4NPCA

Crystal structure of an oxidoreductase, short-chain dehydrogenase/reductase family protein from brucella suis
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
251
structure length
251
Chain Sequence
QIDLNFPLSEKVAIVTGGASGIGAAISKAFIAKGAKVAVLDISADIAKAKAEELGENAKPFVCDVSSQQSVNDAITAVISQFGKIDIAVNSAGVVYLAPAEDISLDYWDKTININLKGSFLVTQAVGRAMIAAGNGGKIINLASQAGTVAIEEHVAYCASKFGVIGMSKTFAAEWGKYGICVNTLSPTIVLTELGKKAWAGEKGEAAKKRIPAGRFAYPEEIAAAAVFLASAGADMITGADLLIDGGYTIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of an Oxidoreductase, Short-Chain Dehydrogenase/Reductase Family Protein from Brucella suis
rcsb
source organism Brucella suis
molecule tags Oxidoreductase
molecule keywords Sorbitol dehydrogenase
total genus 94
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4npcA00
2ZTMA 4BO9A 4BO7A 1YBVA 3RUCA 1C0KA 1OI7A 2YYYA 3BTUA 4YT5A 3ZV4A 2X23A 1LSUA 3OHSX 2DKNA 4E5MA 4FFNA 4DYDA 4L75A 4B79A 1AE1A 3SEFA 3TQHA 3PJDA 2FWMX 2ZB8A 4RLSA 1GZ4A 4RLHA 4CQLB 3AK4A 4BMSA 3JSAA 2TMDA 4Q3EA 1E7QA 1NHWA 3VPHA 3DTYA 3QWFA 4IDEA 4K28A 4R3NA 3X2EA 3TRIA 3BHIA 3RUAA 2AQKA 3PZBA 2DAPA 3G1UA 3KYDB 1PTJA 3FSRA 4BNVA 4L0QA 4ZU3A 3PLRA 1WZIA 5CEJA 4H15A 4M8SA 1MUUA 4YBZA 3WMXA 4E30A 9LDTA 2EIHA 1V9LA 3ZN2A 1KVSA 4B7CA 1PL6A 3KSUA 2IZ0A 1DIHA 3GAZA 4FC6A 3H8VA 4OH1A 3UICA 4CQLA 4HKTA 2QYTA 4AVYA 2Z1MA 1C3VA 1LTHR 2HJSA 5ER6A 5G0WA 2Q50A 4S3MA 3AI1A 2PGJA 4HFMA 1KOLA 4J0EA 2Y93A 2NV6A 1ZCJA 1RM0A 4YA6A 3WQRA 3EK2A 1DEHA 3TL3A 4D79A 4FB5A 4AJJA 5FWNA 2H63A 2AXQA 4BNIA 1E3EA 1OZAA 1KC3A 3GZNA 1VJTA 1QG6A 3GFGA 4CLRB 3FTPA 4D42A 2Z1NA 5KVVA 1JKJA 1B0AA 3D1LA 1G0OA 4J9UE 2AG5A 1PZFA 5DT9A 4MP3A 5F5LA 3V2GA 1I2CA 5BSHA 3UFXA 2C2YA 4CV3A 5CG1A 3PI7A 4YEDA 4BOYA 3OJFA 1DLIA 1QR6A 5BT9A 3QWBA 2VT3A 4WLVA 1ISFA 3O9ZA 3E48A 4DBVO 2ZB4A 4FOSA 4BNMA 3ANMA 4JX8A 4BV8A 5T8KA 3NTOA 4O0LA 4DPMA 1R6DA 1RM4A 1K3TA 1SPXA 3K92A 3PK0A 4CM9D 4XZ3A 4M86A 5CHEA 4NH4A 4YRBA 3ASVA 4I1IA 1ZNQO 5IZCA 4YTEA 4CUZA 1ISMA 5I8WA 4WNCA 3MZ0A 1FDWA 5FFFA 1RYDA 3DHEA 5EERA 1CJCA 1HETA 5H83A 4EITA 4MVJF 2DQ4A 1NWCA 4BNHA 3TWOA 3ANLA 1NNUA 4CM1A 3LQFA 1W6UA 2VYND 3CXRA 4DIOA 1XKQA 1LSOA 2X0IA 3C8MA 1CRWG 4OGWA 4IJWA 3JYQA 1JWAB 3W1VA 4OQZA 1MV8A 4I8XA 4J90A 1SMKA 3KB6A 3E9NA 4GWKA 3OIFA 4ITUA 4WJZA 4GKBA 5JXWA 1T2CA 1DAOA 2P9GA 4DMMA 1JKFA 1UAGA 1V6AA 1EQUA 3B1KA 1ADCA 4IM7A 3TZ6A 4N5NA 3E9MA 3KM0A 1IUKA 4PZEA 1XGKA 2RH8A 3ZNQA 4FDAA 1TT5A 2BMAA 2CDCA 4BNYA 5CP8A 3DZHA 4E32A 3GPIA 4R51A 1PZEA 1UZMA 3PYMA 1K6XA 4F6CA 3OIDA 4MO2A 4J1QA 3K6JA 5KTKA 1MLDA 3Q0EA 3ZU5A 3E6AA 2X22A 2YV1A 3MOIA 3WYCA 2NU6A 1IULA 4OIMA 4WUVA 1Z45A 5HA5A 3JQBA 3MOGA 1DLJA 3WFJA 1NQ5A 4JN6B 3VPSA 2W2LD 1A4UA 3H2ZA 3LYLA 3DHYA 4ZD6A 2UDPA 5EPOA 4GSKA 2PH5A 1R12A 1Q0QA 3AM3A 4IGFA 3GRKA 3EW7A 2J5KA 1I33A 4XQEA 4NK4A 1IOLA 3A06A 3QHAA 5DZSA 5L4LA 1L7DA 4XX0A 2B4TO 3KZVA 2VHYA 1DAPA 1LEHA 2H5LA 4RQTA 3FTNA 1N1GA 1NXQA 4Z3KA 2PGLA 4F6LA 4ZJUA 3ZWWA 2WD7B 5JAZA 1A5ZA 2GYYA 2Q2QA 1E7WA 1ZJZA 4J43A 3GGGA 4XB1A 1XHLA 5DBGA 1SAYA 2F00A 3ZWPA 4W9NA 3PWKA 2HK9A 2NADA 3QRWA 4G65A 2RHCA 3DAPA 4HXYA 4CM3A 3VTZA 2P4HX 3H7AA 3SVTA 4XIYA 1IPFA 1GFSA 1ZH8A 3DMYA 4LSMA 3VVCA 3M1LA 4KUHA 3ZHYA 3Q6IA 5TRTA 3PJFA 2V7PA 1E1MA 4A0SA 3OJEA 3I4FA 3U4HA 3I4CA 2OMEA 3U9LA 3W8FA 4CM5A 1O9BA 1I3NA 1PX0A 1PL8A 2VNAA 5HBRA 1NM5A 2YHIA 5KJ1A 3AUUA 4J4BA 5GZ6A 1PJSA 2X9VA 1NWHA 1EMDA 1GUZA 4NG5A 1MB4A 5EJ2A 1Q0LA 4Y8VA 1C14A 2VYVD 1O5IA 1PGQA 1O0SA 2DPGA 8ADHA 1GTMA 1E77A 4XD2A 1TLTA 3I52A 1U5AA 2R2GA 3EAGA 3G1TA 5HM8A 5I7FA 3I9NA 5CDYA 2IE0A 4Q9NA 3WWZA 3HUDA 5JC1A 2CMDA 1TA4A 4NJMB 5G0VA 1RKXA 3ZWOA 3AW9A 3HSKA 4HNHA 1F8GA 1O6ZA 4TVOA 1CIVA 3PHGA 3S2EA 3H6KA 2I99A 2F1KA 4R1NA 3A28A 1X15A 3DC2A 3NT2A 4K6FA 4ND3A 1Y7TA 5MDHA 1LQUA 4JNKA 2GERA 3JQCA 3P7MA 1P74A 1HLDA 2X5OA 4U7WA 1EDZA 1E1LA 4IS3A 4RZHA 2YDXA 4OOFA 1H9BA 2OXIA 3PYLA 3WICA 4GBJA 3CZRA 3WNVA 5HTOA 4PGFA 1RM3A 1EUCA 3ASUA 2D5AA 1ID1A 4IMRA 3OA2A 1U4SA 4QEDA 3I5MA 4QXMA 1N7HA 5BNFA 3D4OA 1R0LA 1GR0A 3NEPX 4LCJA 4XR9A 5HS4A 2D0IA 3ZWAA 2G1UA 1HE4A 1L7EA 2CDBA 2RBEA 3Q3CA 4IQ0A 4QO8A 3BAZA 1MFZA 4HV4A 1E7RA 1LC3A 1PJ3A 1NYTA 3JQDA 4CPDA 4J2HA 5B4VA 4PLFA 3BTVA 3A9WA 4NFHA 2ZYGA 4WCDA 3RU9A 1OMOA 3DOCA 4DLBA 2FMUA 3RI3A 1PS0A 3WGHA 1IB6A 4RO0A 3JQBC 2NNLD 4CMHA 4Z6KA 5CPBA 3O8QA 3WFIA 3CH6A 1PJQA 1FDUA 2G0TA 1N2SA 1ZK4A 4MP6A 3IMFA 5U9CA 4TZKA 2WE7A 3SLKA 3RFTA 2WTBA 2ZCVA 1ZXBA 3K96A 1UDAA 2PD4A 1YB1A 3NUGA 4ALLA 5GY7A 1PWXA 5CEFA 1C1XA 1FMCA 5JMWA 4Q3CA 5AXDA 4RGBA 2O48X 1HDRA 1TT5B 4YB8A 2BGMA 1LRKA 4MVJI 2PD6A 2PA3A 1J49A 3UGKA 1SB8A 3VDRA 1H0KA 4ZQEA 2HDHA 4O5OA 3EY4A 3U4IA 4YJFA 1SBYA 1P1HA 3MJVA 2GASA 3H9QA 1FDTA 1O95A 4FR5A 4ZN6A 1E3SA 1NQOA 1F17A 1L1FA 2DFDA 3RC9A 5A1TA 1NPTO 5GZ1A 3I83A 1H9AA 5JO0A 4XIJA 4DPLA 5AXAA 4PLYA 3WGZA 3LT4A 2Y0CA 4UEOA 3V8BA 1PJLA 4QFDA 2B4RO 2VTEA 3R1IA 3S2IA 3LC1O 5TGDA 4CMEA 4JJIA 3WQQA 3AI3A 4MDHA 1P0CA 2ZIZA 1EVJA 4BO3A 3ANNA 4DMLA 1I3LA 2ZTLA 3FF4A 1FDSA 4Q3AA 4CLOB 1DC4A 1R4MA 2PGDA 4OXNA 1P1FA 1KEWA 4EJMA 2VOJA 3D4NA 1LU9A 5JE8A 2RH4A 2W2KB 4L4RA 2PR2A 3IAHA 3LDHA 5H82A 3LT0A 2O3QA 3WX0A 3ETDA 1DJQA 1YRLA 2VNSA 3F46A 1BVRA 2QRLA 3GEMA 2XXBA 3QVTA 1K89A 1X13A 1WXDA 1EVZA 3ONDA 3OMLA 2O2YA 1WDMA 3D3WA 2QZ9A 2VHXA 4R41A 4AJ2A 2WE8A 3FNFA 4BKQA 3FD8A 3WTBA 4L74A 3BTOA 3HDQA 1ZUD1 4NBTA 1NBOA 4K26A 1I3MA 3ONFA 2IXAA 4I9NA 5JCJD 4LK3A 1O94A 4DBZA 3MJ4A 1ZW1A 4H3VA 2PV7A 3OJLA 4JROA 2VWQA 5EIOA 3GZNB 2JHFA 3KSZO 4MIYA 1UDBA 1C1XB 1E92A 5CEEA 2DUWA 4CM6A 3Q9UA 2EG9A 5EMHA 3FWZA 2ET6A 5CDSA 4GKVA 4W99A 4MVJD 2O3TA 3JYOA 3U4DA 2TMGA 2EHDA 1BHSA 3KUXA 5B1YA 2NUAA 4JCOA 4BO6A 5I8ZA 3OICA 1BVUA 4B3JA 1S6YA 3CPSA 3N58A 1MXFA 4H7PA 1DSSG 1KS9A 2NLOA 1O8CA 3HADA 3GEDA 4TMFA 4WLFA 4BO4A 3D4PA 1B16A 1ENPA 3MCVA 3LLSA 4O1MA 4BVAA 2YZ7A 3I9MA 1GEEA 1NVTA 4CM7A 2DBZA 1SOVA 4QX6A 3JQEA 4AJ4A 4GLLA 4ZVVA 1UP4A 4YJGA 2WMDA 3GDGA 4Z3DA 1XSEA 1V35A 2NM0A 2ZTUA 1U1IA 4MPDA 1B3BA 1LI4A 4KDFA 1HDXA 2YQ5A 4LRTB 3C3XA 5ILOA 1YDEA 1GD1O 1R4NA 4B4WA 1E5QA 4I9UA 3QJ5A 1UXHA 5EESA 3NX4A 2PKQO 4TVBA 5U4QA 1HE3A 4P8RA 3LLVA 3DONA 4URFA 2Q46A 3SC6A 2XPCA 1LC0A 4J7XA 4E3ZA 3NDRA 2YY7A 4BQRA 1T1SA 1K6IA 4E5KA 4EEXA 1MA0A 3GDFA 3HDHA 1LNQA 1T2EA 2AE2A 4G2NA 4P22A 1HL3A 2FPIA 1V3UA 1Y8RB 2WYWA 3GMDA 1X1TA 2C82A 1E3WB 3WGTA 4BMVA 2P4QA 3WBBA 1OC4A 3BMNA 5TC4A 1EUZA 3QWIA 4FFRA 2VYVA 4J3FA 1HXHA 5L7YA 4WPGA 4PLWA 2R00C 2ZJ0A 5TT1A 2I9PA 3H9GA 2J3KA 5IG2A 2GD1O 3HQ4O 1SC6A 4IBOA 3TDKA 4CLOA 3TZCA 3ZH2A 1VE9A 1W73A 1LJ8A 3EVTA 3PFWO 3DZKA 1V3TA 2ZQYA 3RUIA 2V6FA 3OM9A 3KHUA 2VHZA 1KC1A 3GN2A 1A7AA 4NBUA 3GVCA 3ULKA 1XLTA 2JD1A 2EXXA 5LDHA 4GVLA 1BG6A 1P1JA 2X0JA 3B70A 1YDWA 3PYXA 3FNHA 1YB5A 4PCVA 3OP4A 2AQHA 3G0OA 4JXKA 4A26A 5TIIA 2ZKLA 5T64A 2CUKA 2AMFA 1SEVA 1ISHA 1H94A 5MGBA 3R6DA 1QYCA 2JD0A 4HUJA 2EEZA 1DIGA 1YL5A 2NQTA 4DTIA 3ZDFA 1I2ZA 1E7MA 1WMAA 3D5QA 3PXXA 1CETA 5IN4A 2OOSA 1EK5A 1WP4A 2EGGA 3JCZA 4M1QA 5IXYA 4LGVA 5DBIA 2BF7A 4YDRA 5BSFA 4OHUA 3ZI0A 3RD5A 5I9LA 5BSGA 1D3AA 2VYNA 3ROMA 1VRWA 3GLQA 4OYRA 3E5MA 1KEPA 3GHHA 3DFZA 2O50A 2H6EA 1EFKA 9LDBA 1GV0A 3GR6A 5DNAA 4YT4A 5C37A 4JQCA 2QX7A 3GZ4A 3WB9A 4CQMB 3RJ5A 5IAAA 1JVSA 3GNQA 1XYGA 5LDGA 2W90A 4GGOA 3T7CA 4KP7A 4DIBA 3L6DA 4WCFC 2OL4A 3PQFA 2NTJA 3GT0A 2P5UA 2DBQA 5FI5A 4UREA 4CMIA 1WDKA 4UUPA 3RC2A 5ADHA 1WVGA 2DTXA 4M49A 3IP3A 1DIAA 3QIVA 1JWBB 1PU2A 1PS9A 3G49A 2YHIB 1BMDA 4P4GA 1Z82A 3PZRA 5DOVA 1BXGA 3UUWA 1VC2A 1Y5RA 1VM6A 3ZU3A 1NHGA 1HDCA 4UUNA 5L53A 1HRDA 3AY7A 2UUPA 1BWSA 3RKUA 2AEJA 1IZ0A 1DC6A 3WSVA 3PWSA 1HSOA 4GPD1 1Y9EA 3MJSA 1K6JA 4FIZA 4D45A 3DBRA 3JQ8A 3WMWA 1Q7CA 1I0ZA 5BQFA 1DIBA 5K6AC 3PDJA 3UOGA 5F21A 1QORA 4EYEA 1ISJA 1PJTA 4IDAA 5TSDA 1SEPA 3JV7A 4J7UA 3U4CA 4CL8A 4U6QA 1XELA 1NX6A 5JYEA 1J5PA 3L9WA 4L76A 4W4TA 1C1DB 3W6ZA 1U5CA 2BI7A 1DRUA 1H93A 2DTEA 5DCYA 2YV3A 1B15A 4B4OA 3FHLA 3GPDG 4PZDA 1VL6A 3PEFA 4PLTA 2OP1A 1PS8A 2G17A 2AQ8A 5L45A 4R5MA 3FBTA 1FK8A 1FF9A 3KXDA 4YAKA 3AOEC 3GVIA 3L6EA 4RPLA 4ID9A 1X14A 2A4KA 1TT7A 4PVCA 1GL3A 4XYEA 5L4SA 1PGPA 1DFIA 1AXEA 3VKVA 1QV6A 1Z75A 2Y1FA 4E2ZA 2P91A 1QRRA 4L4XA 4AJIA 3QQPA 2OBYA 3WSWA 4XKJA 4D0RA 1PGOA 4D46A 2DT5A 3EMKA 2HK8A 3RUFA 4GVXA 3GG9A 3PLNA 3FI9A 2BH9A 3EYWA 3WG9A 4OJNA 4BO8A 4ESOA 5KVCA 3AY3A 2GNAA 1CF2O 4FOOA 2X5JO 1AN9A 3QVSA 3GMSA 3PDUA 4BIIA 3H2SA 4YRDA 4YPOA 1UP7A 1XA0A 5G4KB 1OBFO 5JAQA 5EINA 3T7EA 4LN1A 3U49A 2JJYA 3Q11A 2WJPA 2I5PO 1IY8A 3FNEA 2DBRA 3LK7A 4JJGA 1E5LA 2HJRA 4TKMA 2B83A 5CPFA 2JCYA 3ENNA 3GDOA 3ZU4A 4FFLA 4LRSB 1VKNA 1VSVA 2VT2A 2EW8A 3RU7A 2POQX 3EZYA 2JCVA 1NVGA 4ALKA 4PRKA 3QWHA 3WGGA 5A5FA 3EZLA 3ADOA 3ICCA 3LC7O 1M76A 4R16A 1UDCA 4CM9A 1TEHA 1JAYA 2Y0DA 3F4LA 4LMPA 4LVUA 4GI2A 5JNLA 1SZJG 3FBGA 1ZMTA 3QW2A 4WLEA 5KWEA 3CMCO 5ES3A 1XCBA 4HFNA 1YBAA 1PWZA 1UXIA 3CSDA 3NYWA 4KQWA 4RF5A 5JSFA 2J8ZA 3AFMA 5TX7A 4GAEA 1KIFA 1JLLA 3W8DA 5TNXA 4ROSA 4YACA 3AY6A 4EGFA 1YWGO 3G79A 2Q1UA 1E1KA 1I10A 3GOHA 4ALNA 1IZ9A 3UW3A 2JCXA 4NFSA 1CEQA 1ONNA 5TF4A 4W7HA 3UF0A 2BELA 3DAFA 4B3HA 1GPJA 4UVGA 1ZFNA 4HFRA 3I1JA 3DEYX 4TROA 1LLUA 4GX2A 5BNIA 2IEBA 5CFZA 2RCYA 3HWRA 4UEJA 3KYDA 3BIOA 1ZVMA 2NACA 2OFPA 3NRCA 1OC2A 2QYSA 2Q45A 5TJHA 1SCUA 2PY6A 1ORRA 4S1VA 2J5QA 1JN0A 1D1TA 4CMAA 1P0FA 3NT4A 5THQA 3WBFA 4B7XA 3WS7A 2O3SA 1Z6ZA 4RF3A 3JQ7B 4OL9A 4YVFA 2YW9A 5FF9A 4CODB 2BFAA 3FNGA 3M1AA 1ADGA 5DULA 1I30A 3SBOA 3ABIA 2BFPA 1DO8A 3F47A 2FPPA 3OEYA 3NJ4A 3OQ6A 3KYCB 1N8KA 3NDIA 4TRJA 2YFQA 3RBXA 3TL2A 3D7LA 3KOUA 1BW9B 3I6IA 4ZGWA 2UUOA 2QQ5A 4IIUA 4N5MA 3GF4A 4Z9YA 1CQJA 2AG8A 4PLCA 4J7CA 4D44A 1UJMA 3BMCA 4F3YA 5EQFA 4ND2A 2YHUA 4LW8A 3D0OA 4BB6A 2X8LA 4E2WA 4IQ8A 5TT0A 4BQPA 4UVIA 4FFPA 5L40A 3PQDA 1NQTA 4IXWA 3DHNA 3ZV6A 5ICSA 2XOXA 4L8VA 4ZQHA 5F5NA 5KJFA 1DIRA 1GYRA 4RVDA 1MGOA 3I9KA 4RQUA 1QYXA 4CL3A 1E3JA 1YXMA 3IUSA 3HFGA 1ULUA 2C5AA 4FFMA 4DGSA 1E6UA 1R15A 2I6TA 5JO9A 1YGYA 3JYPA 3RCBA 3JD3A 4PRLA 1HYEA 1WAMA 1SO8A 3UXYA 1ZEMA 4R1TA 4TRNA 3RC7A 5G0UA 3WDSA 4GSLA 4OXKA 1P44A 3V1TC 3H9EO 3SLGA 4UULA 3IOYA 1WZEA 2GO1A 4BO0A 1E3IA 3F9IA 2IXBA 3BYZA 1Y1PA 1DDOA 4RVFA 4ALJA 3AM5A 4YAIA 1HF3A 1ZXLA 2Q3EA 4CV0A 2PZMA 5KVQA 3K73O 4M55A 4YXFA 1R0KA 5DN9A 1LXCA 3WGQA 4MKXA 1U3VA 3HDYA 3ICPA 1RPNA 1X7DA 4BS9A 4D3FA 4B4UA 1BXKA 3G17A 4O63O 2V6MA 2O7SA 3F1LA 3KBOA 3N74A 3HZZA 5I7EA 2G5CA 4EZBA 3H5RA 4ILKA 1S7CA 1HYGA 3AUSA 1VPDA 1LLDA 4IUYA 3LC2O 4JK3A 3VPGA 4DQUA 4ZQBA 3EUWA 4DREA 1A72A 5IXSA 5F1OA 3JD0A 3GVHA 3TOXA 4YRAA 3OA0A 5JAMA 3GH3A 2NU8A 1U2GA 1WDLA 1H6AA 1UP6A 3KYCA 1U7HA 3JQ7A 4E2YA 2HU2A 4R9SA 4XRRA 5I7VA 3BMOA 1LDGA 2BFMA 1Z73A 3QP9A 1PJBA 3DZBA 4NJMA 4Y67A 4GWGA 3JD2A 5IJZA 3L4BA 3RUDA 4XRGA 4BGVA 5JY1A 3UH1A 2PZJA 4WLOA 3UVEA 4OKNA 3WOHA 3PJEA 4CMCA 3IUPA 3CEAA 3V2UA 3UHAA 2YJZA 1XDWA 4DLAA 5KKAA 1U2DA 3M6IA 1PSDA 1ONOA 1WMBA 2VZ8A 2J3JA 3PHLA 3R3SA 4ZRNA 2ZB7A 2BLLA 4N5LA 5A9SB 1T2FA 5KJCA 2CFCA 1CDOA 2VWGA 4GH5A 5DCUA 2I3GA 5A06A 4ALIA 2X7HA 3HNPA 3INTA 4WEOA 4JLWA 2AHRA 2V6BA 3DFUA 5B4TA 4U0KA 3TJRA 2PTGA 3W4KA 2VWHA 4YAJA 5T67A 3INGA 2ZATA 5C7LO 1GV1A 4MVJP 3JQGA 4WLUA 4E5YA 3IL2A 3U09A 1Y81A 4CM4B 1Z74A 4JJFA 1UXGA 1KETA 2Q4EA 4YJHB 1GAEO 4DQXA 2B5WA 1XQ1A 2WD7A 3AUAA 1MXHA 3QV1A 4IQGA 3D3EA 4INAA 1NQAO 5G4KA 1NTOA 3RIHA 5JS6A 5L3ZA 3GVXA 3ITDA 3PIIA 2HMWA 4XYBA 2W98A 4II3A 2CDAA 3IJRA 1P77A 4DWVA 1HWYA 5KNLA 1YH3A 4BNJA 3IC5A 2X58A 2HO5A 3WIDA 1ZZEA 1P9LA 3BHJA 4FSHA 3AOEA 1ARZA 1EVIA 5LCXA 1XQ6A 2PWZA 1ZKMA 2FR1A 2OP0A 2QW8A 4HNGA 4OXYA 5GZ3A 1N9GA 1F0YA 2HMTA 2IODA 1CWUA 1BGVA 3AU9A 3NAQA 5AXCA 1U7TA 1I3KA 4NBWA 3I3OA 1MC4A 4BNLA 3MTGA 1JDJA 1YBMA 1C1DA 3AM4A 3DTTA 4FJ0A 2A92A 4KUGA 3VH4A 3QA9A 4YR9A 5A3JA 2VUUA 5A9RA 2J3HA 5F1KA 4RVGA 3WIEA 1VL8A 2GF2A 4NBVA 3KLPX 3O4RA 2OORA 3LT1A 4HBGA 5T57A 3RQSA 1YJ8A 2HQ1A 1AHIA 2OO5A 3HHPA 3E9QA 3ZV5A 2Q2WA 3OIGA 2VQ3A 4BNXA 3FR8A 4B7UA 2EKPA 3BMQB 4NJOA 3PTZA 4RZIA 4WGGA 4CMEC 3B20A 5HRUA 3JQGB 4E5NA 4W82A 2CSUA 3ADPA 2X6TA 4J0FA 5DCWA 2OZPA 2HMVA 4BKRA 4R01A 3VZRA 4TZTA 3DBRB 3JQ8B 3OQBA 4PLPA 1I24A 2BFOA 1F8FA 3CKYA 1X0XA 3QE3A 1N1EA 3KETA 1DJNA 4IINA 5B37A 1W4ZA 1Y9AA 4IDDA 3E8XA 3QLJA 4LMRA 4TQGA 4Y98A 4Z9FA 3ZGYA 4PFJA 1H6DA 2CF6A 2W8ZA 3DBLA 3VOSA 3IKTA 4GQAA 2GUGA 5DP2A 3RVDA 5FYDA 3SJ7A 1GADO 4Y6RA 5G2OA 4W7IA 3ZWBA 4R68A 3PJGA 1E7SA 2Y1OA 5IDWA 5JPIA 4NQZA 1N7GA 3ORFA 3L4BC 5GMOA 5JBIA 3DZGA 4GMGA 4CQMA 4TRRA 1BDBA 2CY0A 4Q3BA 1PIWA 2ILTA 2ZB3A 4MOWA 1DOHA 2IEDA 1EQ2A 3GNSA 2WDZA 2EERA 3GFBA 3VZSA 2XF8A 4BHTA 1C0LA 3B6ZA 1PJ4A 2RHRA 2X4GA 1FJHA 3VDQA 2WM3A 3N7UA 3GG2A 1TVEA 4OMUA 1YL7A 5KIAA 2NWQA 4I5GA 4IS2A 2D4AA 2CF5A 3JQ9C 1BDMA 1PZGA 2JFFA 1B8PA 3PIDA 2Q1WA 3BXXA 4KQXA 4FD3A 4ZQGA 1D8AA 2X86A 3VH2A 4BV9A 3JYLA 2GGSA 4NU5A 1X1EA 4R54A 4U0JA 4E21A 4IZIA 4F45A 1YVEI 3NGXA 2FP4A 4J91A 5CAEA 4DA9A 4RVSA 1ML3A 3AFNA 2PH3A 4RL6A 4CLRA 3AI2A 1WLYA 3P2YA 3PHJA 1IL0A 5JY6A 2EP5A 3H5AA 5JMPA 4Q3NA 3DBHB 3GRPA 3DQPA 4OKIA 4MVJM 3LU1A 2AW5A 3W4JA 5A9SA 4MINA 2D3TA 4Z0HO 4J16A 4Z0TA 3ZHXA 1R4NB 5L7TA 1Q7GA 5DOZA 4ALMA 1NR7A 4BUCA 4D43A 2JHGA 1ZK3A 3FN4A 3JD4A 3MWDB 3IS3A 3SC4A 4AL4A 2AQIA 2EP7A 5KKCA 2P68A 1XG5A 4J4HA 4J1NA 1MC5A 1PQPA 3V1UA 1V3VA 4XJSA 4PG8A 4CV1A 2FZEA 2HK7A 3TFOA 3F3SA 3WWYA 2WWRA 3T4EA 3KTDA 1PJCA 4YWJA 5HS6A 4II2A 3ROQA 3ZNOA 4ZQFA 4BNFA 2GSDA 5LC1A 1R37A 2QZZA 2FOIA 2NTNA 2IDZA 1IHYA 4WLNA 5JW6A 4NK5A 1R66A 2NVWA 1XEAA 4MVJH 4EUHA 5A4DA 6ADHA 3HE3A 3IP1A 1G1AA 1GQ2A 3OF2A 2LDXA 1KY4A 3NJ8A 2BRUA 3PQEA 4D7AA 3D64A 3H5NA 4XGKA 1HT0A 4P38A 2C7VA 1IPEA 2AE1A 2HMSA 3H9UA 1PGJA 4CM8A 2Y1CA 1U28A 3DR3A 3IKVA 1KYQA 4FN4A 1QYWA 4B4VA 3F4BA 3QY9A 4NU6A 3VAZA 2IRWA 3KVOA 4BNUA 1BW9A 3JTMA 1GPDG 1E6WA 4KWHA 4TKLA 4E4YA 4YT2A 5IF3A 4GX1A 2ZYDA 2V6GA 1X7GA 2VUSA 2Y1EA 3KLMX 4OAQA 3HB4X 4XYGA 1XIVA 4OSOA 4IXTA 3AU8A 4J1SA 5AVOA 2NVUA 4IMPA 3AWDA 4JP3A 3L77A 5THKA 1NFFA 1ZJYA 3ZV3A 4BNGA 1E1NA 1D1SA 4BGIA 1DRWA 3U5TA 3QSGA 4MKZA 2CVZA 4YQZA 4XGIA 1KY5A 1B26A 1M2WA 4IY1A 1IHXA 1H2BA 4O59O 5DF1A 1I5RA 2WYUA 3WJ7A 3MEQA 3JYNA 5BR7A 5C3MA 5KCZA 1YQDA 1YONA 4DQVA 1EZ4A 2OUIA 4XCVA 2NU9A 4DIFA 3WR5A 3C1TA 4L4SA 4QO7A 3JD1A 1J4AA 2C59A 4NBRA 3VZPA 4WK6A 3VZQA 1A4IA 3AOGA 4AJPA 5CDUA 3C7CB 1Q2XA 3NTRA 2NVBA 1CYDA 1MX3A 3HG7A 5B4UA 1E7YA 4EUFA 2I65A 4DC0A 1LBEA 4WKGA 4GLOA 4CV2A 4I08A 4WCFA 1QP8A 2O3JA 1NR1A 2WYVA 3D3WB 4WNIA 3VTFA 4W6ZA 3KYBA 4XQ9A 1XR3A 3TZQA 4AICA 1P33A 2DFVA 3L0DA 4M89A 2O3RA 3JQFA 4PG7A 3C7DB 2D59A 1E3LA 3OETA 5JCJA 1N92A 4L73A 3F1KA 4AJHA 2C0CA 5L51A 4CUKA 1HZJA 2Q49A 1GYQA 2W2LA 2H9IA 4NZ9A 4NPCA 2B0JA 4DC1A 1XWFA 1O89A 1H6CA 3H3JA 4D41A 4J2OA 2AEMA 3ZCXA 2Y05A 3H4VA 4R3WA 1PGNA 3LT2A 3E1KA 2W2KA 3ZWCA 4LCEA 4NHEA 3Q9NA 5JLAA 2VUTA 4CMBA 4FQ8A 4FGSA 3R0IA 1BTOA 2VZ0A 4K6CA 5J23A 2PZLA 1OFGA 8LDHA 3IIEA 4CMIB 2Y68A 1Q7BA 3TZKA 4BKUA 4A2CA 1C0PA 3AUTA 5I9NA 2WSBA 3CIFA 5IFLA 4YAGA 1HE2A 3GGOA 2BHLA 3DOOA 4C7KA 4PVDA 3EC7A 3WJAA 3A4VA 1AXGA 2O3UA 1UXKA 2PFGA 1K0UA 4Q39A 1LDEA 1LQTA 4R9RA 1UXJA 3W4IA 4K1LA 4RVHA 1DC3A 2BKAA 3PVZA 1DHTA 4PLHA 4IDBA 4HP8A 4Y9DA 3HFSA 2GN9A 1QLHA 5JAIA 5TJ9A 1LDMA 2JD2A 1RWBA 2R00A 1PEDA 3CUKA 1EE9A 4EW6A 2Q1SA 3ROPA 1YS4A 5ENDA 2VRCD 2E48A 4BO1A 1T2DA 3UKOA 1U8XX 1W8DA 3BA1A 4DRYA 4HADA 4BO5A 3F5QA 2P2SA 3DZIA 1H6BA 1PL7A 1QMGA 3O26A 2QG4A 4BGUA 1YOVA 2P5YA 4HX5A 4ND1A 1BXZA 4A10A 3A1NA 3L07A 3GA0A 2J3IA 2LDBA 1QSGA 1Y5MA 3GQVA 2FZWA 4RF2A 2QRKA 4A7PA 4YYZA 2FN7A 1LLQA 4EDFA 2FR0A 2Q4BA 1MG5A 3ZNPA 1NASA 1HZZA 1XU7A 2C07A 3FCOA 4FBGA 2OBNA 4EBFA 1EFLA 2DM6A 3MJTA 1T25A 4B8ZA 3WQSB 1NPDA 2HRBA 1RM5A 1QV7A 1Y8QB 2GZ2A 2C5EA 2GR9A 3QWAA 1QYDA 4GX5A 4YJFB 1GZ6A 1Z7BA 1EUDA 3ZU2A 1YOVB 2FY8A 3P5SA 2RAFA 3C7AA 5C5IA 5C7IO 4MJLA 4PN3A 1ZSVA 5ILGA 3PP8A 3BMNB 1U3UA 2JL1A 4J1TA 4N54A 1NAHA 3RAJA 4E6PA 4XB2A 3WTCA 1Y8RA 3KRTA 1PQWA 2B69A 4IDFA 2IZ1A 1FDVA 1VJ0A 5A3VA 4B8WA 5BNTA 1AHHA 1E0DA 1T2AA 1J0XO 1ULSA 3LF2A 3V1YA 4B3IA 4R4JA 1UZNA 4QFCA 4DXHA 2I66A 1T1RA 3PGXA 2YQ4A 2DLDA 3KSDO 3VPXA 4K9DA 3FRJA 4DL9A 1QKIA 4XJTA 1B7GO 3K2BA 1M6WA 5EL0A 2CVOA 1Q1NA 3K5PA 4BNZA 2OGUA 5ER9A 3ZW8A 3PHIA 3C1AA 2Y66A 3UCEA 4CQMD 3I23A 5JDCC 4AG3A 4PZCA 5L4NA 4YJGB 1ZBQA 3RUHA 4D3SA 3GY0A 1JQBA 1KBZA 7ADHA 2RIRA 3B1JA 3QVXA 4DPKA 1GU7A 2DC1A 2BGKA 1KERA 3DZFA 4RF4A 1A7KA 4PG6A 4WECA 1JAXA 4AJNA 1R16A 1DC5A 4UUMA 4BKPA 2ZQZA 3E5RA 2IZZA 2QRJA 2O23A 2FPGA 1HLPA 4UVHA 4X54A 1GQYA 3RFXA 1H2HA 1P3DA 3GVPA 1EEHA 4CR6A 4IDCA 5K6AA 1DRVA 3GUCA 4ND5A 2EW2A 4CMGA 4JBIA 1M67A 4AJ1A 2Z95A 4E12A 2JAHA 3OBBA 2HCTA 2Y1GA 3QVOA 2WEKA 4JP2A 4E0BA 3OQ1A 2VN8A 4AJEA 1E3WA 3QVWA 4KZPA 1LX6A 5G0SA 3OJOA 4RCVA 3C85A 3JQAD 1GY8A 4WEQA 6LDHA 1X7HA 4OSPA 5COAA 2EV9A 3WLFA 5T8KC 2V65A 3RFVA 3FPCA 4XYLA 4R1UA 5JC8A 4JIGA 5L9AA 3FWNA 3PFFA 4WOJA 3I6QA 4JBGA 4XA8A 3V2HA 3WGIA 3KV3O 2DU8A 2UV8A 3RROA 3U0BA 4FPXA 3HN2A 3S1LA 2UYYA 5CDGA 4FJ2A 5ITWA 5IZCC 3RJ9A 3G3EA 1Z7EA 5BSEA 3E82A 1ADBA 2I3AA 2VWPA 1HE5A 1ZSYA 1HDYA 4CLDA 3Q1LA 3NKLA 5A9TA 1WWKA 4EI2A 5A05A 1D4FA 4W9NC 4A27A 1YQXA 2GCGA 4CUJA 1DBVO 4MIEA 2HKIA 3MTJA 1DFHA 5I9MA 1Q0HA 5A04A 4QT0A 1ENYA 3ZHBA 4GGPA 1VKOA 4IPTA 1YKFA 3DO5A 4ZHSA 2OHXA 4PIVA 3P19A 3S55A 1ZO8A 5AYVA 4YCAA 3GK3A 4GX0A 2GPTA 4WOKA 5HWSA 3ZWMA 5JYDA 5ITVA 1R4MB 2GN6A 2B4QA 4PG4A 1NP3A 3C24A 3HDJA 5JCXA 4Z0PA 3TNLA 3I9LA 5JDIC 2VHVA 2EJWA 3W8EA 3SX2A 5KJ6A 2EJVA 3X2FA 1B8UA 2A94A 2VCYA 2CD9A 2O2SA 3K31A 4PLGA 1NFQA 4RJTA 3BMQA 1QXSA 3CTMA 1KVTA 2AA3A 3BMOB 4KMSA 1G6KA 3RUEA 4Y6SA 3WLEA 1LDYA 3ZWXA 1DB3A 1DPGA 3GN1A 5F1PA 3EGOA 5CG2A 4J49A 2C20A 3PGJA 1WW8A 3Q2KA 4KDEA 5FEUA 4NNJA 1B3RA 1AUPA 1AGNA 1M66A 1I01A 4JBHA 2JFGA 1I8TA 5IN5A 4R1SA 5A03A 3DL2A 1UR5A 4EJ6A 1M75A 2PLAA 4HWKA 4Q3DA 4ZICA 1U4OA 4YJDA 3H9JA 1A9ZA 5KJEA 1OOEA 5EQDA 5IZ4A 2Z5LA 2C54A 1C0IA 5C7OO 2FSVA 5AXBA 3BZUA 1F12A 2Q1TA 3GAFA 4XDYA 4A73A 2ZK7A 4Y6PA 1T4BA 2Y67A 4RPGA 1LDNA 3PRJA 3ZWYA 4IDGA 3JQFC 5DP1A 3ZZNA 5TLSA 4XEHA 5U1PA 2SCUA 1EVYA 4OOEA 3M2TA 1ISGA 1JVBA 2B37A 1QLJA 2DUUA 4MKRA 3EHEA 4PLZA 1XU9A 2PKQP 1ONPA 4FGWA 5L7WA 5F3RA 4M54A 1P1IA 5T6BA 1ZMOA 4TRMA 4MP8A 4KOAA 1P31A 3K9QO 1VSUA 5L95A 3WYEA 5ICMA 4P4NA 2BI8A 4MIOA 1GCUA 2D8AA 3EDMA 2G82A 1V8BA 4WCFB 4PLVA 3OJ0A 4RDIA 3DAGA 4FC7A 3ETEA 1IYZA 1U8FO 5DDIP 1DHRA 3BHMA 2IYPA 3VPFA 4DVJA 5FI3A 2JFHA 3GGPA 3V5NA 3DBHA 4U6SA 2CZCA 1HTBA 4N18A 4DLLA 3FPLA 1EBFA 1KVQA 4YQYA 4RPKA 2O7QA 4CM8B 3IDSA 4ZA2A 1K5HA 4CMJA 1DXYA 2UVDA 2GN8A 4RVUA 1T24A 2D1YA 1T4DA 2A9FA 1B2LA 3DB2A 3K8ZA 1JA9A 3HB5X 3O03A 2C2XA 1NFRA 1ZIDA 1FXSA 2VRBA 3ENKA 1F06A 5JFOA 4AJOA 4U5QA 5EN4A 1PJ2A 3F6YA 4R69A 2E37A 4J6FA 1EE2A 1LA2A 1PR9A 4RORA 1NAIA 4RPHA 4A5OA 3STHA 4IJKA 1UH5A 4JGBA 4BO2A 4UAGA 2G76A 2XAAA 3LF1A 2B35A 3A14A 5B12A 3O8QB 1WNTA 4CLEA 1SB9A 1VL0A 3GEGA 4KWIA 4OQYA 2PK3A 1R0SA 4XGNA 3Q2IA 2HMUA 3R3JA 4CMKA 1H5QA 1ENZA 2JAPA 5H81A 3HJAA 1JKIA 3P2OA 1MG0A 1F14A 2QHXA 3SXPA 2DVMA 4IZHA 3ETGA 3OH8A 1HDGO 5G4LA 4UVDA 3W6UA 4NFYA 4UVEA 3B1FA 3L6OO 2ZCUA 3MWEB 4BGEA 2VZ9A 4M87A 1QYVA 2H1SA 3RBZA 1KEUA 3GUYA 3T4XA 1CERA 1BSVA 1U3TA 4EJ0A 2YUTA 2VRCA 3BMCB 3VC7A 3WNQA 1D7OA 4XDZA 1G0NA 2D2IA 4FW8A 5TS3A 3U62A 4CJXA 1NVMB 3ZHZA 1ZK1A 3DMTC 5KVSA 3KO8A 1TXGA 2DTDA 4LSWA 4BNTA 4AJKA 2X1HA 3GHYA 5IDYA 1J6UA 3TN7A 4E31A 4EUEA 3K2EA 2GZ3A 2FRDA 3WYBA 3DWFA 2E49A 2GDZA 2YV2A 1LSJA 2EKLA 2X0RA 1UUFA 2Y99A 1YJQA 2A35A 5K9ZA 4LISA 1UZLA 2W4QA 2J6IA 1B14A 1HYHA 5ENVA 2FHSA 3K30A 3LVFO 3LZ6A 4QQRA 1Y8QA 2Y1DA 4AJLA 1TI7A 2O4UX 3ROKA 1KVRA 1WPQA 4IJVA 3OECA 1M6HA 3DOJA 3I9OA 1YE3A 4FS3A 1GUFA 1LUAA 1EBUA 2NTVA 2XXJA 3NDJA 3INRA 1ZK2A 4ND4A 4GMFA 4NIMA 4RPJA 1V0JA 3VH1A 4Z9XA 3ST7A 3AJRA 2HAEA 1N5DA 3JQAB 2NQ8A 5I7SA 4E13A 1A9YA 1KEVA 3NT5A 3D5TA 3NV9A 4I5DA 1YQGA 4AFNA 3M2PA 1HSZA 1ZEJA 2GZ1A 4UUOA 1SNYA 2B5VA 4OM8A 3DBVO 4MVJA 5A5EA 1ISIA 2X5KO 2Y0EA 3DBLB 1A71A 2EF1A 4HFJA 3FR7A 4CR8A 2IYOA 5G0TA 4BNNA 3LSYA 5COBA 3GC6A 4FJ1A 4QECA 3H65A 5AQ1A 4EEZA 2FSSA 4D3DA 1LRLA 4XR4A 2EWMA 4IIVA 2E82A 1IE3A 1RJWA 2ZTVA 4N7RA 1P1RA 3KEQA 4FFOA 4XYMA 4YT8A 3NGLA 1GDHA 2EGHA 3TPCA 1HKUA 2QIOA 4KTVE 3OEWA 4CM4A 3S2FA 1P45A 3ZWNA 3RSHA 4NI5A 1LSSA 4I9HA 2C29D 1NPYA 4CLXA 4TWRA 2DBVO 1RYEA 1EDOA 3CINA 5T5QA 1MFPA 3IQDB 1MP0A 3S8MA 1PR3A 1LDBA 2DPHA 4F46A 1KVUA 2GLXA 5TQVA 4NDNE 4OO3A 7MDHA 5AOVA 4ONEA 1YL6A 2NU7A 5CDTA 3KEOA 1I2BA 4E2XA 2YFHA 1VJ1A 3EVNA 3TFQA 1JW9B 4P4LA 3SJUA 1GQQA 5K0ZA 3VVBA 4QSMA 3PPIA 1ZK0A 3I9JA 4KTTE 2I67A 1YB4A 4J9VA 4RV9A 3UCFA 4E33A 1DFGA 1JTVA 1YO6A 3UCXA 5A02A 3WGOA 3DXFA 4BB5A 4HY3A 1UAYA 3JQAA 1I36A 2VHWA 4BMNA 1W0CA 3L9XA 4ZRMA 4A03A 1OAAA 4J4TA 3TSCA 1A27A 2R6JA 3WXBA 2X9NA 4LVCA 3E18A 1GCOA 1P1KA 3E03A 1GUYA 4NR0A 4IGEA 3WGYA 4KUEA 3ZNNA 4YJHA 1ZSNA 1U3WA 1PQUA 2C7GA 2PZKA 3ONEA 4FCCA 2UAGA 2HRZA 4MVJE 4YAEA 2Q2VA 4QTZA 3HN7A 1TB4A 2NSDA 4I5EA 2EKQA 1SOWA 4RDHA 3VKUA 1I32A 2AEFA 4CLHA 4G5HA 5JDIA 1VLLA 1EK6A 4G81A 2YDYA 4TSKA 2O4CA 1K2WA 2PNFA 3RC1A 3C1OA 4D0SA 4O6VA 1B8VA 5JDCA 3UN1A 4DYVA 1VI2A 3O38A 2E6UX 1N9GB 4MVJG 2PD3A 1ENOA 3DMTA 2VOEA 3NTQA 2PKRA 2Q99A 3CE6A 3F5SA 1BXGB 2ZJ1A 1JU9A 2HLPA 2BGLA 1GEGA 2P9CA 2VTDA 4E5PA 3PWZA 3PHHA 5IDXA 4DUPA 2P9EA 4L9RA 4WASA 3RASA 5IDQA 4XWYA 1ADFA 3OFSA 2BD0A 1PZHA 3U3XA 4C7JA 4BL5A 3OSUA 3TOZA 4GL4A 3TZHA 4I5FA 1GZ3A 2J5RA 3RWBA 4XQGA 4R5HA 3GNTA 2D5CA 2X0NA 2X9GA 3COSA 3S2GA 2JKVA 2HSDA 1U9JA 1E6EA 2GRAA 4QUKA 4WE3A 3MJCA 3ZWVA 3CMMA 3JQ9A 4IJUA 3IJPA 4U8GA 3DDNA 1HDOA 5DBFA 2NVUB 2ZYAA 5KOIA 3TF5A 4C4OA 1GYPA 3DZJA 4BKOA 3ITKA 2FR8A 4NMHA 3CZMA 3VH3A 3MJEA 2I76A 5COQA 3BTSA 2HUNA 4CR7A 1BRMA 4PG5A 1CQIA 1LRJA 1T26A 4BNWA 1HEUA 3JQ6A 2B36A 1LLCA 3L4SO 2GN4A 2WD8A 3UAGA 3VHRA 1HDZA 2CVQA 1X0VA 3H3FA 2E4AA 4XQCA 4BNKA 1Y6JA 3RKRA 3RBVA 3ON5A 4UEKA 2CNBA 3ZW9A 4H16A
chains in the Genus database with same CATH superfamily
1ZQ9A 3D2CA 4NL4H 1OZHA 4R0MA 2PGXA 4DIDA 1KO1A 3HA7A 3EGIA 4JQYA 4PHHA 7MHTA 3ZV4A 2X23A 4D4HA 3OHSX 1CLUA 3EDRA 1KMHA 4E5MA 2I54A 4M8LA 4MVWA 2AXNA 3UWKA 3EC2A 2QLFA 2AG1A 3VYTB 2QVYX 3ZHQA 4GO1A 4O0MA 1ZDMA 1QOPB 1IIRA 4MRRA 4R1PA 3TEFA 1UIRA 3JSAA 4ECEA 4EG0A 1JHOA 1KP2A 1LV8A 2INGX 3P94A 1YJAA 4IDEA 4R3NA 5I51A 3BHIA 5JD3A 3LPNA 3I05A 4ZO4A 4ZV4A 4MTLA 1Q12A 2XRMA 3HP1A 1GG2A 3KYDB 1PTJA 1KP3A 2EFHB 4MWOA 2BKUA 2DULA 2OCGA 1RZVA 1WZIA 1ZW6A 5CEJA 2XZDA 1ZGZA 4H15A 1D5CA 3ZQJA 1QHYA 3WK7A 1UKZA 2F3PA 3WRYA 1J0AA 4I6JA 4ZI5A 3ZN2A 4B7CA 3TXXA 3KSUA 2IZ0A 1DIHA 3ANXA 3UICA 1E89A 1J09A 4BECA 2L82A 2YYAA 5EFZA 1L8AA 4ZT6A 2I7CA 2PX4A 4GP6A 4ZWNA 2IH5A 2ZSFA 2Q8PA 4WY8A 2PO7A 2WHYA 3LRTA 1LF0A 3DXYA 2PGJA 3P9SA 4CL0A 1L4BA 2H18A 2RIPA 2Y93A 2ZXUA 1DEHA 4XVRA 1KDVA 3BD6A 1R0ZA 2MSEB 2H63A 4FGUA 5FWNA 2HRQA 1JMYA 1H2ZA 2J59A 3JALA 1OZAA 4K9QA 2O8FA 1ITZA 2BISA 3H3XA 4CLRB 4KE9A 3LKVA 3SSAA 1EJBA 3OWOA 1K4MA 1P5ZB 2Z1NA 4HK4A 1JKJA 1DG1G 2C5BA 4OQEA 1R3UA 1ZH4A 1VRVA 1HUQA 2HO4A 1G7SA 5A0VA 1I2CA 2FZKA 2I62A 2C2YA 4MGKR 3PI7A 1NX9A 3GL9A 1H66A 3OJFA 4BOYA 5BT9A 5K0BA 2JCSA 1I7NA 2YJ5A 3CFYA 3QWBA 4RVNA 1CQPA 4WLVA 3VKGA 1CY7A 3E48A 4DBVO 1HY3A 5CVVA 2VP3A 4Y2UA 1G19A 1V1JA 2P65A 4BNMA 3R20A 4JMLA 4JJAA 1QFXA 4MCAA 5JJLA 1RI3A 2ZJBA 2BOVA 5AVVA 3IVCA 5IANA 2ZIXA 3CXUA 2JI6A 2NOAA 3FPBA 5C0OE 3SC2B 4NMMA 3RVBA 3U9TA 3DFFA 3KQKA 4YRBA 3ASVA 4JSYA 1RAIA 4I1IA 1EUQA 4LK2A 4L8WB 4YTEA 1MOQA 1S2OA 3NNSA 4MUIA 4CUZA 2J5XA 4OU4A 5I8WA 1JR6A 1PYDA 1GNQA 3ESRA 1WVMA 4O4LA 5LQDA 3T3NA 3DHEA 5EERA 2QRMA 5IKMA 4L3OA 4U63A 5CYFA 4MQFB 2G5GX 5BQPA 5BYKA 4EITA 2H29A 2QGZA 3KPJA 4MVJF 4W9MC 1QHEA 2GEDA 3N59A 5JVDB 3MELA 2DQ4A 1N8SA 1FBNA 2Q1XA 3DWIA 3O3NB 5CT4A 4YRJA 3OU6A 3E81A 3WHIA 2WKRA 4DBLC 4EGQA 4CKWA 5HCNA 4CM1A 2HEGA 3TLEA 2VYND 3CXRA 5FA6A 1I4EB 1XKQA 1ZQ1A 1LSOA 2X0IA 1TECE 5CR9A 4RV4A 4LF9B 4OQZA 3J81k 1JA0A 2BSXA 1V5WA 2PRYA 1UT6A 4IUCS 3B9QA 3EY9A 2XQFA 4G85A 4RNCA 5CHYA 5L3SA 1TJNA 5LWQA 1ZONA 4UXIA 4WJZA 3U6KA 2PH1A 3ILHA 3H0KA 5H9VA 3BCRA 2ZZNA 1ETHA 3F49S 2QUZA 3Q3HA 4HEA6 5EE1A 1E1CB 4US0R 1PAUA 4DWWA 4IM7A 3MVEA 3TZ6A 3VSBA 4AMUA 4BUJA 4YFVA 1T8UA 1XJ0A 4LCBA 5AKZA 5DYWA 4LUCA 5ED0A 1SBQA 1M1YE 3U3JA 5AUOB 3RIGA 1L0BA 1KDOA 1LBHA 4S35A 1TT5A 2BMAA 3CO5A 3I61A 4IGKA 1QVWA 1NG1A 2WHPB 4OHBA 4ARBA 3NHZA 4I55F 1B8OA 4DKXA 4Z2YA 4CL2A 3AV0B 4R51A 4RFSB 3SJAA 4BQIA 5KQLA 2IEYA 2JG3A 5BY2A 2YHBA 4TXHA 5JD5A 1PFQA 1YAHA 1VJGA 3V8VA 1E9DA 2J7PD 1OZGA 3Q0EA 3E6AA 3HPQA 5CFMA 2W71A 3U40A 3LBFA 1W36C 4PAOA 2NU6A 4I4TA 2YJ3A 1WU7A 1YFJA 2PQ0A 3A25A 4D80A 1UMBA 2OBLA 3IVGA 1NQ5A 1KJIA 2IP1A 4L8GA 4Y2JA 5CX4A 4ZO7A 2EBWA 1GPYA 1TUBB 3VPSA 1CJVC 2W2LD 3FVWA 2HHHB 4DCCA 4YO7A 3QKUA 2ID8A 1VFNA 3KDPA 4ZD6A 3QVVA 1DTSA 1YQWA 1SQ6A 1KJZA 3AM3A 4KXLA 4NATA 3I9V6 2Q6OA 1P18A 2QIPA 1NVVR 2LVBA 1AKWA 2B1QA 4ZK6A 4RTKA 2FP3A 1SKYB 5AH0A 3VVLA 4ERNA 1UMDA 1ZI9A 3ICWA 4DRXA 4L57A 5CFLA 1Z12A 5ESWA 4HYEA 3ZXXA 1ZHOA 1AUVA 2UUBB 2LV8A 2XMGA 2HPHA 2B2XA 2E4ZA 4LDJA 1C3LA 2B4TO 2NSYA 5EJMA 4UFPA 4C7MA 1DAPA 2V4UA 4U2KA 3E4CA 4KXFB 4RTJA 3BE5A 3NHPA 2FKAA 5BQOA 1FFCA 4F38A 4F6LA 5K8JB 2RC6A 2C7PA 5TY0A 5TMBA 3CF2A 3MINA 4UMDA 1Y3FE 1A5ZA 3CH4B 4HTFB 4DSAA 3DE5X 1ZJZA 3FJ1A 4XB1A 2LXNA 4ZU6X 3UAXA 1N1MA 1OT5A 2OCDA 3KKZA 1N2CE 4WKOA 5DBGA 1KOGA 5B1IA 1NJ2A 3DKIA 5P8WA 3VTZA 3QBTA 4RTMA 4WFIA 2NUTA 3AF3A 3NTVA 1IPFA 5I01A 5F2NA 4ZTUB 2BFEB 2JVKA 3VVCA 2QQ0A 1SXIA 3NWEA 5TRTA 3ZHYA 2W6MA 1M10A 4X93A 3PQ7A 1ATZA 1E1MA 5JWHA 4A0SA 1KAEA 2C9DA 5D87A 4OHMA 1X3SA 1RJDA 621PA 4CM5A 1O9BA 1PL8A 2H4FA 2H48A 1RYYA 2VNAA 5HBRA 4YQFA 5IABA 1W5AA 1T5HX 5CCEA 2R68A 4TMTA 4B76A 1OFIA 2JIZD 1EMDA 2DQYA 3EN0A 4JITA 3T5BA 1Q0LA 1I1NA 1C14A 1OXSC 2FUKA 4KV7A 2ZETA 4M1OA 1O5IA 3CUSA 5K45A 1O0SA 1A8SA 2A67A 3OBIA 3DL0A 1ND6A 1PTKA 1JDVA 4AK9A 2R2GA 4A8TA 3F5DA 3GRCA 4OMFG 4H7JA 1NTRA 4NU0A 4MI3A 1D1PA 2BRUC 1QH8B 2HSZA 4HTAA 4Q4HB 4D4LA 5I7FA 2IHNA 4I9FA 4BP8A 3KJXA 1AS0A 1P4RA 2IE0A 3O1LA 4ACAA 2HDNB 3VKFA 4E5UA 5CDYA 5JC1A 3L6UA 1SQFA 2AFHB 1PKXA 2CMDA 4DLRA 4OI1A 3ZYZA 1USWA 4ND8B 1RKXA 2QJTA 3IEIA 3ODGA 4R1QA 2A58A 4X3CA 3R7WA 5A4IS 5KTPA 1F8GA 4C29A 1CIVA 1K9VF 1J00A 2QM3A 4PC3A 5BV8A 5K3OA 2I99A 2R84A 2F1KA 2ETVA 3TLMA 5DKFA 2NUBA 4HQ0A 5TGTA 4OGLA 3VR6H 3A28A 3DCIA 3PQ5A 1ZIOA 1X15A 1KYIA 2QU8A 4G1BA 1LZKA 3S1AB 5BW8A 2XHEA 1NATA 1Y7TA 1WKBA 5E7MA 5JYBA 1XOIA 4EY4A 5J47A 5KBYA 2DHDA 2ZBPA 3K9FC 4JYPA 2ZDQA 4CIXA 1TD1A 2O8VA 3OEED 3BXFA 1UDWA 1P74A 3GLIA 2PYDA 1L5LA 2H4WA 2CNOA 3DQZA 1EDZA 3R6GA 4IS3A 1QTRA 4U7WA 3TB6A 4NFLA 4P81A 3T15A 3VNSA 3DOIA 4TV8F 3PYLA 1G8KA 3BA6A 5FIUA 3WICA 2GBCA 4K9MA 1CP2A 3QE2A 2NO7A 3ASUA 3C8HA 3QU4A 1I6KA 4IMRA 4X61A 4BFXA 1YZUA 3OLYA 2X3FA 3CIOA 4GOOD 1GOTA 2F1IA 4QXMA 1V1MB 4XVHA 3FOFC 4JI0B 3D4OA 1H8EA 1FXUA 3PXEA 4OHKA 4QLBA 3ZLVA 4QUBA 1ZC3A 1WPXA 2G1UA 1RTKA 1FLDA 1RE0A 2VA9A 1XEXA 2ZYSA 2P0AA 4BLWA 4M7PA 2ORYA 4IQ0A 3OTGA 4QO8A 1KQPA 3E3LA 5AVTA 1E7RA 1Z5OA 2CHGA 1LC3A 4WERA 1BO6A 3TCKA 4O29A 4RV5A 1PJ3A 4ND6A 1NYTA 4V39A 4PPYA 5PGMA 1XEWX 2G4VA 1RKBA 2H1FA 2PUWA 1SUDA 1B41A 4HQ6A 1PEYA 3BTVA 2RGAA 4GYWA 1OMOA 4MR7A 4F5ZA 5DGIA 2B3TA 2O57A 4MMYB 1NVWQ 2PE5A 2C7BA 2VNIA 2FMUA 3RI3A 3NEAA 2CLCX 1F2DA 1MQ8B 1NMEA 3I37X 3TL6A 3JQBC 1Z62A 3QJYA 3B3QA 4G8BA 1YR9A 1ZN7A 3CH6A 2AD5A 1PJQA 5EG5A 1DJLA 4R2WA 2PJRA 1FUIA 3A9RA 5J5VA 1MAVA 2HFKA 5CVDA 2C4KA 1QPZA 2PX6A 2WTBA 3LH5A 1UDAA 4HS4A 4QOFA 5A6SB 4D0GA 3L05A 4L3WA 2WFLA 3LUPA 5GY7A 2XTNA 1HEIA 1MDFA 1ZN2A 3KE8A 3L8MA 4WY2A 5F73A 3C48A 3P9XA 4DR6B 1ZY2A 3G13A 4UU7A 1UBCA 4RGBA 3WZ2A 3F8TA 1HDRA 1TT5B 3B1XA 3LCRA 1QIEA 5DWVA 4YB8A 1PK7A 4YV2A 5FX2A 1NYQA 3PL5A 3PGA1 2BJVA 1RXSA 5IARA 3VDRA 5I9IA 1H0KA 2ZUBA 4ZQEA 4KI7A 4ESEA 1HGXA 2AK2A 2ZB2A 1UJ6A 2ZJYA 3U4IA 2GASA 4DLAA 5EJ5A 1N78A 1XTZA 2I6GA 3D8UA 3H9QA 1FDTA 4LYEA 1Z35A 2V7XA 3GXBA 2FSHA 1E3SA 3C74A 4NECA 4U7GA 1OTHA 4B2IA 2R65A 4URWR 4H1UA 2AOUA 3WLMA 2FMIA 5JO0A 3ILVA 1BH2A 1AGYA 1CVRA 2X7JA 3WGZA 1LF5A 2KWIA 2XA9A 1K7EB 1NBMD 4MIKA 3EOAI 1PJLA 1O5OA 4QFDA 3QOFA 3R1IA 1NVBA 1D04A 2B7LA 4CMEA 2XXAB 1ZJ6A 3O73A 2Q3BA 3ORYA 1EVJA 1FFXB 2ZIZA 3ANNA 1YB6A 2IQ5A 3A1VA 3QVGA 1O97C 3FF4A 4MSUA 2C7QA 4Q3AA 3GP3A 4CLOB 1F8UA 8GPBA 1R4MA 4OXNA 1KEWA 1P29A 3OUUA 4R84A 3WLIA 3PC2A 3MILA 4KPUA 3Q1KA 4QULA 4AZTA 3K8YA 1JQEA 2W2KB 4TXNA 4QWWA 3H9CA 1ZS9A 2JRLA 2PR2A 2X8AA 3LDHA 4NZYA 4F06A 5HPYB 3LT0A 1IN4A 1PFWA 1NMXA 2QVZX 4CN9A 2RK6A 3JQRA 2CE7A 2F48A 2VNSA 3F46A 3S5UA 3TRKA 4D4GA 4E51A 4EFMA 4RTSA 4RD0A 2WWFA 2QRLA 3ZDEA 3KELA 3FTQA 3EGWA 1E94E 1DQNA 4GOLD 1X13A 1EVZA 4UAJA 3L06A 3DHVA 4I5IA 4ANFA 1X7WB 3AG6A 2IV3A 4R41A 3SJBA 2XCUA 4HEQA 5JNRA 1VCMA 2VPTA 1DQYA 3FNFA 3A6GA 3FD8A 2FEMA 3TCNA 4L74A 1LW7A 3HDQA 2VXYA 3SZOA 1ZUD1 4NBTA 3JR7A 1VL5A 5BOSA 5K0CA 1OB2A 4BLVA 4GYYA 4R0VA 1B4DA 3AO0B 4LK3A 1Q57A 1JSXA 1S3IA 3Q6MA 2ORVA 1CY2A 2C7OA 1KA9H 2VXBA 2J7PA 4MHSA 2VWQA 1IQPA 4M1MA 4QE3A 1PYGA 3VC3A 2WU0A 4G0XA 1RIFA 2QLNA 3KSZO 2JNWA 1UDBA 3LPDA 3CF4A 3ND9A 3K0CC 4ZYWA 1O94D 3AI7A 3Q9UA 2EG9A 3Q98A 3FWZA 4BX9A 2ZYUX 1NXVA 3V4OA 5IMSA 2XCTB 3ETNA 3HGQA 3RJTA 2QEQA 4W99A 5DLPA 4A16A 4F8YA 2HDWA 1IBMB 1LBSA 5DMXA 1T9AA 4LWPA 4D9FA 1QE5A 2EHDA 2VS1A 3N76A 1XRSB 4UU8A 5B1YA 1M8JA 4K2AA 4X97A 4BO6A 3P2KA 3OICA 4LDRA 4B3JA 1MXFA 2P2NA 4H7PA 4L9AA 4AS3A 2ONYA 4E5DA 2EHJA 4MS4A 5CDHA 4BO4A 2NYAA 1G291 1M2EA 3IJEB 2X0FA 3C4VA 2PX2A 3MD9A 4N01A 2YZ7A 1ESZA 2TRSB 3QUBA 1IZZA 2VL7A 4YMVA 1HQCA 3H5WA 4V3BA 4B5KA 5K09A 4WZAE 2HJGA 3HUUA 2DBZA 1NQWA 5BURA 3CC8A 3IBYA 4HNAA 2NO9A 3KKLA 4Y2QA 2I6UA 1UP4A 1Z4LA 2YOFA 3P97A 4POAA 4ZVVA 3ETLA 4PRYA 4Z3DA 1XSEA 3A2MA 2NM0A 4QHSA 5AIBA 1SXPA 1S8FA 3PUJA 1T0PA 4HUQA 5K20A 1G98A 1WB5A 2Q07A 2PDAA 4MPDA 2V96A 2VBIA 4RFLA 1I2AA 1WX1A 5E6SA 4AO8A 4DMGA 4FB4A 1HDXA 2YQ5A 5KDDA 3C3XA 3GQBA 1Z7WA 5ILOA 4RA6A 5EIHA 1PZXA 4WFJA 3NX4A 2F43A 3ZE1B 3WO0A 2PKQO 3THWA 5LZ8A 3RYIB 3BWMA 3LLVA 3DONA 2ZEJA 4KK4A 2H08A 4N0DA 5AHWA 3TQFA 4N5DA 4MRAA 4E3ZA 2XRZA 3KU4A 3AWIA 3LY7A 3NDRA 4H27A 2FW6A 1KE2A 1K3UB 4KB5A 4MKGA 4EEXA 5B5SA 3R9XB 4B3GA 2EWWA 3ZUGA 3ZJVA 4MDFA 2ZWOA 2JCBA 1H1DA 3LKBA 2AE2A 1IC6A 3P9IA 4IHKA 4D99A 2Z08A 3GUZA 4M0DA 3DVAB 1V3UA 1JLMA 1Q21A 1PVDA 3IBFA 3NYIA 2WYWA 2XODA 1X1TA 3GMDA 3DEZA 3QELB 4LV5B 4OHOA 1V7ZA 3EYAA 1MW9X 1W5SA 5B3LA 3BMNA 1CUYA 3IAM6 3QWIA 4J3FA 3RR2A 3RTCA 3SHFA 4US2R 5MFPA 3TLZA 4PC1A 2BIFA 5T4HA 3PUYA 5HZHA 1D9XA 2PUAA 1EX7A 4LJAA 4MA5A 2KI5A 4CLOA 1OD6A 5J2TF 3RIEA 2XQKA 1AGPA 4P32A 3SMQA 5EP4A 2O5CA 2WJVA 3QA3E 3WISA 1H85A 2UKDA 1UOPA 1APBA 5AVXA 1M34E 3KHUA 1M83A 3L6CA 4DLTA 4NBUA 1GZUA 3E7FA 3GVCA 1WZNA 1ZP6A 4KACA 5IKOA 2WD9A 2HPVA 2NUPB 1R50A 1WEKA 3TNDA 4GVLA 3S8YA 1YDGA 3PYXA 4BX3A 2NQ2C 1N2CB 5DLEA 3TR6A 3OP4A 2C98A 3SSOA 4RZSA 2IY9A 4LDAA 5ECGC 5T64A 4OFBA 5L3RA 1A5TA 4TTTS 3S44A 1QHSA 2NQTA 2QAGB 4G8CA 4DEYA 5JMOA 2NV0A 1XJCA 2P5TB 2IBTA 1MD9A 3AHHA 2BAGA 3D5QA 4GFDA 1ZD2P 1U9ZA 2VHJA 3OPVA 2K2WA 2OOSA 1WP4A 1XZAA 4TTJA 3EQZA 1TZKA 4ZHQA 2ICAA 3RC3A 5IXYA 1WJGA 1RHUA 2E2WA 1V6SA 4QL3A 1FRQA 2WJIA 2WZCA 1KKUA 3USCS 1UPUA 5LBIA 2OYCA 4C4XA 4DSZA 2VZLA 3BD9A 3PXCX 3EJWA 4OYRA 3E5MA 3H19A 3GHHA 3DFZA 3WY9A 4N0MA 1B73A 2DFPA 3R7WB 3VR0A 1W75A 3G5LA 3DC7A 9LDBA 1TRHA 3GR6A 4K9RA 4C20A 1Q0ZA 2RKBA 4JQCA 3SU8A 2QMUA 3AF1A 2QX7A 3GZ4A 1V11A 4BZWA 1WY5A 1G5RA 3QBVA 3RJ5A 5FH9A 2VATA 5LDGA 5SYMA 3A1EA 3B5JA 4O2BA 2GD2A 4PZDA 5JR3A 4L50A 4G9GA 5EXSA 1E9VA 2H2WA 3O8CA 2UXCB 2NTJA 3HLYA 3SQLA 1X39A 1EA7A 2O5EA 3E15A 1JNYA 1L9KA 4CMIA 1RXEA 5CA1F 4H3KB 3EGDB 4PYRA 2NZJA 3HVRA 1WVGA 1GA1A 2H16A 2GYVA 3UT5A 4ZZIA 1QTNA 3HZRA 3IP3A 4M49A 1QRUA 2FWIA 1HLGA 1ZVJA 2IUEA 2P3SA 3I9FA 5LQCA 2VDPB 1EFCA 2QRVA 2ZRDA 3MMPA 5K8TA 1Z82A 3PZRA 5DOVA 4EVQA 3EEIA 2CMGA 3UUWA 1VC2A 1YUBA 3H2IA 1Z4JA 2QU7A 1PVVA 3ZU3A 3NLLA 1NHGA 4UUNA 1SCNE 3FY4A 1BCRA 5TGZA 2B92A 1J42A 1EUCB 3NEJA 3PC3A 4YRKA 3JZAA 4X7RA 3KQTA 3WSVA 3PWSA 2PBRA 1SU7A 2JGEA 4KNVA 4R9VA 2GOYA 3SEQA 4G36A 1K6JA 4D45A 2OTCA 1IH8A 3PNBA 3G9XA 3H2GA 4PC2A 2FNAA 2P78A 3DBRA 3JQ8A 4I3FA 1I0ZA 3TPFA 3WAJA 2QLJA 4FONA 3RVOA 2HU5A 5K6AC 3PDJA 3UOGA 4YR7A 4BB9A 1XAHA 5EMKA 1ISJA 1PJTA 3DV0B 5TSDA 3JV7A 3FTCA 4TTQA 1THTA 4FZVA 3RO7A 3C4QA 1XELA 1BU5A 1NX6A 4E94A 3L9WA 4OHVA 3TO5A 1UT8A 1BXRB 4MUNA 4B1FA 4JJ8A 3RS7A 1C1DB 3W6ZA 2PKXA 1DRUA 2IVZA 3TTYA 4BCDA 1WSWA 3MJDA 1FEZA 2YV3A 1B15A 4IO1A 1LD3A 4NMWA 4ND8A 4B4OA 1LPMA 1DRJA 1CZNA 1VL6A 1H2FA 2EP8A 2J0UB 1G9XA 4PLTA 2G17A 1PS8A 4WK0B 2AQ8A 5KI6A 3EPPA 1CVLA 1RI1A 4YAKA 3GVIA 5AI6A 3M33A 2OCBA 1DO0A 3VMMA 3Q72A 4HI0E 5JI3E 5CVJA 4XYEA 2QP3A 3FPFA 3HVIA 3MNFA 1QV6A 4RK1A 5C8DA 5I7WA 2J9RA 1PG2A 4TM8A 2H1RA 1Z6QA 5C53B 5JQGB 3FM9A 4P84A 4K46A 3ORSA 4JLSA 1U5BA 3GG9A 3PLNA 1QVZA 3HJHA 4IH1A 4NE2A 4BO8A 3HKBA 4URUR 4EHLA 5KYUB 4MPRA 1XTQA 2VK8A 3ELUA 4J07A 3OC6A 4CCAA 3A7DA 1M2GA 1UPBA 1P4HA 2BEWB 4GXTA 4DM3A 2GTHA 3PQ3A 3Q7IA 1BD4A 4NV3A 5G4KB 3C97A 3SCZA 1D7AA 2O2XA 5JAQA 3G5MA 3MB8A 1E66A 1L5MA 2X8WA 2JJYA 4LN1A 2WJPA 2IYWA 1R9GA 4CYMA 1IY8A 1UEIA 3FNEA 3GD5A 4QBTA 2IYEA 4QOJA 4EP1A 4HGPA 4BVHA 3HMKA 4B75A 1IBKB 3ZGZA 3G6KA 4WIAA 4WA8A 3ZU4A 3F6PA 3TH5A 1YCGA 2VT2A 1LK5A 4HTFA 3WV4A 2OOKA 3EZYA 3B85A 3EBPA 3U60B 4LNUA 1AQNA 3D3JA 3ZCRA 5A5FA 2RGUA 3PNVA 1XCGB 3EZLA 1G17A 3F2IA 1LVHA 1V1RB 1NI4B 4HZUA 4DLVA 4ZVSA 2JAOA 1VLQA 3HSSA 3OE5A 5JH7F 1AG9A 1SZJG 4H7DA 3ICOA 1L7AA 4CVNA 2CBZA 3P5BA 2WQ7A 3OQOA 4LHWA 2EQBA 1XCBA 2ODNA 3K7EA 3NYQA 4HFNA 4JJ4A 1PWZA 3CM0A 4UBMA 4CETA 4UD2A 2V8OA 1MEEA 3CSDA 3NYWA 2CVFA 1JHRA 2J8ZA 4UOQA 2P6UA 2VK1A 3TLXA 3AFMA 1QWOA 2NP7A 1A8UA 1QG2A 3O4IA 3PNSA 3OWHA 4YPVA 1G55A 4EGFA 2BP7B 3G79A 4MWCA 1LPPA 1X1DA 1AB6A 3GOHA 5ILQA 2OR3A 1SXGA 4BGDA 5TF4A 2AZ4A 1E4EA 1FP7A 4RH0A 3OCUA 4Q9HA 5EGNA 2BELA 1LGYA 4Y1RA 3UF0A 1GPJA 1O6BA 4UVGA 4B3HA 4D56A 4DIMA 1PT7A 3B3AA 3I1JA 4RS4A 4LJYA 4XD7A 1KYYA 3VM6A 5I4KA 1V71A 5CFZA 4MULA 2ZRQA 1R8YA 1R8SA 3EA0A 5AJXA 3BIOA 1ZVMA 2NACA 1OC2A 3QVGB 1G2IA 1KO8A 2PY6A 4QJIA 4S1VA 4ESHA 1P19A 2IHYA 4CMAA 4W5TA 2JAWA 2ODEA 4IFIA 5I5GA 1ZCAA 1Z6ZA 2BPOA 4OL9A 4YVFA 3QW4B 2IUUA 4CODB 2XT9A 1PI3A 5AHRA 1Z5PA 4FGZA 1ADGA 5DULA 4B6JA 1PX2A 3K2QA 4QUGA 3LYUA 2QLBA 1DO8A 2MTBA 1SZDA 1U4NA 4FNAA 2WAXA 2AZMA 3OEYA 4KQ9A 4AX4A 3VOAA 2YMMA 2YFQA 4G0QA 4MKHA 1EI9A 3KOUA 4OQMA 1M3SA 2CJXA 1AURA 5AM5A 3I6IA 4IWYA 2JH9A 1D6NA 4UZFA 4Z7JA 4ECAA 3AIKA 4N5MA 4ZALA 4ADSG 2I1VB 3FKJA 3UUGA 4PLCA 4J7CA 4PBSA 2GDJA 4NESA 1UJMA 4OV6B 4KNYA 1QVVA 1I5EA 3U3OA 2W6JA 5C4IA 4LW8A 3D0OA 2ISSD 1GGEA 3ZZTA 1HORA 4BB6A 4DHEA 4LE0A 4BYMA 4Z4CA 4NMLA 3THSA 3HXMA 4BQPA 1R6XA 3NFRA 1A76A 3QI2A 2O1SA 4OY3A 4PC6A 1DO2A 4M22A 4UU0A 2C99A 5E7IA 1LNZA 3UY4A 5ICSA 5G3YA 2ZRJA 2JFNA 3L41A 1DIRA 4IWNA 2IEGA 3IBTA 2GZMA 4PO3X 4RQUA 4RVDA 4YHBA 4CHGA 4DGQA 3KZXA 4WESB 4KFSA 3RWOA 6AT1A 3IUSA 3NM4A 1YRWA 1Q1QA 1ULUA 3OCVA 4IF6A 1L4FA 4DGSA 4KPGA 2LUOA 2Q3FA 2WIFA 4ZEOA 5FPHA 4D02A 1R15A 4M4SA 5JO9A 1WMEA 4KFUA 4DIKA 2QJOA 4S05A 3IMCA 3L5OA 3SEAA 2B8WA 3JD3A 1HYEA 5EZQA 3TXAA 4JVLA 4GUAA 1WAMA 1M34A 3UXYA 2IS1A 4M9ZA 4YPFA 1NNI1 5G0UA 2XUOA 1P6UA 1SG6A 1P44A 1U1DA 3W2TA 2YZMA 4YMUA 2FMTA 1DBQA 4UULA 3I04M 5BW5A 2QTLA 2R11A 1JPNA 1JAZA 2Y2VA 3BYZA 5EXPA 2FJUA 5CXUA 1Y1PA 1TU4A 2G71A 4RVFA 2MSCB 2RGNA 3KKEA 4ALJA 3GX1A 2Y76A 3L1IA 1LKZA 1U0TA 1ZXLA 4MEAA 3RF6A 4X95A 5EEGA 3WRXA 4V0OA 1CEEA 1LS1A 1L5HB 1YE5A 3T8YA 3K71B 2A6PA 3RK4A 2XHZA 4K6HA 1FFYA 4A5SA 4RESA 3A6FA 3V7FA 4RTPA 4MKXA 4BS9A 4D3FA 4B4UA 1RLMA 2WIAA 3OX1A 4A6PA 3OU7A 4CIAA 1W4RA 1Q77A 1JZTA 2O7SA 3F1LA 3N74A 4LTNA 4PCUA 1Z6GA 5FCDA 2G5CA 5JNUA 4PC7A 3H6GA 1U1GA 1Y5NA 1TKBA 1QFJA 4IILA 1SCKA 1GKYA 1SU8A 4AY3A 3AUSA 5EZYB 1VPDA 1XWWA 1C30B 1ZN9A 2I7XA 3RSCA 3TUIC 3HJTA 3JD0A 2R5NA 3GFTA 1KOJA 2EATA 2WP0A 1WDLA 4OJQA 1U1EA 1UP6A 2FFJA 1U7HA 2RK3A 2WSMA 2GHQA 3C2QA 3JQ7A 3LA8A 2MJLA 4DCTA 2HU2A 3GFRA 5EXXA 5FBQB 3HPRA 3RIXA 4N82A 1IK4A 1WHTA 2GB4A 2PRIA 2LCQA 1LTKA 1DBRA 1GGHA 1A5BB 1PJBA 1R6VA 1V5FA 2BLNA 3N07A 3N2KA 4EAQA 3V7NA 4GWGA 2C83A 1XDGA 4GYKA 4LZNA 1MJHA 4S2UA 2A4MA 3NONA 3RUDA 4ZYZA 3UH1A 3A2KA 1JE1A 4QJ3A 1G63A 1L1EA 1VZ3A 1E5XA 1TAQA 2P2YA 1S4MA 3FVVA 5DXJA 3UVEA 4B6PA 4CMCA 2F90A 3H11A 3MC1A 4QDUA 1EWQA 1Q0RA 3FMIA 2QSYA 3DNMA 3V2UA 1ZD9A 2QS9A 3B52X 2YJZA 3HFRA 2FPKA 4IRMA 4NZOA 5KKAA 5KPDA 3HCDA 1GP2A 4HQRA 1E20A 4HAOA 4MPPA 3PHLA 4ZOBA 4BMZA 1H4SA 2EIXA 1P4JA 2MT9A 1U7DA 2ZB7A 4O4JF 4BBJA 5K3EA 1PLJA 3K0FA 4TWAA 1T2FA 1RJEA 4MQ4A 3MFYA 2XB9A 4PNPA 4F8EA 3T0GA 4JAVC 4ZC1A 2BFBB 4O4IA 3C3KA 3REFA 2X7HA 1HDEA 3C8UA 1JQ3A 3VO8A 4JLWA 2VSNA 3TLYA 4D3SA 5LKAA 3T9DA 4RIIA 4MPTA 4ZI7A 1JG3A 1JR4A 1H65A 3TJRA 2FZ4A 2PTGA 4X20A 3W4KA 4YAJA 5K0TA 5F9HA 2A3RA 2X4LA 3THXB 3CLRC 1GV1A 4K2HA 2C2WA 3CCBA 1DWQA 4X60A 3UB3A 4ER0A 2HRCA 4KBYA 3FWKA 5FFNA 1AK1A 2C8LA 3KQUA 1VCIA 1CS4C 4R9NA 2PX8A 2ODQA 4JJFA 221PA 2AMLA 2E5WA 4YUVA 1UXGA 3CW9A 3IIIA 5AUNB 1KETA 1JXAA 2PCJA 4RACA 5F33A 1GAEO 3S2YA 4BPBA 4WJLA 2H5JA 2JI8A 4JQOA 3G0BA 4CG0A 4AQ7A 3M6VA 1MXHA 3CLSC 1R6UA 1Z0ZA 3D3EA 4GDMA 3X43A 5JD4A 1NQAO 1WG8A 2D8MA 1XL0A 2NZWA 2DWUA 3MMSA 5L3ZA 2Q4TA 2LW7A 5BN5A 3GVXA 3OCYA 1P2DA 4LOLA 2GYUA 4ZDWA 4DZRA 3H8JA 1ZHHA 4L1KA 1FJ2A 2VJKA 3KKNA 2CDAA 1CKEA 2I4RA 5ERGB 4OBEA 2FSPA 4OU5A 4DWVA 1HWYA 1V9CA 3RLFA 2ZI3A 3MGBA 4HDCA 4QC2A 2XRFA 3GGJA 4V1CI 3EIOA 2RI0A 5ALXA 1BE6A 1P9LA 5D84A 1G3QA 3JY6A 4DLUA 4DMKA 5CLJA 4HVLA 1QOQB 3LO8A 1YR8A 1CJBA 1ZKMA 4ZVNA 4LF7B 2AYXA 4NOMA 2ZSIA 3SSNA 4G24A 3W7VA 1U63A 2QW8A 4AWAA 1U7WA 2GPSA 3PFCA 1J07A 1WVIA 3A32A 5GZ3A 1N9GA 2ZS8A 4OUKX 1F0YA 3KR1A 2JJ8A 1VBNA 3AEXA 3UMSA 2IODA 1BGVA 2VG8A 4C5AA 3X1XA 1U7TA 4EPXA 1ZICA 4FMDF 4BTLA 3I3OA 4HDAA 5DHFA 1RC1A 3UMRA 1QOZA 2XT6A 1YBMA 3H42B 1ODTC 4FJ0A 3EVZA 1K97A 3I5AA 4J7AA 4EG7A 2PS0A 3W3AD 5A9RA 5F1KA 4RVGA 3WIEA 1VL8A 2BM9A 2KS6A 3IVRA 1MV5A 4CKBA 1SIUA 3MCTA 4BQSA 1XDUA 2VJAA 1HR0B 3RQSA 1ZH2A 4M1KA 4DUGD 2Q2WA 4XEUA 3EC1A 4YECA 1WOYA 4V0SA 4UCFA 4UJ5A 2NXWA 3N7AA 3S2ZA 4M8IA 2FRVA 5DHAA 3CZAA 5B2FA 4I1UA 4WGGA 1XZGA 3JQGB 4E5NA 2VUHB 1RRMA 1N7IA 2QPAA 1U11A 2YZ2A 4FYXA 3GRZA 4HDNA 5TB5A 4D98A 4HBZA 4J0FA 1HL7A 3TIVA 5E3IA 5FTLA 3EG5A 2HMVA 4R01A 3VZRA 4IVPA 3OQBA 2R6R1 3N8NA 2AC7A 2B78A 2H0RA 3CKYA 4O3MA 4N7JA 1JZSA 1KJJA 4WZ6A 1G8HA 1CS0A 3HVKA 1DJNA 1QZUA 1W4ZA 3DZDA 3QE9Y 3QLJA 2ZBFA 2BBTA 4Z9FA 1V8OA 4WOBA 1WCIA 2ZJ6A 1XBTA 5FPKA 3PC8A 4GQAA 5DP2A 4AKIA 1VMKA 2ACVA 2VA8A 3FCYA 4L5IA 1N2CA 3SHOA 4DS3A 4W7IA 3FDFA 4EB8A 1U0OC 4RULA 2IU6A 3PJGA 4R68A 3OMWA 1XXHE 7GPBA 1ZISA 1L4EA 2ZE7A 1N7GA 3AKDA 1GTZA 3HH8A 3DUFB 3L4BC 2YHAA 1C1HA 1NBIA 4GMGA 4PFKA 1XZ8A 4TRRA 3K6KA 2IYXA 3P4YA 1Y7PA 3DMNA 1GNLA 3IRUA 4G0ZA 5SZKB 3PDWA 4K6MA 4CDMA 1EQ2A 2GVDC 4J3NA 3VZSA 1PNVA 3GFBA 4BHTA 3NBYC 1U02A 5AKKA 1C0LA 2ZBQA 5JVDF 1E1QD 2QTTA 3Q3JB 3X1DA 3WGUA 3EQ9A 3J7TA 4RWZA 1KFEB 5I7RA 1IK6A 4IDQA 1XNQB 1VBMA 3GG2A 1EGAA 2PAAA 2QG9A 4TLEA 3SYNA 4BAZA 1TMKA 3SFTA 3G2NA 5HX7A 3LECA 1CUDA 1FUYB 2CUNA 3LDUA 1BDMA 1FMJA 4KQXA 4QXRA 4JFRA 4RHEA 3R4VA 3MMXA 1WRBA 2D2FA 2Q5CA 3NHAA 1ESCA 2XWJI 4FD3A 4FYYA 3QELA 4OFZA 3O3OB 4BV9A 2CXHA 1LBIA 4IZIA 4FUQA 1X38A 4Q7EA 4QQFA 5M3BA 1Q5PA 1SCJA 3EVBA 3NGXA 2VJMB 5CAEA 2UUAB 5I48A 4RVSA 3TZHA 3MN1A 1UZAA 1TYAE 1US8B 1WF6A 3DHWC 3FRHA 4WINA 1XMJA 4CLRA 2C2KA 4WUTA 3P2YA 4NVRA 1K63A 4NF2A 3GBSA 5AW9A 2RAPA 4Q4AB 4HRXA 1XVIA 4OQQA 1OILA 3EBOA 4Q3NA 5EUCA 1GT91 1F5SA 2ZSDA 3AVOA 4S1WA 3LU1A 1AMUA 5A9SA 3OEEA 4NZMA 3AVYA 5KYGA 2YICA 4RY8A 2XKBA 2R6ZA 3SOZA 3QHPA 4HLCA 3TIXB 2D5BA 1Q7GA 4OJKA 3UAYA 2C3MA 5JADA 4ZGGA 2JHGA 3FN4A 2ZUEA 2WQZA 4J2TA 5KKCA 5LUBA 1T4CA 1IY9A 3NRBA 4K87A 1MC5A 1MQAA 4PSCA 4ZAWA 5FBLB 2IUTA 3BFPA 4HZIA 4Y2XA 1H8ED 4XJSA 3AVTA 1TUIA 3TRHA 4ENSA 1HFWA 4QUHA 3BXOA 3EMVA 1ZD8A 4PSAA 2ZRKA 1FPMA 1ZGJA 2RHOA 2D3WA 3M4NA 3NO4A 3IUQA 2FCRA 2NPOA 2R25B 3F6EX 3N0RA 3W2IA 4KH0A 1PJCA 4YWJA 2PWYA 5FNVB 5IJWA 4ZOQI 1I7PA 3HO8A 4BNFA 4II2A 3X1ZA 4FDUA 3SIRA 2GSDA 1ZI8A 1R37A 2GNOA 1OLXB 4I6EA 1IHYA 3E70C 2C97A 1JIQA 1RLOA 1Q3KA 1SVLA 5AVKA 3KJHA 1N5LA 4EUHA 1PTJC 4TT3A 1DC7A 3KJZA 3MCAA 3OF2A 1RFLA 2WKQA 4DQDA 1KY4A 2NTEA 3CUWA 3KSRA 1FFDA 4MAMA 4X7BA 1Y1SA 5E6RB 3TS1A 1ZKDA 3RYCA 2GFHA 4YUYA 5SZHB 5E38A 4ZMSA 1Q1AA 2XECA 3GFOA 4LZWA 4MWDA 5M5BA 3PB3A 2VAMA 4JUAA 1E2PA 3ZI4A 5DNEA 3UYLA 3H9UA 2V3WA 1KI9A 5B1EA 1Y1RA 2C1XA 3N3BC 3KPVA 3K6SB 1IOZA 1Y3HA 2VDOB 3BSWA 1JXMA 1BX0A 1KYQA 1QYWA 3PQCA 4HATA 4NU6A 4TL9A 4X1YB 3VAZA 4C06A 1TM5E 3R44A 4XJXA 1CY0A 3SYLA 1WUYA 4G1CA 3KWJA 1E6WA 2QTBA 1U2RA 3HXKA 4KWHA 4WK4B 4B6RA 4GX1A 4D6XA 5CB4B 3THWB 4LRUA 1WA5A 3IAXA 3VNVA 1OUMA 1GL7A 4FLMA 4I99A 2VUSA 5CJ2A 1U8TA 4Q7MB 5EJ6A 3M49A 3KLMX 2AJBA 4WDQA 4XYGA 5JEDA 1MO4A 4IKEA 4IXTA 1ILWA 2XNHA 4E3WA 2NVUA 2GA9A 3C3BA 1Q19A 3JATA 1B1AA 4IMPA 3T3IA 4QU9A 3WK8A 4JP3A 2XCIA 1D2HA 1NFFA 5D51S 2NO0A 5THKA 4CCYA 4BNGA 3SZLA 1NC3A 1P2UA 2IYNA 1DRWA 2R2AA 1UK6A 2B3DA 3QSGA 4GD3Q 1FLAA 2CVZA 4XGIA 4DARA 1B26A 1TJPB 3PNOA 3OTOB 3HU5A 4U7FA 3ECCA 3N2GA 1IBLB 1DKPA 4I4TB 2QAGC 4O59O 4ZKDA 1AQYA 5ECYA 5BSVA 1EINA 1GXSA 2ZFUA 3D2LA 4QELA 5DIFA 1F1BA 1MPTA 1PQYA 1CUVA 4OK5A 3P20A 3SE7A 1WF3A 1R0CA 1XTPA 3FE2A 2CUZA 4OLFA 3ANYB 3IYLW 1Y3IA 3LWNA 3QI7A 4UHKA 4AY2A 4UNPA 3N3AC 2NU9A 2J9ZB 3ENZA 3ZTWA 3V48A 3JD1A 4ZOEA 3TKAA 2C59A 3R3UA 2H1WA 2F4NA 1ZHFA