4NP4H

Clostridium difficile toxin b crop domain in complex with fab domains of neutralizing antibody bezlotoxumab
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
221
structure length
215
Chain Sequence
EVQLVQSGAEVKKSGESLKISCKGSGYSFTSYWIGWVRQMPGKGLEWMGIFYPGDSSTRYSPSFQGQVTISADKSVNTAYLQWSSLKASDTAMYYCARRRNWGNAFDIWGQGTMVTVSSASTKGPSVFPLAPSSTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Toxin B
publication title Mechanism of Action and Epitopes of Clostridium difficile Toxin B-neutralizing Antibody Bezlotoxumab Revealed by X-ray Crystallography.
pubmed doi rcsb
molecule tags Immune system
total genus 35
structure length 215
sequence length 221
chains with identical sequence I
ec nomenclature
pdb deposition date 2013-11-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4np4H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4np4H01
1MRCH 4TUKL 1B6DA 1CIDA 4P3WA 1NCCL 4ONFH 3O3UN 4G9FB 2QSVA 1F8TH 2XN9D 3VXOA 1QRND 3TWCH 5KG9B 2ZG2A 1HZHH 3SQOH 3TBTB 2VXTH 1FO0B 4QOKD 1MIMH 3QIUD 4RRPG 3MR9A 2GSIA 2Y23A 1AFVL 4G7YL 4IMLA 1PG7W 4MA3A 4MNGB 4FS0A 5FA3A 4N1EA 1I8KB 4OF8A 2C3XA 4CU6A 2IPTL 2ORBL 1WZMA 1D6VH 5IMOB 4ZS7H 3V6OC 3BGMB 4YBQD 4E0RB 4HFUL 5FOBA 1FCCA 5I8OH 3O3AB 2OLDA 4AEIL 1XT5A 1WUNT 5JW4M 2V7NB 4EN3A 2HRPH 1G7MB 1ZK9A 1WCBB 3CVHH 2VR4A 3I75A 3SCMA 3G08A 4TVPD 4LEOB 1PZ5A 4U1MB 2OTPA 3D2UA 5C2UB 3HR5B 3G04B 1PYWA 2ZSWA 3I6LE 3EHBD 5D4QA 2AQ1A 2WP3O 4WW2C 4MQ7B 3PIQB 4NQDA 4WEUD 3MRPA 2F15A 5IB2A 5F7EH 3WJJA 1DZBA 1BZ7B 1H8SA 2E6PA 1DANU 3BUTA 4ALAH 1RIVH 3DTXB 1A22B 4GO6B 1VGKA 1T5XA 4PRDB 1I8MB 5INCA 3I3EA 3VG9C 3K8LA 1T66C 4F57H 1KJVB 1I4FA 5IBTH 2FH6A 3M8OL 4KI5E 1F4YL 2BXYA 3DX8B 3ULUF 3DX7B 1AQKL 4HUWB 1DDHB 1MCLA 3U4EA 1EHXA 3H0TA 1OWRM 4PJCF 2D7MA 4R7NB 1UVQB 2ZSVA 2OSLB 4DGIH 1TCRA 5IW3A 4M93C 3OKDA 4P23B 4D8PB 3DYOA 2I60H 3WBDA 3OAUH 4XX1E 3BVNB 1G7IA 1ZVHA 4X4XA 3ARFC 1KEML 2FX7L 3MLSL 4OZ4B 2GSGB 4KK5D 2P44B 2HJFB 3VFUB 3ZTNH 4NKMB 2H3NA 4FQQB 4P2QE 5IQ7L 4NRXA 2XXMB 5FAAA 1LHZA 3MV11 3MNZB 1KLGB 4YZFF 3O0RH 3RKPA 5ANMA 1DBMH 4NM8H 4PRPB 4AEHL 4HW6A 4PGEB 3VXNB 1ORSB 1NJ9B 4JDZA 1OPGH 3R0MA 3RX5A 4Q9RL 2FRGP 5H37H 4JO3L 1F6AB 3IDXH 5T3ZL 4UQ3B 3S98A 3MLTB 2PYFA 2CRZA 1LP9F 4Y4KD 5DHYB 3DX9B 3T0DA 2A0LC 4Z77A 1N6QH 3UZQA 4TOYH 4NQXA 2R39A 2R4RL 3G6JB 1U41A 4ORZC 1I1AC 2BSRB 5DR5H 5J1SC 5I30L 3AMKA 1YNKH 3VXRE 4ODUB 5DRZA 4KKBC 4MA1B 3QDMA 5BZDA 2F54D 3QWOB 5CJOH 3WS6A 4PJHA 3LQMA 5HHPB 2OR7A 3CDCA 1UZ8A 1UYWH 1F4XH 1H3VA 2W0FA 3KPMB 4UDUB 1YNLL 2B1AL 2B2XH 3U7AA 3RWJA 3QEGH 1U92A 3Q1SL 5EBWB 1P7KA 4G6KH 2VDMH 4X7FC 2AJZB 2NY0B 4ORGA 4XNMB 1JWUB 1I7TB 4CADA 3MX0A 2BSSB 1BAFL 1W72H 5T1KD 5ICZB 1U8LA 3SDAB 5CP3H 5T3XL 1QFOA 4FTVB 4PS4L 3GZKA 3WNNA 3EYOB 1XGRB 1IC7L 4NGHH 4LSSL 2HKHH 1TETH 2VSDA 2QSQA 5K9JL 4MJ6A 2M2DA 1BECA 3TJEH 2XFXB 3N1MC 1CDGA 4NWTL 1A9EB 1NUGA 2BJML 3O6ML 3UTTB 4JY5H 5C0JB 1G9ML 2PYED 1L7TL 3LKPB 2ITCA 3LKRB 1Z5LB 2ZCKH 4R4FL 1T66D 4QNPE 5JORA 5IKCB 5DZOA 3UYRL 4TSCL 3BN9D 3O11B 4MB5A 5EOQL 1RZJC 5F1KC 1FL3B 1QFWI 3B6SB 1JUFB 5EN2A 4P4KC 4PUBH 4ZUSA 3BGFC 4OFIA 4RRPA 1C7TA 4DZBB 4JRXE 4FG6C 1S7UB 5GJSH 5GGVY 4HIXH 1YPZA 4ZODA 1MLCB 1U3HA 4QRPD 4PJ8C 3CNKA 3VW3L 5DQDH 1RUML 1P4IL 3OKKA 2AABL 3NA9H 3TCXA 3W9DA 2YN3A 1RJLA 4D9RD 3QUKA 3ARFD 5TDOB 1O5DT 3N1GC 3D39B 4OZIB 3CD4A 5MEQB 5ADOH 3RZCB 3HNTL 2KBGA 3PUCA 4R0LB 1FIGL 4PRHE 4WUUD 5C0CA 1UKQA 3HRPA 4MXWH 3C5ZB 4U3XA 5L0QC 3ULVF 1DL7H 4XP4L 1YUHA 4MAYA 4ZQKB 5LCVL 3V4VL 4XTRC 4M48L 3O8XA 3AM8A 1UQSA 2AJXL 3G6AB 5D9SB 3D3VE 1HHKA 3STLA 3QHFH 3HI1A 5K9OA 1ITCA 2MJWA 4QRRB 5IEHB 3MV9E 4X7SL 1Q9OA 1YY8B 2A0LD 3RBSA 2COQA 4HS6A 1OWWA 3BP7A 3NTCL 4GAGH 3BZ4B 1I1AD 1MFDL 4LL9A 3V4PL 4X99A 4KKBD 3ZDZE 5C9JB 4JFED 1CFNA 3VWKB 3GSNB 2J8UA 5I9QC 4D94A 1N2RB 3LEXA 4NHUB 1OAXH 5F1SA 4JPVL 4NQEA 3PJSA 1HZHL 1BM3H 3RVWD 1JNLL 2VXTL 2W9DL 5T33H 3S36X 2Q3ZA 3C8DA 2I26N 4IRJB 3LKSB 4FQIH 1DSFH 3VXUA 2EDBA 2DICA 2W59A 1JWSB 1AO7D 4GW4A 4GXUM 4PP2B 4U3CA 5F44A 2HLAB 3G6DH 1KTLB 4GRMB 5CIPB 2Y4SA 3EZ8A 1D6VL 2HYMA 1S7TB 2BNRA 3HG1A 1IT9L 1KB5L 1DVFA 4HMDA 4JO2H 4A2LA 3QDJB 2AXJA 3I6GB 1GOHA 4J3XA 4WV1B 5JHDB 1FZMB 1WZKA 2HRPL 3ARPA 3PGDB 3BE1H 4EN3C 1AY1H 4H1LH 5H35A 3CVHL 3NFPA 4D3CH 4EI5A 1LP9B 1JJUA 2C3VA 3SCMC 5F9WC 1CICB 4OLWL 3CMGA 3B3IA 1AGDA 2GQHA 3BUYA 4P3DA 3RWHA 5I1EL 3R1GL 2AAVA 3HPJA 1X7QA 1GOGA 1KT2B 5A1AA 2YPLA 2W92A 4OLYH 5F7EL 2FHBA 1PX3A 2Q8BH 1XGTA 3WFBH 5F7FA 2NY4C 3WJJC 4DOHB 4TRPH 3IKKA 3U9PH 2F8XC 1J88A 1RIVL 3GM8A 2CDFA 1JV5B 4QF1A 2YMXL 1V3KA 3ES6B 4I13B 3ZZ1A 4PJ8D 4JFDB 2DIBA 2JJTA 1AI1H 3RL2A 5IWLC 5MEOB 3TYGH 3U48A 4F57L 5EIIA 2FLRT 3WKML 4M1DH 4KAQH 5C8JA 4L8SA 4PIRF 1AQDB 5IJKA 1Y18A 4HGKC 4K9EH 4NT6B 2AV1A 3JWDC 5J4MA 1QRNE 2OP4H 3EDJA 3KPPA 4M4PA 5DRNA 5ERWA 4PG9A 1FFPA 1F4WH 2F5BL 1Z9SA 3VXTB 2I5YH 4LCCA 4QOKE 2ZUQB 4M7KL 3L3DA 3CH1A 5C0GA 3VA6A 4XTRD 4UILL 2FD6L 2UWEE 4TQEH 2I60L 1MHCB 2FJHB 2HH0L 5DQ9A 3OAUL 4X6DA 5CHNB 3QA3B 1HCFX 4OUUB 3TCLB 3BRFA 3OZ9L 3X14B 5CJBA 4H0GA 2DQIL 1GCFA 2ID5A 3DPBA 1EVUA 1AXTL 1AGBB 1ERNA 5K33A 4JJHA 3SPVA 1EX0A 2AI0L 5FK9A 4TVPE 2EYSA 4K94L 4PJXF 3H9HB 4XI5C 4LVHC 5E24E 4HEPG 4ODVH 2P46B 4Y5YA 3UTQA 2ED9A 5DVNA 5IV2A 3HZMB 2EE3A 5GRJL 5JIKA 5TQ2L 4GW5B 4PTTA 1AKJA 1ZHNB 1A6AB 2MSPA 3F7YB 4YUEH 5J13C 1K8IB 4WJ5B 5EC2A 3WNMA 4LP5A 5HHOB 3BDXA 1XR9B 3WFDH 3LPFA 4YXHH 1MEXH 1F4XL 3DI3B 1UM4L 3QIWB 5C0IB 1AE6L 1FHGA 4HXBL 3ROLB 3CFDB 4L9LB 4G6JL 4N5UA 1JHKH 3V7AE 2B2XL 5IMKB 4N90E 3U0TB 1V05A 4G6KL 2VDML 5E94B 4PTUA 2P42B 4LBEA 5L8LB 5D2NB 3D18A 1FG9C 5C6PB 4LVOC 5C08D 4JRYD 4D0DA 3KPQA 3ZYZA 3QNZB 1W72L 3SO5A 4G43B 4HWEH 4RWYL 2IF7A 5FYLH 2B7DT 4NQDD 1TETL 1L9MA 4YHML 5CBEB 2UY7A 3QPXL 1CL7I 5GGUB 1U95A 3KLAA 5D7SH 5C0DB 5IVXA 5SWZB 5B3JE 1HHHA 1F5WA 1T20B 4JY5L 5IFHL 4PJGE 3MUGB 3WHE1 5KVDH 5JO5A 5D7IE 4FXLA 1UCBL 3LKQA 4IOIB 2YS4A 2CRMA 4TUJB 2DQTH 1Q1JL 3T4AB 4W4NA 3RUGB 5ACZB 3CSYB 1XR8B 3IFPA 1JRHI 1WBYB 2Z8VC 3FONA 1UWEH 2V2TA 4MAUH 1AR1C 3KJ6H 4UAOC 1RVFH 5GJSL 1T1ZA 2I07B 1EJ6A 4HIXL 4DKEH 4UTAH 4WTWA 3EKCA 1OP5H 1CGYA 5EU6B 1UENA 5HYFA 1U3HC 2G5BB 1A6TB 4NN5C 5ID1B 1N6VA 3ZT5A 3ESVF 3QCUL 4M3KB 3SKNB 5I19H 3KPNA 2F54E 4PD4J 3P73A 3O4LA 1J1XH 4N1CA 2R1XA 3LRHA 3DO7B 2Z9TA 1JF1A 1OOAA 4Z7OF 3U46A 3FHQA 3FQWA 3V6OE 1JTOA 4GBXC 1TZHA 3MLYH 3DRTB 4PREA 3LSOA 2NY6C 2D4DA 3UPRB 1Z0NA 3NIDF 4HV8A 1Q72H 2RIKA 4MXWL 3QUXB 3RVUC 3L6FA 2FIKB 4RDQF 3SKMB 1S7SA 3DVIA 3BH9B 4HIJB 4LP4A 2EH8H 4WEBH 3WYRA 5CP7B 4LVEA 4OT1H 4Y5XB 3QO1A 3CDGA 1ZGLB 4WHCA 2CRYA 3KXFD 3JBG7 1CLCA 3Q2CA 1P69B 5DJAB 5E8OB 2VO5A 3CX5K 5I17A 5ADPH 3O81A 4HC1L 1HSAB 4G6ML 2GEEA 4PRBA 4AM0A 1Z9LA 1X5HA 3EYUH 5D5MA 1MJ7H 3GRWA 5MERA 1C1EL 5DQJA 3MLUH 4U1JB 1CVSC 2PYEE 5GGRB 2V9QA 3WFCH 4S1RH 5D1XA 4QYOA 1UJ3C 4BH8B 5DHVB 2Q1EA 1P6AB 4I48A 5IMMB 4JFFA 2VLRB 1IM9A 4BZ2L 4TTGA 5GSVB 2HTLC 4ZUTB 3EOBB 2DL9A 1I85A 2QSCH 5GRWA 4KKNA 3LKNB 3WD5L 4NNPL 5DGRA 3LPWA 1JZ4A 4QRPE 1I9IL 3LN4A 1PZUB 1I1YB 4YEEA 3BQUC 3G6DL 1WICA 2IANA 3MREA 4P0DA 3BZFB 3SE4C 4E5XA 2VR5A 4XMKH 1MCWM 1J87A 2E7BA 1ZTXH 2DQUH 3S37X 1OSPL 1G0DA 4P2RD 1FJ1B 2QADB 3WUWG 4F3FA 2EDNA 4M6MH 1EAPA 4WUUE 5C07B 2BVQA 1QEWA 4EIZC 3EJZC 2YRZA 2IFGA 5DRXA 3DGGB 4Z5RB 1LQSR 3MFFB 1MI5B 1NDMB 4U1KA 3OHXB 2KPNA 3PWVA 4LEXH 5L9DL 1JWMB 2RAMA 1MCPL 1OT1A 3M45A 4OI9A 4RA3A 4C54A 2FWOA 1C5DA 2HFEB 1AR1D 2Q8BL 2VN7A 3WFBL 4BFBD 2AJ3B 4TRPL 3U9PL 3NFNA 3SGJA 3WIIH 4K3DH 2DDQH 3X11B 1Z6JT 4KROC 3ULSA 1MCQA 1TQCC 1WITA 2IALA 2WLYA 2JJTC 3IVKB 4JFEE 3DIFB 4AH2A 1RQ5A 1WBZA 1AD9B 4KAQL 4LK4A 4ONHA 3E8UL 4I4WA 5I1AA 5IG7B 5DD6A 4NRYA 1AH1A 3MODH 5IJKC 4GBXD 4PJEE 1RZIB 2BSED 2OP4L 3UROR 4XVSL 2EECA 1IGFH 2NY6D 2ZCLL 3C6SA 3MCKA 4ODXA 1E4XL 1CN4A 1KTDA 1U8JB 1IAII 4RA0C 4GRLC 5HGHB 3V0AC 5IMLA 1P1ZA 4QHNA 3IJHA 5CD5C 1JHLH 2V7HA 4B5EA 1UZ6F 2HT4C 2P4AB 1EAJA 3RNQB 4NNYB 4GJTB 1F42A 4S1SH 4Z8FH 4UDTA 3SDCA 1CGWA 4PRNB 3CFIC 4RMTA 4HUXA 4J3VA 3RIAF 4H20L 5ALCL 2VC2H 1GC1C 2DOCA 2KUTA 3INUH 4MDIA 7FABH 5IEKA 1KJ2L 1XF4B 2J4WL 4NO2B 5I1CL 1MAMH 4ZTPL 1T3FA 2W65A 3K80A 5ITBH 3MROB 4XPFL 3BT2H 1T2QH 1M05A 5JW3L 1GXEA 5KAQF 1T83C 2IEPA 4P5TC 1FGVH 1WT5A 5LGJA 1XZ0A 3MV8D 4YNYA 1ZLWH 1BF2A 2ZKHL 4Y5YC 2HTLD 1S9XB 4PGBA 4XHJD 1HYRC 3GI9H 5KSUB 1JIBA 3OV6A 4U6HA 1EMTH 4YUEL 4P2YA 2APXA 3TO4C 1DN2A 5GS0H 2X4SB 4ZNEE 4RZCB 2J3SA 3FHAA 2Q7YA 2WUBH 3I02B 4U1NA 5BOPA 4DKFL 5KVMC 5HGDA 3BQUD 1CI5A 3CDYA 5FYJL 1NUDA 4EJ1C 4KRMB 4YXHL 3MNWB 4R4NC 4M61B 2IBZX 2VDOH 1BZ9B 5KVFH 5EUKA 1XF3B 3F8UB 5FKAB 1BWMA 4P59L 5FGCB 1RIHH 1RJZA 4XCNB 4NIKB 1A3QA 4MD5A 4NZDA 5KSAA 1DJSA 2VQTA 3NZ8A 2XZQL 5J06A 3EJZD 4DEPC 4HCRA 3TIDB 4PV9A 4FQLH 4PB0H 4QRSA 4XCYB 4Q58C 3W5NA 3ETBF 4PRIB 5DC0A 1YMMA 5D93B 4M7JH 3HAEG 3WIFA 5I1DB 1T21A 5HDBF 5I73C 1EHAA 2NNAB 4M6NH 1MOEA 4BSWA 4Y4HA 5MENB 5JLZA 4KROD 3HRZA 4PJBF 1U93B 5KVDL 2FEDC 5IVZA 5CSZA 3T4YA 3S96A 3VXSD 4P5MA 1G7QA 1M1SA 5A3ID 5F9OL 5CGYC 4PLJC 4MWFB 3VFWA 5C1MB 1OVZA 1S7RB 4PJAE 5TE4H 3C5JB 1A1MB 1IKFH 2IAMA 3MLXH 1NGWB 3HE6B 1QLRB 4R97C 4MAUL 1I9EA 4NN6B 1RZGA 1TVHA 5DMGD 4I3SL 4LHUD 4GRLD 2H26A 2IPUK 4KKLD 5LGHH 3HC0B 4ZS6C 2D03L 4IMKA 3LIZL 3PQYD 2HT4D 5SX4H 3UBXI 5MEPB 1ZE3C 4WRLA 5SV3A 1J1XL 4JLRA 4ZAKB 2VQ1B 1I9RH 1A2YA 4XWGL 3VD9A 4RNRA 3TH3T 3DUUB 4WGWB 4Z95L 3M17A 5FXCH 3L3JB 3OGCA 1MCNA 3WUWA 1FAKT 3VGEA 5F7HA 2GFBA 1RHFA 3FQTB 3HN3A 3BEVA 5D2LA 3EOTH 1F4AA 4CUCA 3SKJH 3K8KA 2Q6WA 3FZUC 2EH8L 4JRYE 5C08E 3UZVB 4P5TD 1IMHC 1OP5K 4JZJA 4UUJB 2Z91B 4OLXH 1GGBL 4LLWA 2VL4A 1H3XA 5ADPL 3BKYL 4HJJL 2GJ6D 1LO0H 2DM7A 2X4PA 3TO4D 3FN0H 4APQA 3LB6C 1IEBB 3B9DA 5BW7A 1QLEH 3HNVH 3ILQC 2NY2C 3BP6B 4QXWA 1NC4D 2YK1L 4OCXL 3CZJA 4S1RL 1KJMB 3NN8B 1QG3A 4R4ND 5D1XC 2QHRL 2NY5L 2O5YL 5HHQB 1HHGA 43C9B 4HGWB 3DV4A 4HT1L 2UYLA 3X3GL 1CR9H 2QSCL 5BRZD 4YQXL 4HG4K 1I85C 4JPWH 3EJJX 4M1CC 4OCWH 1TPXC 3HS0B 4UB0L 4ERSH 5MHSD 5C0AE 5JW4Q 4YWGH 4LCYA 2ILLA 4WW1A 5FGRA 5AUMA 3ZTJG 1NFDA 1OTUC 5DHXB 4CL7A 3ZDZF 2WSKA 4BJLA 5DJYA 1SYSB 3S4SA 1JPFA 2CGRH 4XBGB 3QXDB 4M6ML 2FEDD 2FJGA 3WN5A 5TPWH 3OB0H 1HI6B 1YEGL 3X13A 3EOAB 4MD0B 1BLNB 12E8L 2NR6C 3EYFA 4LHJB 4PLJD 2JJWA 3I85A 3SE8H 5I8EA 1OGAD 4LEXL 3QB7C 1KIUA 3LS4L 2EC9T 5EU5A 4BFGA 3KXFE 1RUAL 4KY1H 4PJIE 2GKIA 5D7KE 1MLBB 4JFPB 2FIRT 5CJQH 4HKZA 2A74A 4Y19A 4ZS6D 1FLRH 2A6IB 5ACLA 5GS1B 2DDQL 2R69H 4P2QB 2Y7QA 3LRSB 3GSRA 5IQ9B 3GJEA 4CMMB 3ZYJA 1KPVA 4JFXA 2NLJB 3C09B 4N8PA 1DLFH 4QO1A 5B4MD 1VEPA 3RY5A 1IC5H 4JPKL 3ME0A 1JGEB 4Z9KB 5ID0A 4L3CB 2YR3A 4KGJA 5E4EB 1T5WB 5CMAB 3GSNH 3TM6A 3OB8A 2H9GA 2UZYB 1JHLL 2E6JA 4LLYA 3FZUD 3GSQB 4PJ5D 3VXRB 1HH6B 2WINB 2KQNA 1P5VA 4HIIA 3HAEA 3MLPA 2B20A 3MJ9L 4Z8FL 5SV4A 3FT2A 2NYYC 1PEWA 1C7SA 2A9MH 1CD9B 5KTEH 3LD8B 1FO0L 1N5AB 1FH5H 2VC2L 5FEBA 1OSZB 4GKSB 2DLTA 5FO8A 5T5FH 4U6TA 7FABL 2E7CA 2B1HH 2OR9L 5L7XL 1YYLH 3LB6D 4K7PH 5GRUH 4XRCB 4IIQA 1TVDA 3BIAX 3ILQD 2NY2D 3WE6A 1NGPL 4P2RE 1T2QL 5CIPH 4Y4FB 4G8EA 5D1XD 4S1QH 1FGVL 4XVTH 4Y89A 1UEYA 2YKLH 1WT5C 2L0DA 5KBNC 3QXUA 5IF0B 1HXMB 1R3KA 3IU4H 4NO3B 1M4KA 1AP2B 3D87B 4MNQA 4OLVL 1XCQA 2HMID 1VGEH 1Z0MA 2UWEF 5DTFA 1ADQA 5IUSA 3M1BB 2F8OA 2WUBL 1IAKA 1IKNC 1WTGT 2UVEA 5DSCA 3BDYL 1DQML 4ENEC 3AXLA 2LU3A 1MF2H 4H88H 5IB3A 1NFIA 1OGTB 3IDYC 1UXWB 1AR2A 2I9LA 1MJUH 2EXYC 3MRHA 5F7WC 1JPSH 2YC1B 4OZGE 1RJYB 5E5MB 1TQBC 2BOCA 5DEFA 4O2CB 4U6XA 1O0VA 3DURA 1E4KA 1ZLWK 2XOTA 2VUOA 4FXKA 3RWCB 4BSJA 2DQDL 1RHHB 1CE6B 5GGSB 1ZWIB 4EDXB 2ZOLA 5D8JH 1S8DA 5CCKL 3X17A 5F3HA 1DFBL 1CDUA 4MX7A 5BQ7A 3SO3C 5DJ8A 4HXAH 1ZT7A 1FZKB 1SJXA 4NO0D 1IZJA 3ZDYE 2VIRA 1NSNL 1U3ZA 3QUYC 1T4KB 2GK2A 4MDJB 4MNHA 5E7BA 3OG4B 3E2HB 4M6NL 4HF5L 4I0PD 1KCVH 1MH5B 5CZVL 4Y4HC 4PRHB 4IOFC 1CT8A 3STZA 1VFMA 3AY4C 2B8OT 1GYAA 2Z93A 3IFNH 4MA7H 5CWSB 3TLRA 4JR9H 3QH3A 1WGOA 5KSVA 3B8SA 3BKJL 5T1MB 2C3HA 2FO4B 3D3VB 5I8KH 1IKFL 2QEJA 4J8RA 5HYEA 3TZVB 3G9VA 3MLXL 1A7PL 3L1OL 3MV8E 4EUPG 2IAMC 3MV9B 4Z0BL 2W0LA 3QISA 4EEEA 3EDFA 4CVWA 2FNBA 4YBLC 5JXEA 2YZ8A 3WMSA 4N0FB 1UM5H 1A6ZB 2CIKB 4WO4B 5A2JH 3BEWB 5SWSA 3T3ME 3IDJA 2NYYD 3QEUB 1G9NH 4M62L 1DN0B 1JPST 3ALXA 5B3JF 1G1CA 1WIPA 2B39A 4LNRB 5B38G 1ULVA 1J12A 4JAMA 5I6XB 3K3QA 4G6AC 4YE4H 4PJ9B 1K3IA 2EH7L 3FB5A 5HI4D 1FVDA 4LSPH 5ISZD 1G6RA 2C7UB 4OF7A 5ITFB 1U8KB 1GPOH 3SKJL 5I71B 1KIRA 2PO6C 5DRWA 3KLHD 1X5FA 3ULVH 1PKOA 3AGVA 5DFVC 4DVRH 3BP4A 4JZJC 3IDNA 4X6CA 4FQCL 4D0BB 3G5XB 4BK5A 4IRSD 3QFJA 5D1QA 2PTVA 3B9KC 4OJFH 4BZYA 4F7CA 1GZPB 2CSPA 2EDQA 1I8LC 4ODBD 3PWJB 5BW7C 3HNVL 1YJDH 5B3NA 5DUPH 4NUGH 4ENED 2C4FU 3MC0A 1P7QD 2V2WB 5D7JB 1S78C 2H2SC 2XXCB 3DV6A 3VXSE 3K2UL 4OCYL 4X5XA 2HJLA 2EXYD 3KNBA 5J1AA 5J11C 3ZKXC 4XPBL 1A7RH 5FO9B 3MUY1 4LVNB 2EDEA 1FE8H 4JHAH 1EBAA 5I1KH 4MCYB 2AK1L 5GGTH 3SOBH 3O3BA 4JPWL 4HUUA 4Z7WE 4CN4A 4WW2F 3T3PF 5BS0A 3PQYE 4K3JH 4NJAL 3WLWC 3BPOC 1PSKL 4YWGL 1YEIH 1ZVYA 3QUYD 2A83B 4F9PA 2WW8A 2CK0H 1UM6H 2GTWB 2F58L 2XN9B 3BW9A 4X8XA 3TF7C 4HBCH 4X7TB 1QRNB 2JK5B 4DGYH 3FT3A 4N8CH 4W68A 5A16A 2DMKA 2CGRL 4IOFD 5JW5A 5MP6H 2JLLA 1KENH 5BZWB 5C71A 1Y0LA 4DZ8B 4QOKB 3BWUC 5I1LA 3GGWB 3QIUB 5F9JB 1ZHKA 1BD2D 1UH4A 2UWEB 4WHTB 4LSVH 1G0YR 1UXSB 2X7LA 1QR4A 3UBXB 5DO2C 1CGXA 3QYCA 4U6YA 3RWFB 1MJJB 4YDVB 5I18H 2XKNB 5HGGS 1A4KA 3GBMH 4GSDH 3VGAB 4G6FD 3F58L 3FB6B 3GMOB 5BJTA 1JYVA 1LO3L 5FYKH 2GJ6E 2VITB 3SKOB 1NLBL 2R69L 4UIMB 1EH9A 2KZWA 1F3DJ 5EUOE 2K1MA 3BJLA 1KIQB 3GO1L 5TE6H 2JJUA 4G8GD 3OB0K 2BVOB 1RURL 3GSXA 4JCMA 3TN0A 2GTZB 4HHAA 1J05A 1KG0B 4G6AD 1BOGA 5BVJB 4XNQA 2AEWA 3VGGA 5IT2H 2BY0A 3NBNA 2I27N 4JY6B 1R5VB 3GSNL 1PLGH 3C2SA 4P4RB 5DHVH 3SDDD 3KYMB 5BRZE 2OTWA 2QR0B 2PO6D 4Y2OA 4KZEL 4ZSOA 4Q6IA 5H94B 5E2UL 2BMKA 1E28B 2GJZB 5DFVD 4PGDB 1U3JA 5EU3A 6CGTA 5MHSE 1D5IH 5IVNA 4YX2L 2DF3A 1VADA 2G2RA 3QR2A 4CVXA 2VLJA 5AYUL 2JCCE 1EHNA 3RWGB 4F15B 2BOBB 4JB9H 3B9KD 3VFTA 1N64L 1HN1A 5GRUL 4PJFA 4XPHH 3DWTA 3IU3B 1IGML 3KLDA 1J7VR 3QQ4A 5I74C 2CXGA 1S78D 2H2SD 3VD3A 5JZ7C 4S1QL 1ONQB 3G5ZA 1FNSH 3TBWB 5C3LD 4QRQA 4OD2A 3R06B 3T65A 1BBJA 4RMUA 4EUPA 5GS3A 1OGAE 4J4PA 3IU4L 2I25N 5HHVH 1XF5B 3MRCB 2R2BB 1U8PB 4I77H 1YEKL 4OZHF 1DR9A 4NP4L 1S7XB 3SE9L 3TIEA 2ICEB 4MB3A 4Q2ZA 1OL0A 1S9KC 1XGYL 4PJGB 4Z7VA 3JTSB 1DE4B 4G3YH 4GG8A 3NCMA 3WLWD 1CG9A 3RAJH 5D7IB 4IM8A 4CU7A 2EDKA 3ECBB 5B38A 1MF2L 4H88L 4P48A 3V9FA 3FFCA 4P49A 4ZNCD 3IDMA 1JZ6A 3GIVA 3H9SA 3RI5F 3VH8G 1QVOB 2VDKH 3IFOB 3V5HA 2XPGB 2X4UB 4F33B 1K8DB 1ZSDA 1CD8A 1E4KC 3NGBC 1VCAA 4HFWB 4Y4KB 4YLQT 3MFGB 3T2NH 4MD4B 2ED7A 2VABA 1ZHLA 5CKGA 4PJ5E 5M7QA 4O5LH 5F96H 4C56D 1ROWA 2RHEA 1BIIB 1HE7A 2F54B 3IRZA 3QUMB 3GKZA 3AUVA 4OM1L 5IB4A 3W0WA 1CDHA 4WFHD 3ARDA 3ZKMC 3IDIB 3BJ91 3MYZA 1DUYA 4F9LA 3W2DH 4DQOH 4XNZC 4GAJH 1VA9A 1LD9A 1D5BA 3NIGE 3CVHA 5GGQL 3BKCH 3QQ3A 3VFGL 5C7XH 4R6UA 4XBEH 3IFLH 5DI8A 2R2HA 3IFNL 4PV8B 4EOWH 3FOLB 2BRQA 4I3RH 2P7TB 2L7JA 1OAYH 1FGNH 1B0WA 1T04B 5T1KB 3I3DA 1IGCL 3OJVC 2Y06L 2FATH 2PR4H 4XXCA 3MA9L 3QXVA 2R2EB 3L3IB 4NO5B 4WW2B 2P5WD 1NGZB 2VISB 4IEFB 1LNUA 3Q6GH 5FGBA 1VESA 4FQXD 3MXWH 4JG0H 3LS5H 3GMPB 1XF2B 2X70A 3ZKSD 3FQRB 1WZLA 3RGHA 1P9MC 2VDNL 1VFBB 5DZNA 2PYEB 1J9CT 1MSPA 3EBAA 4R90L 5CILH 5CFHA 2VE6B 3EOYG 1EHLL 1G9NL 2VUYA 1FVCB 2J1KA 4HKXA 4EXKA 5L2KA 3S7GA 1MFCH 3RQ3A 3O6KH 4LDEB 2RFXB 2X09A 2Q76A 3TBVB 2RCSL 4YE4L 5T1LD 4F7PA 5IW6A 3VFNB 3HE7A 1W0WB 2EXWD 5DD3L 3NCBB 2EYTB 1DLHA 4PJAF 2F5AL 4ZFFB 1CFSB 4HUMB 5JZ7D 1DQQA 1VFAB 3BN3B 1N59A 4KTEH 4WENB 4F8QA 4QRPB 1TZIB 4LSTH 1G9EA 5CAYB 3FCTB 5K93A 3KPSA 2EKSB 2ADGB 1V3JA 2FSEB 3DYMA 1JF6A 3ARFB 1GGYA 5F7MC 4PRAA 4S11A 4KVNL 1RUPL 3QO0A 4XPGH 4U05A 5D1QC 1HSBB 1BREA 2E7LA 1YJDL 4JG1L 5CEZH 1VACA 5DUPL 4MJID 2HAZA 4UINH 4ZUVB 1XCTB 4WUUB 5E8PB 5AAWA 3VRJB 4H1LG 3GEWB 3P9MB 5JNYA 1BFOA 2Y36H 3QUZA 5IBLC 3CZFB 1ES0A 2DD8H 2HFFB 2XTJC 3PHOB 2AJUH 1A7RL 4L8DB 1NAML 5HPMA 1H0DA 1YC8A 3SJVD 3D0LB 3MBEC 3R4DA 1OAQL 5CLWA 2M8XA 4UT7H 3FO2B 4JFQA 4U1SA 4WI3A 2F19H 3Q3GA 3R8QA 5BXFA 3LQAH 1I1AB 4WI6A 3F6IA 3C8HA 4JM2A 4QCIB 4L1HA 2HN7A 4JFEB 5DK0B 1WWAX 2XWBB 3T2QA 4XNYL 4S0TD 4J6RL 3QCTH 1F6FB 5I75C 4O58H 3ZKMD 1JZ3A 2NZ9C 3P11H 4MJ5B 3L3OA 4P5KA 4H26B 1AHWC 4D2NA 3LH2L 4PJEB 4JO1L 3B43A 3REVA 4NNXB 4N9GB 1BQHG 4P9HH 1QKZL 5ISZE 3L7EA 1W72A 2YRPA 3LDBB 5CP3A 4TULL 3VFOA 1X5XA 4UQ2A 2AJYL 4WFED 1AO7B 4L3EA 3MSPA 3O6LL 5CD3B 3QEQE 2E9WA 3P9LA 3HI5H 3N1PC 4GLRI 4P2CG 2ATPB 4ZUWA 1SVCP 4JQVA 1KC5L 5FYKL 3CJJA 4WWKC 4ZXBC 4L8CB 2VDQL 1EO7A 1FRGH 4N0UA 1G9MC 1VDGA 5EZJB 3NA4A 3ZT6A 5KJRH 4ELMA 2PTTA 3C60A 4PJDE 4RFEB 3VH8A 2DM3A 4HJGA 5J1TC 3P4NB 1PQZB 3FQUA 2EIZA 3QG6A 1I1CA 4WU7B 1G7HA 3BGFB 5E08L 4KHXH 5IHLB 2DBLH 4HUVB 2CKBL 1XGPA 2AXGA 4LMQE 2N1KA 3P3YA 3T1WA 1NMAL 5BV7L 5KN5B 3GUTB 3DRQA 3CU7A 3J8F7 3RL1B 4R8WH 3ULUC 3JWOL 4LKCA 1INDL 4HZLB 4IRZH 3GBNH 1A6UH 1JK8A 4JM4H 4PJ8B 4Y8AA 1FFNA 3QWRA 2WBKA 4QRTB 5I1JL 2X1WL 2BXZA 2XNAB 2R0WH 4WTXA 1IQWH 4B53A 1UWGH 3I6KB 2P49B 4YAQA 5L6YH 4XPHL 4MHHG 4NQVA 1I7UB 4H8WH 3S3PA 4K23L 1LDPH 5B39G 1KXVC 3I50H 2EYRB 1OARH 4PJHF 2BVUA 4N68A 3UJTL 1S7QB 3ORJA 4JZNB 4F58H 5EFIB 1FIEA 1QFWL 5IBLD 1BD2E 3MMEA 5IK3A 1JGDB 5T3ZD 2VRAA 3IJYA 1YN6B 1JRHH 4DFIA 1CF8L 5LGKA 2RBLA 3O9WA 3O41B 2BVPB 3IAQA 3MBED 1IEAB 1EJOH 4ZPVB 5EWIH 5JR1L 4O9HL 4ZFGH 3TT3H 3GSWB 2DI8A 4EI6B 1MCJA 4K7FB 2OJEB 4O4YL 1TIUA 1I7RB 3X12A 2MOVA 3IGAA 4AT6A 4PBVC 5IB5A 3UTSA 3NZHH 2WZPD 4CVZA 3QNYA 3FOMB 1FVEB 1XH3A 4G8GE 2NZ9D 2ATKA 1ZT4B 4D9QD 2DWEB 3RWEB 2JKXA 4PJAB 4QTIH 1WC7B 1CGUA 1UCTA 3P0YH 3MV7D 1CD1B 3HR6A 1A5FL 1C12A 1MRDH 4OZFB 4U31A 5KW9H 3BRDA 3PDOB 3QJHA 1YECL 1LEIA 4U7KA 4HS8L 1IQDB 1C16A 3CCHB 3A0OA 3CPLA 2X1QA 3BKML 3VFVB 3T2NL 3GJFA 2PXYC 2Z92B 5IJVA 5T3XD 3T1FB 1JN6A 5ICXA 2AS5M 3NH7H 3EUUA 1U8HB 4UT9L 4RAUA 3OKYA 1MY7A 2QKIB 4YPJA 3ARDC 2VXQH 1YPZF 1NFKA 3VCLA 4WWKD 4PJ7E 4ZXBD 4F9LC 3C5SA 3HUJE 4X6EA 4N0YL 1PVHA 4H1LA 4X6FB 3IFLL 5FYJU 3LEYH 1FNGB 1G0XA 4I3RL 5C08B 4JRYB 5JHLL 3H9ZA 2EZ0C 4XCCH 2MMXA 4GMSH 4K8RL 4O51B 2FATL 2PR4L 2V9RA 4LQ1A 4Z76A 2YD4A 3MZGB 1DQLH 4D0CA 1F13A 3FTGB 3Q6GL 3B5TA 4NQDB 4YHNA 3FFDB 4YXKH 5HBBA 5JOFB 3MXWL 4JG0L 5FGBC 1OF2B 3LS5L 1TLKA 1XGUB 4KZDH 3PWPA 3PABA 3ULUD 2GCYA 2YA1A 2O5ZL 4Y1AD 1PG7H 4LCWD 1LE5A 4RGOL 5J12C 1SJHA 4FQPA 2VYRE 4NOFA 2H2PC 1KGCD 1BQHA 2NY7H 3WIHH 1JNHA 2ARJB 4JPIB 2J8UF 4KQ4H 4NN7B 5F1NB 4HKBB 4L4VA 5IIEA 1A1NA 4ODSH 4KPHL 3LQZA 4RGND 2N7BA 1R5IB 4LSTL 3AREA 1ZA3B 1X5YA 2IH1A 4C56E 1PW3A 4E41D 2HWZL 3VJ6A 1NUNB 5C09D 5TGBA 4BQCA 1NLDH 3O45B 2OS7A 3RFZC 3DECA 4DCQA 4WFHE 5FB8A 3T3MF 1DBKL 5CEZL 2E7LC 4LFHG 1AD0B 2IADA 1BEYH 3T0BA 2FL5B 3ZMRA 1A3LL 3MRBA 4WU5B 5EO1B 1CLOH 4I5BA 1QSFD 5EBLA 4K94C 1KJ3H 1BF8A 2DD8L 2AJUL 1A1OA 1MVUA 3DUSA 2X4RB 1Q9KB 4L4TD 3KXFB 3V6BR 4FQ1H 4PJIB 2P5WE 4MMZC 3UTZA 5I76A 5LWYH 2WNGA 5ESAA 1CU4L 2PXYD 4Z77B 4RQQA 1EDQA 1GH7A 5J13B 4ZOAA 3HPLB 5E2VH 3WHXB 1FYTA 4Y16D 1Q0YH 2C4XA 3DETC 4JM2C 4N0CC 2CLRB 4JHWH 3QCTL 2HVJB 3OTTA 3ARGA 4DGVL 1DBJH 3Q6FA 1R0AH 2BNUA 2FYYA 1CE1L 5B39A 2E3VA 1RZ8B 4DUXA 5ILTL 3U2SA 2AV7B 4PBWD 4XGZA 1HQRA 1YY9D 3IJSB 5K59F 5A2KH 4RX4D 4P9HL 4U1HA 3RDTD 4ORGB 3MLVH 2FHCA 3DVGB 3O4OB 1B2WL 4UOW1 5EC1B 2EZ0D 2ZJSH 3REWA 1IJ9A 1U8LB 5C0BA 4PD4K 4GKNA 4XMPL 4W4OA 4ODWB 4MSWA 1E4WL 4PG2C 3MRJA 4JQVC 2PCPB 3ZKQD 1JTPA 2X9WA 1FRGL 3EDEA 4Z7UE 1IM3A 4X6DF 5GGRY 1X5KA 4MJIE 4P2RB 1V7NH 5K9QI 1AIFB 2XA3A 5F71A 4JZOA 1SJEB 1AJ7H 1X4XA 1MUJA 4U1IB 3VI4E 1OW0A 2FECI 5F6IC 3DBXA 4R2GC 1D5MB 1MQKH 2X4TA 4V1DA 3MRNB 4U0RC 1I8IB 1CXKA 3SJVE 4UAOB 3U83A 1FQ9C 1FPTL 2VR9A 1LO4H 5DJZA 4LPWA 4JO4H 5B21A 4IRZL 1A6UL 4JM4L 1NBVL 1WBXA 2H6PB 1ZA6A 3LAFA 3WXVH 4Q7DA 1OB1B 4UU9A 3ZSTA 3ARBD 3ULVD 2OK0H 4NKDB 2XZAH 2AJSH 4XHQA 4OZGB 1IQWL 3WNKA 1CL7L 1UWGL 5EUOF 1EGJH 5L6YL 1EIBA 4NZRL 5AYQA 4XZUA 4X80H 4GBXB 2NY6B 1K5NB 1LDPL 3I50L 1KCUL 3MOBL 1OARL 3CAFA 4MVBC 2P48B 4HDIA 1IBGL 3FQXA 1CFTA 1H5BA 3PNWA 5DDHB 2XA8H 1D7FA 2CUMA 5MI0C 2O5XL 3EO9L 5B8CA 1CFQA 1U36A 1A14H 2H8PB 4PY8I 5D72L 5HYJA 2GITB 4WFEE 1G7JA 3L9RA 2Q8AL 4KUZH 4OB5L 5EWIL 2EDTA 2HG5A 4ZFGL 3PGCA 4QHLB 2P5EA 2H32B 3JV4B 1MNUH 3WS3A 1QFUH 4OD3L 2JCCF 4S10A 3DETD 2C5DC 4JM2D 1FORH 2BNQA 1T7ZA 4XPTH 5IB1A 5IR1A 1UJ3B 1LEKA 5KVEH 1WQVT 3MUJA 1UB6A 4FP8L 4QTIL 3L3HB 4U1LA 3SDXE 3LN5B 3MV8B 1MRDL 3VXMD 3K1KC 4TN9A 3ZHDA 3A6OA 2DMBA 1TJIH 3GI8H 1LMKA 3I2CH 4CRPA 3UYPA 3KYOA 4HIEA 1BJ8A 4ZO7A 3HCVB 5KOMC 4TVPH 1PEZA 1QQDB 2B4CL 1FFOB 1QSEA 1MCKA 1VKXA 3ZE1E 2DJ4A 4X7CC 3BQUB 2B5IC 1K4CB 5FM5O 4Y2DA 1CBVH 3NABH 3VWJA 5AAMA 5KS9A 1RZFL 1X5JA 5DYOB 1DBBH 5F3BB 2MKLC 2DMCA 4ETQB 2DYPD 3GMNA 2AKRA 1QZ1A 4P3CL 2BSTA 3KPLA 4F7MB 1MHEB 1NCNA 2VLKD 2VOTA 1FG2B 3PGFH 4I0CC 2G60H 4LSDA 4POUB 3RIFF 2XQYK 2Y07L 4XCCL 1NEUA 4FTVE 4GMSL 4GQ9H 2F53D 5I66B 4R2GD 3DARA 1HOCA 3OKLB 5T3ZE 4LMQI 1BQLH 2D0GA 2P8MB 3LV3A 3O3EB 5EU4A 5INDA 2DLEA 3P77B 3EW3B 3QIBC 1CDBA 2WWKO 3MRMA 1UA6H 1YN7B 2CDFB 2J88H 4KROB 1OP3H 5DS8A 1WLHA 2DQEH 1TQCB 5DUBB 1T03H 1CCZA 4LLVA 3MJ8B 1GZQB 2YSSB 1D9KA 1D6EA 3VXSB 3UCRA 3TBSB 3HI6H 1EA9C 5D5MF 4D9QE 4X0KB 4EKXA 2A6DB 2W1NA 1TZGL 1ITBB 2NY7L 3MV7E 1BFVH 4NUJB 3BXNB 2NW3B 4G9FA 4M1GH 3CLEH 4XP1H 4LHUB 4GRLB 5KG9A 1RI8A 4KUCD 1FZJB 4Z7WB 5F89B 3PQYB 3TBTA 5D71H 3M07A 3OKNB 3AREC 3T8XB 5T3XE 4TPRH 5I2IB 1FO0A 3QDGD 1AC0A 4PY8J 5JUEH 5F1IB 1A7NL 1NLDL 1S7VA 5JDSB 5C6TH 4ZD3H 4X6DB 5E03A 4OI7A 3E3QC 5ALBH 2Y5EA 4QEGA 3S9DB 3GB7B 2WV3A 3GNMH 3IDGB 4MNGA 3FAXA 1I8KA 2WUCH 1YYML 3QUMH 4NKIL 5IMOA 1XIWD 2AJVH 1W0VB 2MCG1 5I8CA 3BGMA 1J0HA 1I1FB 4FOMA 4E0RA 3O3AA 1KCRH 3P30L 4P5TB 3RTQC 2V7NA 1C5CH 3L5WA 1G7MA 4K07A 1WCBA 1X5LA 4Y5VC 1MIEH 5TE7H 1WAAA 1IAIL 4LEOA 4U1MA 4JHBA 3HR5A 2GJ6B 3G04A 3TO4B 4X4ZA 5DJ6B 4YDKL 4JN1H 5E2VL 4MQ7A 3PIQA 1JHTB 3ULUE 5EUOB 2RQ8A 3CFCL 4HIHB 1NC4B 4JHWL 5EC2B 3UC0H 1C08B 3EYQD 2ZUUA 4Y1AE 2CMRH 4PJCE 4LCWE 2J7LA 1DBJL 3DTXA 2EC9U 3ARGC 5DJ0B 2AEQH 4PRDA 5IFAH 1I8MA 1MHPL 4DKDC 1CDCA 1KGCE 2ZCHH 4X4MA 2QHLA 1KJVA 1M6OB 3QQ9D 2X05A 5BRZB 3B2VH 4LBEB 4AQ1B 3MLVL 3DX8A 2DLFH 2QQLL 2FB4H 3DX7A 4M6OH 4RGNE 4HUWA 1DDHA 2DQCH 5IVOA 2MTPA 1MPAL 4UV4L 5JW4R 4R7NA 1UVQA 3QCVL 4E41E 5JXAH 2JCCB 1UJTA 4MA8H 5C09E 1MVFA 4YZFE 1CXFA 4D8PA 4P23A 1I1RA 4QXUL 1SM3H 3QIBD 5JIHA 1VHPA 1W2KT 2RR3A 1U95B 1JGLL 4HJ0C 4EVNB 3BVNA 4N5EC 1KEGH 4LOUC 4OZ4A 2VH5H 4QGTA 2VSCA 2GSGA 1DP0A 2HJFA 3VFUA 1AJ7L 3N85L 4JKMA 4NKMA 5AEAA 1QSFE 4FQQA 4NSKB 1AXIB 3EO0B 2OXHA 1OGAB 1OW0C 3UJJL 2GT9B 4YHZH 4HUNB 3MNZA 1QHOA 3RA7L 1KLGA 3WUZA 1I3RB 1K3ZA 5I1GL 4L4TE 4JVPA 4PRPA 2WIIB 3VXNA 4PGEA 1ORSA 4S0SD 1NJ9A 3K1DA 1LO4L 1C8PA 3NMEA 1F6AA 3NCCB 5C0EB 5EORH 4UQ3A 3L5XH 3MLTA 3VDBA 4NQCD 3WXVL 1IRAY 3DX9A 5DHYA 2GAZB 1N4XH 1EEZB 2BC4B 1RMFL 2XZAL 3G6JA 2AJSL 2BSRA 2IQ9H 4ODUA 5LXGL 1MREH 1A0QL 2J6EH 4X80L 2APBA 1RZ7H 3V95A 3KPRD 3QWOA 4PJDF 5HHPA 1GAFL 2BRRL 2C3WA 3Q5TA 3VU2A 5JQHC 1H5BC 1QFPA 2XA8L 3KPMA 4UDUA 4PYHA 3ESUF 4PJ5B 2DIJA 3BI9X 1CXIA 3L3GA 5B8CC 5EBWA 3RTQD 3VXQA 5CINL 2AJZA 4XNMA 4X4YB 1JWUA 2BCKB 5CGMA 1I7TA 1F58L 4KUZL 5GIRB 3VRLF 3RGVC 1CK0H 3D0VB 2BSSA 5ICZA 1OT2A 4J12A 4BH7B 1MNUL 1Q0XH 2IH3B 3BMVA 4L29B 3ARSA 4KXZI 5FHAL 1Q94B 3EYOA 1RZKC 1XGRA 2NY2B 1FYTD 2DQFB 2J8HA 4LRNH 4DN3L 4XPTL 3BH8B 3MYJB 2XFXA 1KCKA 1A02N 5D1XB 3U4BH 4M03A 1KLUB 2NY5C 3ARGD 3UTTA 5C0JA 2P45B 2E27L 5CJ5A 3LKRA 4GKZB 1Z5LA 4NQSB 4OFPA 3DX6B 4XB8A 5IKCA 3I2CL 2NXZC 4HG4J 3AB0C 2CLVB 3TYFB 3O11A 1I7ZB 2DBJA 4PR5B 1FL3A 3B6SA 1Y6NR 4TVPL 1JUFA 4GG6E 3OKEB 1RZJH 1TPXB 4L4JA 5GRVK 5DT1H 2PUQT 2XWTB 4B0MM 4DZBA 3J7HA 5HHOE 2NTFB 3EO1B 2HKFH 3U0PB 1S7UA 3NABL 1CBVL 3T0XA 1RUQH 4KTDH 1MLCA 3ULVE 3HB3C 1IGJB 1DBBL 2R4SH 4QXTB 3L5JA 2HRLA 4HJ0D 1MFEL 5A40E 4N5ED 3OJDB 1YQ2A 4LOUD 1P6FA 5TDOA 4XT1C 4NRZB 4XAWL 3D39A 4OZIA 3RZCA 5L88L 5DRXB 3C5ZA 4BQ8A 4NO0B 1TTUA 2A1WH 2A73A 5D2LF 5KOVC 2VKXA 4JFZH 4ZQKA 1IGYA 3SGDI 5ESQB 2VDLH 2OYPA 4J3OC 4DWHA 5IGXL 1S5IH 2DJUA 4BKLB 1T89C 4I0PB 4OBSA 3G6AA 5D9SA 3HC3L 1ZANL 3VDAA 2DQEL 4QRRA 5HYSB 5IEHA 2BP3A 1YY8A 3OSKA 2IWGA 4PJ7F 4NWUH 1D9KC 5E2TL 3BZ4A 5D96C 1EXUA 1KPRB 2KZ1B 1V3MA 1KN4H 4LRIC 5C9JA 1P7HL 5HGBB 3WHE0 4HPYH 5TH2B 3CLFH 3VWKA 1IE5A 4JKPL 4YO0B 3GSNA 3VXME 2X4NB 3HLAB 3OX8B 4X5WB 1N2RA 2G9HB 3QHZL 4NHUA 4XP1L 5GGSY 3BZDA 3LHPH 5C70A 1CGTA 4M5YL 5E9DD 1GGIH 4U33A 2Z8SA 3HC4H 1N26A 3V0WL 1OP3K 4OZFH 3DO7A 1YEJH 4IRJA 3LKSA 5C6TL 5D6DA 3RGVD 3FB7B 3HFMH 2J5LC 2W9LA 1ZT1B 5F7UA 4TUOB 1JWSA 2JF1A 2P5ED 4PP2A 4K71C 2HLAA 1KTLA 4WUKH 2HTKC 2WUCL 4GRMA 3RY6C 1RFDH 5ISZB 1CS6A 1NFDF 5J6HB 1S7TA 1L7IH 2VLKE 3NAAH 5SX4I 4HCRL 3QDJA 4B7IA 1U2CA 3I6GA 1DQDH 3DNKA 4WV1A 4FQ2H 1OAUH 5JHDA 2F53E 1FZMA 4P9ML 3PGDA 4X83A 4YNYB 2VXSH 5TE7L 2NXZD 2VZ1A 2R8SL 1LP9A 4IRSB 1CICA 1BBDH 3K2MC 4J1UB 5DVKA 3V52L 2JB6A 1KT2A 3RPIB 3D9AH 4LSRH 3HHRB 1WZ1L 4ISVB 4PJDB 4F37K 1P7QB 1QHPA 4JFOB 2CQVA 4NYLB 3TC9A 1CGSH 4UOJA 1NMBH 4X7EC 1M7XA 3HB3D 3IDYB 4G9DB 1JV5A 3MXVL 5AWNL 3ES6A 5HGAB 4RSVA 2FHFA 4JFDA 5MEOA 1TQBB 3FT4B 4LFHD 4V2BA 3VFPB 5CUSH 3HZYB 4OCSH 1KB9J 3BAEH 4I0KA 1QFHA 4DVBB 4CGTA 1E0OB 1KSRA 1AQDA 1FLTX 3K7UA 1KIPB 4NT6A 1HH9B 5DD0L 4HWZB 3G5YB 3RU8H 5DMIH 3JWDH 1GRWA 3SO3B 4OQTH 1OLLA 1I3VA 1N5YH 3VXTA 3QDGE 5AZEH 4X5LA 3PP4H 3QUYB 4Q6YA 1EEUA 3A6CH 5J56B 4OKVB 5LAXB 1SM3L 5C2BH 3WFEL 1MHCA 4PJXE 5GZNC 4KDVA 2FJHA 8FABB 2QLVB 2NX5D 5CHNA 3E1F1 3QA3A 3N9GH 5C07E 1DBAH 3TCLA 2EEAA 2P43B 1K6QL 2ZUSA 4ZDHB 3SY0B 3QDAA 1G7QB 1HIML 5DJDB 1BD2B 2GJJA 2NW2B 4FQJH 4YHZL 1AGBA 3IS1X 4ZYKB 1J0IA 3RNKB 2YD9A 1Z3GH 3CC5A 4G6FB 3H9HA 2H45A 3VA2C 3P4LA 2DKMA 5EORL 1D5ZB 1OY3B 3P2TA 3L5XL 3HZMA 5IFJB 1T0NB 4GW5A 4RGMC 3U1SL 1ZHNA 1A6AA 3F7YA 15C8H 1GSMA 5DJXA 1J1OH 4G8GB 1JGUL 4TYUA 4GXUN 3A6BL 3RKDC 2Z8WC 1NBYB 2IQ9L 1K8IA 4TSAH 5FYKU 2O61B 4DW2H 2YHGA 5KSBE 1EK3A 4WJ5A 4CMHC 1XEDA 4K3EH 5T1DL 4MA1C 4YC2C 5F7DB 1RPQA 2HTKD 1XR9A 2VB5A 4TSBH 5E8EA 1EO5A 4CDGC 3NVQA 2GFBB 1KPUB 3QIWA 5C0IA 3ROLA 3CFDA 4P57B 4L9LA 5D2LB 3SDDB 2V2XB 1NGXA 1QA9A 2PO6B 5IMKA 3TEUA 3LMJH 1HDMB 1MWAB 2YEZB 4AL8H 5E94A 1ZLSH 1NAKH 1U3YA 5D2NA 2X44D 1A9BB 4IOSD 2WANA 4P46C 1RK1B 5JDJA 1CK0L 3GSUB 3TT1L 1HHIB 3QNZA 3QQNA 4PJ7B 1GHFH 1LK3L 4G43A 3HUJB 3B9KB 5FGSA 2D3VA 5HXMA 1QR1A 3H6JA 1EFXD 4LRNL 1CD0A 3ARTA 5CBEA 2FX9H 5GGUA 5DVMA 5C0DA 3U4BL 5SWZA 3V0VB 1T20A 2HP4A 3MUGA 1C5BH 4NC1C 4LDOB 5GGTA 4IOIA 3KVQA 3PF2A 1W8OA 4TUJA 4LF3B 2VMFA 3TA3C 1QSVA 3RUGA 5ACZA 1T2XA 3CSYA 4Z7OE 5JQ6L 1XR8A 1WBYA 5EA0H 2I24N 3BPOB 3DROB 3NIDE 4NQCE 2HKFL 3BIKB 5HVWA 4LCYB 2I07A 5DEGB 5EU6A 1F11B 2G5BA 1QO3B 1A6TA 5ID1A 4TTDC 3PE9A 2EO9A 3T0ED 3E6FB 5GZND 3SKNA 5D6CB 1T6VN 4L5FL 3CXHJ 1B0RB 3KPRE 4DN4H 3LPGA 3JZ7A 3QWQB 1QBMH 6FABH 3X13B 4BFIB 3DRTA 5J8OA 3UPRA 3RZCC 1GOFA 3OF6A 4UV7H 3VGDA 3GIZH 4FXGB 4C56B 2XQBH 3QUXA 1FCGA 5TFSH 2A1WL 5H2BB 1DANT 2FIKA 3RJQB 3SKMA 1AGFB 3BH9A 4HIJA 5EU5B 3LZFH 5HDQH 5CP7A 3ZE1F 2L4OA 3JVGC 4Y5XA 1B6UA 1ZGLA 3EGSB 4X6CF 1RK0B 5I1HL 4OFKA 3H2WA 5E8OA 3SBWC 1TTFA 5HVGB 4JDVB 1KCSL 2XG5A 4JDTH 5J6GB 2H32H 5FM5M 2KL6A 3K0WA 4U1JA 3IXTB 5GGRA 1MRFH 4HPYL 1A6VL 4BH8A 3CMOH 5DHVA 2P5WB 4HWUA 1T22B 5IMMA 4FQXB 2HJKB 2VLRA 1GGIL 3U6RB 3Q5OA 5C0NC 4LLYB 5GSVA 1FNLA 4ZUTA 3ZL4H 1L6ZA 3GHBH 2X89D 5ECJE 2DL2A 3ZKNC 3NPSC 4IDJL 4P46D 3LKNA 4UBDC 4GLRH 5I16B 3HFML 2CRIA 4N0RA 3FL7A 1I1YA 4EBQH 1R5WB 5T1LB 2JB5H 3L5HA 3PL6C 3BZFA 4I2XE 5I74B 2BFVH 1BX2B 4FZEH 1FFQA 1NC2A 1ND0A 3F7RA 5GSRB 3UO1L 1MFBL 2E7HA 2YUZA 1OAUL 1FJ1A 3P4OB 4WV1C 4ZTOH 2VXSL 5EO0B 4OD1H 1R3KB 2AEPH 1JBJA 4Z5RA 1V7MH 2HFTA 3TA3D 1BBDL 1LEGA 1MI5A 1NDMA 3MFFA 2BZDA 3OHXA 1KELH 1CICC 1PBYA 3ZE0F 4MZ3A 1JWMA 4Z7UB 2WBJC 1ACYL 1SEQH 4I18C 4GMTH 1NPUA 3D9AL 3MCLL 2HFEA 4MJIB 1S3KH 4YHKH 4JEGB 1YEFL 2XZZA 3MTRA 1FNAA 4ONGH 3DMMD 1CGSL 1NMBL 5DK2B 3X11A 4YHIB 3S88L 1UZ6E 1OD9A 2O26U 4YPGB 5CUSL 3IVKA 5E6YA 3DIFA 5DEFB 2QQNH 1JI1A 5DJCB 1AD9A 5JTWA 3SJVB 2AK4A 3EYSH 3NGBB 4FXKB 4KJWC 5IG7A 2IBGA 3C6LD 5EULV 4GQPH 1EUUA 1RZIA 5E9DE 1MCDA 2LTQC 3QXWA 5DMIL 4XMLL 5D70L 4OQTL 1U8JA 3C2AH 4OF0A 2EDDA 2PW2A 5HGHA 4Q9QH 1DQTA 4Z78A 4FN0A 3L95B 4JVUA 3RNQA 4NNYA 3FRUA 4KHTH 4ZO9A 3E0GA 1IFHH 1U91B 5J89A 5CS7A 4PRNA 5BCAA 4UIKH 1T1WB 5EZIL 1DBAL 1G6RL 1E6OH 4LSUL 5FHBL 3HNSH 1QLFB 5E00B 4CNIB 1GC1H 1XF4A 4NO2A 5CBAB 3AS0A 3SDYH 25C8H 3ARVA 2D4FA 3OXSB 4FQJL 5KAQG 3MROA 4DAGL 4FA8A 4OLUH 1Z3GL 4ODTH 2ARJQ 1YQVH 3BFOA 3MGAA 2PN5A 5LG1A 1WK0A 3HKFA 5C0ND 1MAJA 3MLZH 1S9XA 3RX7A 2ZNXA 2VXUL 4XX1G 1OLZA 5KSUA 1G9NC 5TF1H 5TDNB 2AW2A 3ZKND 4LASL 4XP5H 3O2WH 1NDGB 4X6BB 2X4SA 3QEHB 4RZCA 5IBUB 4PLKC 3I02A 3SDXB 3NACL 4CAGA 5AD0B 5FCUH 4Z7VF 1NCDL 5LQBL 2HA1A 1A6PA 4Z0XB 5FUCE 4TSBL 3PL6D 4NC2B 3MNWA 4M61A 1BZ9A 1J5OL 2Q7NA 1XF3A 3QIWC 2QSTA 5FKAA 4RMVA 5HDBE 1JFQH 4LAQH 4L9LC 2VZTA 1KIRB 3RP1A 5DRWB 4GT7A 1AXSB 4XCNA 1IEHA 3F7VB 5F88B 4PJBE 4W6YB 1R3IH 2IGFL 4OIBA 1PG7X 1CQYA 4FMFA 5DLML 3TIDA 3ROOB 1MCRA 3NIFE 1B4JL 4XCYA 1GHFL 2ENYA 4PRIA 2WBJD 1EO8L 1QPPA 4BYHA 4F2MB 4M02A 4JY4A 1BWWA 5I1DA 1SMOA 2NX5E 5HY9B 3RVTC 2NNAA 3Q48A 4YFEA 5M94B 1TJGH 1DQJB 1JZ5A 1REIA 1JPGB 5MENA 1QD0A 3O2VL 4X5XB 1TVBB 1RU9H 2HJLB 1U93A 4OFYD 1C5BL 1NEZB 2MCPL 3FRPG 4YGVB 1ZLVH 5FKPB 2Z35B 2DQJH 1CLYL 3MBEB 3MRDB 4GKOA 4HKJB 4MWFA 2H1PL 5D7LA 3KPTA 4RFNB 4QY8B 4GXVL 3C5JA 1J8HD 1A1MA 2V5TA 1SBSH 5EZOH 3HE6A 1QLRA 3GSVB 4WCYH 3GK8L 4FZ8H 3HC0A 5I75B 1MFAH 4XP9L 4OGYL 3O2DH 4YH6A 5AG9A 5FECB 1UACH 1AHWB 5D1ZC 5IROA 4YHOH 1G1YA 3MV7B 5MEPA 1MJ8H 3OPZH 4DN4L 3UMTA 4ZAKA 4O2EB 6FABL 3K4AA 3MA7A 2YA0A 2AP2A 3DUUA 3MRGB 3VI3E 3L3JA 1RULH 3B2UC 2VLLB 4LPUA 4LCUB 3TVMC 2XQBL 3JXAA 3QUXC 4XC3L 4GG6F 4OCNC 5EOTB 5HDQL 1KULA 4KK6C 4LIQH 4X9GA 1YEHL 2N56A 4UUJA 4WWKB 4ZXBB 2Z91A 4LU5L 1PKQE 1P4BH 2FX8L 3S36H 4UTBH 2VWEE 1IEBA 1T1XB 3KG5A 1S9VB 1BQSA 3GMRB 4PLKD 2CKNA 2VN4A 4IS6B 3BP6A 1MRFL 1A7BA 1J05B 1RV6X 4U7SA 4FABH 1KJMA 3NN8A 5BV7C 5A43C 3I3BA 2D7OA 1H3PH 4CW1B 1U6AH 2NY3C 2IJ0C 4CJ1A 3JWOC 43C9A 4D9LH 1K85A 3AC0A 4HGWA 3D85D 1MRCL 2AGJH 1OM3H 3V7MA 2IG2H 4ONFL 1D3CA 3GMLB 4EQ3A 4Y1AB 1F8TL 4PJCB 2C9AA 4LCWB 3TWCL 1BIHA 2WIMA 1RAMA 3HS0A 1FNEB 3SQOL 4EBQL 4JM2F 4OIIH 3T0EE 3DXAD 5EOCH 1MIML 2JB5L 5J9PB 2N7AA 2XY2A 5F7NC 4KQ3H 4JGUA 3RVTD 2ZOKB 5DA4A 3CFKB 3QQ4B 4LPYA 4FZEL 2YPKB 1JNNH 2ESVD 1SYSA 4RGNB 4X98B 4XBGA 3QXDA 3SE3A 3BO8B 4E41B 4OD1L 4ZS7L 1H15B 4DUWA 4YIQB 5C09B 4MD0A 1BLNA 4X7DC 1V7ML 5I8OL 2G5RA 1FL5B 2I9TB 1SEQL 2OX5A 4R9HA 4BUGA 4Z7VB 2C1PB 4OCRH 2CR6A 5FV2A 4ONGL 1MLBA 4JFPA 3SN6N 5GS1A 3PDDA 1QSFB 4P4KD 4P2QA 4ZO8A 5IQ9A 1YMHB 1U9KA 5D1ZD 4CMMA 2EEDA 3S3SA 1HQ4B 2NLJA 3LVEA 1FV1B 4AIZB 4WDIB 2QQNL 4ELMF 2EEBA 1HYSC 4L4TB 4JANB 4FG6D 1ZSDB 4ALAL 4L8BB 4NJ9H 2PTUA 2JJVA 1JYXA 5E8NA 2PXYB 1JGEA 2X2YA 3B2UD 4L3CA 3TVMD 4Q0XH 3OF6D 4Y16B 4UMGA 3IAGC 5CMAA 5IBTL 4E42A 3O3DB 3DVFA 4HK3J 2DTMH 4CBPA 2XN9E 1LWRA 3GSQA 3VXRA 4KK6D 1HH6A 2WINA 1VFUA 1BVKB 1KB5B 4KHTL 1DUYB 4UT6H 1U42A 1IFHL 2UZXB 3BP5B 1INEH 3VMNA 1N5AA 3ILPB 1OSZA 4GKSA 3MQIA 3D1MC 4DGIL 3SGEI 3RDTB 2R1WA 3QQ3B 1NH6A 2SEBB 5DI8B 3H3PH 5DURD 4K8RC 25C8L 2L7UA 3FRPA 3VD4A 2CDGB 2ZZUT 5BVPH 1H3GA 1FAIH 4NCC1 4NC1E 5FFLA 5JMOC 4KUCF 1M7IB 4ODTL 1ZVSB 3ZTNL 1Q9WB 1YQVL 2BERA 5HYQB 2NY3D 2YD2A 1HXMA 3QG7H 4NO3A 1AP2A 3MLZL 1Q9LB 3O0RL 3UBXG 3AU1B 2YBRB 5TF1L 1DBML 4NM8L 2FBJH 3M1BA 3VGHA 2ZPKH 1NGYB 1OPGL 5FUZH 2EIBA 3IDXL 1LO5B 1VFOA 5FCUL 4O2FB 3MLRH 4FNLH 3THMH 5KVGH 3FO0H 1N6QL 4TOYL 1FNHA 1OGTA 1UXWA 5DR5L 2YC1A 4GG6B 1YNKL 1RJYA 5E5MA 1NL0H 4O2CA 1NC2D 2E9JA 3WV0A 3S6CA 3F65A 1DEDA 4AMKH 1KBGH 4JRXA 4Q74A 5CJOL 4LDLB 2OCFD 3MNVB 3RWCA 1RHHA 3WS6C 1CE6A 5GGSA 1UYWL 1ZWIA 4EDXA 2Y5TB 2UV3A 3ARBB 4KU1A 1T2JA 5JA9A 1WFUA 4NCDA 4PY7B 3QEGL 3VE0B 3DJ9A 1NCBH 2PW1B 1FZKA 1MHHB 4EN3D 5I0DA 1ACZA 1FP5A 1T4KA 3EFFB 1JTTA 4MDJA 1GGUA 4MXVF 3SCMD 5KSBF 1LE9B 1MCEA 1UG9A 3B83A 2XTLA 3D2UD 2DB8A 2BX5A 3KHOA 1MH5A 3CSGA 4JJ5B 3V7AG 2W60B 4PRHA 1DEEB 4NGHL 1FN4B 3C08H 2HKHL 3CU1A 4G7VH 2FGZA 5CWSA 2NY4D 3TJEL 2AK4D 2P8PB 3DHMA 2DLGA 5T1MA 4NC0B 3D3VA 1M7DB 4RIRB 1SBSL 3TZVA 4ZFOB 3BRGC 2ZCKL 1WVZA 3ARUA 3MV9A 4WCYL 2JIXA 3HE6C 1BVLB 4JM2B 4FZ8L 1WIOA 1MFAL 4HLZH 4QWWC 3O2DL 4N0FA 4PUBL 2CIKA 1A6ZA 1UACL 4WO4A 3BEWA 3MRQB 1JGVH 4HSQA 5JPNB 2RJMA 3QEUA 3VXMB 2CDEA 1DN0A 5LBSH 4P9HC 1UH3A 3FMGH 5FV1L 1ZLVK 4LNRA 4GUPB 4NM4H 4KJPC 4K8RD 5DQDL 1T1YB 3PWUB 3NA9L 2VTFA 1TJHH 2EDWA 3BPLB 3KGRA 4PJ9A 3MRKB 1U58B 5GS2D 1LGVA 3CFJB 2C7UA 5ITFA 4YHPB 1U8KA 4WI4A 5ADOL 5JIPA 1XGQB 4J3WA 1J0ZA 3PHQB 4NDMB 1GIGH 1MWAH 2DYPB 4ODHH 4M7LH 5C86A 1P4BL 1JL8A 1DTUA 1DL7L 4D0BA 2X9YA 3G5XA 5DUMH 4F7EB 1T7VA 4K3HA 1BFSA 2PTTB 1KUMA 2VLKB 4MAYC 4AJ0A 1A6WH 4XI5D 3FKUS 1GZPA 1P2CB 3O8XC 1SQ2N 3AM8C 1I3UA 3PWJA 4JRWA 1ZS8B 3QHFL 2F53B 2FGWH 4R2GB 3T3PE 2PNDA 2HVKB 1GL4B 4YDJB 2V2WA 5D7JA 3U36B 4ZMAT 4U0RB 1F45A 4GAGL 4EDWH 3DOSA 2XWJB 2CO7B 4OGAC 3VRIB 1CTNA 4D9LL 5FO9A 1FZOB 4JQXA 1J8HE 3UZEA 3QDMD 2X42A 1OM3L 1A3RH 1IILE 2IG2L 4MCYA 4HH9B 3F12B 3MRFB 1SHMA 1OAXL 5GZOC 1EGJA 2XV6B 5IHBA 3PWNB 1D5XB 1BM3L 1L0XA 1XFPA 5FDWB 5A2LH 2XRAH 1YNTA 3CVIH 5T33L 1F90H 4FQIL 2A83A 3CX2A 1DSFL 2GTWA 4KI5C 3BPNC 3HMXH 3EFDH 4X7TA 4BELD 1QRNA 2JK5A 2LABA 5FUOH 5MI0B 4DTGH 2FECL 2P47B 3I9GH 3AS2A 3KLSA 5DWUH 5BZWA 3W11C 4DZ8A 3QDGB 4QOKA 3SE3C 4RFOH 4D9RE 3W81A 3GGWA 3QIUA 5HI3C 4MLIA 4JO2L 2UWEA 4Y88A 4WHTA 1DVFC 2JJSA 4PGCB 2CIIB 2GK0A 4M7LT 1URLA 3PV7A 5D7LD 4PJXB 4N1HB 1UXSA 2WWKT 1KN2H 3UBXA 4TNVK 3BE1L 1MJJA 4YDVA 3RWFA 1AY1L 2XKNA 4D3CL 3X12B 3BZEB 4U2YA 1XIWB 3FB6A 3GMOA 4EI5C 3BSZH 3K74B 3SKOA 2VITA 2OL3B 4QWWD 1IL1B 3WNLA 1XH3B 4UIMA 4C59B 5LJYH 3OGOE 4OLYL 1OQXA 1QOKA 1KIQA 1FBIH 3WL9B 3QJHB 2BVOA 2GTZA 1TDQA 4NJ9L 3MOAH 1T7XA 1U3HD 1KG0A 5BVJA 2B4CC 3GJFB 1N0XH 1AI1L 3NCJH 3TYGL 4JVWA 4G8IA 4LLMB 2YN5A 4JY6A 1R5VA 4M1DL 4P4RA 3KYMA 2QR0A 3KYKH 4PP1C 4K9EL 4L8SC 4QHUB 5H94A 3IRPX 5KSBB 1E28A 2GJZA 3BHBB 4PGDA 4XPAH 1F4WL 4KXZH 5HHMD 5C0CD 2I5YL 3RVUD 3DXAE 3CUPB 4LCCC 3VFMB 3AVEA 3B9VA 3RWGA 4BUHA 4OZHE 4MAYD 3GSOB 3S5LB 2BOBA 1I75A 2WM0A 4TQEL 3H3PL 3O8XD 5F9AC 1G6VK 2ESVE 1AO7E 3L3KB 2WQ8A 4NFDA 2AXFB 1F3JB 3CXDH 1ONQA 2OI9C 3W9EB 3TBWA 3R06A 4OGAD 2CLZA 3QIBB 2EE6A 3QG7L 1XF5A 3MRCA 2R2BA 1U8PA 3S4SG 3WXWH 3A67H 3PABB 2CJUH 43CAB 3F7PC 4MB4A 1S7XA 2DWDB 2FBJL 2ICWI 4HPOH 5GZOD 2ZPKL 5DGQA 4ODVL 4PJGA 4HK0B 3JTSA 1DE4A 3AFLA 1ADQH 4NQED 2FJFA 3MLRL 5ELIA 5D7IA 4CN6A 2NXYC 3ECBA 3MGTB 5KVGL 4XP6H 1NCCH 1EPFA 1DUZB 1QVOA 3VXUD 3IFOA 2XPGA 2D31B 3KS0J 4F33A 2DQHH 1K8DA 3WFDL 4NQCB 4HFWA 4Y4KA 1MEXL 2R23B 5TJWK 1VENA 3OMZA 3FO1B 4MD4A 5HI3D 5TGBB 1JHKL 3SGDH 1NCWH 2BNRD 3HG1D 4DJMA 1DVFD 1KJ2B 4ZPTB 1BIIA 1AFVH 2F54A 3KPRB 4G7YH 5ICYB 4X8JB 3QUMA 4YHYC 3C9NB 3IDIA 5EZLA 5HTSA 5KS9F 1K4DB 2IPTH 4EI5D 2EDHA 4LQFH 2ORBH 3V6OA 3BD3A 3TO2B 1N0LA 4HWEL 4HFUH 5ESVB 3WO4C 4AEIH 5FYLL 1F2XK 3WJLA 3RTQB 1EEYB 2YPLD 4M8QB 2VAJA 2ICES 4Y5VB 4PV8A 5TDPB 4OFVA 1BP3B 2P7TA 5D7SL 3BOVA 1T04A 5T1KA 1IC4H 3MO1B 1A7OH 2R2EA 2ED8A 3L3IA 4NO5A 4WW2A 1M71B 3AAZB 1NGZA 2F8VA 1VEOA 2VISA 4M6AA 1FYTB 1U8IB 3NIFF 1WEJH 2DQTL 1X6LA 5I0ZA 4PP1D 3GMPA 3FQRA 3MRIB 1FSKC 3ARGB 3IXAB 1VFBA 1UWEL 2PYEA 5DFWH 2VE6A 3KJ6L 1FVCA 3SEPA 4AEFA 1RVFL 2G75A 4DKEL 1U8NB 4ZFZB 5CD5D 4UTAL 3ZTJH 2RFXA 1SMAA 3M8OH 3KWWB 1F4YH 3EJYC 3TBVA 1FL6A 1MCFA 5I19L 3QXAB 2EE9A 3VFNA 4PJ9C 5HHNA 4BSVB 1W0WA 3REWB 4OZFG 5EH1A 2EYTA 1S5HB 5LKNA 2ITDB 4ZFFA 1CFSA 4J23A 1VFAA 4HMEA 1T80A 5DJ2B 2AXHA 3MLYL 1TZIA 4QRPA 4PLOB 3T2OA 5DFTA 1GIGL 3MRJB 1Q72L 3FCTA 2PF6A 2BHZA 1QTYT 2EKSA 5F7YC 4IJ3B 2ADGA 3PWLB 3U9UA 2FSEA 4I2XB 5IW1B 4WEBL 5DC4B 2VZOA 3MLSH 2FX7H 4OT1L 2ICWJ 1P84K 1YZZA 1HSBA 4MMXC 4M43H 4ZUVA 1XCTA 4RAVB 1ORQB 4LLQB 2EDYA 4WUUA 5E8PA 3VGFA 2NXYD 4B41A 4NQDE 3VI3F 3BWAB 1AKJD 5D7JC 2LV4A 2IBBA 3EYUL 4HS3B 1MJ7L 3CZFA 4C58B 1QSZA 4U7MA 2HFFA 4UNTA 3PHOA 5HYIA 4L8DA 3MLUL 1O7VA 4S2SB 4Q9RH 2FEEI 3OJ2C 3WSQH 4JO3H 1WJ3A 4R96B 5T3ZH 5ETUB 3WFCL 4JRXD 1U8OB 3D0LA 3IF1B 1WAAF 2B0SH 3FO2A 2A6KB 2X40A 4YDLC 4W6WB 1I1AA 2J6EA 4M4RA 1CXLA 5I30H 2XRAL 2P1YA 4QCIA 1L9NA 3P0GB 3KR3H 4JFEA 5EBGA 1QBLH 1QUNA 4LKXB 5DK0A 2XWBA 3T77B 1B3JA 3H3BC 3OR7B 4MZ2A 2QQKH 4MJ5A 3HMXL 4H26A 4PJEA 4Y7MA 5DMKB 5E9DB 1J8KA 5FUOL 5HVHC 1YNLH 2B1AH 4N9GA 5B8CB 3I9GL 3Q1SH 1N6UA 5CEXA 1YDPB 1HHJA 1R3HB 4XMKL 3RGVB 4J2XA 1ZTXL 5IOPB 4OAWB 1BAFH 5E99H 4CDHA 2DQUL 2JJSC 3K4ZA 1P4LB 2P5EB 5T3XH 4PS4H 2VERN 5CD3A 1B0GB 3GHEH 4PYGA 3N1QC 4ZUUB 2JIXD 4N8VG 3VGAC 3WDHA 4KDWA 5CGYD 5K9JH 5ANME 5IB1B 1U8QB 4NPYB 4L8CA 4Y0GA 5EZJA 2BJMH 3RY4A 1G9MH 1L7TH 32C2B 4HX1B 1SEBB 1BHGA 4J3TA 1FBIL 4RFEA 4R4FH 2NXZB 3P4NA 3WIIL 3AB0B 1PQZA 3SGJC 4GRWF 3UYRH 3KYOB 4K3DL 1IAOB 3LCYA 3MOAL 4TSCH 1N0XL 2NTSP 4NBZB 4WU7A 4LCIH 1JZ8A 4HUVA 3PP3H 3QDME 3O4LD 5KN5A 2MHAB 3GUTA 4PJHE 1OAZH 5JIIA 4ZNEA 3MODL 4LLUB 3RL1A 3QRFM 4HZLA 1IGFL 4XNXH 3H7BB 4PJ8A 5EDXA 4YK4C 3ULUH 3VW3H 4QRTA 3DUHA 1RUMH 2XNAA 1P4IH 2AABH 2FZ3B 3G6JF 2BSTB 2WMPA 3QULB 3I6KA 4MXQC 1OP9A 1I7UA 4S1SL 3HNTH 4GW1B 2EYRA 5L2JB 3SDCC 4M5ZH 1SY6H 3KAAA 4PJBB 2LU7A 1CYGA 3CFEB 4GS7C 1HOCB 1S7QA 2X4QB 3ZO0A 3QJFB 5CEYB 3INUL 3D69B 4JZNA 4NBYB 5EFIA 4XP4H 4UOW0 2Y6SC 1MAML 1JGDA 2OJZH 3V4VH 3JSSA 1YN6A 4AENB 5ITBL 2AJXH 3O41A 3BT2L 2BVPA 2NX5B 3TBYB 1Y6KR 3B5HA 1IEAA 4ZPVA 1X3DA 4Q97A 3BMWA 4X7SH 2YD5A 4HPOL 3GSWA 4KK5C 3UDWA 4JFFD 4EI6A 3S8WA 2R0LH 3NTCH 2OJEA 1IM9D 2IQAB 1I7RA 1MFDH 2O93L 3MJ7B 2MPAH 3V4PH 3GI9L 4WGVB 3FOMA 1EMTL 4XP6L 1FVEA 1KNOB 4M1CD 5GS0L 1ZT4A 2DWEA 1BZQK 4XXDB 3RWEA 4PJAA 3V79C 2KDGA 1WC7A 1Y6MR 5HPOA 5JMRA 1CD1A 1YPZE 2APTA 1N8ZB 4OZFA 2DQHL 2Y25A 4JPVH 4NZUH 4OSUH 3PDOA 3BIBX 5EG6C 2OMBA 1JNLH 4W70A 2W9DH 1QBAA 2IAND 1IQDA 3CCHA 5KANI 1T0MB 2VDOL 1OTUD 4Y4KC 3VFVA 5KVFL 4XH2B 2Z92A 4K55A 1S7VB 4QRUB 1NCWL 4KH2A 2J5LB 1RIHL 3T1FA 2NMSA 5DVOA 5JPMB 1PX4A 2C4FT 4K71B 1KB9K 1U8HA 5KSAC 2J2ZA 3E6HB 2QKIA 4U6VH 5HHME 3CH8A 5C0CE 2NR6D 1WWBX 4LQFL 5EIQA 2APWA 4FQLL 4PB0L 5I8CB 3V5DB 4JKWA 1IT9H 4WFFD 1KB5H 2P8LB 5IM7B 1UEMA 4X6FA 3AROA 4M7JL 3WJLC 2QJDA 4YXLH 3L5WB 4R4BB 5J0BA 4BFEA 1FNGA 4XVUC 4ETYA 1CTOA 1MY5A 5C08A 4JRYA 4OZIF 1ZAGA 3JV5A 3CGTA 3TFKC 4F7TB 1IC4L 4O51A 1WTLA 1A7OL 4OLWH 1PKQB 1S9YB 5I1EH 2VKWA 3R1GH 5TF0A 2F74A 3MRRB 4LLDB 3FTGA 1EFXB 3FFDA 1WEJL 4WHYH 5JOFA 4XC1H 2J8UE 1OF2A 4OI8A 4CJ0A 1XGUA 5TE4L 1X5IA 1VERA 2VAAB 1J1PH 2YMXH 5LVEA 5IWLA 4NQEE 1V3LA 4HLJA 3ARQA 1WSST 5LGHL 3WKMH 3BN9C 4IMKC 4BQ9A 4MXQD 3D6GA 3L7FB 3VXUE 4OQTA 4N90D 5T5NG 2ENSA 4H0HB 2ARJA 1I9JH 3SDCD 4JPIA 5F1NA 4HKBA 1I9RL 2F5BH 2ICWB 4M7ZB 2YOCA 3P4MB 4M7KH 3JV6B 1TTGA 1R5IA 2Y6SD 1ZA3A 2OMNA 2BNRE 3HG1E 5C0AA 4UILH 1EEQA 2FD6H 3T0EB 4M9PA 4N8VA 2EIDA 3LKOB 2HH0H 3EOTL 3O45A 3FB8B 3K4DA 5ENWB 1A21A 1IGTB 1LK2B 3OZ9H 1K2DB 4GRWB 4OLXL 1YC7A 2IPKB 4M43L 4U1GC 5GJTH 2DQIH 1AD0A 1MCIA 5FO7B 2FL5A 3ARXA 2EIEA 4BK4A 3JTTB 2YPLE 4WU5A 1LO0L 4OM0H 5EO1A 1AXTH 1WIUA 3FN0L 2AI0H 1INQB 4RMSA 4APQC 3VG0H 1QLEL 4ZOCA 4K94H 4P2OA 2X4RA 2Q87A 1Q9KA 3WSQL 3KXFA 4KDTA 5DVLA 4PJIA 5K59E 4RGMB 5GRJH 2B0SL 3V4UH 5TQ2H 3HA0A 3OXRB 5FA4B 2APFA 3HPLA 2CPCA 3WHXA 1HXYB 3KR3L 4C83A 1HKLH 4CMHB 1QBLL 1CR9L 3K81A 2CLRA 2X9XA 4YC2B 1F4HA 5KSAD 4HWNA 5DK3A 2HVJA 1SYVB 1ZMYA 2QQKL 4OCWL 2R15A 1UM4H 4ERSL 1AE6H 4HXBH 2FCBA 1RZ8A 1A4JB 4G6JH 2AV7A 3RWDB 1TXKA 3IJSA 3GKWH 3L3GB 3RVWC 1YMMD 3FN3A 4JFYB 3VXQB 3TPKA 4X6DE 4XVUD 4P46B 3MRLB 3DVGA 5EC1A 3TFKD 3LDBC 4LHUG 3OKMB 5E99L 4Y4HD 2GUOB 1HKFA 4OF3A 1G7PB 3CXHK 4G80B 4RWYH 5TPWL 3GHEL 3CK0H 4ODWA 3WN5C 4LPXA 3OR6B 4YHMH 3SE8L 2PCPA 4ELKB 3QPXH 4FFWC 2FBOJ 3FQNB 2IAMD 5IFHH 2V9TA 4RMWA 3HZVB 4P2RA 1NKOA 5DZLA 4KY1L 1AIFA 1QRKA 4YDIH 5CJQL 1SJEA 4GAYB 4OCLC 1FLRL 1UCBH 3TA3B 4U1IA 3WLBB 2YUWA 1Q1JH 1D5MA 1ZXQA 2Q86B 4LCIL 3WFHB 4XWOC 3MRNA 1I8IA 1DLFL 1OAZL 1N7MH 2DIAA 1IC5L 2BK8A 2R29H 2VL5B 3DMMB 5H37G 4XNXL 3TPUB 4KMLB 1EERB 2YD1A 2C1OB 3ULUL 2H6PA 1OB1A 4YHLH 3QCUH 3L5IA 4NKDA 1G7LB 2IBZY 4OZGA 1H3TA 3IKCB 3C6LB 4GBXA 1OD7A 1F02I 1K5NA 2A9ML 4KJYB 5KTEL 4M5ZL 1SY6L 1FH5L 3PP3K 1NQBA 1NMCC 5DDHA 5T5FL 2B1HL 1YYLL 2A73B 2EDRA 3T0VA 4K7PL 4APQD 1AGEB 2OJZL 1IGYB 2H8PA 2NPLX 5IVXE 2GITA 4IIQC 4A6YB 3OAYH 4UZGA 2YXMA 1S7WB 1OHQA 1ED3B 2LAGB 4XVTL 3FJTA 4QHLA 3PXJA 4PB9H 2H32A 2YKLL 3JV4A 4HC1H 1P5UA 4G6MH 2R0LL 3UDWC 3TNMB 2MPAL 1EXUB 2R9HC 1C1EH 1VGEL 4R3SB 1UJ3A 5E6IA 2OL3H 2YWZA 3L3HA 4GAFB 3LN5A 4G8FB 3MV8A 4NZUL 4OSUL 2WAHA 4BZ2H 1YEDB 2HFGH 2YRLA 4I9WD 4CU8A 1ZHBA 3HCVA 3TNNA 3GM0A 3NPSB 1MJUL 3O4LE 1NBQA 5EBMB 3IDUA 1JPSL 3U7YH 4B7LA 1QQDA 3RUGF 3OJMB 3WD5H 1FFOA 5DEZA 4U0QB 4MQSB 3GJFH 4NNPH 1I9IH 5E2JA 3BQUA 1K4CA 3VFSA 3PL6B 4U6VL 5D8JL 2MKWA 1WCQA 5E0QA 5GXBB 3C8KB 4LIQE 3QZWB 3SE4A 5DYOA 5F3BA 5EO9B 4HMCA 4FFWD 4ETQA 4HXAL 4WVRA 5DO2D 1OSPH 4F7MA 1MHEA 1QNZH 4YXLL 1FG2A 1RY7B 3DYPA 4IHOB 1J0YA 1KCVL 4Y19D 1T7YA 4U3HA 2EDOA 3ZDXF 5I66A 1JYWA 1L4IA 3OKLA 5D5ME 4XWOD 1U8MB 2WBJB 4XCEB 5L9DH 4I18B 1MCPH 2JB6B 4MA7L 2P8MA 1X5AA 3O3EA 4JR9L 3P77A 3OKOB 4WFGD 4XC1L 4QHMB 1JZ7A 5IHZB 4OQ1A 5I8KL 3KPOB 1YN7A 4JFFE 5DUBA 1J1PL 4H25A 2XKUA 3MJ8A 1GZQA 1R24B 2YSSA 3VXSA 4TVSa 3TBSA 5JXEC 1VPOH 1UM5L 3E8UH 4R7DB 4X0KA 2Y9RT 2A6DA 1J8HB 1HEZB 5DXWA 1BVZA 3LOWA 2A9NH 3KDMB 3QNXB 3VG9B 2LTQB 4XVSH 1I9JL 2ZCLH 4NUJA 3BXNA