S A;  3OYH A;  3GPL A;  4FSS A;  1Q7Y U;  3QUI A;  4BUG A;  1HYO A;  4M78 E;  1LOJ A;  4KGV B;  1W6X A;  4X1V A;  4HVW A;  4M75 C;  1M8V A;  2RQW A;  2X4W A;  1W4S A;  3J81 E;  2X3W D;  3TVT A;  1SHG A;  1BKB A;  1RAC B;  1WYX A;  2QXF A;  1UUE A;  3U23 A;  2GTJ A;  4M75 D;  1V76 A;  4F7U A;  1K9A A;  4JJN K;  1UB4 A;  4OML A;  4O5V A;  1AZG B;  3RUX A;  3EFR A;  4LUD A;  1WJS A;  2KK4 A;  1ZSZ A;  3CCS T;  2OTL T;  3HTR A;  5DM7 R;  1TU0 B;  4HCK A;  3RKY A;  3OMC A;  1VQP T;  1QCF A;  2EAY A;  2E5K A;  4M77 C;  2V8J A;  1RL2 A;  4QQG A;  4XTV A;  2RMO A;  1YHQ Q;  3OYM A;  4A4H A;  1IRE B;  2L89 A;  5ECA A;  3G6E T;  1K9M C;  2QA4 Q;  2DTI A;  1SRL A;  2K3Y A;  5IXB A;  4M77 D;  3MEW A;  4KUL A;  1X6B A;  4DOW A;  1GBR A;  2K9G A;  2DET A;  2JW4 A;  2DTO A;  5FW9 A;  5GAN j;  1LVK A;  2LVM A;  3HFO A;  1EZZ B;  5KYU B;  2QI2 A;  4M75 E;  2QEX Q;  3TSZ A;  3JB9 H;  4C5E A;  2K6D A;  3M59 A;  2DA9 A;  5LJ5 h;  3THK A;  4EMK A;  1IO6 A;  2MI6 A;  2OTJ T;  3TRE A;  1S72 Q;  3CCU A;  4QQD A;  2DER A;  3G4S A;  2A37 A;  1UDL A;  1G5V A;  4LE9 A;  3HFN A;  5GAN f;  3CCQ Q;  1VQK Q;  2O01 E;  3S3M A;  2LJ1 A;  2COY A;  3RBB B;  1JU5 C;  7AT1 B;  4V2S A;  1GBQ A;  1OOT A;  3M4G A;  3JCM h;  3NGP A;  3EHR A;  2GF7 A;  2RF0 A;  2DXT A;  5EG2 A;  1RAE B;  1M8M A;  3EG1 A;  3G71 A;  3L2Z A;  5CKF A;  1RAD B;  1N6A A;  3VKI A;  1X43 A;  3MCA B;  1ZBX A;  3CCL T;  3I55 A;  3FC3 A;  3MEA A;  3CME A;  4RCC A;  2LX9 A;  3VS6 A;  2YUP A;  2R57 A;  3CMA T;  4E7K A;  2JS2 A;  4M7D A;  2HKN A;  5J3B A;  3LGF A;  1VQ7 Q;  2EGA A;  5KYX A;  3NPF A;  2YRC A;  1TUG B;  2D0N A;  2ED0 A;  4ZGD B;  1WJR A;  4D6W A;  5HK0 A;  4OB1 B;  2KSS A;  4RTT A;  2P4R A;  5GAO n;  2CZ6 B;  1VQL T;  4OP0 A;  5L23 A;  3UA6 A;  2FPE A;  1VQN Q;  5I2S A;  3Q1J A;  4QVD A;  2X51 A;  1Q82 U;  1YBY A;  2PNI A;  2DTH A;  2LX7 A;  2DK3 A;  2Z0W A;  4GLK A;  5AT1 B;  1UJ0 A;  2EYQ A;  3LYI A;  4F7U G;  5LJ5 d;  2XDB A;  1UJY A;  2HL5 C;  1Y96 B;  1NYG A;  1YJN A;  3CC7 A;  3V8K A;  2K3X A;  3CCM A;  4QVZ A;  2CYZ B;  1NE8 A;  4M7A G;  4M7D F;  3QYH B;  3D7S B;  2IPO B;  5GAO r;  3BW1 A;  3JCM d;  3G1J A;  5IH2 A;  4ELZ C;  5LJ3 e;  4XAX B;  1WHJ A;  1UHC A;  3ASK A;  3JCM X;  2YWW A;  5CIU A;  1SPK A;  5D7U A;  2LT1 A;  4PJO A;  2GCX A;  3CQT A;  2X4Y A;  2J7I A;  1SG5 A;  4JUV A;  2GNC A;  2DEQ A;  1WFW A;  2CP0 A;  5FRM A;  2FB7 A;  2CP6 A;  1C6V X;  1IXD A;  1N9R A;  3CCE Q;  2DEU A;  3EFO A;  2AZS A;  2P0Q A;  3CD6 A;  2ZGW A;  3EG3 A;  2CT4 A;  2RHU A;  3I5S A;  3VYG A;  1VQ5 Q;  4HVV A;  2RJC A;  1YI2 A;  4C8Q A;  3CC4 A;  1JJ2 P;  2K5L A;  3E1S A;  3CPW P;  4XU2 A;  3MEU A;  2ZPH B;  2KEA A;  4N0A A;  1ZX6 A;  2PZ1 A;  1HK9 A;  1H3H A;  5GMK h;  2A36 A;  3TQ7 P;  2HL3 A;  5CKD A;  2PVD B;  4RTX A;  2CKK A;  1ZQ1 A;  5LJ5 j;  4MZT A;  1M9S A;  2O9V A;  1IHV A;  1I0C A;  1XOV A;  1YWO A;  3BE3 A;  1ZSZ B;  2ROT A;  2J6K A;  4EPC A;  2QGG A;  2HSE B;  4PJO F;  1VQ4 T;  2FRW A;  5HCK A;  1NYF A;  4HCZ A;  2FYK A;  2MOX A;  3L2W A;  2BZY A;  4BI8 B;  3A5Z B;  1RLQ C;  5FWC A;  3LWH A;  5LJ5 f;  3VV0 A;  1U5S A;  1BBZ A;  5KH6 A;  2KXD A;  2KI7 A;  2KT1 A;  5D6W A;  3RER A;  4C8Q F;  3PVL A;  3TU4 K;  4Z02 A;  1M90 R;  4CC2 A;  3CEY A;  4MZP A;  3QDF A;  4DBR A;  2DBM A;  2OI3 A;  3JCM f;  2EQI A;  4HXJ A;  2EYX A;  2CUD A;  1VQM T;  2OJ2 A;  2ZPE B;  2FPD A;  1UG1 A;  4EMK B;  3PMT A;  4JJC A;  4B9X A;  4J9H A;  3DKM A;  4J83 A;  1YHQ A;  2LDM A;  3CCR Q;  6AT1 B;  4RTY A;  2QA4 A;  3VS0 A;  2JXB A;  3G7Z A;  4QT7 A;  1X2K A;  2XHC A;  2KNB B;  2J06 A;  4NL2 A;  1K1Z A;  4MMK A;  3JCM c;  2MF2 A;  4BI4 A;  3WVD B;  5I11 A;  1SF9 A;  1VA7 A;  2FVU A;  3GLX A;  1LCK A;  2QEX A;  5M9O A;  4VUB A;  2L3Q A;  2SEM A;  2RK2 A;  1QP3 A;  1OV3 A;  2CSI A;  4J8O A;  3OB9 A;  2LRQ A;  1W2B P;  1N27 A;  1S72 A;  4OMO A;  1T3L A;  4XTY A;  4ANJ A;  3E19 A;  1BIB A;  1VQK A;  3CCQ A;  1T0H A;  4M7D B;  3O5Z A;  5KYX B;  4GLM A;  3F70 A;  1VYT A;  4KUI A;  1KG1 A;  4LDX A;  2QK0 A;  4C0D C;  1KD1 C;  2LQK A;  1N8R R;  2DIL A;  2CRE A;  4LD9 K;  2EWN A;  2COZ A;  1NM7 A;  3QDR B;  4BY6 B;  1NPP A;  4PL6 A;  2RJE A;  4GBQ A;  4Z8A A;  3ME9 A;  2CH4 A;  3URG A;  2QAS A;  1TXQ A;  4IIM A;  4JZ3 A;  3V7R A;  1M1K U;  2M1H A;  1VQ7 A;  4FYX B;  2BE9 B;  3L42 A;  1PKS A;  3QYG B;  3OYL A;  1Q86 R;  1X27 A;  2JTE A;  2YUQ A;  2EVR A;  3RDV A;  3LLR A;  1VQ6 T;  2RQU A;  2ZPI B;  4IIO A;  4FU6 A;  4RKU E;  5GAO q;  4OMN A;  1WGS A;  1OZ2 A;  3JCM b;  2F2W A;  4FM4 B;  2VC8 A;  2OAU A;  3CCJ Q;  3OSV A;  2GQV A;  4FT2 A;  2JZ2 A;  1VQN A;  4PJM A;  1AEY A;  2H3E B;  2M9U A;  2FG0 A;  2HMA A;  3I56 Q;  1M30 A;  1B3Q A;  1WI7 A;  3G6E Q;  4PJO B;  4ORZ A;  5FRN A;  1M2V A;  1WXT A;  2KMT A;  4CRI A;  4NOY A;  1CKA A;  3VS5 A;  1JQQ A;  2LQN A;  5GAN h;  2EQJ A;  2PTK A;  3EFO B;  4J9F A;  1QWE A;  4AG2 C;  3RMS A;  4J6W A;  3HRT A;  2BUD A;  1KHC A;  2V8K A;  4C8Q B;  4ZGE B;  3OW2 P;  4LUE A;  3OBW A;  1QVG A;  2F2V A;  2E12 A;  1ZSZ C;  5GAN 6;  1V1C A;  2PU9 B;  2DD4 A;  2R58 A;  5GMK i;  3SHW A;  4MDX A;  4E47 A;  2HDA A;  3JB9 F;  4HVU A;  2K7A A;  2XI9 A;  2E41 A;  4DEX A;  4FCY A;  3FEO A;  2ABL A;  3R6O A;  1XJW B;  2W10 A;  1V29 B;  3P8H A;  1VQ9 Q;  3CCE A;  1KC8 R;  1VQ5 A;  2VYT A;  1YN8 A;  3RIR A;  1U1S A;  4FSX A;  5CKB A;  3M56 A;  1NLP C;  2X4X A;  3LWI A;  5GJW B;  1QVG S;  3PE0 A;  4X34 A;  2IVW A;  3QHS A;  1X2Q A;  2XG8 D;  4EMK C;  4EMG A;  3LX7 A;  1KQS P;  4RG2 A;  3FLG A;  4JDS A;  4XU3 A;  3SB2 A;  3KBG A;  3DB4 A;  4E2F B;  1K8A C;  2RPN A;  1NJI U;  5GAM g;  4A4K A;  2ATC B;  3L2R A;  3VRZ A;  4NL3 A;  1BB9 A;  3M53 A;  1JB0 E;  1RAA B;  3NTK A;  3INZ A;  2D8J A;  3VYH B;  5LJ5 e;  2A0F B;  1Y71 A;  2O2O A;  3EG9 A;  2VGM A;  4FYW B;  4II1 A;  1AD5 A;  1EIF A;  2J6O A;  3CCV T;  1MMN A;  3OSS C;  5FU7 B;  3G4S T;  2XIC A;  4IUQ A;  1UTI A;  2BZX A;  2M0Y A;  1M3B A;  3JCM e;  3EGX A;  4FYV B;  2IG0 A;  4M7D C;  3JB9 G;  2LQ8 A;  2L0A A;  1IB8 A;  2RI5 A;  2J6F A;  4QVC A;  3DB3 A;  3G71 T;  1Q7Y C;  4M7D D;  2XMF A;  2O4X A;  4M7A A;  1ABQ A;  3CCR A;  1X6G A;  3X26 B;  2YT6 A;  2M0O A;  3HRS A;  3I55 T;  2DNU A;  4BY6 C;  4C92 C;  4ZN1 A;  1K9M U;  3M58 A;  2LT4 A;  3CME T;  4DBH A;  4M4Z A;  3PNW C;  1RAB B;  1G3Y A;  1G2B A;  2RD1 A;  1I5O B;  2EW3 A;  4C92 D;  2C0I A;  2X9H A;  5CAI A;  2KGT A;  1PRM C;  1UFF A;  2QTX A;  1YJ9 Q;  1AZE A;  3M0R A;  1YFN A;  1VYU A;  2NLU A;  4JJB A;  4ATO A;  8ATC B;  2BIV A;  1IRX A;  3RMQ A;  4BE0 A;  1M2O A;  2DLP A;  4M78 A;  1QLY A;  2I0N A;  2WSE E;  3M0U A;  4PLI A;  3KFV A;  4F7U F;  4AFS C;  2E5Q A;  1M1F A;  3DLL A;  2XID A;  1M3C A;  1E6H A;  2DJZ A;  2EGE A;  2V1R A;  4OVA A;  1QCO A;  2W0Z A;  2O88 A;  4M7A F;  3BDL A;  4PJO C;  1G8X A;  2QQB A;  4L59 A;  2MWO A;  1E6G A;  2QAZ A;  1X6O A;  2YLB A;  5GAN 2;  3UPU A;  2QGF B;  1YJN T;  3CC7 T;  4FW2 A;  4Z88 A;  3CCM T;  4PJO D;  2HQX A;  3FJ5 A;  4C92 E;  2QQS A;  3OYN A;  2DL4 A;  4BDY A;  3BFM A;  4M77 E;  3CBM A;  1D3B A;  1M2V B;  4AFU C;  1OZ3 A;  4C8Q C;  1EX4 A;  4IKF A;  1YIT T;  2YUN A;  2JT4 A;  1QVP A;  1R0B G;  2AIR B;  4JPB W;  4F16 A;  5LJ3 g;  2ED1 A;  2HQE A;  4N0A C;  4E7I A;  2MIO A;  4LDY A;  4C8Q D;  4M78 F;  3SWN C;  3EG0 A;  2GGR A;  2X3X D;  1M4Z A;  5LL6 S;  1D0Z A;  2CP5 A;  1VQO Q;  3FRN A;  1OU9 A;  4F14 A;  1E7O A;  3CCJ A;  4M75 A;  1ZA2 B;  4E7S A;  3CD6 T;  3SEM A;  3JCM Q;  5HY6 A;  1QP2 A;  2VB6 A;  2KRS A;  1Q82 R;  3H8Z A;  2LCL A;  3ZBD A;  1K0S A;  1GCP A;  3I56 A;  3CC4 T;  1IHW A;  1UGR B;  3G6E A;  1G3T A;  1UE9 A;  2K57 A;  4RMO A;  4KGZ B;  1PD0 A;  5J26 A;  4OB2 B;  3C95 A;  3HL8 A;  2MCN A;  3MPU B;  4J9C A;  5GAM h;  1UGP B;  5GMK e;  3VS4 A;  1FMV A;  4OF1 A;  3C4S A;  2K5I A;  2C0O A;  1OX9 A;  3J7A F;  2E70 A;  3MHX A;  1S1N A;  3MEV A;  4N4H A;  1QWF A;  2VXF A;  2P0P A;  1O75 A;  1PNJ A;  5KE3 A;  1TUD A;  3QZ5 B;  4C8Q E;  4F04 B;  1IGQ A;  3NTI A;  4AMC A;  1H92 A;  2F1L A;  1JXM A;  1CKB A;  4X9C A;  2XDD A;  2R5M A;  2E6N A;  1QW1 A;  4LN2 A;  2Y90 A;  2XD0 A;  1QMC A;  1EFN A;  4KH0 B;  2Y4Y A;  4RTZ A;  1GL5 A;  2HD0 A;  4BDZ A;  4M75 F;  3HRU A;  2RQR A;  2RQV A;  3AHU A;  1UGV A;  1QKX A;  3CC2 Q;  1VQ9 A;  2WAC A;  2L8D A;  8AT1 B;  3OMG A;  3MP6 A;  2V1Q A;  4HT8 A;  1M27 C;  2CSQ A;  4QW2 A;  4ZN3 A;  2RHZ A;  1PG5 B;  2EJG A;  2EYY A;  4PK4 A;  1KIK A;  2A28 A;  2C0T A;  3OBY A;  3RNJ A;  2RHI A;  1H8K A;  2DRK A;  3L2V A;  4M78 G;  3V8J A;  3EG9 B;  4RUG A;  1PRL C;  3EFS A;  3OQ5 A;  2RM4 A;  1TH7 A;  3VS2 A;  1YHQ T;  3H0I A;  2FEI A;  2D9T A;  1KQ1 A;  4AFZ C;  1ABO A;  2QA4 T;  4LDU A;  1G3W A;  1M3A A;  3EGX B;  5FRO A;  4KBM B;  1I4K 1;  3GIB A;  2X35 A;  4F7U B;  3CPW A;  3QII A;  1RAH B;  2L3S A;  2CZ1 B;  5DY9 A;  5GAM d;  1PC0 A;  2YDL A;  1Y7X A;  2L5Q A;  2O4X B;  3OYF A;  2GFA A;  2EYW A;  4M7A B;  2QEX T;  2DXC A;  2COW A;  2DFU A;  5FLX E;  2LCS A;  1R0C B;  2RN8 A;  3LH0 A;  4BE1 A;  2YRV A;  1HD3 A;  1S72 T;  2NUP A;  5CO7 A;  5DLQ E;  4A4F A;  1NLO C;  2GBQ A;  2QQA A;  2CP3 A;  3HKS A;  4XU1 A;  1VQK T;  3CCQ T;  2YLC A;  3S3N A;  3EH2 A;  1WA7 A;  2MPX C;  3MJX A;  1MNE A;  3RKW A;  2OX7 A;  1QVF P;  1ACM B;  1FYN A;  3OYK A;  1NZ9 A;  3FDR A;  1JJ2 S;  3WXM B;  5CKH A;  1R8O B;  4IUU A;  4M75 G;  3CPW S;  1JEG A;  5IN1 A;  3EAE A;  4L6V 5;  2GQI A;  1YIJ Q;  4M78 B;  2XU8 A;  3JSC A;  1WHL A;  1XNI A;  1KK7 A;  2QQ9 A;  1JXO A;  2AZV A;  2KYM A;  5IT9 E;  1VIE A;  2LJ0 A;  1Y07 A;  1ZHI A;  4HCC A;  2DZC A;  2DXU A;  5L8R E;  3J80 E;  1YJ9 A;  2L3P A;  2VXE A;  3BDU A;  5GAM j;  3EGD A;  1PM3 A;  2K79 A;  4M77 G;  1VUB A;  2M02 A;  4Q5W A;  2MAM A;  3CPF A;  5KYN A;  2VVK A;  1GCQ C;  2E6Z A;  1M90 C;  2EJ9 A;  5KYY A;  1YJW Q;  1D3B B;  1WPY A;  2E10 A;  3PVQ A;  1VQ8 Q;  1I81 A;  2L2P A;  1VQN T;  2RJD A;  3X24 B;  4MML A;  3QZ9 B;  1RLP C;  3X20 B;  2QDL A;  5GAM f;  3M0S A;  3OYE A;  1X69 A;  1TSF A;  3QXE B;  3OYG A;  1UGS B;  2EKO A;  1AOJ A;  3M57 A;  5GAN e;  1KD1 U;  4J6X A;  4A4E A;  1MMD A;  4BI3 A;  3X25 B;  3X28 B;  3P8D A;  1W2B A;  2DO3 A;  1B34 A;  2E3H A;  4M75 B;  5HK3 A;  1XQH A;  2KE9 A;  4LDV A;  3R6N A;  3PTA A;  3CBO A;  2K5F A;  1JBM A;  2DRM A;  4AFQ C;  1WXU A;  3SD4 A;  1B07 A;  1M1K R;  3CCV Q;  1BCM A;  1RI9 A;  1SEM A;  3CXC P;  1Q95 G;  4F17 A;  1KSW A;  3GNG A;  1QKW A;  4LNP A;  1FXX A;  2RI2 A;  4PKC C;  2R5A A;  4DBF A;  3OYY A;  1WHH A;  3RES A;  3VS7 A;  3GP8 A;  4Y92 A;  2E1H A;  4UC4 A;  3VU3 C;  1VQO A;  1GXI E;  1KQ2 A;  4OB3 B;  4QQ6 A;  4R0K A;  3RR6 A;  3CCE T;  3CCS Q;  2OTL Q;  2KY9 A;  1W2B S;  1VQ5 T;  2JTM A;  3IQL A;  2RO0 A;  4PFZ A;  5HKC A;  1N8R C;  2FL7 A;  3PIP A;  3VS3 A;  1NG2 A;  1VQP Q;  1WZO A;  3JCM V;  4IUV A;  4OMP A;  1C0M A;  3QWY A;  2DL5 A;  1M5Q 1;  3M9Q A;  3QBY A;  3UF4 A;  1H64 1;  4DBQ A;  2P4T A;  2K3B A;  2CDT A;  1I8F A;  2P84 A;  4E7L A;  1MMG A;  1WXB A;  2F5K A;  4PJN A;  2D8H A;  2ZAE A;  2GTO A;  2HZY A;  1H3Z A;  4P5N A;  2VKN A;  1Q86 C;  5GMK l;  2DM1 A;  1WLP B;  1FWZ A;  2DVE A;  2OTJ Q;  1K73 R;  2ESW A;  4BAC A;  4PFP A;  2MYS A;  2KRM A;  1WQ7 A;  4M7A C;  4OMQ A;  4FT4 A;  1I5L A;  1AWJ A;  3CC2 A;  3OW2 A;  1WHK A;  2D1X A;  5A0G A;  4LXC A;  4XTX A;  4LD6 A;  1K73 U;  4M7A D;  2DE0 X;  1NBE B;  1C1A A;  4ME7 A;  4JZ4 A;  2GFU A;  1I07 A;  3VUB A;  2ZPB B;  4D8K A;  2JNG A;  3QO3 A;  2LQW A;  5LJ3 f;  3I35 A;  3CCL Q;  2NUP B;  1YIT Q;  3CCR T;  2HNI A;  1FMW A;  3REB B;  4FL6 A;  2FZK B;  3S3O A;  2RB6 A;  1NJI R;  4EMH A;  2VUB A;  4ZTJ A;  5FU6 B;  3CMA Q;  1SHF A;  3UA7 A;  3FIF A;  1K8A U;  3KXT A;  1Q81 C;  1WNL A;  4F7U E;  1IGU A;  1R77 A;  3L2Q A;  4PFO A;  4N4I A;  3OW2 S;  4BE2 A;  3AT1 B;  3M0Q A;  1RUW A;  2DAQ A;  2DPP B;  4DQ2 A;  4ZGJ B;  1OPK A;  5GMK m;  2MWP A;  1VQL Q;  4PJL A;  3L1A A;  4OB0 B;  1KC8 C;  1N5Z A;  2JUF A;  2EJF A;  1ZBJ A;  2F5T X;  4JJD A;  1AWW A;  4J9B A;  1LNX A;  2KQW A;  2VAS A;  1D0Y A;  2HKQ B;  3NMZ C;  1YCS B;  3CCU T;  5IAY A;  4ELY C;  1OPL A;  3EGD B;  2KRN A;  1ZLM A;  4E7H A;  3FJP A;  5CK9 A; 
#chains in the Genus database with same CATH homology
 3OYD A;  3H8Z A;  5KH6 A;  2G3R A;  2LCL A;  3PGG A;  1WJQ A;  3ZBD A;  5KCH A;  5GMK j;  3I56 A;  2I2L A;  3CC4 T;  1YIJ A;  1UGR B;  1O9S A;  5D6W A;  4JRP A;  3G6E A;  1G3T A;  2K57 A;  4RMO A;  3RER A;  4C8Q F;  3JCM J;  3PFS A;  5J26 A;  2XKO C;  4OB2 B;  3C95 A;  3HL8 A;  3TU4 K;  4Z02 A;  4CI0 C;  3GF5 A;  3MET A;  5GAM h;  1UGP B;  5GMK e;  4N4G A;  3JB9 J;  3CEY A;  4MZP A;  3M55 A;  5C6S A;  2EQM A;  4OF1 A;  1Q86 U;  3JCM f;  5GAO p;  3C4S A;  1KQS S;  3CXC S;  2K5I A;  3RKX A;  1RI0 A;  5GAN 5;  3J7A F;  2E70 A;  3MHX A;  1VQM T;  2ZPE B;  4EDU A;  4OGC A;  3MEV A;  4N4H A;  4E7J A;  2VXF A;  2P0P A;  4EMK B;  3JCM Q;  1O75 A;  3PMT A;  1B34 B;  2RI3 A;  4B9X A;  3DKM A;  5KE3 A;  2QDY B;  3QZ5 B;  4C8Q E;  4YTL A;  5C0M A;  5I2M A;  1KHI A;  3NTI A;  4J83 A;  1YHQ A;  2LDM A;  2HBP A;  4HCB A;  3M4Y A;  4J7F A;  5LJ5 g;  2DXB A;  3OS0 A;  4TVR A;  4X9C A;  5CR2 A;  2QA4 A;  5LJ3 j;  2XDD A;  1YJW A;  3G7Z A;  2XHC A;  2R5M A;  2E6N A;  4NL2 A;  2LC4 A;  4HA8 A;  3CCJ T;  1QW1 A;  1OYX A;  2Y90 A;  2PVG B;  3CBP A;  2XD0 A;  1SSF A;  4MMK A;  1VQ8 A;  1WQW A;  2Y4Y A;  2HD0 A;  4BDZ A;  4M75 F;  3JCM c;  1M1G A;  3HRU A;  2MF2 A;  4BI4 A;  3I56 T;  4JRQ A;  1NPR A;  2VV5 A;  3TCJ A;  3WVD B;  1YIJ T;  3AHU A;  2DIQ A;  5CQY A;  3MP8 A;  1MGQ A;  2FVU A;  3OYB A;  5GAM e;  3O8V A;  2WAC A;  3OYI A;  3SWN B;  3JCM g;  3GLX A;  2L8D A;  5GAN 4;  3OMG A;  3MP6 A;  2QEX A;  1MHN A;  3A8L B;  2EIF A;  5M9O A;  2MMP A;  4VUB A;  4HT8 A;  2KDS A;  2LNV A;  2RK2 A;  1QP3 A;  4QW2 A;  1U1T A;  4ZN3 A;  4J8O A;  3OB9 A;  2RHZ A;  4A53 A;  2LRQ A;  4M7D E;  2LTO A;  2EJG A;  4JRK A;  1BI3 A;  4Y28 E;  1N27 A;  1S72 A;  1BI2 A;  3JRZ A;  3JCM W;  5KE2 A;  3OBY A;  4IUP A;  1X01 A;  4M78 C;  4XTY A;  2RHI A;  2K4Y A;  4C5H A;  1Q81 U;  3E19 A;  3L2V A;  1BIB A;  3H6Z A;  4M78 G;  1K73 C;  3V8J A;  4BD3 A;  3P8B B;  3A8G B;  3WVE B;  2P0K A;  3CCQ A;  1VQK A;  5CCA A;  1UGQ B;  2XK0 A;  4M7D B;  3EFS A;  1VQ6 A;  3HSB A;  3C12 A;  3OQ5 A;  1BI0 A;  4DOV A;  3QPH A;  3F70 A;  2RM4 A;  1TH7 A;  4M78 D;  4KUI A;  1KG1 A;  4HKE A;  4LDX A;  1YHQ T;  1Y96 A;  3OA6 A;  2D9T A;  2Y4X A;  1KQ1 A;  3LW5 E;  2H3J A;  2YHT A;  4C0D C;  3CCV A;  1KD1 C;  2LQK A;  2EFI A;  3ER0 A;  4XQ3 A;  2QA4 T;  4LDU A;  1YJW T;  3OY9 A;  2V8I A;  1G3W A;  2PUK B;  1KC8 U;  3OS5 A;  2CZ0 B;  5FRO A;  4KBM B;  3V7S A;  2EWN A;  1I4K 1;  4IUR A;  4LD9 K;  3GIB A;  2X35 A;  4F7U B;  3CPW A;  3QDR B;  3QII A;  3PIO A;  3M5A A;  1KQS A;  1VQ8 T;  4M7A E;  4BY6 B;  3A8M B;  2CZ1 B;  1NPP A;  5DY9 A;  2JTF A;  5GAM d;  3QKJ A;  2QQR A;  1P92 A;  3V8L A;  4PL6 A;  2PUO B;  3SFM A;  2FHD A;  2JOY A;  1Y7X A;  2RJE A;  4NS5 A;  2DIG A;  2L5Q A;  2O4X B;  2RA2 A;  2GFA A;  3UDC A;  3OYC A;  3OYF A;  4J6Y A;  3ME9 A;  2KVQ G;  2ZPG B;  5GAN 3;  4M7A B;  2QEX T;  3URG A;  3CCS A;  4JS5 A;  2OTL A;  2DXC A;  5FLX E;  1DJ7 B;  4XK8 E;  2JN0 A;  2D6F A;  3V7R A;  3LH0 A;  2EQK A;  4BE1 A;  2YRV A;  1M1K U;  5D6Y A;  2A3L A;  2M1H A;  3A8H B;  4Y91 A;  4C0Z A;  1S72 T;  1NJI C;  1VQ7 A;  5CO7 A;  1HXD A;  2RK1 A;  3L42 A;  4O6J A;  5DLQ E;  4A4F A;  1VQP A;  5GAN d;  2QQA A;  3QYG B;  5GAN 7;  3HKS A;  1PSF A;  5CVI A;  3OYL A;  4XU1 A;  1YI2 T;  1VQK T;  3CCQ T;  2YLC A;  5CKE A;  4C0F A;  3LLR A;  5HY6 A;  3S3N A;  4RCB A;  2ZPI B;  1VQ6 T;  3UT1 A;  1G3S A;  4JLG A;  4FU6 A;  4RKU E;  5GAO q;  3OYH A;  3QUI A;  3V7C A;  1WGS A;  3GPL A;  4BUG A;  1OZ2 A;  3JCM b;  1Q7Y U;  4M78 E;  2F69 A;  3RKW A;  4FM4 B;  1LOJ A;  2HAX A;  4PJO E;  2VC8 A;  3NTH A;  2OAU A;  3OYK A;  3OS2 A;  1NZ9 A;  3OSV A;  2GQV A;  3FDR A;  1JJ2 S;  4M75 C;  3WXM B;  1M8V A;  4FT2 A;  2JZ2 A;  5CKH A;  2X4W A;  1VQN A;  1R8O B;  1W4S A;  3FJP A;  4IUU A;  4M75 G;  3J81 E;  3CPW S;  1BKB A;  5IN1 A;  3EAE A;  4L6V 5;  2M9U A;  5CQX A;  4M78 B;  2QXF A;  2XU8 A;  5J39 A;  3JSC A;  4PJO B;  4B9W A;  5FRN A;  5FU6 C;  4M75 D;  1XNI A;  2KMT A;  4F7U A;  2QQ9 A;  3S6W A;  1UB4 A;  3E9G A;  4NOY A;  4CRI A;  4C92 A;  4O5V A;  4JJN K;  4L5G A;  3RUX A;  3EFR A;  4M77 A;  1WJS A;  5IT9 E;  5GAN h;  2E65 A;  4ZTF A;  2OTJ A;  2KK4 A;  1VIE A;  2EQJ A;  3CCS T;  2OTL T;  4C0D B;  4MZM A;  5DM7 R;  1Y07 A;  2D0Q B;  1ZHI A;  3RMS A;  4J6W A;  2M16 A;  3HRT A;  4HCC A;  2DZC A;  3RKY A;  2DXU A;  2BUD A;  1KHC A;  2V8K A;  4C8Q B;  4ZGE B;  4R56 A;  3OMC A;  5L8R E;  3J80 E;  1Q82 C;  1YJ9 A;  1VQP T;  2VXE A;  2EAY A;  3BDU A;  3OBW A;  5GAM j;  4M77 C;  1QVG A;  2V8J A;  1IZ6 A;  1RL2 A;  4QQG A;  4XTV A;  4M77 G;  1VUB A;  2E12 A;  4Q5W A;  2MAM A;  3OYM A;  2L3R A;  3CPF A;  4A4H A;  5GAN 6;  2C06 A;  2PU9 B;  2R58 A;  2DD4 A;  2E6Z A;  5GMK i;  1IRE B;  2L89 A;  1M90 C;  2EJ9 A;  3G6E T;  1K9M C;  2DTI A;  2K3Y A;  4HT9 A;  3T9N A;  3KUF A;  3NFC A;  1D3B B;  1WPY A;  3MEW A;  4KUL A;  4M77 D;  2E10 A;  4DOW A;  4MDX A;  4E47 A;  3JB9 F;  4A54 A;  5KCO A;  1I81 A;  4R55 A;  1VQN T;  2RJD A;  2E41 A;  2XI9 A;  5FU7 C;  2RHY A;  3X24 B;  3FEO A;  2DTO A;  4MML A;  3QZ9 B;  3R6O A;  3CCL A;  3X20 B;  5GAN j;  1V29 B;  1N9S A;  3P8H A;  5GAM f;  1YIT A;  2LVM A;  1JRI A;  3M54 A;  3OYE A;  3HFO A;  3QXE B;  2QI2 A;  3CCE A;  3OYG A;  1UGS B;  2EKO A;  3M57 A;  4M75 E;  2EQU A;  3JB9 H;  4C5E A;  5GAN e;  1VQ5 A;  2VYT A;  1KD1 U;  3M59 A;  4J6X A;  4A4E A;  4BI3 A;  5LJ5 h;  3X25 B;  4C92 F;  3X28 B;  3E9F A;  3P8D A;  4EMK A;  3CMA A;  2MI6 A;  2DO3 A;  1W2B A;  2OTJ T;  3TRE A;  1B34 A;  4M77 F;  4JRI A;  4QQD A;  3HPW A;  3CCU A;  3RIR A;  1U1S A;  4FSX A;  1XQH A;  4M75 B;  4OGE A;  5CKB A;  4LDV A;  3BY7 A;  5HK3 A;  3M56 A;  3PTA A;  1FX7 A;  2CS7 A;  2CGH A;  3G4S A;  3CBO A;  1G5V A;  2X4X A;  1YCY A;  3HFN A;  5GAN f;  3LWI A;  2K5F A;  1JBM A;  2O01 E;  1JJ2 A;  1QVG S;  3S3M A;  1YJ9 T;  4X34 A;  2IVW A;  3QHS A;  3SD4 A;  2XG8 D;  5GAN 8;  4V2S A;  4EMK C;  3HP9 A;  4EMG A;  4WF2 A;  3LX7 A;  3M4G A;  3JCM h;  5I21 A;  1VQL A;  1OI1 A;  4IUT A;  4RG2 A;  4PLL A;  3FLG A;  3FB9 A;  3N5B B;  4JDS A;  2GF7 A;  4XU3 A;  3ZFJ A;  3SB2 A;  3GNG A;  2DXT A;  5EG2 A;  3ZEH A;  3KBG A;  3DB4 A;  1K8A C;  1FXX A;  5A2Q E;  3OYA A;  3L2Z A;  2RI2 A;  4PKC C;  3G71 A;  1NJI U;  4GY5 A;  5CKF A;  2R5A A;  1N6A A;  5GAM g;  3DLM A;  3OYY A;  3SWN A;  3VKI A;  4A4K A;  3RES A;  3VUZ A;  4PNO A;  3JB9 I;  3GP8 A;  1VQ9 T;  3L2R A;  2E1H A;  4OMF B;  4UC4 A;  3VU3 C;  4NL3 A;  3M53 A;  3MCA B;  1JB0 E;  1ZBX A;  1VQO A;  3CCL T;  1KQ2 A;  1GXI E;  3I55 A;  3NTK A;  3FC3 A;  3INZ A;  4OB3 B;  4QQ6 A;  3MEA A;  3CME A;  3CCE T;  3VYH B;  4RCC A;  2RHX A;  2KY9 A;  5LJ5 e;  1W2B S;  1BI1 A;  2LX9 A;  4FIB A;  1VQ5 T;  2JTM A;  1Y71 A;  2RO0 A;  5HKC A;  4JS4 A;  2R57 A;  3CMA T;  4E7K A;  2DD5 A;  5DLO A;  4M7D A;  1BYM A;  3A8O B;  5J3B A;  2VGM A;  3LGF A;  4XTU A;  5GAN g;  1N8R C;  2FL7 A;  4II1 A;  2DZ9 A;  3PIP A;  1EIF A;  3CCV T;  2E64 A;  4RG8 A;  3OSS C;  5FU7 B;  3G4S T;  2XIC A;  4IUQ A;  2PQW A;  4X9D A;  4ZGD B;  1WJR A;  3HHT B;  3UWN A;  3JCM V;  4D6W A;  4IUV A;  5HK0 A;  4OB1 B;  2KSS A;  3SDZ A;  5LJ3 h;  1M5Q 1;  3M9Q A;  3QBY A;  3JCM e;  1H64 1;  2IG0 A;  2P4T A;  5GAO n;  1U8R A;  1QVF A;  4M7D C;  2CZ6 B;  4M7D G;  1I8F A;  3JB9 G;  1VQL T;  2LQ8 A;  4OP0 A;  5GAO l;  2RI5 A;  2KAF A;  4A4G A;  4QVC A;  2B8A A;  5I2S A;  3GOX A;  1PSE A;  3DB3 A;  4E7L A;  1X75 C;  3G71 T;  3Q1J A;  4QVD A;  1Q7Y C;  4M7D D;  5AYF A;  2F5K A;  3JB9 D;  2O4X A;  3VJP A;  1Q82 U;  1YBY A;  2ZZD A;  2A7Y A;  1BIA A;  3CCR A;  4M7A A;  2DTH A;  3X26 B;  4DA4 A;  1H3Z A;  2M0O A;  3HRS A;  3JAM E;  2BKD N;  2DK3 A;  4P5N A;  1VQO T;  1VQ7 T;  4GLK A;  1Q86 C;  2EYQ A;  4C92 C;  3LYI A;  4BY6 C;  4F7U G;  5GMK l;  5LJ5 d;  3I55 T;  4ZN1 A;  2XDB A;  1M90 U;  4C92 G;  3M58 A;  2LT4 A;  1FWZ A;  3LGL A;  3CME T;  1K9M U;  4MDW A;  2DVE A;  3PNW C;  1Y96 B;  4BAC A;  1G3Y A;  4XTW A;  2RD1 A;  1YJN A;  3CC7 A;  2CZ7 B;  3PT9 A;  2K3X A;  3V8K A;  4C92 D;  1WQ7 A;  3CCM A;  4M7A C;  4QVZ A;  2WSF E;  2CYZ B;  2VGN A;  4KUD K;  1NE8 A;  4M7A G;  4FT4 A;  5CAI A;  1I5L A;  3CC2 A;  4M7D F;  2QTX A;  3OW2 A;  3QYH B;  5A0G A;  5GAO r;  3BW1 A;  4XTX A;  3C94 A;  4LD6 A;  1K73 U;  3JCM d;  4M7A D;  2X4J A;  3GNF B;  4ELZ C;  2NLU A;  5LJ3 e;  1QVF S;  4ATO A;  4XAX B;  4ME7 A;  3MO8 A;  2BIV A;  4J5Y A;  3RMQ A;  4BE0 A;  2GFU A;  3ASK A;  1AHJ B;  2JVV A;  4M78 A;  3JCM X;  5CIU A;  2LT1 A;  3VUB A;  2GCX A;  2XDP A;  4PJO A;  2X4Y A;  2ZPB B;  2WSE E;  2JNG A;  3QO3 A;  4PLI A;  4F7U F;  3OYJ A;  2E5Q A;  1VQ4 A;  4JUV A;  2DKG A;  5LJ3 f;  2DEQ A;  1M1F A;  3DLL A;  5FRM A;  2XID A;  1VIF A;  2FB7 A;  2ZPF B;  4C5G A;  2DJZ A;  3CCR T;  1N9R A;  2HNI A;  2K2V A;  4FL6 A;  2P0Q A;  2WSC E;  4OVA A;  4C5I A;  4M7A F;  3S3O A;  3BDL A;  2ZGW A;  3CD6 A;  2RB6 A;  2QQB A;  2RHU A;  3VYG A;  5D6X A;  4EMH A;  4PJO C;  4L59 A;  2VUB A;  2MWO A;  4JLI A;  2RJC A;  4PJO G;  4ZTJ A;  1YI2 A;  5FU6 B;  4C8Q A;  3OS1 A;  1X6O A;  3CC4 A;  3QJY A;  1M1K C;  2YLB A;  3FIF A;  1K8A U;  3L2U A;  3KXT A;  1Q81 C;  2K5L A;  1WNL A;  3E1S A;  5GAN 2;  5GAO m;  3UPU A;  1YJN T;  4XTZ A;  3CC7 T;  3QSU A;  1UEB A;  3QG1 A;  4XU2 A;  4F7U E;  3L2Q A;  3CCM T;  4PJO D;  2HQX A;  3MEU A;  4N4I A;  4C92 E;  2ZPH B;  3OW2 S;  1LJO A;  2QQS A;  4BE2 A;  4N0A A;  3OYN A;  1XTD A;  2RH2 A;  3CC2 T;  2AHJ B;  4BDY A;  1HK9 A;  3BFM A;  4M77 E;  3CBM A;  5GMK h;  5A0D A;  2DAQ A;  5LJ3 d;  5CKD A;  1D3B A;  2DPP B;  4DQ2 A;  1OZ3 A;  4ZGJ B;  2PVD B;  4C8Q C;  2CKK A;  1ZQ1 A;  4C8Q G;  5GMK m;  2MWP A;  4C92 B;  5LJ5 j;  1VQM A;  4MZT A;  3CXC A;  1M9S A;  5A0L A;  4IKF A;  1YIT T;  3L1A A;  3MP1 A;  4OB0 B;  1KC8 C;  4M77 B;  2JUF A;  3PMI A;  1VQ9 A;  1XOV A;  2EJF A;  1QVP A;  4C0G A;  5LJ3 g;  4E7I A;  2HQE A;  4N0A C;  2F5T X;  4LDY A;  4C8Q D;  1N8R U;  4EPC A;  4M78 F;  3SWN C;  1LNX A;  4PJO F;  2KQW A;  1VQ4 T;  1M4Z A;  2LCC A;  2ZCF B;  2PVO B;  5LL6 S;  3TEE A;  4HCZ A;  3JCM P;  3QJ6 A;  2FYK A;  4XU0 A;  3FRN A;  5IAY A;  3L2W A;  3CCU T;  4BI8 B;  4KT0 E;  3A5Z B;  4ELY C;  3LWH A;  5LJ5 f;  4BB7 A;  3CCJ A;  4E7H A;  4LDW A;  4M75 A;  3CD6 T;  4J7I A;  2RJF A;  5CK9 A;  3VV0 A;  1QP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...