4NOYA

Crystal structure of listeria monocytogenes hfq f43w
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
MKQGGQGLQDYYLNQLRKEKILATVFLTNGFQLRGRVVSFDNWTVLLDVEGKQQLVFKHAISTFSPQKNVALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of U-rich RNA by Hfq from the Gram-positive pathogen Listeria monocytogenes.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Rna binding protein
molecule keywords Protein Hfq
total genus 16
structure length 73
sequence length 73
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2013-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4noyA00
4RCBA 3QO3A 4X9CA 3AHUA 4EMGA 2DXTA 5GMKl 4N0AC 3JCMe 2DZCA 4HA8A 5GAMg 4C92E 4M7AF 3VU3C 5LJ5g 2DEQA 3JCMb 1M8VA 4V2SA 1M5Q1 4C8QC 1D3BA 4M75G 3PGGA 4M78F 2K57A 2HNIA 4M77F 5GAOm 3JCMQ 4NL3A 2CGHA 2DTIA 5GAN6 1B34B 3HFOA 1JBMA 3JB9J 4C8QE 3FIFA 4XTZA 4XTWA 4XU0A 4C8QA 4EMKB 5LJ5f 5LJ3j 5LJ3f 4J6WA 5GANj 4A54A 1LNXA 5GAN2 1I81A 3V7SA 1MGQA 5GANh 2DVEA 4M7DA 3HSBA 2DTHA 4M78D 1KQ2A 3JCMW 4PNOA 3V8JA 4WF2A 4NL2A 3JCMP 3L2ZA 4M78A 4PJOD 4PJOF 2VXEA 4C8QB 4EMKA 4F7UA 3RKXA 4M7DD 4M7AD 4XTVA 5GAMe 2RM4A 4XU3A 4J5YA 4C92D 4M7AA 4EMHA 3SWNA 4F7UF 4PJOA 3FB9A 1WNLA 1U1TA 2JN0A 1D3BB 2E65A 4C8QG 5GAN5 3JCMd 3RKWA 3RERA 4XU1A 3JCMX 4XTYA 5GANd 4N0AA 5DY9A 4RCCA 2EWNA 2YLBA 4XTUA 4M7DB 3JB9I 4C8QF 4M75A 4PJOG 4C92F 5GAMf 5GAMj 4M75D 3BFMA 1TH7A 3RESA 1LOJA 3V8LA 3JB9F 1X01A 5LJ5h 4XQ3A 5GMKj 4MMKA 4M7DG 1HXDA 2E10A 5GAN3 4JRKA 4PJOB 1YCYA 3M4GA 3INZA 3BDUA 5LJ5e 3EFSA 4OP0A 1KQ1A 5LJ3e 5LJ3g 3QHSA 5GAN7 4M78G 1BIBA 1LJOA 1Y96B 5CAIA 2VXFA 4DQ2A 2Y90A 4M77D 1U1SA 4J6XA 4M7AG 5GAOl 2DTOA 2I2LA 2DXUA 2ZGWA 4M7DF 1I8FA 1JRIA 5GAOn 4C92A 3RUXA 3SWNC 4M75F 4QVCA 4X9DA 3JB9G 4M7DC 5GAN4 3JCMc 3JCMf 5LJ5j 2RA2A 3SWNB 4C8QD 2EAYA 5GAN8 3JB9D 4M7AB 4MMLA 5GAOr 5GMKm 3JCMJ 4M7DE 5GANe 4JRIA 5GMKe 2E64A 3FJPA 5GAOq 2E41A 2FB7A 5GAMh 4F7UB 1H641 3QSUA 4M78B 5GAOp 3JCMg 1N9SA 1I5LA 3QUIA 2YLCA 4XU2A 4JLIA 1HK9A 4JUVA 5GMKh 3RIRA 3JCMV 5I21A 5GANg 4M7AE 3EFRA 4F7UG 3V7CA 1WQWA 2EJGA 4M78C 2QTXA 4Y91A 1Y96A 4M75C 4NOYA 4PJOE 4M77B 4HT8A 1I4K1 4M78E 5GAMd 1B34A 2DJZA 5LJ5d 4F7UE 2FYKA 5LJ3h 4PJOC 2E1HA 2YHTA 4C92G 4M7AC 2DZ9A 3BW1A 3HFNA 1N9RA 3SB2A 4C92C 4M75E 4A53A 5GANf 3JB9H 4EMKC 3L1AA 3RKYA 2RD1A 3BY7A 2EJ9A 1WPYA 3V7RA 4C92B 4M77A 2RB6A 5LJ3d 3GIBA 4M77E 4XTXA 4QVDA 2VC8A 3JCMh 4J6YA 5GMKi 1WQ7A 1BIAA 4HT9A 4M77C 3V8KA 4M75B 2EJFA 2DKGA 4M77G
chains in the Genus database with same CATH superfamily
1M1KC 3J81E 3DB3A 2DXTA 2M16A 3GP8A 2DEQA 1IGQA 3D7SB 1D0XA 3CC4T 1JB0E 1S72Q 4O5VA 2NUTA 3P8BB 4C5IA 2PVDB 1YWOA 3FEOA 4N4HA 4QQDA 3SFMA 1C1AA 4JJBA 2FEIA 5I2MA 1MNEA 2LNHB 3OYGA 2KXCA 3CC4Q 3OW2A 1AOJA 3OYKA 3L2UA 1PKSA 4XU3A 4CC3A 2HKQB 1IHVA 2D9TA 3A1PA 1VQ9T 4DBHA 1UGQB 2AT1B 3TCJA 2QQ9A 2ECZA 3TVTA 4JJCA 1GXIE 2QA4A 4OB0B 3G71Q 1IRXA 2QQSA 2KYMA 1M3AA 1ZLMA 4FYVB 3LGFA 1X01A 3M56A 3RR6A 1Q82U 3CC7A 1WHGA 2XDBA 2R5MA 1NLPC 3FRNA 1LPLA 1Y96B 2YUQA 1QVGS 4JZ4A 4L6V5 4M7AG 2Z0WA 3E19A 4B9XA 2HEQA 4OMQA 2QQRA 1EX4A 1CKAA 2KAFA 1WIEA 1ZQ1A 3M57A 2QA4Q 1QQJA 1VQ4Q 2CZ1B 1M8VA 3FJPA 2D0NA 2HBPA 1PNJA 2DD4A 3JCMg 3QUIA 4XU2A 1HK9A 3JCMV 4RG2A 1WJQA 5KYWA 2EJGA 1VQ6A 1K73C 1GL5A 2LQ8A 1N8RC 2OJ2A 5D6XA 1D1BA 3JB9H 4LDXA 2LZ6B 4IIMA 2X4YA 2YXYA 4M77A 2QGFB 3EH2A 2LQKA 2RO0A 1BI2A 2OAWA 2ZCFB 3J80E 1YJNQ 1M1KU 3JCMe 1G8XA 1TTHB 3CCRA 5FU6B 2ZZDA 2A0FB 4ATOA 1MMGA 1R8OB 3SEMA 2O9VA 2GF7A 3RDVA 2DTIA 2SRCA 1RLPC 2JXBA 2CSQA 2B86A 1WZOA 1MGQA 2DVEA 2JVVA 1HSQA 2RN8A 1RI0A 3QKJA 4DEXA 1TOVA 5ECAA 1H3ZA 1M2VB 5I2SA 3OB9A 1ZA1B 3H8ZA 3EG1A 4DEYA 2LQNA 3JCMd 4A4EA 4M7DB 1YI2A 1UGPB 2ABLA 4YTLA 2VKNA 1VYVA 3BFMA 4QW2A 2DM1A 2XG8D 5IXFA 2PVOB 2CP3A 4PJOB 4C0GA 2HCKA 1WFWA 2MWOA 1VQ7Q 5LJ3e 2KRNA 2CSIA 2HDAA 2G3RA 4JRPA 2Y90A 2OTLQ 2CZ7B 2KMTA 3OYCA 1QVFP 4IUVA 5GAOl 2KT8A 3UDCA 5KYYB 3JB9G 2JTEA 2RNAA 1BK2A 5LJ5j 2EAYA 2HAXA 1PKTA 1PSEA 5CKDA 5GAOq 5GAMh 2DNUA 1G5VA 2DLPA 1Y71A 1VQOT 3HHTB 1M9SA 1I5LA 4D8KA 1SHGA 3LWIA 1OOTA 2E5QA 3EFRA 1WDXA 1IB8A 4M78C 3I56A 2DEUA 4M7AC 3CCVT 3HRTA 3CC2Q 3BY7A 1WHMA 2CUBA 3NHNA 2DL3A 4XTXA 5CQYA 2KRMA 3C12A 2DK3A 2FL7A 2HQXA 2C0IA 1UDLA 1VQLT 1N5ZA 2L89A 3JCMb 3FDRA 2CS7A 1T3LA 3PIPA 3A8OB 5GAOm 2CGHA 1AZGB 1QKXA 1JBMA 2JT4A 1VQNT 1D0ZA 3I55T 2COZA 3HRUA 4J7FA 1KIKA 2RHZA 1UE9A 5FRMA 4LXCA 1NYFA 1AWOA 1WHHA 1ABQA 4BUGA 4F7UA 2QGGA 1X75C 2CP2A 1VIFA 4ELZC 3SWNA 4IUTA 4ZGEB 1I1JA 3RKWA 3CMET 4E6RA 1NJIC 1E7OA 2KY9A 1W4SA 1X27A 4PFOA 1SPKA 2CKKA 3QJYA 3P8DA 3G6EQ 1OEBA 5CKFA 3CCVA 4JRQA 4NS5A 3G71A 1VQ8Q 1NE8A 2D0QB 2NUZA 4RTVA 4FYXB 1I8FA 2X4WA 4LNPA 5GAN4 1N6AA 1TUCA 1K8AC 4MMLA 5IAYA 4LDUA 1ZUKA 2E64A 4DBFA 1BI0A 2K5LA 5HY6A 2QASA 5FU6C 3TSWA 1W2BA 4ZGJB 3G6EA 5GANg 2COWA 1OX9A 2LP5A 4AG1C 3CCMA 1VQKQ 2GTOA 1B34A 1NPRA 2FYKA 1HJDA 8AT1B 2J05A 2J6KA 2RI2A 2JS0A 2HSEB 3L2VA 4OMPA 2XICA 2JMAA 4FSXA 3S6WA 4J6YA 5C6SA 1WJRA 2EJFA 4ZTFA 1PCXA 1ZHIA 4HVWA 2DZCA 1XJWB 3QWYA 4C92E 4M7AF 1VQMQ 2L2PA 3U23A 4M75G 4M78F 2QQAA 1Q7YC 2EQKA 1Q86R 2PUOB 1AWJA 4FL6A 3J7AF 1SRMA 3JB9J 1FMWA 5LJ5f 1YJNA 5GANj 5J39A 3OYEA 1UFFA 3S3OA 2BE9B 4JJNK 2ZAEA 2ZPIB 2CP0A 3T9NA 2V8IA 2EYWA 2CH4W 2JW4A 1G3YA 1YFNA 2LT1A 4WTOB 4XTYA 3JB9I 2HQEA 3QBYA 2CP7A 3OYNA 4BE1A 4RTXA 3X28B 2F5TX 1M90C 4IUQA 3EG3A 5I11A 5CKBA 2EYZA 1KD1R 2KT1A 5CKEA 1W70A 1QVPA 2F2VA 1W6XA 2ZGWA 4FCYA 3A5ZB 1M4ZA 1B3QA 1D1AA 2P84A 3SWNC 3CCMT 2RJFA 2R5AA 3JCMc 3ZL7C 2NUTB 1VQ7A 2K3YA 1VQNA 2NWMA 1G2BA 1MMDA 4FW2A 1BBZA 2QG9B 2OTLA 4K11A 2DJQA 3CQTA 1VQPT 1UHFA 1WQWA 3PVLA 3OW2P 4X1VA 2GCXA 5GAMd 1MMNA 1SKUB 2RPNA 2DZ9A 4X34A 2JTMA 2ED1A 3CCQA 3CCUT 1XOVA 4M75B 3CD6Q 2BZ8A 5FW9A 4GY5A 4LD6A 5CVIA 1FYNA 4GBQA 1U8RA 4FYWB 3GPLA 1B34B 3TSZA 2LX7A 3DB4A 3PFSA 4RG8A 2KROA 1DJ7B 2LJ0A 3EGDA 3H0FA 1W1FA 2FO0A 4PJOD 1QWEA 4J5YA 4C92D 1OPKA 1VQ8T 1D3BB 1K76A 2HD0A 4J9CA 1K0XA 3OSVA 4E47A 4JDSA 1KQSA 2X3XD 4OMOA 1R0CB 2RJEA 4C92F 2FHDA 1WHJA 4RTTA 2DXBA 4C0ZA 1LOJA 2F2WA 1O9SA 5GMKj 2HQHA 3VRZA 3HL8A 1TS9A 3CCSA 4ZTJA 3NTIA 3QYHB 2VYTA 2GQIA 4BE0A 2W0ZA 4MDXA 5L23A 1GRIA 2EFIA 1WI7A 4C92A 1QCOA 3OBYA 2A28A 2AHJB 2RA2A 5EC7A 1U06A 1SSHA 1W2BP 3BDLA 4RKUE 4QQ6A 2M9UA 3PMIA 2EGAA 2YUPA 2EYYA 3UWNA 2O4XB 2H3JA 2QDLA 4HT8A 1BB9A 2ENMA 3JAME 4EMKC 3L1AA 2YRDA 1I5OB 3CCJQ 1WGSA 4PL6A 2E4HA 3CCRT 1AT1B 2VC8A 2QTVA 1OYXA 1Y57A 1H92A 2HMAA 1MNDA 4EMGA 1VOMA 5GMKl 2ATCB 4LUDA 2GBQA 4HA8A 4MZPA 4IKFA 3CXCA 2VWFA 1PWTA 2H8HA 2GQVA 1YI2T 4KGVB 2MPXC 3CC7Q 1CKBA 4RTYA 2A3LA 2KSSA 3CPWA 3H9NA 2XK0A 2ESWA 2BIVA 5IHNA 3KXTA 1IGUA 3RKXA 4XTVA 2AIRB 3S3MA 4R56A 2OTLT 2QQBA 4BI3A 1LVKA 1X2QA 3MEWA 2ED0A 3H41A 1NJIR 1GCPA 3LW5E 1VQ4T 1K73R 1OX8A 2SEMA 5GAN3 1YCYA 1Q82R 3OYYA 3CPWS 3UA7A 1QVGA 2X3WD 1KQ1A 4KRTA 1UB4A 1YITT 5GAN7 2EGEA 1LJOA 3QIIA 4E2FB 1X69A 2L8DA 2I2LA 1YHQT 2LCLA 2V26A 3OYLA 1OU8A 1JO8A 2VUBA 1ACMB 3CCRQ 2QAZA 1FX7A 3JCMJ 3MKDA 3G7ZA 5GMKe 2C06A 1PSFA 2CH4A 3G71T 3A8LB 1BI1A 3MEUA 1KHIA 3IQLA 1NEBA 3QJ6A 2D8HA 3NMZC 1Q95G 1M30A 1ZSZB 1IXDA 4Y92A 5LJ3h 2DFUA 1OQKA 3PTAA 3I5RA 4JPBW 2QI2A 2KK4A 4Q5WA 1U5SA 3MP8A 1WHLA 4M77E 1OV3A 1KHCA 4JJDA 1LNXA 5M9OA 3EAEA 1TU0B 1NLOC 1Z9ZA 2AZVA 1M3BA 1ZBXA 3BE3A 4M77F 1AWWA 3AT1B 3HFOA 4XU0A 5FWBA 3NGPA 1X6BA 3UATA 4CC7A 2HL3A 2XHCA 1WA7A 3Q1JA 1EZZB 4M78D 2X35A 1VQKT 3PNWC 4A4KA 4EMKA 5AT1B 1VQ9A 1YITQ 4PFPA 3VV0A 2I0NA 3OBWA 3TREA 2O31A 4XTUA 2YLBA 1QW1A 3LGLA 2R57A 4B6MA 4PLLA 5LJ5h 1NPPA 3WVDB 3MPUB 3INZA 3NFCA 4FSSA 3CC2A 2K6DA 1PRMC 3EFSA 1VQ9Q 1HYOA 3OYIA 4EDUA 4M77D 4L5GA 5HK3A 1JRIA 1ZX6A 4M75F 4X9DA 2EVRA 1P92A 2DMOA 3CCSQ 3LWHA 2HZYA 1KK7A 1EFNA 2FG0A 3OYBA 5KYYA 1NJIU 4KUDK 4ZN1A 4XAXB 2IVWA 5GANf 1YJWQ 3S3NA 1KQSP 2RB6A 5D7UA 2PUKB 4II1A 1V1CA 2MIOA 3QO3A 2CZ0B 2COYA 3EGXA 2K3BA 2XKOC 2JOYA 2PVGB 1ZSZA 1QP2A 1M2VA 1E6HA 3CCVQ 3R6NA 5IT9E 4J9DA 1WJSA 3P8HA 3JCMP 4M78A 3OYAA 1GCQA 1IO6A 2CDTA 3G1JA 1M90R 1WNLA 2RJCA 3OYJA 5CO7A 3EGDB 3I55Q 2KEAA 4GLMA 2EYQA 2LCSA 4LN2A 1U3OA 1RI9A 3CCMQ 2YDLA 1D09B 4BDYA 2A7YA 1Q86U 2WSFE 5A2QE 2EKHA 2J6OA 1YCSB 3THKA 4CI0C 5LJ5e 3QZ9B 4PJLA 1JU5C 2K4YA 5KYWB 3L42A 4AFSC 4QKUA 3MCAB 3QDRB 3H6ZA 5IN1A 2X9HA 2G6FX 1N9SA 3QYGB 3F70A 4LE9A 1VQ4A 3OYHA 3TEEA 2PTKA 2FRWA 1ZA2B 2EGCA 3PMTA 2P4RA 4BI8B 5LJ5d 2RHXA 3A8MB 3ULRB 3ME9A 1LCKA 4A53A 2HKNA 1VQ6Q 1GBRA 1WPYA 3MO8A 1WYXA 2BUDA 1VQOA 1KC8C 4HCBA 3GIBA 4J8OA 5GJVB 2XU8A 2NUPB 1YJWT 2E3HA 5IH2A 3OYFA 3CMAQ 3SDZA 3UF4A 4C8QC 2QK0A 4FYYB 3VS4A 4C5GA 1PRLC 1RL2A 3I56T 3CCJT 4E7JA 3NTKA 3RBBB 3RMQA 1KQ2A 2V1QA 5CQXA 2JUFA 4WF2A 4E7ZA 3L2ZA 2KXDA 2MWPA 2W10A 1X43A 3JSCA 3MEAA 3QG1A 4PJOA 3CBMA 1C6VX 3MHXA 4ESRA 3CCUQ 4M4ZA 1MHNA 2ZPFB 1M1GA 2K5IA 2LDMA 4MZMA 4C8QF 3CMEA 2DL8A 3QPHA 3G4SA 1TH7A 3RESA 2E6ZA 2BKDN 1M1FA 1QVFA 4JRKA 3CCLQ 1YHQQ 1SHFA 2DX1A 1E6GA 4OGCA 3HTRA 3ASKA 2HSPA 1X6GA 1PG5B 4M78G 3CCQQ 2VXFA 3VS0A 2Y4YA 2DL5A 2JJ9A 4VUBA 3M58A 2LX9A 3FC3A 3FLGA 1KSWA 1M90U 1G3WA 3VYGA 5IXBA 2DIGA 1H3HA 5GANe 3OS5A 4DA4A 1R0BG 2DRKA 3G4SQ 4M78B 1YBYA 4J9EA 4E7HA 1IZ6A 2EQUA 5L8RE 3EG2A 2M02A 3CCLA 3TU4K 6AT1B 4JS5A 1XTDA 2M0YA 5FU7B 1YNZA 2E1HA 2AK5A 5DLQE 4PJNA 5KH6A 3M59A 3SB2A 3I56Q 2RD1A 1PHTA 3LH5A 1YIJQ 1FMVA 1G3TA 1K9MU 2RQWA 1WQ7A 2AZSA 1H8KA 3V8KA 4EIKA 4RTZA 2EW3A 5GAMg 2RQUA 3VS5A 3EH1A 5GAN6 2X4XA 3L2QA 1UG1A 4OMFB 1WXTA 3A8HB 4C8QA 1VQ6T 1PD1A 1ZUUA 5LJ3f 3VJPA 4JZ3A 4Z02A 2E70A 2RI5A 3QWXX 3EHRA 1QP3A 2GFUA 4EMHA 2ROTA 4F7UF 1BCMA 3PIOA 4C8QG 3I35A 2RJDA 4N0AA 3VS6A 1WXBA 2AKLA 3DLMA 3DLLA 1QVFS 3VYHB 4RTWA 5GAMj 2EKOA 4MZTA 1KD1U 3V8LA 4QT7A 4XQ3A 1GFCA 2E10A 2WACA 2KGTA 1VIEA 5DLOA 1JJ2S 4LDVA 3CBPA 4FT4A 4RUGA 4HKEA 1RACB 4HVUA 2KDSA 1BI3A 1ZSGA 2JNGA 2MAMA 3LX7A 4C5HA 1KG1A 2RHUA 2L0AA 4FW1A 2FPDA 1VQ8A 2KNBB 3RUXA 4DBQA 1RABB 1AWXA 2VV5A 1K8AU 4M7DE 2MI6A 2BE7D 4JRIA 3LLRA 3C95A 1MUZA 2RHYA 2H3EB 2O01E 4D8DA 5GAOp 2RMOA 2EBPA 1VUBA 4JS4A 2A37A 2KE9A 3JV3A 4AT1B 5KE2A 4Y91A 3REBB 1UJYA 1WHKA 3JRZA 2DXCA 3BW1A 1N9RA 3GNGA 2DERA 2J7IA 1YJ9T 1M3CA 5LJ3d 1RAAB 3SD4A 5GMKi 3AHUA 1RAGB 4N4GA 2CP6A 3OW2S 1KD1C 2QEXQ 3VU3C 5LJ5g 1M5Q1 1D3BA 2K57A 1VQOQ 4J9BA 1GBQA 1VQMA 9ATCB 3X20B 4R0KA 4C8QE 4IIOA 4XTWA 1ABOA 2XI9A 3OS0A 5GAN2 1Y7XA 5GANh 4M7DA 1BCOA 1I0CA 2VB6A 4O6JA 3R6OA 2A36A 2VASA 3UA6A 4FT2A 5C0MA 5KYXB 2CREA 1JXMA 2JN0A 3C4SA 3M55A 1RAEB 4XU1A 4ANJA 2LJ3A 4M75A 2M1HA 5AYFA 2RK1A 3H0HA 3MP6A 3OYMA 2JZ2A 3A8GB 4ZGDB 1VA7A 1Q7YR 3CCET 5IHKA 4OB1B 3EGXB 1SEMA 4OP0A 1ZUYA 5FWCA 1FMKA 3CEYA 1SSFA 3CMEQ 4QQGA 4J9IA 4A63B 4C0FA 3CBOA 1UUEA 3CPFA 2QXFA 4FU6A 5GAOn 5KCOA 3HP9A 4ME7A 4M7DC 4FM4B 5GAN8 3SWNB 3JB9D 2E41A 2FB7A 4OB2B 2XMFA 4J9GA 3I5SA 1VQNQ 4JLIA 4JUVA 5I21A 3OYDA 3MJXA 2FVUA 1Y96A 2GFAA 4M78E 1K9MR 2L3RA 4C92G 2DYBA 1IREB 2IPOB 3VUZA 1HD3A 4OMNA 1UGVA 4PLIA 2E65A 1JEGA 2F2XA 4PK4A 4ORZA 2MF2A 4RTUA 1YWPA 1RAHB 1TUGB 5D6WA 3VS1A 5I22A 2D1XA 1R77A 1TUDA 3FIFA 4PJMA 2EYXA 1Y07A 2LVMA 2L3SA 4OF1A 3CC2T 1AD5A 1SF9A 3VRYA 2K7AA 1MV0B 1OI1A 1RUWA 1JJ2P 3HKSA 4AFZC 4IUPA 1KJWA 3CCEA 4ELYC 3RERA 4KT0E 3ZBDA 5GANd 5DY9A 4BY6B 2MOXA 4KUIA 4M75D 1S72A 4OMLA 1K0SA 1K73U 2DYIA 5CAIA 4GLKA 1M2OA 1UJ0A 1U1SA 3GNFB 3C0CA 3G4ST 2YUOA 2CT4A 3OQ5A 3CC4A 3CCEQ 2RI3A 2DPPB 2EQJA 4KGXB 2Y4XA 3JCMf 4C8QD 1FWZA 5J3BA 4F16A 3CPWP 1GCQC 2YRCA 1JJ2A 1QCFA 1Z9QA 4DOWA 4BDZA 2YWWA 1VQKA 1WLPB 2E3IA 2ZPGB 4PJOC 5EG2A 2LQWA 1YP5A 4C92C 4Z89A 4M75E 3RKYA 1C0MA 2EJ9A 2NYSA 3E9FA 1TXQA 2DILA 1MMAA 3URGA 2XDPA 2F69A 4KBMB 2ZPHB 4QVDA 3I55A 3CCJA 2O88A 1Q86C 4PFZA 2MK5A 2E6NA 2DKGA 1UTIA 3OY9A 4N0AC 1B07A 4BE2A 1YN8A 2CP5A 1PC0A 3ER0A 2R58A 3UT1A 3M54A 3PE0A 3NPFA 3HPWA 3X24B 3EFOB 2EIFA 3MEVA 1CSKA 4A54A 1Y0MA 4DOVA 2QEXA 4OMMA 3JCMW 4PNOA 4P5NA 3VS7A 4C8QB 1OU9A 2GTJA 1SRLA 3OS1A 3KBGA 2DL7A 4ZN3A 1D0YA 1O75A 5GAN5 4LDWA 3UPUA 1G3SA 3JCMX 4XK8E 2QYZA 4PJOG 3M0TA 2D8JA 3E1SA 3SHWA 3ZFJA 3ZEHA 3OS2A 3JB9F 4MDWA 2EQMA 1ZSZC 1HXDA 2J06A 4ZNXA 2CUDA 1B7TA 2FZCB 2DF6A 1VQ5T 4E7LA 3L2WA 1BIBA 1WXUA 1RAFB 3I9QA 2PQWA 2DBKA 4HCCA 1TG0A 3QZ5B 1PD0A 3CMAA 1VQMT 5KYUA 5KYXA 2VGMA 4QVZA 1T0HA 1QKWA 4BACA 4BI4A 3G6ET 2O4XA 4JLGA 5GMKh 3N5BB 4F7UG 2MCNA 4RMOA 1QCNA 4PJOE 1Q81R 2WSCE 5DM7R 2YHTA 2QEXT 2EQIA 2X51A 3LH0A 2L3PA 2L3QA 2M51A 3GOXA 4CRIA 2K79A 1W2BS 2FZKB 3M0PA 2RHIA 2KQWA 3JCMh 4AFUC 1K9AA 1AEYA 2FPFA 3EHQA 3E9GA 4AMCA 1OZ3A 2PNIA 5A0DA 3MP1A 3JCMQ 4NL3A 2OTJA 2LTOA 5LL6S 2B8AA 2VGNA 2LCCA 2ZPBB 5HCKA 3V7SA 2O9SA 4EPCA 1RADB 5FU7C 5J26A 2DTHA 3OMCA 3A98A 4A4FA 2VXEA 2RQVA 4LD9K 4E7KA 2AKKA 4WCIA 3FB9A 1YJ9Q 1U1TA 4A4HA 1XQHA 1NZ9A 1VQ7T 2CYZB 1Q81U 4RCCA 2EWNA 1NBEB 2DBMA 2OTJQ 1OPLA 4CC2A 3WXMB 2QA4T 2DAQA 4MMKA 1PM3A 5CR2A 1K1ZA 1UHCA 1KFZA 5KCHA 2J6FA 1M1KR 4J6XA 1D1CA 2PU9B 1YJ9A 2DTOA 2LMJA 4R55A 1XNIA 2P4TA 1M8MA 1QLYA 3CXCS 5D6YA 4M7AB 5GAOr 4KULA 1VQLQ 2QDYB 4KH0B 4F7UB 3QSUA 3M4YA 3M9QA 1NM7A 4Z88A 2YLCA 1Q81C 3RIRA 3X25B 3V7CA 2RQTA 2HL5C 2QTXA 1ARKA 1V29B 4HXJA 4Y28E 2YSQA 1NG2A 4F7UE 1A0NB 3WVEB 5FLXE 1UEBA 1UGSB 3HFNA 1G83A 2RQRA 5GJWB 3EGUA 1OZ2A 2V8JA 1Q7YU 2FPEA 3CCQT 3RMSA 2CT3A 3V7RA 2IIMA 1KC8R 1MV3A 3PT9A 4BB7A 1YJWA 2IG0A 2K9GA 1I07A 1JXOA 1RLQC 4J83A 2DA9A 4E7SA 2L5QA 2DE0X 4J7IA 4PJJA 3EG9A 1UGRB 2D6FA 4V2SA 2P0KA 3PGGA 4N4IA 1M27C 2KRSA 1GFDA 2X4JA 1UECA 1NEGA 5KYNA 1RAIB 5LJ3j 4J6WA 2V1RA 3RNJA 1V76A 3HSBA 3VS3A 2E5KA 1VQPA 4Z8AA 4KGZB 1N8RR 2XDDA 3OMGA 3TQ7P 4B9WA 5IHIA 4M7DD 4M7AD 1BYMA 4IUUA 2YT6A 1AZEA 2F5KA 3NTHA 4FIBA 4DBRA 1K4US 2JM9A 3GF5A 3O5ZA 2JTFA 2GGRA 3PVQA 4PKCC 2JMCA 3QXEB 2WSEE 5GAMf 1S72T 1K9MC 3META 2OAUA 2PZ1A 1TSFA 2P0PA 1NYGA 2FRYA 2C0OA 1X6OA 3DKMA 4M7DG 1BKBA 3M4GA 4OVAA 1T0JA 3BDUA 2KVQG 3M0QA 1VQPQ 5FRNA 5CIUA 7AT1B 2CZ6B 5LJ3g 4OB3B 5FROA 3QHSA 4UC4A 4D6WA 2EPDA 4DQ2A 3REAB 3M0SA 1EIFA 4OGEA 4F17A 4QVCA 1S1NA 4LDYA 1K8AR 3VUBA 4HCZA 4C0DC 1ZBJA 5GMKm 2DVJA 1YJNT 3CCLT 2P0QA 5KE3A 2RK2A 3M0UA 4BD3A 3VKIA 2NUPA 3FJ5A 4C5EA 1JQQA 4F04B 1OULA 2BZXA 4HVVA 1FXXA 1X2KA 1I4K1 5HKCA 2FZGB 3CMAT 2OI3A 5HK0A 3L2RA 3OA6A 1Q82C 4HCKA 2BZYA 3VS2A 1TWBA 3O8VA 5KYUB 2DO3A 2YUNA 5A0LA 3EG9B 1QMCA 2JM8A 2C0TA 1N8RU 3CCST 3EG0A 4M77C 3KFVA 1QVGP 4HT9A 2DETA 4RCBA 4X9CA 4E7IA 1VYTA 2ZPEB 4IURA 3M53A 2HNIA 2YRVA 1N27A 1KQSS 4C0DB 3E2UA 4AG2C 4XTZA 4EMKB 2KBTA 2K5FA 2RH2A 1F1BB 1I81A 2LC4A 3C94A 5A0GA 3V8JA 1YITA 4NL2A 2RF0A 2VVKA 2K3XA 4PJOF 1YI2Q 2K2MA 5GAMe 2RM4A 3EFOA 4M7AA 5CCAA 1QWFA 2A08A 2LRQA 1VQ5Q 2DRMA 2KYBA 1BU1A 4AFQC 3CD6A 2DIQA 5CKHA 3CCUA 3HRSA 2K2VA 2XD0A 1T3SA 4BY6C 3CXCP 2XIDA 2OX7A 1WX6A 2KI7A 4TVRA 3LYIA 3OSSC 4F14A 2HBWA 2O2OA 8ATCB 4J9HA 1YIJT 1SG5A 2MYSA 5CK9A 1YHQA 2LNVA 1VQ5A 3QDFA 4LUEA 2DXUA 4A4GA 4M7DF 2F1LA 2GNCA 2LJ1A 2OTJT 4KH1B 2LT4A 4CC4B 3GBQA 1AHJB 1H641 1VYUA 3M5AA 4M7AE 2KR3A 3CC7T 4M75C 4NOYA 4M77B 3CD6T 1VQLA 2DJZA 3X26B 1KC8U 2BTTA 3H0IA 2E12A 1J3TA 2M0OA 3KUFA 4L59A 3GLXA 1AVZC 2DL4A 2JS2A 2ROLA 3M0RA 1IHWA 4C92B 4J9FA 2MMPA 1BIAA 1YIJA 2NLUA 2DD5A 2V8KA 4M77G
chains in the Genus database with same CATH topology
1M1KC 3OY9A 3J81E 3DB3A 2DXTA 2M16A 4N0AC 4GY5A 4LD6A 4BE2A 3OYFA 5CVIA 3GP8A 2DEQA 3ER0A 3SDZA 3CC4T 2R58A 1JB0E 4C8QC 3UT1A 4O5VA 1U8RA 3M54A 3GPLA 3HPWA 3X24B 3P8BB 4C5IA 1B34B 2EIFA 4C5GA 3MEVA 1RL2A 3I56T 3CCJT 4A54A 2PVDB 3DB4A 4E7JA 3PFSA 4DOVA 4RG8A 3FEOA 4N4HA 2QEXA 3NTKA 4QQDA 3RMQA 3SFMA 1DJ7B 1KQ2A 3JCMW 4PNOA 5CQXA 2JUFA 4WF2A 5I2MA 4P5NA 3OW2A 3L2ZA 3OYGA 4PJOD 4C8QB 2MWPA 3OYKA 3L2UA 4XU3A 4J5YA 4C92D 2D9TA 3JSCA 3MEAA 3OS1A 3KBGA 3QG1A 4PJOA 4ZN3A 1VQ8T 1D3BB 1O75A 3CBMA 2HD0A 5GAN5 1VQ9T 1UGQB 3OSVA 4LDWA 3MHXA 4E47A 3UPUA 3TCJA 4JDSA 2QQ9A 1G3SA 3JCMX 1MHNA 2ZPFB 4XK8E 1M1GA 2K5IA 2LDMA 4MZMA 1KQSA 1GXIE 2QA4A 2RJEA 4OB0B 3QPHA 4PJOG 2QQSA 4C92F 2FHDA 4C8QF 3CMEA 3G4SA 2DXBA 4C0ZA 1TH7A 3E1SA 3LGFA 3RESA 1LOJA 3ZFJA 3ZEHA 1X01A 1O9SA 2E6ZA 2BKDN 1M1FA 2EQMA 3M56A 4MDWA 5GMKj 1HXDA 1QVFA 4JRKA 1Q82U 3CC7A 3HL8A 2XDBA 3CCSA 4ZTJA 4OGCA 3ASKA 3NTIA 2R5MA 3QYHB 1VQ5T 2VYTA 4E7LA 3FRNA 4M78G 3L2WA 4BE0A 1BIBA 1Y96B 2VXFA 1QVGS 2Y4YA 4L6V5 2PQWA 4M7AG 3E19A 4B9XA 4MDXA 2EFIA 3CMAT 4HCCA 4VUBA 2QQRA 3M58A 3QZ5B 4C92A 2LX9A 3FC3A 3OBYA 2AHJB 3FLGA 3CMAA 1VQMT 2RA2A 2KAFA 1M90U 1G3WA 1ZQ1A 3VYGA 3M57A 2DIGA 2VGMA 4QVZA 5GANe 3OS5A 2CZ1B 4DA4A 1M8VA 3FJPA 4BACA 4BI4A 2HBPA 4M78B 1YBYA 3BDLA 3G6ET 1IZ6A 2DD4A 4E7HA 3JCMg 2EQUA 4RKUE 2O4XA 3QUIA 4JLGA 4QQ6A 4XU2A 1HK9A 5L8RE 5GMKh 3JCMV 3CCLA 2M9UA 3N5BB 3PMIA 4RG2A 4F7UG 3TU4K 4JS5A 1XTDA 1WJQA 4RMOA 2EJGA 3UWNA 2O4XB 4PJOE 2H3JA 1VQ6A 1K73C 4HT8A 2WSCE 5FU7B 5DM7R 2E1HA 2YHTA 2LQ8A 2QEXT 1N8RC 5DLQE 5D6XA 5KH6A 3M59A 3SB2A 3JAME 3JB9H 4EMKC 3L1AA 3LH0A 2RD1A 4LDXA 1G3TA 1WGSA 4PL6A 4CRIA 3GOXA 1K9MU 1W2BS 2X4YA 4M77A 3CCRT 2RHIA 2KQWA 2LQKA 2VC8A 3JCMh 2RO0A 1OYXA 1WQ7A 1BI2A 3J80E 2ZCFB 3V8KA 1M1KU 3JCMe 4EMGA 5GMKl 4HA8A 4MZPA 5GAMg 3CCRA 5FU6B 4IKFA 3CXCA 2ZZDA 3E9GA 4ATOA 1OZ3A 2GQVA 1YI2T 5A0DA 1R8OB 3MP1A 3JCMQ 2GF7A 4NL3A 5GAN6 2DTIA 2OTJA 2X4XA 3L2QA 2LTOA 2A3LA 4OMFB 2KSSA 5LL6S 3CPWA 2B8AA 2XK0A 3A8HB 4C8QA 1VQ6T 2VGNA 5LJ3f 2BIVA 2LCCA 2ZPBB 3VJPA 3V7SA 4Z02A 1MGQA 4C5HA 2E70A 2DVEA 2JVVA 4EPCA 5FU7C 5J26A 1RI0A 2DTHA 2RI5A 3OMCA 3QKJA 1H3ZA 3KXTA 1YJWT 5I2SA 3OB9A 4A4FA 2VXEA 3RKXA 1QP3A 2GFUA 4XTVA 4LD9K 4E7KA 3S3MA 4R56A 4EMHA 3H8ZA 4F7UF 2OTLT 3FB9A 3PIOA 1U1TA 4A4HA 2QQBA 1XQHA 4C8QG 2RJDA 3JCMd 4BI3A 3MEWA 1NZ9A 2E6NA 1VQ7T 2CYZB 1Q81U 4N0AA 4RCCA 2EWNA 3DLMA 4A4EA 4M7DB 3DLLA 1QVFS 1YI2A 1UGPB 3VYHB 5GAMj 3LW5E 2EKOA 4YTLA 3WXMB 4MZTA 3BFMA 4QW2A 1VQ4T 2QA4T 4JRPA 3V8LA 2DAQA 1KD1U 4XQ3A 2XG8D 4MMKA 2PVOB 5CR2A 2E10A 5GAN3 2WACA 4C0GA 1YCYA 4PJOB 3OYYA 3CPWS 1VIEA 5KCHA 5DLOA 2MWOA 1JJ2S 1QVGA 4LDVA 5LJ3e 1KQ1A 1UB4A 3CBPA 4FT4A 1YITT 5GAN7 4HKEA 2G3RA 1LJOA 2KDSA 1BI3A 2JNGA 2MAMA 2Y90A 3LX7A 3QIIA 4J6XA 2PU9B 2CZ7B 2KMTA 2RHUA 3OYCA 1YJ9A 1KG1A 4IUVA 5GAOl 2DTOA 2I2LA 2L8DA 4R55A 1YHQT 2LCLA 3UDCA 3OYLA 3JB9G 3RUXA 1VQ8A 1XNIA 2P4TA 2VUBA 5LJ5j 3CXCS 2VV5A 1K8AU 5D6YA 2EAYA 4M7DE 4M7AB 5GAOr 1FX7A 2MI6A 4KULA 1PSEA 3JCMJ 2HAXA 3G7ZA 4JRIA 5CKDA 2QDYB 5GMKe 5GAOq 3LLRA 5GAMh 3C95A 1PSFA 4F7UB 2C06A 2RHYA 3QSUA 3M4YA 2O01E 3A8LB 3G71T 1BI1A 5GAOp 1G5VA 1VUBA 1Y71A 1VQOT 3HHTB 1KHIA 1M9SA 3M9QA 3MEUA 2YLCA 4JS4A 3QJ6A 3LWIA 1Q81C 1I5LA 3RIRA 3X25B 5KE2A 2E5QA 3EFRA 3V7CA 4M78C 4Y91A 2QTXA 1V29B 4Y28E 3I56A 3JRZA 2DXCA 5LJ3h 3WVEB 4F7UE 4M7AC 5FLXE 1UEBA 3PTAA 3BW1A 1UGSB 3HFNA 1N9RA 3GNGA 3CCVT 3HRTA 2QI2A 1OZ2A 2V8JA 3BY7A 3CCQT 1Q7YU 3RMSA 2KK4A 4Q5WA 3V7RA 1YJ9T 3PT9A 4BB7A 1YJWA 2IG0A 3MP8A 4J83A 5LJ3d 4M77E 4XTXA 5CQYA 3SD4A 1KHCA 5GMKi 3C12A 2L5QA 2DK3A 2FL7A 1LNXA 2HQXA 3AHUA 4N4GA 4J7IA 5M9OA 3EAEA 3OW2S 1KD1C 1VQLT 2L89A 1UGRB 2D6FA 3VU3C 5LJ5g 3JCMb 4V2SA 3FDRA 2P0KA 2CS7A 1M5Q1 1D3BA 3PGGA 1ZBXA 2K57A 4N4IA 4M77F 3PIPA 3A8OB 2X4JA 5GAOm 1VQMA 2CGHA 3HFOA 1JBMA 3X20B 4C8QE 1VQNT 4XTWA 4XU0A 3I55T 5LJ3j 4J6WA 2XI9A 3HRUA 3OS0A 4J7FA 5GAN2 1Y7XA 5GANh 4M7DA 3HSBA 2XHCA 2RHZA 3Q1JA 4M78D 2X35A 4O6JA 1VQPA 3R6OA 1VQKT 3PNWC 5FRMA 4A4KA 2XDDA 3OMGA 4BUGA 4EMKA 4B9WA 4F7UA 4M7DD 4M7AD 4FT2A 1BYMA 1VQ9A 4IUUA 5C0MA 2F5KA 1X75C 4ELZC 1VIFA 3NTHA 3SWNA 4IUTA 4ZGEB 2JN0A 3C4SA 4FIBA 3VV0A 3M55A 3RKWA 3CMET 4XU1A 3GF5A 3OBWA 3TREA 2JTFA 4PKCC 4XTUA 2YLBA 1NJIC 3QXEB 2WSEE 4M75A 5GAMf 1S72T 2M1HA 1QW1A 3LGLA 5AYFA 2KY9A 1W4SA 2R57A 2RK1A 1K9MC 3META 3MP6A 3OYMA 2OAUA 2JZ2A 4PLLA 2P0PA 3A8GB 5LJ5h 2CKKA 3DKMA 1X6OA 3QJYA 4ZGDB 1NPPA 4M7DG 3WVDB 1BKBA 3M4GA 3P8DA 3INZA 3NFCA 4OVAA 3BDUA 3CC2A 2KVQG 3CCET 5CKFA 5FRNA 5CIUA 2CZ6B 4OB1B 3EFSA 4OP0A 5LJ3g 4OB3B 5FROA 3QHSA 3CEYA 4UC4A 3CCVA 1SSFA 4NS5A 3G71A 4JRQA 4D6WA 4QQGA 1NE8A 3OYIA 2D0QB 4DQ2A 4C0FA 4EDUA 4M77D 3CBOA 4L5GA 5HK3A 1EIFA 3CPFA 1I8FA 2QXFA 1JRIA 4FU6A 4OGEA 4QVCA 5KCOA 4M75F 5GAOn 4X9DA 3HP9A 4ME7A 2X4WA 3JB9F 4M7DC 5GAN4 4FM4B 4LDYA 1N6AA 5GAN8 1P92A 3SWNB 3JB9D 3VUBA 1K8AC 4HCZA 4MMLA 4C0DC 5IAYA 4LDUA 5GMKm 3LWHA 2E64A 1YJNT 2E41A 2FB7A 4OB2B 1BI0A 2K5LA 3CCLT 5HY6A 2P0QA 5KE3A 3OYBA 2RK2A 5FU6C 4BD3A 4JLIA 4JUVA 1NJIU 5I21A 1W2BA 4ZGJB 3OYDA 3VKIA 5GANg 3G6EA 4KUDK 4ZN1A 4C5EA 2FVUA 1Y96A 3CCMA 1FXXA 2GFAA 1I4K1 4M78E 4XAXB 1B34A 5HKCA 1NPRA 5HK0A 2FYKA 2L3RA 3L2RA 4C92G 3OA6A 1Q82C 1IREB 2IVWA 5GANf 3S3NA 2RI2A 3O8VA 2DO3A 3VUZA 5A0LA 3L2VA 2RB6A 2PUKB 2XICA 4FSXA 4II1A 1N8RU 3S6WA 3CCST 4J6YA 5C6SA 1WJRA 4HT9A 4M77C 4PLIA 2EJFA 2E65A 4ZTFA 4RCBA 1ZHIA 3QO3A 4X9CA 2CZ0B 2DZCA 2MF2A 4M7AF 4C92E 4E7IA 2XKOC 2JOYA 2ZPEB 4IURA 4M75G 5D6WA 4M78F 2QQAA 2HNIA 3M53A 2YRVA 1Q7YC 2EQKA 2PVGB 1N27A 2PUOB 4FL6A 1KQSS 3J7AF 4C0DB 1QP2A 3JB9J 3FIFA 4XTZA 4EMKB 5LJ5f 1YJNA 2K5FA 1Y07A 3OS2A 5GANj 2RH2A 2LVMA 5IT9E 1I81A 4OF1A 3CC2T 2LC4A 3C94A 5J39A 3OYEA 5A0GA 1WJSA 3V8JA 3P8HA 3S3OA 4NL2A 3JCMP 1YITA 4JJNK 2K3XA 4M78A 4PJOF 3OYAA 2ZPIB 3T9NA 5GAMe 2RM4A 2V8IA 1OI1A 5CCAA 4M7AA 2LRQA 1WNLA 1G3YA 3HKSA 4IUPA 2RJCA 3CCEA 2LT1A 4ELYC 3OYJA 4KT0E 3RERA 5CO7A 3ZBDA 4XTYA 5GANd 5DY9A 4BY6B 3CD6A 2DIQA 3JB9I 4KUIA 2EYQA 2HQEA 5CKHA 3CCUA 3QBYA 4M75D 3HRSA 3OYNA 2K2VA 2XD0A 4BY6C 4BE1A 1S72A 4BDYA 2XIDA 2A7YA 2F5TX 3X28B 1Q86U 1M90C 2WSFE 4TVRA 5A2QE 3LYIA 3OSSC 4IUQA 4CI0C 5LJ5e 3QZ9B 1K73U 5CKBA 1YIJT 5CK9A 5CAIA 4GLKA 1YHQA 2LNVA 2K4YA 4M75B 1U1SA 3GNFB 5CKEA 3L42A 1VQ5A 3G4ST 1QVPA 3OQ5A 3CC4A 2ZGWA 2DXUA 3A5ZB 1M4ZA 4A4GA 4M7DF 3MCAB 2RI3A 2DPPB 3SWNC 2EQJA 2Y4XA 3CCMT 2OTJT 2RJFA 2R5AA 3JCMf 3JCMc 3QDRB 3H6ZA 4C8QD 1VQ7A 2LT4A 5IN1A 1FWZA 2K3YA 1VQNA 5J3BA 1AHJB 1H641 1JJ2A 4DOWA 2OTLA 1N9SA 3QYGB 3F70A 3M5AA 4BDZA 1VQ4A 1VQPT 1VQKA 3OYHA 3TEEA 4M7AE 1WQWA 3CC7T 2ZPGB 4M75C 4NOYA 3PMTA 4M77B 2GCXA 3CD6T 5GAMd 4PJOC 4BI8B 2DJZA 5EG2A 3X26B 2RHXA 5LJ5d 3A8MB 1KC8U 1VQLA 2E12A 2DZ9A 4C92C 3ME9A 4X34A 2JTMA 4M75E 4A53A 3RKYA 2M0OA 3KUFA 4L59A 2EJ9A 3GLXA 1WPYA 3E9FA 3MO8A 2BUDA 1VQOA 1KC8C 3URGA 4C92B 2XDPA 4HCBA 3GIBA 2F69A 4KBMB 3CCQA 2ZPHB 4J8OA 2MMPA 4QVDA 3CCUT 2XU8A 1XOVA 3I55A 3CCJA 1BIAA 1YIJA 2NLUA 1Q86C 2DD5A 2V8KA 2DKGA 4M77G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RCB A;  3QO3 A;  4X9C A;  3AHU A;  4EMG A;  2DXT A;  5GMK l;  4N0A C;  3JCM e;  2DZC A;  4HA8 A;  5GAM g;  4C92 E;  4M7A F;  3VU3 C;  5LJ5 g;  2DEQ A;  3JCM b;  1M8V A;  4V2S A;  1M5Q 1;  4C8Q C;  1D3B A;  4M75 G;  3PGG A;  4M78 F;  2K57 A;  2HNI A;  4M77 F;  5GAO m;  3JCM Q;  4NL3 A;  2CGH A;  2DTI A;  5GAN 6;  1B34 B;  3HFO A;  1JBM A;  3JB9 J;  4C8Q E;  3FIF A;  4XTZ A;  4XTW A;  4XU0 A;  4C8Q A;  4EMK B;  5LJ5 f;  5LJ3 j;  5LJ3 f;  4J6W A;  5GAN j;  4A54 A;  1LNX A;  5GAN 2;  1I81 A;  3V7S A;  1MGQ A;  5GAN h;  2DVE A;  4M7D A;  3HSB A;  2DTH A;  4M78 D;  1KQ2 A;  3JCM W;  4PNO A;  3V8J A;  4WF2 A;  4NL2 A;  3JCM P;  3L2Z A;  4M78 A;  4PJO D;  4PJO F;  2VXE A;  4C8Q B;  4EMK A;  4F7U A;  3RKX A;  4M7D D;  4M7A D;  4XTV A;  5GAM e;  2RM4 A;  4XU3 A;  4J5Y A;  4C92 D;  4M7A A;  4EMH A;  3SWN A;  4F7U F;  4PJO A;  3FB9 A;  1WNL A;  1U1T A;  2JN0 A;  1D3B B;  2E65 A;  4C8Q G;  5GAN 5;  3JCM d;  3RKW A;  3RER A;  4XU1 A;  3JCM X;  4XTY A;  5GAN d;  4N0A A;  5DY9 A;  4RCC A;  2EWN A;  2YLB A;  4XTU A;  4M7D B;  3JB9 I;  4C8Q F;  4M75 A;  4PJO G;  4C92 F;  5GAM f;  5GAM j;  4M75 D;  3BFM A;  1TH7 A;  3RES A;  1LOJ A;  3V8L A;  3JB9 F;  1X01 A;  5LJ5 h;  4XQ3 A;  5GMK j;  4MMK A;  4M7D G;  1HXD A;  2E10 A;  5GAN 3;  4JRK A;  4PJO B;  1YCY A;  3M4G A;  3INZ A;  3BDU A;  5LJ5 e;  3EFS A;  4OP0 A;  1KQ1 A;  5LJ3 e;  5LJ3 g;  3QHS A;  5GAN 7;  4M78 G;  1BIB A;  1LJO A;  1Y96 B;  5CAI A;  2VXF A;  4DQ2 A;  2Y90 A;  4M77 D;  1U1S A;  4J6X A;  4M7A G;  5GAO l;  2DTO A;  2I2L A;  2DXU A;  2ZGW A;  4M7D F;  1I8F A;  1JRI A;  5GAO n;  4C92 A;  3RUX A;  3SWN C;  4M75 F;  4QVC A;  4X9D A;  3JB9 G;  4M7D C;  5GAN 4;  3JCM c;  3JCM f;  5LJ5 j;  2RA2 A;  3SWN B;  4C8Q D;  2EAY A;  5GAN 8;  3JB9 D;  4M7A B;  4MML A;  5GAO r;  5GMK m;  3JCM J;  4M7D E;  5GAN e;  4JRI A;  5GMK e;  2E64 A;  3FJP A;  5GAO q;  2E41 A;  2FB7 A;  5GAM h;  4F7U B;  1H64 1;  3QSU A;  4M78 B;  5GAO p;  3JCM g;  1N9S A;  1I5L A;  3QUI A;  2YLC A;  4XU2 A;  4JLI A;  1HK9 A;  4JUV A;  5GMK h;  3RIR A;  3JCM V;  5I21 A;  5GAN g;  4M7A E;  3EFR A;  4F7U G;  3V7C A;  1WQW A;  2EJG A;  4M78 C;  2QTX A;  4Y91 A;  1Y96 A;  4M75 C;  4NOY A;  4PJO E;  4M77 B;  4HT8 A;  1I4K 1;  4M78 E;  5GAM d;  1B34 A;  2DJZ A;  5LJ5 d;  4F7U E;  2FYK A;  5LJ3 h;  4PJO C;  2E1H A;  2YHT A;  4C92 G;  4M7A C;  2DZ9 A;  3BW1 A;  3HFN A;  1N9R A;  3SB2 A;  4C92 C;  4M75 E;  4A53 A;  5GAN f;  3JB9 H;  4EMK C;  3L1A A;  3RKY A;  2RD1 A;  3BY7 A;  2EJ9 A;  1WPY A;  3V7R A;  4C92 B;  4M77 A;  2RB6 A;  5LJ3 d;  3GIB A;  4M77 E;  4XTX A;  4QVD A;  2VC8 A;  3JCM h;  4J6Y A;  5GMK i;  1WQ7 A;  1BIA A;  4HT9 A;  4M77 C;  3V8K A;  4M75 B;  2EJF A;  2DKG A;  4M77 G; 
#chains in the Genus database with same CATH topology
 1M1K C;  3J81 E;  3DB3 A;  2DXT A;  2M16 A;  3GP8 A;  2DEQ A;  1IGQ A;  3D7S B;  1D0X A;  3CC4 T;  1JB0 E;  1S72 Q;  4O5V A;  2NUT A;  3P8B B;  4C5I A;  2PVD B;  1YWO A;  3FEO A;  4N4H A;  4QQD A;  3SFM A;  1C1A A;  4JJB A;  2FEI A;  5I2M A;  1MNE A;  2LNH B;  3OYG A;  2KXC A;  3CC4 Q;  3OW2 A;  1AOJ A;  3OYK A;  3L2U A;  1PKS A;  4XU3 A;  4CC3 A;  2HKQ B;  1IHV A;  2D9T A;  3A1P A;  1VQ9 T;  4DBH A;  1UGQ B;  2AT1 B;  3TCJ A;  2QQ9 A;  2ECZ A;  3TVT A;  4JJC A;  1GXI E;  2QA4 A;  4OB0 B;  3G71 Q;  1IRX A;  2QQS A;  2KYM A;  1M3A A;  1ZLM A;  4FYV B;  3LGF A;  1X01 A;  3M56 A;  3RR6 A;  1Q82 U;  3CC7 A;  1WHG A;  2XDB A;  2R5M A;  1NLP C;  3FRN A;  1LPL A;  1Y96 B;  2YUQ A;  1QVG S;  4JZ4 A;  4L6V 5;  4M7A G;  2Z0W A;  3E19 A;  4B9X A;  2HEQ A;  4OMQ A;  2QQR A;  1EX4 A;  1CKA A;  2KAF A;  1WIE A;  1ZQ1 A;  3M57 A;  2QA4 Q;  1QQJ A;  1VQ4 Q;  2CZ1 B;  1M8V A;  3FJP A;  2D0N A;  2HBP A;  1PNJ A;  2DD4 A;  3JCM g;  3QUI A;  4XU2 A;  1HK9 A;  3JCM V;  4RG2 A;  1WJQ A;  5KYW A;  2EJG A;  1VQ6 A;  1K73 C;  1GL5 A;  2LQ8 A;  1N8R C;  2OJ2 A;  5D6X A;  1D1B A;  3JB9 H;  4LDX A;  2LZ6 B;  4IIM A;  2X4Y A;  2YXY A;  4M77 A;  2QGF B;  3EH2 A;  2LQK A;  2RO0 A;  1BI2 A;  2OAW A;  2ZCF B;  3J80 E;  1YJN Q;  1M1K U;  3JCM e;  1G8X A;  1TTH B;  3CCR A;  5FU6 B;  2ZZD A;  2A0F B;  4ATO A;  1MMG A;  1R8O B;  3SEM A;  2O9V A;  2GF7 A;  3RDV A;  2DTI A;  2SRC A;  1RLP C;  2JXB A;  2CSQ A;  2B86 A;  1WZO A;  1MGQ A;  2DVE A;  2JVV A;  1HSQ A;  2RN8 A;  1RI0 A;  3QKJ A;  4DEX A;  1TOV A;  5ECA A;  1H3Z A;  1M2V B;  5I2S A;  3OB9 A;  1ZA1 B;  3H8Z A;  3EG1 A;  4DEY A;  2LQN A;  3JCM d;  4A4E A;  4M7D B;  1YI2 A;  1UGP B;  2ABL A;  4YTL A;  2VKN A;  1VYV A;  3BFM A;  4QW2 A;  2DM1 A;  2XG8 D;  5IXF A;  2PVO B;  2CP3 A;  4PJO B;  4C0G A;  2HCK A;  1WFW A;  2MWO A;  1VQ7 Q;  5LJ3 e;  2KRN A;  2CSI A;  2HDA A;  2G3R A;  4JRP A;  2Y90 A;  2OTL Q;  2CZ7 B;  2KMT A;  3OYC A;  1QVF P;  4IUV A;  5GAO l;  2KT8 A;  3UDC A;  5KYY B;  3JB9 G;  2JTE A;  2RNA A;  1BK2 A;  5LJ5 j;  2EAY A;  2HAX A;  1PKT A;  1PSE A;  5CKD A;  5GAO q;  5GAM h;  2DNU A;  1G5V A;  2DLP A;  1Y71 A;  1VQO T;  3HHT B;  1M9S A;  1I5L A;  4D8K A;  1SHG A;  3LWI A;  1OOT A;  2E5Q A;  3EFR A;  1WDX A;  1IB8 A;  4M78 C;  3I56 A;  2DEU A;  4M7A C;  3CCV T;  3HRT A;  3CC2 Q;  3BY7 A;  1WHM A;  2CUB A;  3NHN A;  2DL3 A;  4XTX A;  5CQY A;  2KRM A;  3C12 A;  2DK3 A;  2FL7 A;  2HQX A;  2C0I A;  1UDL A;  1VQL T;  1N5Z A;  2L89 A;  3JCM b;  3FDR A;  2CS7 A;  1T3L A;  3PIP A;  3A8O B;  5GAO m;  2CGH A;  1AZG B;  1QKX A;  1JBM A;  2JT4 A;  1VQN T;  1D0Z A;  3I55 T;  2COZ A;  3HRU A;  4J7F A;  1KIK A;  2RHZ A;  1UE9 A;  5FRM A;  4LXC A;  1NYF A;  1AWO A;  1WHH A;  1ABQ A;  4BUG A;  4F7U A;  2QGG A;  1X75 C;  2CP2 A;  1VIF A;  4ELZ C;  3SWN A;  4IUT A;  4ZGE B;  1I1J A;  3RKW A;  3CME T;  4E6R A;  1NJI C;  1E7O A;  2KY9 A;  1W4S A;  1X27 A;  4PFO A;  1SPK A;  2CKK A;  3QJY A;  3P8D A;  3G6E Q;  1OEB A;  5CKF A;  3CCV A;  4JRQ A;  4NS5 A;  3G71 A;  1VQ8 Q;  1NE8 A;  2D0Q B;  2NUZ A;  4RTV A;  4FYX B;  1I8F A;  2X4W A;  4LNP A;  5GAN 4;  1N6A A;  1TUC A;  1K8A C;  4MML A;  5IAY A;  4LDU A;  1ZUK A;  2E64 A;  4DBF A;  1BI0 A;  2K5L A;  5HY6 A;  2QAS A;  5FU6 C;  3TSW A;  1W2B A;  4ZGJ B;  3G6E A;  5GAN g;  2COW A;  1OX9 A;  2LP5 A;  4AG1 C;  3CCM A;  1VQK Q;  2GTO A;  1B34 A;  1NPR A;  2FYK A;  1HJD A;  8AT1 B;  2J05 A;  2J6K A;  2RI2 A;  2JS0 A;  2HSE B;  3L2V A;  4OMP A;  2XIC A;  2JMA A;  4FSX A;  3S6W A;  4J6Y A;  5C6S A;  1WJR A;  2EJF A;  4ZTF A;  1PCX A;  1ZHI A;  4HVW A;  2DZC A;  1XJW B;  3QWY A;  4C92 E;  4M7A F;  1VQM Q;  2L2P A;  3U23 A;  4M75 G;  4M78 F;  2QQA A;  1Q7Y C;  2EQK A;  1Q86 R;  2PUO B;  1AWJ A;  4FL6 A;  3J7A F;  1SRM A;  3JB9 J;  1FMW A;  5LJ5 f;  1YJN A;  5GAN j;  5J39 A;  3OYE A;  1UFF A;  3S3O A;  2BE9 B;  4JJN K;  2ZAE A;  2ZPI B;  2CP0 A;  3T9N A;  2V8I A;  2EYW A;  2CH4 W;  2JW4 A;  1G3Y A;  1YFN A;  2LT1 A;  4WTO B;  4XTY A;  3JB9 I;  2HQE A;  3QBY A;  2CP7 A;  3OYN A;  4BE1 A;  4RTX A;  3X28 B;  2F5T X;  1M90 C;  4IUQ A;  3EG3 A;  5I11 A;  5CKB A;  2EYZ A;  1KD1 R;  2KT1 A;  5CKE A;  1W70 A;  1QVP A;  2F2V A;  1W6X A;  2ZGW A;  4FCY A;  3A5Z B;  1M4Z A;  1B3Q A;  1D1A A;  2P84 A;  3SWN C;  3CCM T;  2RJF A;  2R5A A;  3JCM c;  3ZL7 C;  2NUT B;  1VQ7 A;  2K3Y A;  1VQN A;  2NWM A;  1G2B A;  1MMD A;  4FW2 A;  1BBZ A;  2QG9 B;  2OTL A;  4K11 A;  2DJQ A;  3CQT A;  1VQP T;  1UHF A;  1WQW A;  3PVL A;  3OW2 P;  4X1V A;  2GCX A;  5GAM d;  1MMN A;  1SKU B;  2RPN A;  2DZ9 A;  4X34 A;  2JTM A;  2ED1 A;  3CCQ A;  3CCU T;  1XOV A;  4M75 B;  3CD6 Q;  2BZ8 A;  5FW9 A;  4GY5 A;  4LD6 A;  5CVI A;  1FYN A;  4GBQ A;  1U8R A;  4FYW B;  3GPL A;  1B34 B;  3TSZ A;  2LX7 A;  3DB4 A;  3PFS A;  4RG8 A;  2KRO A;  1DJ7 B;  2LJ0 A;  3EGD A;  3H0F A;  1W1F A;  2FO0 A;  4PJO D;  1QWE A;  4J5Y A;  4C92 D;  1OPK A;  1VQ8 T;  1D3B B;  1K76 A;  2HD0 A;  4J9C A;  1K0X A;  3OSV A;  4E47 A;  4JDS A;  1KQS A;  2X3X D;  4OMO A;  1R0C B;  2RJE A;  4C92 F;  2FHD A;  1WHJ A;  4RTT A;  2DXB A;  4C0Z A;  1LOJ A;  2F2W A;  1O9S A;  5GMK j;  2HQH A;  3VRZ A;  3HL8 A;  1TS9 A;  3CCS A;  4ZTJ A;  3NTI A;  3QYH B;  2VYT A;  2GQI A;  4BE0 A;  2W0Z A;  4MDX A;  5L23 A;  1GRI A;  2EFI A;  1WI7 A;  4C92 A;  1QCO A;  3OBY A;  2A28 A;  2AHJ B;  2RA2 A;  5EC7 A;  1U06 A;  1SSH A;  1W2B P;  3BDL A;  4RKU E;  4QQ6 A;  2M9U A;  3PMI A;  2EGA A;  2YUP A;  2EYY A;  3UWN A;  2O4X B;  2H3J A;  2QDL A;  4HT8 A;  1BB9 A;  2ENM A;  3JAM E;  4EMK C;  3L1A A;  2YRD A;  1I5O B;  3CCJ Q;  1WGS A;  4PL6 A;  2E4H A;  3CCR T;  1AT1 B;  2VC8 A;  2QTV A;  1OYX A;  1Y57 A;  1H92 A;  2HMA A;  1MND A;  4EMG A;  1VOM A;  5GMK l;  2ATC B;  4LUD A;  2GBQ A;  4HA8 A;  4MZP A;  4IKF A;  3CXC A;  2VWF A;  1PWT A;  2H8H A;  2GQV A;  1YI2 T;  4KGV B;  2MPX C;  3CC7 Q;  1CKB A;  4RTY A;  2A3L A;  2KSS A;  3CPW A;  3H9N A;  2XK0 A;  2ESW A;  2BIV A;  5IHN A;  3KXT A;  1IGU A;  3RKX A;  4XTV A;  2AIR B;  3S3M A;  4R56 A;  2OTL T;  2QQB A;  4BI3 A;  1LVK A;  1X2Q A;  3MEW A;  2ED0 A;  3H41 A;  1NJI R;  1GCP A;  3LW5 E;  1VQ4 T;  1K73 R;  1OX8 A;  2SEM A;  5GAN 3;  1YCY A;  1Q82 R;  3OYY A;  3CPW S;  3UA7 A;  1QVG A;  2X3W D;  1KQ1 A;  4KRT A;  1UB4 A;  1YIT T;  5GAN 7;  2EGE A;  1LJO A;  3QII A;  4E2F B;  1X69 A;  2L8D A;  2I2L A;  1YHQ T;  2LCL A;  2V26 A;  3OYL A;  1OU8 A;  1JO8 A;  2VUB A;  1ACM B;  3CCR Q;  2QAZ A;  1FX7 A;  3JCM J;  3MKD A;  3G7Z A;  5GMK e;  2C06 A;  1PSF A;  2CH4 A;  3G71 T;  3A8L B;  1BI1 A;  3MEU A;  1KHI A;  3IQL A;  1NEB A;  3QJ6 A;  2D8H A;  3NMZ C;  1Q95 G;  1M30 A;  1ZSZ B;  1IXD A;  4Y92 A;  5LJ3 h;  2DFU A;  1OQK A;  3PTA A;  3I5R A;  4JPB W;  2QI2 A;  2KK4 A;  4Q5W A;  1U5S A;  3MP8 A;  1WHL A;  4M77 E;  1OV3 A;  1KHC A;  4JJD A;  1LNX A;  5M9O A;  3EAE A;  1TU0 B;  1NLO C;  1Z9Z A;  2AZV A;  1M3B A;  1ZBX A;  3BE3 A;  4M77 F;  1AWW A;  3AT1 B;  3HFO A;  4XU0 A;  5FWB A;  3NGP A;  1X6B A;  3UAT A;  4CC7 A;  2HL3 A;  2XHC A;  1WA7 A;  3Q1J A;  1EZZ B;  4M78 D;  2X35 A;  1VQK T;  3PNW C;  4A4K A;  4EMK A;  5AT1 B;  1VQ9 A;  1YIT Q;  4PFP A;  3VV0 A;  2I0N A;  3OBW A;  3TRE A;  2O31 A;  4XTU A;  2YLB A;  1QW1 A;  3LGL A;  2R57 A;  4B6M A;  4PLL A;  5LJ5 h;  1NPP A;  3WVD B;  3MPU B;  3INZ A;  3NFC A;  4FSS A;  3CC2 A;  2K6D A;  1PRM C;  3EFS A;  1VQ9 Q;  1HYO A;  3OYI A;  4EDU A;  4M77 D;  4L5G A;  5HK3 A;  1JRI A;  1ZX6 A;  4M75 F;  4X9D A;  2EVR A;  1P92 A;  2DMO A;  3CCS Q;  3LWH A;  2HZY A;  1KK7 A;  1EFN A;  2FG0 A;  3OYB A;  5KYY A;  1NJI U;  4KUD K;  4ZN1 A;  4XAX B;  2IVW A;  5GAN f;  1YJW Q;  3S3N A;  1KQS P;  2RB6 A;  5D7U A;  2PUK B;  4II1 A;  1V1C A;  2MIO A;  3QO3 A;  2CZ0 B;  2COY A;  3EGX A;  2K3B A;  2XKO C;  2JOY A;  2PVG B;  1ZSZ A;  1QP2 A;  1M2V A;  1E6H A;  3CCV Q;  3R6N A;  5IT9 E;  4J9D A;  1WJS A;  3P8H A;  3JCM P;  4M78 A;  3OYA A;  1GCQ A;  1IO6 A;  2CDT A;  3G1J A;  1M90 R;  1WNL A;  2RJC A;  3OYJ A;  5CO7 A;  3EGD B;  3I55 Q;  2KEA A;  4GLM A;  2EYQ A;  2LCS A;  4LN2 A;  1U3O A;  1RI9 A;  3CCM Q;  2YDL A;  1D09 B;  4BDY A;  2A7Y A;  1Q86 U;  2WSF E;  5A2Q E;  2EKH A;  2J6O A;  1YCS B;  3THK A;  4CI0 C;  5LJ5 e;  3QZ9 B;  4PJL A;  1JU5 C;  2K4Y A;  5KYW B;  3L42 A;  4AFS C;  4QKU A;  3MCA B;  3QDR B;  3H6Z A;  5IN1 A;  2X9H A;  2G6F X;  1N9S A;  3QYG B;  3F70 A;  4LE9 A;  1VQ4 A;  3OYH A;  3TEE A;  2PTK A;  2FRW A;  1ZA2 B;  2EGC A;  3PMT A;  2P4R A;  4BI8 B;  5LJ5 d;  2RHX A;  3A8M B;  3ULR B;  3ME9 A;  1LCK A;  4A53 A;  2HKN A;  1VQ6 Q;  1GBR A;  1WPY A;  3MO8 A;  1WYX A;  2BUD A;  1VQO A;  1KC8 C;  4HCB A;  3GIB A;  4J8O A;  5GJV B;  2XU8 A;  2NUP B;  1YJW T;  2E3H A;  5IH2 A;  3OYF A;  3CMA Q;  3SDZ A;  3UF4 A;  4C8Q C;  2QK0 A;  4FYY B;  3VS4 A;  4C5G A;  1PRL C;  1RL2 A;  3I56 T;  3CCJ T;  4E7J A;  3NTK A;  3RBB B;  3RMQ A;  1KQ2 A;  2V1Q A;  5CQX A;  2JUF A;  4WF2 A;  4E7Z A;  3L2Z A;  2KXD A;  2MWP A;  2W10 A;  1X43 A;  3JSC A;  3MEA A;  3QG1 A;  4PJO A;  3CBM A;  1C6V X;  3MHX A;  4ESR A;  3CCU Q;  4M4Z A;  1MHN A;  2ZPF B;  1M1G A;  2K5I A;  2LDM A;  4MZM A;  4C8Q F;  3CME A;  2DL8 A;  3QPH A;  3G4S A;  1TH7 A;  3RES A;  2E6Z A;  2BKD N;  1M1F A;  1QVF A;  4JRK A;  3CCL Q;  1YHQ Q;  1SHF A;  2DX1 A;  1E6G A;  4OGC A;  3HTR A;  3ASK A;  2HSP A;  1X6G A;  1PG5 B;  4M78 G;  3CCQ Q;  2VXF A;  3VS0 A;  2Y4Y A;  2DL5 A;  2JJ9 A;  4VUB A;  3M58 A;  2LX9 A;  3FC3 A;  3FLG A;  1KSW A;  1M90 U;  1G3W A;  3VYG A;  5IXB A;  2DIG A;  1H3H A;  5GAN e;  3OS5 A;  4DA4 A;  1R0B G;  2DRK A;  3G4S Q;  4M78 B;  1YBY A;  4J9E A;  4E7H A;  1IZ6 A;  2EQU A;  5L8R E;  3EG2 A;  2M02 A;  3CCL A;  3TU4 K;  6AT1 B;  4JS5 A;  1XTD A;  2M0Y A;  5FU7 B;  1YNZ A;  2E1H A;  2AK5 A;  5DLQ E;  4PJN A;  5KH6 A;  3M59 A;  3SB2 A;  3I56 Q;  2RD1 A;  1PHT A;  3LH5 A;  1YIJ Q;  1FMV A;  1G3T A;  1K9M U;  2RQW A;  1WQ7 A;  2AZS A;  1H8K A;  3V8K A;  4EIK A;  4RTZ A;  2EW3 A;  5GAM g;  2RQU A;  3VS5 A;  3EH1 A;  5GAN 6;  2X4X A;  3L2Q A;  1UG1 A;  4OMF B;  1WXT A;  3A8H B;  4C8Q A;  1VQ6 T;  1PD1 A;  1ZUU A;  5LJ3 f;  3VJP A;  4JZ3 A;  4Z02 A;  2E70 A;  2RI5 A;  3QWX X;  3EHR A;  1QP3 A;  2GFU A;  4EMH A;  2ROT A;  4F7U F;  1BCM A;  3PIO A;  4C8Q G;  3I35 A;  2RJD A;  4N0A A;  3VS6 A;  1WXB A;  2AKL A;  3DLM A;  3DLL A;  1QVF S;  3VYH B;  4RTW A;  5GAM j;  2EKO A;  4MZT A;  1KD1 U;  3V8L A;  4QT7 A;  4XQ3 A;  1GFC A;  2E10 A;  2WAC A;  2KGT A;  1VIE A;  5DLO A;  1JJ2 S;  4LDV A;  3CBP A;  4FT4 A;  4RUG A;  4HKE A;  1RAC B;  4HVU A;  2KDS A;  1BI3 A;  1ZSG A;  2JNG A;  2MAM A;  3LX7 A;  4C5H A;  1KG1 A;  2RHU A;  2L0A A;  4FW1 A;  2FPD A;  1VQ8 A;  2KNB B;  3RUX A;  4DBQ A;  1RAB B;  1AWX A;  2VV5 A;  1K8A U;  4M7D E;  2MI6 A;  2BE7 D;  4JRI A;  3LLR A;  3C95 A;  1MUZ A;  2RHY A;  2H3E B;  2O01 E;  4D8D A;  5GAO p;  2RMO A;  2EBP A;  1VUB A;  4JS4 A;  2A37 A;  2KE9 A;  3JV3 A;  4AT1 B;  5KE2 A;  4Y91 A;  3REB B;  1UJY A;  1WHK A;  3JRZ A;  2DXC A;  3BW1 A;  1N9R A;  3GNG A;  2DER A;  2J7I A;  1YJ9 T;  1M3C A;  5LJ3 d;  1RAA B;  3SD4 A;  5GMK i;  3AHU A;  1RAG B;  4N4G A;  2CP6 A;  3OW2 S;  1KD1 C;  2QEX Q;  3VU3 C;  5LJ5 g;  1M5Q 1;  1D3B A;  2K57 A;  1VQO Q;  4J9B A;  1GBQ A;  1VQM A;  9ATC B;  3X20 B;  4R0K A;  4C8Q E;  4IIO A;  4XTW A;  1ABO A;  2XI9 A;  3OS0 A;  5GAN 2;  1Y7X A;  5GAN h;  4M7D A;  1BCO A;  1I0C A;  2VB6 A;  4O6J A;  3R6O A;  2A36 A;  2VAS A;  3UA6 A;  4FT2 A;  5C0M A;  5KYX B;  2CRE A;  1JXM A;  2JN0 A;  3C4S A;  3M55 A;  1RAE B;  4XU1 A;  4ANJ A;  2LJ3 A;  4M75 A;  2M1H A;  5AYF A;  2RK1 A;  3H0H A;  3MP6 A;  3OYM A;  2JZ2 A;  3A8G B;  4ZGD B;  1VA7 A;  1Q7Y R;  3CCE T;  5IHK A;  4OB1 B;  3EGX B;  1SEM A;  4OP0 A;  1ZUY A;  5FWC A;  1FMK A;  3CEY A;  1SSF A;  3CME Q;  4QQG A;  4J9I A;  4A63 B;  4C0F A;  3CBO A;  1UUE A;  3CPF A;  2QXF A;  4FU6 A;  5GAO n;  5KCO A;  3HP9 A;  4ME7 A;  4M7D C;  4FM4 B;  5GAN 8;  3SWN B;  3JB9 D;  2E41 A;  2FB7 A;  4OB2 B;  2XMF A;  4J9G A;  3I5S A;  1VQN Q;  4JLI A;  4JUV A;  5I21 A;  3OYD A;  3MJX A;  2FVU A;  1Y96 A;  2GFA A;  4M78 E;  1K9M R;  2L3R A;  4C92 G;  2DYB A;  1IRE B;  2IPO B;  3VUZ A;  1HD3 A;  4OMN A;  1UGV A;  4PLI A;  2E65 A;  1JEG A;  2F2X A;  4PK4 A;  4ORZ A;  2MF2 A;  4RTU A;  1YWP A;  1RAH B;  1TUG B;  5D6W A;  3VS1 A;  5I22 A;  2D1X A;  1R77 A;  1TUD A;  3FIF A;  4PJM A;  2EYX A;  1Y07 A;  2LVM A;  2L3S A;  4OF1 A;  3CC2 T;  1AD5 A;  1SF9 A;  3VRY A;  2K7A A;  1MV0 B;  1OI1 A;  1RUW A;  1JJ2 P;  3HKS A;  4AFZ C;  4IUP A;  1KJW A;  3CCE A;  4ELY C;  3RER A;  4KT0 E;  3ZBD A;  5GAN d;  5DY9 A;  4BY6 B;  2MOX A;  4KUI A;  4M75 D;  1S72 A;  4OML A;  1K0S A;  1K73 U;  2DYI A;  5CAI A;  4GLK A;  1M2O A;  1UJ0 A;  1U1S A;  3GNF B;  3C0C A;  3G4S T;  2YUO A;  2CT4 A;  3OQ5 A;  3CC4 A;  3CCE Q;  2RI3 A;  2DPP B;  2EQJ A;  4KGX B;  2Y4X A;  3JCM f;  4C8Q D;  1FWZ A;  5J3B A;  4F16 A;  3CPW P;  1GCQ C;  2YRC A;  1JJ2 A;  1QCF A;  1Z9Q A;  4DOW A;  4BDZ A;  2YWW A;  1VQK A;  1WLP B;  2E3I A;  2ZPG B;  4PJO C;  5EG2 A;  2LQW A;  1YP5 A;  4C92 C;  4Z89 A;  4M75 E;  3RKY A;  1C0M A;  2EJ9 A;  2NYS A;  3E9F A;  1TXQ A;  2DIL A;  1MMA A;  3URG A;  2XDP A;  2F69 A;  4KBM B;  2ZPH B;  4QVD A;  3I55 A;  3CCJ A;  2O88 A;  1Q86 C;  4PFZ A;  2MK5 A;  2E6N A;  2DKG A;  1UTI A;  3OY9 A;  4N0A C;  1B07 A;  4BE2 A;  1YN8 A;  2CP5 A;  1PC0 A;  3ER0 A;  2R58 A;  3UT1 A;  3M54 A;  3PE0 A;  3NPF A;  3HPW A;  3X24 B;  3EFO B;  2EIF A;  3MEV A;  1CSK A;  4A54 A;  1Y0M A;  4DOV A;  2QEX A;  4OMM A;  3JCM W;  4PNO A;  4P5N A;  3VS7 A;  4C8Q B;  1OU9 A;  2GTJ A;  1SRL A;  3OS1 A;  3KBG A;  2DL7 A;  4ZN3 A;  1D0Y A;  1O75 A;  5GAN 5;  4LDW A;  3UPU A;  1G3S A;  3JCM X;  4XK8 E;  2QYZ A;  4PJO G;  3M0T A;  2D8J A;  3E1S A;  3SHW A;  3ZFJ A;  3ZEH A;  3OS2 A;  3JB9 F;  4MDW A;  2EQM A;  1ZSZ C;  1HXD A;  2J06 A;  4ZNX A;  2CUD A;  1B7T A;  2FZC B;  2DF6 A;  1VQ5 T;  4E7L A;  3L2W A;  1BIB A;  1WXU A;  1RAF B;  3I9Q A;  2PQW A;  2DBK A;  4HCC A;  1TG0 A;  3QZ5 B;  1PD0 A;  3CMA A;  1VQM T;  5KYU A;  5KYX A;  2VGM A;  4QVZ A;  1T0H A;  1QKW A;  4BAC A;  4BI4 A;  3G6E T;  2O4X A;  4JLG A;  5GMK h;  3N5B B;  4F7U G;  2MCN A;  4RMO A;  1QCN A;  4PJO E;  1Q81 R;  2WSC E;  5DM7 R;  2YHT A;  2QEX T;  2EQI A;  2X51 A;  3LH0 A;  2L3P A;  2L3Q A;  2M51 A;  3GOX A;  4CRI A;  2K79 A;  1W2B S;  2FZK B;  3M0P A;  2RHI A;  2KQW A;  3JCM h;  4AFU C;  1K9A A;  1AEY A;  2FPF A;  3EHQ A;  3E9G A;  4AMC A;  1OZ3 A;  2PNI A;  5A0D A;  3MP1 A;  3JCM Q;  4NL3 A;  2OTJ A;  2LTO A;  5LL6 S;  2B8A A;  2VGN A;  2LCC A;  2ZPB B;  5HCK A;  3V7S A;  2O9S A;  4EPC A;  1RAD B;  5FU7 C;  5J26 A;  2DTH A;  3OMC A;  3A98 A;  4A4F A;  2VXE A;  2RQV A;  4LD9 K;  4E7K A;  2AKK A;  4WCI A;  3FB9 A;  1YJ9 Q;  1U1T A;  4A4H A;  1XQH A;  1NZ9 A;  1VQ7 T;  2CYZ B;  1Q81 U;  4RCC A;  2EWN A;  1NBE B;  2DBM A;  2OTJ Q;  1OPL A;  4CC2 A;  3WXM B;  2QA4 T;  2DAQ A;  4MMK A;  1PM3 A;  5CR2 A;  1K1Z A;  1UHC A;  1KFZ A;  5KCH A;  2J6F A;  1M1K R;  4J6X A;  1D1C A;  2PU9 B;  1YJ9 A;  2DTO A;  2LMJ A;  4R55 A;  1XNI A;  2P4T A;  1M8M A;  1QLY A;  3CXC S;  5D6Y A;  4M7A B;  5GAO r;  4KUL A;  1VQL Q;  2QDY B;  4KH0 B;  4F7U B;  3QSU A;  3M4Y A;  3M9Q A;  1NM7 A;  4Z88 A;  2YLC A;  1Q81 C;  3RIR A;  3X25 B;  3V7C A;  2RQT A;  2HL5 C;  2QTX A;  1ARK A;  1V29 B;  4HXJ A;  4Y28 E;  2YSQ A;  1NG2 A;  4F7U E;  1A0N B;  3WVE B;  5FLX E;  1UEB A;  1UGS B;  3HFN A;  1G83 A;  2RQR A;  5GJW B;  3EGU A;  1OZ2 A;  2V8J A;  1Q7Y U;  2FPE A;  3CCQ T;  3RMS A;  2CT3 A;  3V7R A;  2IIM A;  1KC8 R;  1MV3 A;  3PT9 A;  4BB7 A;  1YJW A;  2IG0 A;  2K9G A;  1I07 A;  1JXO A;  1RLQ C;  4J83 A;  2DA9 A;  4E7S A;  2L5Q A;  2DE0 X;  4J7I A;  4PJJ A;  3EG9 A;  1UGR B;  2D6F A;  4V2S A;  2P0K A;  3PGG A;  4N4I A;  1M27 C;  2KRS A;  1GFD A;  2X4J A;  1UEC A;  1NEG A;  5KYN A;  1RAI B;  5LJ3 j;  4J6W A;  2V1R A;  3RNJ A;  1V76 A;  3HSB A;  3VS3 A;  2E5K A;  1VQP A;  4Z8A A;  4KGZ B;  1N8R R;  2XDD A;  3OMG A;  3TQ7 P;  4B9W A;  5IHI A;  4M7D D;  4M7A D;  1BYM A;  4IUU A;  2YT6 A;  1AZE A;  2F5K A;  3NTH A;  4FIB A;  4DBR A;  1K4U S;  2JM9 A;  3GF5 A;  3O5Z A;  2JTF A;  2GGR A;  3PVQ A;  4PKC C;  2JMC A;  3QXE B;  2WSE E;  5GAM f;  1S72 T;  1K9M C;  3MET A;  2OAU A;  2PZ1 A;  1TSF A;  2P0P A;  1NYG A;  2FRY A;  2C0O A;  1X6O A;  3DKM A;  4M7D G;  1BKB A;  3M4G A;  4OVA A;  1T0J A;  3BDU A;  2KVQ G;  3M0Q A;  1VQP Q;  5FRN A;  5CIU A;  7AT1 B;  2CZ6 B;  5LJ3 g;  4OB3 B;  5FRO A;  3QHS A;  4UC4 A;  4D6W A;  2EPD A;  4DQ2 A;  3REA B;  3M0S A;  1EIF A;  4OGE A;  4F17 A;  4QVC A;  1S1N A;  4LDY A;  1K8A R;  3VUB A;  4HCZ A;  4C0D C;  1ZBJ A;  5GMK m;  2DVJ A;  1YJN T;  3CCL T;  2P0Q A;  5KE3 A;  2RK2 A;  3M0U A;  4BD3 A;  3VKI A;  2NUP A;  3FJ5 A;  4C5E A;  1JQQ A;  4F04 B;  1OUL A;  2BZX A;  4HVV A;  1FXX A;  1X2K A;  1I4K 1;  5HKC A;  2FZG B;  3CMA T;  2OI3 A;  5HK0 A;  3L2R A;  3OA6 A;  1Q82 C;  4HCK A;  2BZY A;  3VS2 A;  1TWB A;  3O8V A;  5KYU B;  2DO3 A;  2YUN A;  5A0L A;  3EG9 B;  1QMC A;  2JM8 A;  2C0T A;  1N8R U;  3CCS T;  3EG0 A;  4M77 C;  3KFV A;  1QVG P;  4HT9 A;  2DET A;  4RCB A;  4X9C A;  4E7I A;  1VYT A;  2ZPE B;  4IUR A;  3M53 A;  2HNI A;  2YRV A;  1N27 A;  1KQS S;  4C0D B;  3E2U A;  4AG2 C;  4XTZ A;  4EMK B;  2KBT A;  2K5F A;  2RH2 A;  1F1B B;  1I81 A;  2LC4 A;  3C94 A;  5A0G A;  3V8J A;  1YIT A;  4NL2 A;  2RF0 A;  2VVK A;  2K3X A;  4PJO F;  1YI2 Q;  2K2M A;  5GAM e;  2RM4 A;  3EFO A;  4M7A A;  5CCA A;  1QWF A;  2A08 A;  2LRQ A;  1VQ5 Q;  2DRM A;  2KYB A;  1BU1 A;  4AFQ C;  3CD6 A;  2DIQ A;  5CKH A;  3CCU A;  3HRS A;  2K2V A;  2XD0 A;  1T3S A;  4BY6 C;  3CXC P;  2XID A;  2OX7 A;  1WX6 A;  2KI7 A;  4TVR A;  3LYI A;  3OSS C;  4F14 A;  2HBW A;  2O2O A;  8ATC B;  4J9H A;  1YIJ T;  1SG5 A;  2MYS A;  5CK9 A;  1YHQ A;  2LNV A;  1VQ5 A;  3QDF A;  4LUE A;  2DXU A;  4A4G A;  4M7D F;  2F1L A;  2GNC A;  2LJ1 A;  2OTJ T;  4KH1 B;  2LT4 A;  4CC4 B;  3GBQ A;  1AHJ B;  1H64 1;  1VYU A;  3M5A A;  4M7A E;  2KR3 A;  3CC7 T;  4M75 C;  4NOY A;  4M77 B;  3CD6 T;  1VQL A;  2DJZ A;  3X26 B;  1KC8 U;  2BTT A;  3H0I A;  2E12 A;  1J3T A;  2M0O A;  3KUF A;  4L59 A;  3GLX A;  1AVZ C;  2DL4 A;  2JS2 A;  2ROL A;  3M0R A;  1IHW A;  4C92 B;  4J9F A;  2MMP A;  1BIA A;  1YIJ A;  2NLU A;  2DD5 A;  2V8K A;  4M77 G; 
#chains in the Genus database with same CATH homology
 1M1K C;  3OY9 A;  3J81 E;  3DB3 A;  2DXT A;  2M16 A;  4N0A C;  4GY5 A;  4LD6 A;  4BE2 A;  3OYF A;  5CVI A;  3GP8 A;  2DEQ A;  3ER0 A;  3SDZ A;  3CC4 T;  2R58 A;  1JB0 E;  4C8Q C;  3UT1 A;  4O5V A;  1U8R A;  3M54 A;  3GPL A;  3HPW A;  3X24 B;  3P8B B;  4C5I A;  1B34 B;  2EIF A;  4C5G A;  3MEV A;  1RL2 A;  3I56 T;  3CCJ T;  4A54 A;  2PVD B;  3DB4 A;  4E7J A;  3PFS A;  4DOV A;  4RG8 A;  3FEO A;  4N4H A;  2QEX A;  3NTK A;  4QQD A;  3RMQ A;  3SFM A;  1DJ7 B;  1KQ2 A;  3JCM W;  4PNO A;  5CQX A;  2JUF A;  4WF2 A;  5I2M A;  4P5N A;  3OW2 A;  3L2Z A;  3OYG A;  4PJO D;  4C8Q B;  2MWP A;  3OYK A;  3L2U A;  4XU3 A;  4J5Y A;  4C92 D;  2D9T A;  3JSC A;  3MEA A;  3OS1 A;  3KBG A;  3QG1 A;  4PJO A;  4ZN3 A;  1VQ8 T;  1D3B B;  1O75 A;  3CBM A;  2HD0 A;  5GAN 5;  1VQ9 T;  1UGQ B;  3OSV A;  4LDW A;  3MHX A;  4E47 A;  3UPU A;  3TCJ A;  4JDS A;  2QQ9 A;  1G3S A;  3JCM X;  1MHN A;  2ZPF B;  4XK8 E;  1M1G A;  2K5I A;  2LDM A;  4MZM A;  1KQS A;  1GXI E;  2QA4 A;  2RJE A;  4OB0 B;  3QPH A;  4PJO G;  2QQS A;  4C92 F;  2FHD A;  4C8Q F;  3CME A;  3G4S A;  2DXB A;  4C0Z A;  1TH7 A;  3E1S A;  3LGF A;  3RES A;  1LOJ A;  3ZFJ A;  3ZEH A;  1X01 A;  1O9S A;  2E6Z A;  2BKD N;  1M1F A;  2EQM A;  3M56 A;  4MDW A;  5GMK j;  1HXD A;  1QVF A;  4JRK A;  1Q82 U;  3CC7 A;  3HL8 A;  2XDB A;  3CCS A;  4ZTJ A;  4OGC A;  3ASK A;  3NTI A;  2R5M A;  3QYH B;  1VQ5 T;  2VYT A;  4E7L A;  3FRN A;  4M78 G;  3L2W A;  4BE0 A;  1BIB A;  1Y96 B;  2VXF A;  1QVG S;  2Y4Y A;  4L6V 5;  2PQW A;  4M7A G;  3E19 A;  4B9X A;  4MDX A;  2EFI A;  3CMA T;  4HCC A;  4VUB A;  2QQR A;  3M58 A;  3QZ5 B;  4C92 A;  2LX9 A;  3FC3 A;  3OBY A;  2AHJ B;  3FLG A;  3CMA A;  1VQM T;  2RA2 A;  2KAF A;  1M90 U;  1G3W A;  1ZQ1 A;  3VYG A;  3M57 A;  2DIG A;  2VGM A;  4QVZ A;  5GAN e;  3OS5 A;  2CZ1 B;  4DA4 A;  1M8V A;  3FJP A;  4BAC A;  4BI4 A;  2HBP A;  4M78 B;  1YBY A;  3BDL A;  3G6E T;  1IZ6 A;  2DD4 A;  4E7H A;  3JCM g;  2EQU A;  4RKU E;  2O4X A;  3QUI A;  4JLG A;  4QQ6 A;  4XU2 A;  1HK9 A;  5L8R E;  5GMK h;  3JCM V;  3CCL A;  2M9U A;  3N5B B;  3PMI A;  4RG2 A;  4F7U G;  3TU4 K;  4JS5 A;  1XTD A;  1WJQ A;  4RMO A;  2EJG A;  3UWN A;  2O4X B;  4PJO E;  2H3J A;  1VQ6 A;  1K73 C;  4HT8 A;  2WSC E;  5FU7 B;  5DM7 R;  2E1H A;  2YHT A;  2LQ8 A;  2QEX T;  1N8R C;  5DLQ E;  5D6X A;  5KH6 A;  3M59 A;  3SB2 A;  3JAM E;  3JB9 H;  4EMK C;  3L1A A;  3LH0 A;  2RD1 A;  4LDX A;  1G3T A;  1WGS A;  4PL6 A;  4CRI A;  3GOX A;  1K9M U;  1W2B S;  2X4Y A;  4M77 A;  3CCR T;  2RHI A;  2KQW A;  2LQK A;  2VC8 A;  3JCM h;  2RO0 A;  1OYX A;  1WQ7 A;  1BI2 A;  3J80 E;  2ZCF B;  3V8K A;  1M1K U;  3JCM e;  4EMG A;  5GMK l;  4HA8 A;  4MZP A;  5GAM g;  3CCR A;  5FU6 B;  4IKF A;  3CXC A;  2ZZD A;  3E9G A;  4ATO A;  1OZ3 A;  2GQV A;  1YI2 T;  5A0D A;  1R8O B;  3MP1 A;  3JCM Q;  2GF7 A;  4NL3 A;  5GAN 6;  2DTI A;  2OTJ A;  2X4X A;  3L2Q A;  2LTO A;  2A3L A;  4OMF B;  2KSS A;  5LL6 S;  3CPW A;  2B8A A;  2XK0 A;  3A8H B;  4C8Q A;  1VQ6 T;  2VGN A;  5LJ3 f;  2BIV A;  2LCC A;  2ZPB B;  3VJP A;  3V7S A;  4Z02 A;  1MGQ A;  4C5H A;  2E70 A;  2DVE A;  2JVV A;  4EPC A;  5FU7 C;  5J26 A;  1RI0 A;  2DTH A;  2RI5 A;  3OMC A;  3QKJ A;  1H3Z A;  3KXT A;  1YJW T;  5I2S A;  3OB9 A;  4A4F A;  2VXE A;  3RKX A;  1QP3 A;  2GFU A;  4XTV A;  4LD9 K;  4E7K A;  3S3M A;  4R56 A;  4EMH A;  3H8Z A;  4F7U F;  2OTL T;  3FB9 A;  3PIO A;  1U1T A;  4A4H A;  2QQB A;  1XQH A;  4C8Q G;  2RJD A;  3JCM d;  4BI3 A;  3MEW A;  1NZ9 A;  2E6N A;  1VQ7 T;  2CYZ B;  1Q81 U;  4N0A A;  4RCC A;  2EWN A;  3DLM A;  4A4E A;  4M7D B;  3DLL A;  1QVF S;  1YI2 A;  1UGP B;  3VYH B;  5GAM j;  3LW5 E;  2EKO A;  4YTL A;  3WXM B;  4MZT A;  3BFM A;  4QW2 A;  1VQ4 T;  2QA4 T;  4JRP A;  3V8L A;  2DAQ A;  1KD1 U;  4XQ3 A;  2XG8 D;  4MMK A;  2PVO B;  5CR2 A;  2E10 A;  5GAN 3;  2WAC A;  4C0G A;  1YCY A;  4PJO B;  3OYY A;  3CPW S;  1VIE A;  5KCH A;  5DLO A;  2MWO A;  1JJ2 S;  1QVG A;  4LDV A;  5LJ3 e;  1KQ1 A;  1UB4 A;  3CBP A;  4FT4 A;  1YIT T;  5GAN 7;  4HKE A;  2G3R A;  1LJO A;  2KDS A;  1BI3 A;  2JNG A;  2MAM A;  2Y90 A;  3LX7 A;  3QII A;  4J6X A;  2PU9 B;  2CZ7 B;  2KMT A;  2RHU A;  3OYC A;  1YJ9 A;  1KG1 A;  4IUV A;  5GAO l;  2DTO A;  2I2L A;  2L8D A;  4R55 A;  1YHQ T;  2LCL A;  3UDC A;  3OYL A;  3JB9 G;  3RUX A;  1VQ8 A;  1XNI A;  2P4T A;  2VUB A;  5LJ5 j;  3CXC S;  2VV5 A;  1K8A U;  5D6Y A;  2EAY A;  4M7D E;  4M7A B;  5GAO r;  1FX7 A;  2MI6 A;  4KUL A;  1PSE A;  3JCM J;  2HAX A;  3G7Z A;  4JRI A;  5CKD A;  2QDY B;  5GMK e;  5GAO q;  3LLR A;  5GAM h;  3C95 A;  1PSF A;  4F7U B;  2C06 A;  2RHY A;  3QSU A;  3M4Y A;  2O01 E;  3A8L B;  3G71 T;  1BI1 A;  5GAO p;  1G5V A;  1VUB A;  1Y71 A;  1VQO T;  3HHT B;  1KHI A;  1M9S A;  3M9Q A;  3MEU A;  2YLC A;  4JS4 A;  3QJ6 A;  3LWI A;  1Q81 C;  1I5L A;  3RIR A;  3X25 B;  5KE2 A;  2E5Q A;  3EFR A;  3V7C A;  4M78 C;  4Y91 A;  2QTX A;  1V29 B;  4Y28 E;  3I56 A;  3JRZ A;  2DXC A;  5LJ3 h;  3WVE B;  4F7U E;  4M7A C;  5FLX E;  1UEB A;  3PTA A;  3BW1 A;  1UGS B;  3HFN A;  1N9R A;  3GNG A;  3CCV T;  3HRT A;  2QI2 A;  1OZ2 A;  2V8J A;  3BY7 A;  3CCQ T;  1Q7Y U;  3RMS A;  2KK4 A;  4Q5W A;  3V7R A;  1YJ9 T;  3PT9 A;  4BB7 A;  1YJW A;  2IG0 A;  3MP8 A;  4J83 A;  5LJ3 d;  4M77 E;  4XTX A;  5CQY A;  3SD4 A;  1KHC A;  5GMK i;  3C12 A;  2L5Q A;  2DK3 A;  2FL7 A;  1LNX A;  2HQX A;  3AHU A;  4N4G A;  4J7I A;  5M9O A;  3EAE A;  3OW2 S;  1KD1 C;  1VQL T;  2L89 A;  1UGR B;  2D6F A;  3VU3 C;  5LJ5 g;  3JCM b;  4V2S A;  3FDR A;  2P0K A;  2CS7 A;  1M5Q 1;  1D3B A;  3PGG A;  1ZBX A;  2K57 A;  4N4I A;  4M77 F;  3PIP A;  3A8O B;  2X4J A;  5GAO m;  1VQM A;  2CGH A;  3HFO A;  1JBM A;  3X20 B;  4C8Q E;  1VQN T;  4XTW A;  4XU0 A;  3I55 T;  5LJ3 j;  4J6W A;  2XI9 A;  3HRU A;  3OS0 A;  4J7F A;  5GAN 2;  1Y7X A;  5GAN h;  4M7D A;  3HSB A;  2XHC A;  2RHZ A;  3Q1J A;  4M78 D;  2X35 A;  4O6J A;  1VQP A;  3R6O A;  1VQK T;  3PNW C;  5FRM A;  4A4K A;  2XDD A;  3OMG A;  4BUG A;  4EMK A;  4B9W A;  4F7U A;  4M7D D;  4M7A D;  4FT2 A;  1BYM A;  1VQ9 A;  4IUU A;  5C0M A;  2F5K A;  1X75 C;  4ELZ C;  1VIF A;  3NTH A;  3SWN A;  4IUT A;  4ZGE B;  2JN0 A;  3C4S A;  4FIB A;  3VV0 A;  3M55 A;  3RKW A;  3CME T;  4XU1 A;  3GF5 A;  3OBW A;  3TRE A;  2JTF A;  4PKC C;  4XTU A;  2YLB A;  1NJI C;  3QXE B;  2WSE E;  4M75 A;  5GAM f;  1S72 T;  2M1H A;  1QW1 A;  3LGL A;  5AYF A;  2KY9 A;  1W4S A;  2R57 A;  2RK1 A;  1K9M C;  3MET A;  3MP6 A;  3OYM A;  2OAU A;  2JZ2 A;  4PLL A;  2P0P A;  3A8G B;  5LJ5 h;  2CKK A;  3DKM A;  1X6O A;  3QJY A;  4ZGD B;  1NPP A;  4M7D G;  3WVD B;  1BKB A;  3M4G A;  3P8D A;  3INZ A;  3NFC A;  4OVA A;  3BDU A;  3CC2 A;  2KVQ G;  3CCE T;  5CKF A;  5FRN A;  5CIU A;  2CZ6 B;  4OB1 B;  3EFS A;  4OP0 A;  5LJ3 g;  4OB3 B;  5FRO A;  3QHS A;  3CEY A;  4UC4 A;  3CCV A;  1SSF A;  4NS5 A;  3G71 A;  4JRQ A;  4D6W A;  4QQG A;  1NE8 A;  3OYI A;  2D0Q B;  4DQ2 A;  4C0F A;  4EDU A;  4M77 D;  3CBO A;  4L5G A;  5HK3 A;  1EIF A;  3CPF A;  1I8F A;  2QXF A;  1JRI A;  4FU6 A;  4OGE A;  4QVC A;  5KCO A;  4M75 F;  5GAO n;  4X9D A;  3HP9 A;  4ME7 A;  2X4W A;  3JB9 F;  4M7D C;  5GAN 4;  4FM4 B;  4LDY A;  1N6A A;  5GAN 8;  1P92 A;  3SWN B;  3JB9 D;  3VUB A;  1K8A C;  4HCZ A;  4MML A;  4C0D C;  5IAY A;  4LDU A;  5GMK m;  3LWH A;  2E64 A;  1YJN T;  2E41 A;  2FB7 A;  4OB2 B;  1BI0 A;  2K5L A;  3CCL T;  5HY6 A;  2P0Q A;  5KE3 A;  3OYB A;  2RK2 A;  5FU6 C;  4BD3 A;  4JLI A;  4JUV A;  1NJI U;  5I21 A;  1W2B A;  4ZGJ B;  3OYD A;  3VKI A;  5GAN g;  3G6E A;  4KUD K;  4ZN1 A;  4C5E A;  2FVU A;  1Y96 A;  3CCM A;  1FXX A;  2GFA A;  1I4K 1;  4M78 E;  4XAX B;  1B34 A;  5HKC A;  1NPR A;  5HK0 A;  2FYK A;  2L3R A;  3L2R A;  4C92 G;  3OA6 A;  1Q82 C;  1IRE B;  2IVW A;  5GAN f;  3S3N A;  2RI2 A;  3O8V A;  2DO3 A;  3VUZ A;  5A0L A;  3L2V A;  2RB6 A;  2PUK B;  2XIC A;  4FSX A;  4II1 A;  1N8R U;  3S6W A;  3CCS T;  4J6Y A;  5C6S A;  1WJR A;  4HT9 A;  4M77 C;  4PLI A;  2EJF A;  2E65 A;  4ZTF A;  4RCB A;  1ZHI A;  3QO3 A;  4X9C A;  2CZ0 B;  2DZC A;  2MF2 A;  4M7A F;  4C92 E;  4E7I A;  2XKO C;  2JOY A;  2ZPE B;  4IUR A;  4M75 G;  5D6W A;  4M78 F;  2QQA A;  2HNI A;  3M53 A;  2YRV A;  1Q7Y C;  2EQK A;  2PVG B;  1N27 A;  2PUO B;  4FL6 A;  1KQS S;  3J7A F;  4C0D B;  1QP2 A;  3JB9 J;  3FIF A;  4XTZ A;  4EMK B;  5LJ5 f;  1YJN A;  2K5F A;  1Y07 A;  3OS2 A;  5GAN j;  2RH2 A;  2LVM A;  5IT9 E;  1I81 A;  4OF1 A;  3CC2 T;  2LC4 A;  3C94 A;  5J39 A;  3OYE A;  5A0G A;  1WJS A;  3V8J A;  3P8H A;  3S3O A;  4NL2 A;  3JCM P;  1YIT A;  4JJN K;  2K3X A;  4M78 A;  4PJO F;  3OYA A;  2ZPI B;  3T9N A;  5GAM e;  2RM4 A;  2V8I A;  1OI1 A;  5CCA A;  4M7A A;  2LRQ A;  1WNL A;  1G3Y A;  3HKS A;  4IUP A;  2RJC A;  3CCE A;  2LT1 A;  4ELY C;  3OYJ A;  4KT0 E;  3RER A;  5CO7 A;  3ZBD A;  4XTY A;  5GAN d;  5DY9 A;  4BY6 B;  3CD6 A;  2DIQ A;  3JB9 I;  4KUI A;  2EYQ A;  2HQE A;  5CKH A;  3CCU A;  3QBY A;  4M75 D;  3HRS A;  3OYN A;  2K2V A;  2XD0 A;  4BY6 C;  4BE1 A;  1S72 A;  4BDY A;  2XID A;  2A7Y A;  2F5T X;  3X28 B;  1Q86 U;  1M90 C;  2WSF E;  4TVR A;  5A2Q E;  3LYI A;  3OSS C;  4IUQ A;  4CI0 C;  5LJ5 e;  3QZ9 B;  1K73 U;  5CKB A;  1YIJ T;  5CK9 A;  5CAI A;  4GLK A;  1YHQ A;  2LNV A;  2K4Y A;  4M75 B;  1U1S A;  3GNF B;  5CKE A;  3L42 A;  1VQ5 A;  3G4S T;  1QVP A;  3OQ5 A;  3CC4 A;  2ZGW A;  2DXU A;  3A5Z B;  1M4Z A;  4A4G A;  4M7D F;  3MCA B;  2RI3 A;  2DPP B;  3SWN C;  2EQJ A;  2Y4X A;  3CCM T;  2OTJ T;  2RJF A;  2R5A A;  3JCM f;  3JCM c;  3QDR B;  3H6Z A;  4C8Q D;  1VQ7 A;  2LT4 A;  5IN1 A;  1FWZ A;  2K3Y A;  1VQN A;  5J3B A;  1AHJ B;  1H64 1;  1JJ2 A;  4DOW A;  2OTL A;  1N9S A;  3QYG B;  3F70 A;  3M5A A;  4BDZ A;  1VQ4 A;  1VQP T;  1VQK A;  3OYH A;  3TEE A;  4M7A E;  1WQW A;  3CC7 T;  2ZPG B;  4M75 C;  4NOY A;  3PMT A;  4M77 B;  2GCX A;  3CD6 T;  5GAM d;  4PJO C;  4BI8 B;  2DJZ A;  5EG2 A;  3X26 B;  2RHX A;  5LJ5 d;  3A8M B;  1KC8 U;  1VQL A;  2E12 A;  2DZ9 A;  4C92 C;  3ME9 A;  4X34 A;  2JTM A;  4M75 E;  4A53 A;  3RKY A;  2M0O A;  3KUF A;  4L59 A;  2EJ9 A;  3GLX A;  1WPY A;  3E9F A;  3MO8 A;  2BUD A;  1VQO A;  1KC8 C;  3URG A;  4C92 B;  2XDP A;  4HCB A;  3GIB A;  2F69 A;  4KBM B;  3CCQ A;  2ZPH B;  4J8O A;  2MMP A;  4QVD A;  3CCU T;  2XU8 A;  1XOV A;  3I55 A;  3CCJ A;  1BIA A;  1YIJ A;  2NLU A;  1Q86 C;  2DD5 A;  2V8K A;  2DKG A;  4M77 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...