4NPDA

High-resolution structure of c domain of staphylococcal protein a at cryogenic temperature
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
58
structure length
58
Chain Sequence
ADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
total genus 23
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npdA00
4BXLA 1FC2C 2QVAA 5EFWB 3QWOC 4JBZA 3MHVA 1LT1A 4EYYQ 4ZNCA 2KI7B 4NPFX 1OVUA 4K35A 1EDIA 2P58A 4HJGH 4ASVA 2JWDA 1NVOA 2SPZA 1U7JA 3RGUA 1OVRA 5K5GB 1JM0A 2KIKA 4CPGA 1BDCA 4ZMDA 3FXEA 4NPDA 1EDLA 3FXDA 1LP1B 4ASWA 2QRXA 1EDJA 2I8DA 1SS1A 5DJTB 1H0TA 5CBNA 2OTKE 1MFTA 2M5AA 2R44A 4GOFA 1U7MA 1EC5A 1ZW0A 1JMBA 1S3JA 1ZXGA 4NPEA 1LP1A 2B89A 1OVVA 2B87B 2M0BA 4K3AA 5C39A 2K3RA 4GODA 2LXBA 1H0TB 2RKLA 3S1KA 1BDDA 2LR2A 4HKZH 2B88A 4KJMA 5DJUB 1X0TA 2KS1B 1Y47A 2LXCB 1EDKA 2UWJE 2M5AB 3PH0A 4WWIA 2WMMA 1DEEG 2B87A 4IOIH 5CBOA 3ZDMA 2Q1KA 4GOEA 3MZWB 4HB1A 4MN4C 2KZJA 2KUBA 2HR3A 1Q2NA 2ZAEB 2KZIA
chains in the Genus database with same CATH superfamily
3H25A 1KTMA 2WPSA 3AECC 2IDBA 1BCCJ 3V2RA 1KYOE 3HTKB 4UB8H 1PPJD 1S2EA 1ZOYC 2O3JA 3VYIA 2K88A 1FDIA 1PGQA 1RQUA 4JYCA 3D6YA 2IBZI 3VMYA 5APUA 2QEXP 3A0BE 1KB9D 3B4SA 3MHVA 1SQBD 3PRJA 3CPWO 2W6JH 1SQQE 1N73C 1AA0A 1SQPE 1LWUC 5TJHA 1G1JA 1GK4A 1S4XA 2YMKA 2JR8A 3CWBE 2R3SA 3HD7C 2VRSA 3IFMA 3M9HA 4DZOA 1JTHB 3L37A 3L72J 1QX8A 3LIDA 1P84E 2KI7B 4TT3H 5APQA 3P7KA 2QM8A 2YXRB 2E42A 2OGUA 3QH9A 1OX3A 4H44C 2KSJA 3KZIH 4PJ0H 5APYA 1FJPA 1VF5D 3H1LG 1URQC 3FWLA 4RESB 1KQSO 5CCHC 1VQ7P 2IBZG 1FZAA 5AVZB 1HH0A 4ASVA 3CXHI 1NTKE 4I2LC 3HE5A 3H1HD 2R5BA 5APTA 4C46A 5KKZC 3L74D 1SQQD 1GW4A 1OIPA 1OW7A 3BRVB 4LLHA 4TLFA 1U7JA 3TNUA 4AQRD 3L70E 5K5GB 2FFDB 1HJBA 2KIKA 4PD4E 5AVSB 4C7NA 1QGKB 1E79H 2KK7A 1A02J 2POHA 4WBAA 1Y9BA 1KYOH 2A06G 2C0WA 3B71A 1QL2A 5CCHA 4GDOA 3G71P 1L0NJ 2K37A 4PD4H 3HUSA 5APXA 4D6TJ 4N6JA 4NPDA 4L73A 3FXDA 4L74A 5AVRB 2QJKB 2YKOA 3L4FA 5H2FH 2MJZA 1GL2C 1L0LJ 2ZT9B 5L8RJ 1H89A 1FDMA 1RE4C 1NU1K 5AW7B 1LTJB 1S9KD 1BGYG 1H0TA 2KLVA 3GF7A 2WPQA 1IFDA 2WSSH 1M1JC 2BEZF 2GUSA 4H0LB 5CBNA 2H89C 3H1JJ 1S5LX 1IFJA 2WZ7A 3B8EB 3L75G 1KILB 1P84I 3TNUB 1MFTA 1VPCA 1GMJA 2R44A 1LT9C 2V7QH 2WWWA 2E74D 3HRNA 3M0AA 1VL2A 1S5LH 1G1IA 1NHLA 5CCHD 2GUVA 2HPCA 1IFIA 5TISE 1YIJP 1JO5A 4W7YA 1FU1A 4IL6E 1FZGA 4PV1D 1RHZB 1JMBA 1LNQA 2E75D 3WUVA 4WY4D 3CX5I 5BU8B 2C9LY 1N7SA 3M0DA 2K9YA 2HLOA 3C8VA 1JY3O 2N1TA 2N9YB 2M0BA 1GU5A 2BCCD 2QE7H 2KXPB 1VQ4P 3IR9A 2KNCB 1H0TB 1SQQJ 3AE4C 5AW0B 3V2QA 1SQVK 3CWBJ 2WTYA 3U59A 1QL1A 1VQ6P 5KAIH 4H0LD 1FOSF 1JY2N 4U3FJ 1GTWA 1KQLA 2O01J 2O1JA 3RBXA 3UIAA 3L72G 1GZLA 5DJUB 5H2FE 2IBZE 2WSEH 1PGPA 2QJPC 3HUSC 3BATA 1X9VA 3VMZA 1W2BO 1L4AA 1SQBK 1N73A 1SQBJ 1Y47A 2D2CB 3H1LJ 4N3YB 2UWJE 3SFDC 1EXIA 5BVZA 2XU6A 1SQVD 2IX7C 1IFNA 2FYUE 1AV1A 3MIWA 1N7LA 1IFMA 1RF1B 5AVWB 1L0LD 3H6PA 3O8ZA 2QJPB 2YKPA 3CWBD 4DT0A 3HD7B 2JWAA 3L70G 1SQPD 4RJTA 1AVYA 4IOIH 4YXWH 3JSVC 2R5DA 3L71J 1LT9A 1L4AC 3RL0g 1JUNA 1EZVD 2Q1KA 1IFPA 1OXZA 3CLQA 3HE4A 2IZ0A 1SQXK 1HWTC 3GG2A 1NOHA 3G9RA 4D6TG 2W83C 2QJKC 1KYOD 4EI2A 4AYCA 2ZT9D 1N73B 2KZJA 2BCCE 2MKVA 1J1DB 3MD0A 2ZJSE 2HR3A 3RBZA 2FKWB 2OYHB 1L0LG 1JMMA 1OW8A 1JCDA 1AQTA 2KZIA 3BCCG 3HD7A 2ZYAA 1SQPG 3KXDA 5AVUB 1NTKK 1G2CA 3AE3C 1YQ3C 2AXTH 2YIUC 2Z5HA 3RL0B 4H44B 5APWA 2QSIA 3H1JE 3HE5B 1HGZA 2E74B 2FYZA 1IK9A 2W6BA 5BU5A 1ZP0C 3AEGC 4XA4A 4RO0A 2OYIA 2HG5D 1S1CX 3AEAC 4EYYQ 2A45G 2WSFH 2A06D 2AEJA 2IYOA 2XZRA 3OAKA 3P32A 3SWFA 1UIXA 2YNYA 1PIXA 1QVGO 4K35A 4JYBA 2ZFCA 1EDIA 1NO4A 1SVFA 3VN0A 1Q82Q 3AE8C 3M9BA 3WMM0 3F5HA 4UB6E 1JCCA 2YO3A 1G2CB 2NZ2A 5CMZA 2QJYC 4H44D 1JOCA 3GF3A 4U3FG 3N4XA 2JO1A 1M57D 1URQD 1NVOA 1HVVA 2SPZA 3A0HE 4PD4D 2Z4EA 1NAYA 2J59M 2O01H 3L75D 1BCCE 2D2CD 1E5WA 3AE2C 3CCEP 2BCCJ 2C0XA 2WSEJ 1JM0A 2V7QJ 4I7ZB 2XNXA 1PP9E 3H1HE 1AJYA 1GL2D 3B5NC 5AW6B 1GW3A 2Q3IA 1BE3J 4ZMDA 1CI6B 2ZYDA 5KAFH 1MUUA 1YYCA 3NXSA 1PV3A 3L71E 1KC8Q 2PFXA 1T8ZA 3L72E 2Q6QA 2QRXA 3AE5C 3Q1MA 1EDJA 3RK3B 2V4HA 1SS1A 3L71G 2PAJA 4R4LA 1HF9A 1KB9I 3CXHE 1L0LK 3A2AA 4IL6X 3S4RA 4D6TD 2Y0CA 1N86A 1JTHA 1IZNB 1M56D 2XDJA 2N1TC 2OTKE 1J1DC 3OJAB 4EIJA 1N2DC 1SQBE 2M5AA 3BCCE 3MUDC 4IL6H 1KMIZ 4PJ0E 2E5TA 1T3UA 1LTAC 4I6MC 1QVFO 4WY4C 3CMEP 5KJ7C 1EZVG 1U7MA 3NFQA 3NMDA 4IFMA 5GTHE 2W6AA 1U57A 3MP7B 1IJDB 3BCCJ 3V5BA 1ZW0A 4H13B 1FOSE 3D6ZA 3CCRP 2E76D 3U1AA 1T2KC 3H1KE 1ZLLA 1CI6A 1ZXGA 5GTHH 5M1BA 1SFCB 1NTZD 2NPSB 3CWBG 1FBMA 4H0LC 3L70D 1LTIC 1H88A 1LJ2A 1OVVA 2B87B 5CJ4A 4K3AA 3RK3D 3VMXA 1FZCA 2K3RA 3H1IG 4GODA 1LT9B 2KYVA 1NTMJ 1NTKD 1LTBC 3B5ND 1SQXJ 1UIIA 4IFFA 1M90Q 3GW6A 1SQBG 1L0NE 1S72P 2LR2A 3CCJP 2B88A 3RK2D 1ZRTE 1VQNP 2KS1B 1QLED 2M3EA 1PZQA 3TGUE 3CC2P 1VQPP 1LTJC 3AEDC 3L73G 1S9KE 3L70J 2H7HA 2FXOA 1NTZG 2XNDH 4H13D 3TYYA 2P1JA 2Q3EA 1X79B 2E76B 5TISH 1RH5B 4M3LA 1Q86Q 1L2PA 1NTZE 3FWNA 2N1TD 3PH0A 2OYHC 3V4QA 1PGJA 2NPSD 4C7RA 2YKQA 4OH8B 1BCCD 2B87A 5CBOA 4GT1A 1ZR4A 1PP9G 2G3AA 1VQKP 1NTKG 5KLIB 1JY2P 1VQLP 3B5NB 4HYTB 3ZDMA 5B66H 1T2KD 4GOEA 1BE3E 1JNMA 1GDTA 3MZWB 4OGQB 3E7KA 4O9BA 1YTZI 4KHXA 1VDFA 4HB1A 3SFEC 1BE3G 2ZXEB 1RE3C 1SQPJ 2KLUA 3W67A 1SP4A 5KLVJ 5AVTB 2LKMA 1IO4A 1IK7A 1BGYD 4OGQC 3OA7A 2P67A 1YTZT 4BXLA 1M1KQ 1FC2C 1KFMA 2FXPA 2OTJP 1ZRTD 5CCGD 3KQGA 1P84H 3M06A 3RL0D 1L0ND 1KORA 3IN6A 3JCUH 3HUSB 1NWQA 1YBKA 3U1CA 2QVAA 3TSIA 5EFWB 3QWOC 1URQA 4JBZA 1USEA 2KB7P 3USSA 1YJ9P 4W80A 1LTJA 2WPRA 4EOTA 1YJWP 1NKNA 2WPVB 1NU1G 3O6QB 1LT1A 2R3CA 3PTZA 1FS0E 3WU2H 1DH3A 1NTME 3CX5D 4ZNCA 3CCUP 4YTPC 3V2NA 1AFOA 2Y9ZA 4NPFX 5B5EH 1OVUA 2HFED 3GHGA 4RKUJ 3BVHA 3I5CA 1M8OB 2AEFA 4Y28J 1OWAA 4HJGH 2JEEA 2KP8A 1GU4A 1NTMG 2D2CC 3V2PA 1LTSC 1SQXG 4Y99B 2BCCG 5AVYB 2JWDA 2QG4A 3KYQA 4B86A 4L75A 1NTZK 2PRRA 2WITA 1XTGB 1XTCC 2IFNA 2O01N 1URQB 3TGUJ 1A02F 3V4WA 2QM7A 1OVRA 1SFCC 3R4YA 5CHXA 1AVOA 1KN7A 3PJSK 3TF5A 2ZXXA 3L73J 1SLQA 3L72D 2CPSA 1N7SB 4PV1B 1YJNP 2PP6A 1FE6A 1SQXE 2CK3H 2L5GB 2N1TB 3M9QA 5APSA 3EQ2A 2ITAA 3JCUE 1L0NK 3H1JD 4JF7A 3VOPA 4N78E 3G6EP 1ZN5A 4YXDC 5KJ7A 2A45I 4EDFA 3TDKA 1GD2E 3CXHH 2FYUG 3WUTA 1PPJG 2R32A 1YI2P 2K9JB 1PP9J 2I8DA 1SFCA 3AEFC 3H1KJ 3WUUA 4Z1MH 2KS1A 2HODA 2WT7A 3BASA 3L73E 5AVVB 1NJIQ 1FZEA 3E1RA 3OW2O 1BE3D 1EXJA 3S9OA 1FDOA 3A7OA 4BRYB 2WQYC 3BRTB 1VF5C 1R5SA 3I55P 2ZVOB 4GOFA 1H8AA 4PD4I 1Z56A 3P8MC 1N7SD 1OZHA 3P8CE 3C9IA 4U3FE 3RK3C 3HE4B 4N78D 2YMYA 2P10A 2IYPA 3H1IJ 2WVRA 5AW9B 1L0LE 1T6AA 4AUWA 2W27A 3A0HH 1LTGC 1LP1A 1RF0A 3AE6C 2N9BA 4DOJA 1K9MQ 2FYNC 1J1EC 5C39A 1T3JA 4W7ZA 1PGOA 5AW5B 2E76C 2JJLA 4ZKPA 4A7PA 1GK6A 1MKMA 2LXBA 3TGUD 3LIEA 3Q3DA 2HODB 1HTLC 1IC2A 3L74G 4WY4A 3H1HJ 2OYHA 1SQVJ 2IBZD 3L35A 1NU1J 3T97B 2OARA 1KILE 1BDDA 2Y9YA 1J1EB 4H13C 1NTZJ 1X22A 4KJMA 2WSFJ 3VMAA 1X0TA 3G4SP 2RH0A 4GIFA 2ZYGA 2FXMA 2OYIC 3A0BH 5B66E 1RF0C 2NPSC 2GM4A 2OTLP 2LXCB 1ZV8A 3F89A 1EDKA 1NU1D 3RK2C 1JY3P 1K73Q 2OYOA 3H1KD 4I7ZC 1ZR2A 2K1AA 1NTKJ 1NTMD 1TU3F 2E75B 3CX5E 1PL5A 4WWIA 1NU1E 1M1JA 3M91A 2E5YA 1W5CE 3ITKA 4WY4B 1EZVE 4ZKUA 2HYNA 3FGAD 3O6QA 1ZMEC 2FBWC 3SSUA 3TGUG 3FX0A 4L76A 5AW1B 3MUDA 2ZVNB 1FAVA 1LGHB 5KLVG 2E75C 3Q5SA 4D6TE 1AQ5A 1HGVA 3VP9A 3CL3D 3H1IE 2IFMA 2XKMA 4KT0J 5GTIE 1RY3A 1MV8A 3AE7C 4MN4C 3MGNA 2YO2A 3KZIE 1FZCB 2KUBA 3CD6P 3GHGB 3L71D 2FYUJ 1Q2NA 2KNCA 2ZAEB 4C7NB 1M1JB 3H1KG 3WU2E 3H1LE 2QIWA 3EFFK 2RMZA 2Y0DA 5KLIC 4JPZB 5APVA 2B9BA 3C1LA 1PP9D 4QMAA 3Q2YA 4OVNF 4DCKA 1KV4A 3GHGC 5CCGA 4OWFA 1RQVA 3HD7D 3CMAP 2Y0EA 2P7JA 4UB8E 5E79E 1BCCG 3IAOA 3L75E 5AW2B 3CI9A 2H43A 4Y99C 3MTUE 5AVQB 1HUCA 3RL0C 1GL2B 1QEXA 4LC1A 2W8ZA 3ABVC 1OMIA 3L73D 3CC4P 4DJGA 3EWKA 1SQQK 1Y8AA 1JB0J 2J5UA 2AXTE 1DX7A 3A5TA 3H1LD 1CZQA 3CC7P 4XE5B 2P58A 3CCSP 3CCQP 1CW5A 3AE9C 2K9JA 2CPBA 1JY3N 3B5NA 2YXQB 4HH2A 3TK1A 4BWNA 2A06E 1KZUB 2C9NY 3H1HG 3EFGA 3HTKA 1DD4A 1P84D 3AEEC 1M7LA 3H1ID 1NAFA 1OW6A 1SQXD 2WT7B 1K05A 1LWUB 1GL2A 2DW3A 2A45H 1K8AQ 3PP5A 3RGUA 2IPPA 4GKGA 2RN0A 3IF4A 2M3BA 3R2PA 5CJ0A 4BRYA 1RF1C 2Q5UA 1JY2O 3E1IA 1KFNA 2G8YA 2KSEA 3AEBC 3K5BA 4CPGA 1BDCA 3KDPB 1SFCD 1KQGB 2O1KA 3L36A 3FXEA 2IZ1A 3P8CD 4JQ0D 1USDA 1YITP 1Q7YQ 1N8RQ 2H8PD 1EDLA 1Q90D 2FY8A 1LP1B 2BASA 4ASWA 5B5EE 3CCMP 2Q9IA 2BEQD 2KOGA 1L4AB 3CCLP 5DJTB 4WB4A 1W2EA 1VQOP 2OYIB 1HBWA 2FFDC 3BCCD 1RF1A 3L74E 3AE1C 2FYUK 1WRGA 2I1JA 3II6A 1N7SC 3M0DC 3PHLA 5AW3B 3RK2B 2WSCH 1KILD 3G3ZA 3T97A 1LTTC 3CXHD 1FZCC 1EZVI 1MFZA 3N7NA 3PLNA 5AVXB 1KD1Q 3H32B 1CSBA 1JEKA 2QA4P 3JC22 1DEBA 5KLVD 1EC5A 1RE3A 4WVZA 1NKZB 2FYUD 2FFDA 1SQVE 2E74C 1S3JA 2OQQA 3L74J 4NPEA 1KB9H 5KLVE 1VQ9P 3W68A 1KQFB 1SQVG 2PGDA 4U3FD 2B89A 5KAFE 1FZBA 3Q5RA 4U7JA 4PV1C 3D71A 3SWKA 3LW5H 4XFJA 5KLVK 1KB9E 1X8YA 2JP3A 4LGDE 4R4MA 4YPCA 1VF5B 1MZ9A 1S5LE 1KILA 2NRGA 3CX5H 4OGQD 5AW4B 1KYOI 2RKLA 3S1KA 2J58A 5CCGC 1WMKA 4HKZH 1PPJE 1NH4A 3VTPC 1DIPA 3GLMA 1YHQP 2HPCB 2W90A 1J2JB 1SQQG 3VP8A 1DD3A 2H88C 3NTNA 5KKZB 1R8EA 3H32A 2GA1A 3V6IA 2P2UA 3A3YB 3CCVP 1Q81Q 1PFIA 2FYNB 2Q7CA 1K04A 2M5AB 3D70A 1RE4A 4I1LA 2E43A 2JDIH 1L0NG 3KPEA 1KILC 2XV5A 1HJ0A 1R5LA 2M8RA 5KAIE 2AXCA 2WMMA 1BSHA 3LW5J 1DEEG 1WT6A 3I56P 1VQMP 5KJ7D 2AEMA 5AW8B 1BSNA 2YIUB 2JKVA 1BGYJ 2Z5IA 1YQ4C 2ZT9C 4UB6H 5GTIH 1D7MA 2NPSA 1NYHA 3GMAA 3SWYA 1FZFA 3Q5PA 2WSCJ 1VQ8P 1NGMB 3KHUA 4IFDK 3H1JG 1NTMK 2I1KA 1BGYE 3L75J 2QJYB 1OFCX 5E79H 1SQPK 1VQ5P 5KTBA 1L4AD 3RK3E 1EQ7A 1FJKA 1LWUA 2L91A
chains in the Genus database with same CATH topology
4BXLA 1FC2C 2QVAA 5EFWB 3QWOC 4JBZA 3MHVA 1LT1A 4EYYQ 4ZNCA 2KI7B 4NPFX 1OVUA 4K35A 1EDIA 2P58A 4HJGH 4ASVA 2JWDA 1NVOA 2SPZA 1U7JA 3RGUA 1OVRA 5K5GB 1JM0A 2KIKA 4CPGA 1BDCA 4ZMDA 3FXEA 4NPDA 1EDLA 3FXDA 1LP1B 4ASWA 2QRXA 1EDJA 2I8DA 1SS1A 5DJTB 1H0TA 5CBNA 2OTKE 1MFTA 2M5AA 2R44A 4GOFA 1U7MA 1EC5A 1ZW0A 1JMBA 1S3JA 1ZXGA 4NPEA 1LP1A 2B89A 1OVVA 2B87B 2M0BA 4K3AA 5C39A 2K3RA 4GODA 2LXBA 1H0TB 2RKLA 3S1KA 1BDDA 2LR2A 4HKZH 2B88A 4KJMA 5DJUB 1X0TA 2KS1B 1Y47A 2LXCB 1EDKA 2UWJE 2M5AB 3PH0A 4WWIA 2WMMA 1DEEG 2B87A 4IOIH 5CBOA 3ZDMA 2Q1KA 4GOEA 3MZWB 4HB1A 4MN4C 2KZJA 2KUBA 2HR3A 1Q2NA 2ZAEB 2KZIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXL A;  1FC2 C;  2QVA A;  5EFW B;  3QWO C;  4JBZ A;  3MHV A;  1LT1 A;  4EYY Q;  4ZNC A;  2KI7 B;  4NPF X;  1OVU A;  4K35 A;  1EDI A;  2P58 A;  4HJG H;  4ASV A;  2JWD A;  1NVO A;  2SPZ A;  1U7J A;  3RGU A;  1OVR A;  5K5G B;  1JM0 A;  2KIK A;  4CPG A;  1BDC A;  4ZMD A;  3FXE A;  4NPD A;  1EDL A;  3FXD A;  1LP1 B;  4ASW A;  2QRX A;  1EDJ A;  2I8D A;  1SS1 A;  5DJT B;  1H0T A;  5CBN A;  2OTK E;  1MFT A;  2M5A A;  2R44 A;  4GOF A;  1U7M A;  1EC5 A;  1ZW0 A;  1JMB A;  1S3J A;  1ZXG A;  4NPE A;  1LP1 A;  2B89 A;  1OVV A;  2B87 B;  2M0B A;  4K3A A;  5C39 A;  2K3R A;  4GOD A;  2LXB A;  1H0T B;  2RKL A;  3S1K A;  1BDD A;  2LR2 A;  4HKZ H;  2B88 A;  4KJM A;  5DJU B;  1X0T A;  2KS1 B;  1Y47 A;  2LXC B;  1EDK A;  2UWJ E;  2M5A B;  3PH0 A;  4WWI A;  2WMM A;  1DEE G;  2B87 A;  4IOI H;  5CBO A;  3ZDM A;  2Q1K A;  4GOE A;  3MZW B;  4HB1 A;  4MN4 C;  2KZJ A;  2KUB A;  2HR3 A;  1Q2N A;  2ZAE B;  2KZI A; 
#chains in the Genus database with same CATH topology
 3H25 A;  1KTM A;  2WPS A;  3AEC C;  2IDB A;  1BCC J;  3V2R A;  1KYO E;  3HTK B;  4UB8 H;  1PPJ D;  1S2E A;  1ZOY C;  2O3J A;  3VYI A;  2K88 A;  1FDI A;  1PGQ A;  1RQU A;  4JYC A;  3D6Y A;  2IBZ I;  3VMY A;  5APU A;  2QEX P;  3A0B E;  1KB9 D;  3B4S A;  3MHV A;  1SQB D;  3PRJ A;  3CPW O;  2W6J H;  1SQQ E;  1N73 C;  1AA0 A;  1SQP E;  1LWU C;  5TJH A;  1G1J A;  1GK4 A;  1S4X A;  2YMK A;  2JR8 A;  3CWB E;  2R3S A;  3HD7 C;  2VRS A;  3IFM A;  3M9H A;  4DZO A;  1JTH B;  3L37 A;  3L72 J;  1QX8 A;  3LID A;  1P84 E;  2KI7 B;  4TT3 H;  5APQ A;  3P7K A;  2QM8 A;  2YXR B;  2E42 A;  2OGU A;  3QH9 A;  1OX3 A;  4H44 C;  2KSJ A;  3KZI H;  4PJ0 H;  5APY A;  1FJP A;  1VF5 D;  3H1L G;  1URQ C;  3FWL A;  4RES B;  1KQS O;  5CCH C;  1VQ7 P;  2IBZ G;  1FZA A;  5AVZ B;  1HH0 A;  4ASV A;  3CXH I;  1NTK E;  4I2L C;  3HE5 A;  3H1H D;  2R5B A;  5APT A;  4C46 A;  5KKZ C;  3L74 D;  1SQQ D;  1GW4 A;  1OIP A;  1OW7 A;  3BRV B;  4LLH A;  4TLF A;  1U7J A;  3TNU A;  4AQR D;  3L70 E;  5K5G B;  2FFD B;  1HJB A;  2KIK A;  4PD4 E;  5AVS B;  4C7N A;  1QGK B;  1E79 H;  2KK7 A;  1A02 J;  2POH A;  4WBA A;  1Y9B A;  1KYO H;  2A06 G;  2C0W A;  3B71 A;  1QL2 A;  5CCH A;  4GDO A;  3G71 P;  1L0N J;  2K37 A;  4PD4 H;  3HUS A;  5APX A;  4D6T J;  4N6J A;  4NPD A;  4L73 A;  3FXD A;  4L74 A;  5AVR B;  2QJK B;  2YKO A;  3L4F A;  5H2F H;  2MJZ A;  1GL2 C;  1L0L J;  2ZT9 B;  5L8R J;  1H89 A;  1FDM A;  1RE4 C;  1NU1 K;  5AW7 B;  1LTJ B;  1S9K D;  1BGY G;  1H0T A;  2KLV A;  3GF7 A;  2WPQ A;  1IFD A;  2WSS H;  1M1J C;  2BEZ F;  2GUS A;  4H0L B;  5CBN A;  2H89 C;  3H1J J;  1S5L X;  1IFJ A;  2WZ7 A;  3B8E B;  3L75 G;  1KIL B;  1P84 I;  3TNU B;  1MFT A;  1VPC A;  1GMJ A;  2R44 A;  1LT9 C;  2V7Q H;  2WWW A;  2E74 D;  3HRN A;  3M0A A;  1VL2 A;  1S5L H;  1G1I A;  1NHL A;  5CCH D;  2GUV A;  2HPC A;  1IFI A;  5TIS E;  1YIJ P;  1JO5 A;  4W7Y A;  1FU1 A;  4IL6 E;  1FZG A;  4PV1 D;  1RHZ B;  1JMB A;  1LNQ A;  2E75 D;  3WUV A;  4WY4 D;  3CX5 I;  5BU8 B;  2C9L Y;  1N7S A;  3M0D A;  2K9Y A;  2HLO A;  3C8V A;  1JY3 O;  2N1T A;  2N9Y B;  2M0B A;  1GU5 A;  2BCC D;  2QE7 H;  2KXP B;  1VQ4 P;  3IR9 A;  2KNC B;  1H0T B;  1SQQ J;  3AE4 C;  5AW0 B;  3V2Q A;  1SQV K;  3CWB J;  2WTY A;  3U59 A;  1QL1 A;  1VQ6 P;  5KAI H;  4H0L D;  1FOS F;  1JY2 N;  4U3F J;  1GTW A;  1KQL A;  2O01 J;  2O1J A;  3RBX A;  3UIA A;  3L72 G;  1GZL A;  5DJU B;  5H2F E;  2IBZ E;  2WSE H;  1PGP A;  2QJP C;  3HUS C;  3BAT A;  1X9V A;  3VMZ A;  1W2B O;  1L4A A;  1SQB K;  1N73 A;  1SQB J;  1Y47 A;  2D2C B;  3H1L J;  4N3Y B;  2UWJ E;  3SFD C;  1EXI A;  5BVZ A;  2XU6 A;  1SQV D;  2IX7 C;  1IFN A;  2FYU E;  1AV1 A;  3MIW A;  1N7L A;  1IFM A;  1RF1 B;  5AVW B;  1L0L D;  3H6P A;  3O8Z A;  2QJP B;  2YKP A;  3CWB D;  4DT0 A;  3HD7 B;  2JWA A;  3L70 G;  1SQP D;  4RJT A;  1AVY A;  4IOI H;  4YXW H;  3JSV C;  2R5D A;  3L71 J;  1LT9 A;  1L4A C;  3RL0 g;  1JUN A;  1EZV D;  2Q1K A;  1IFP A;  1OXZ A;  3CLQ A;  3HE4 A;  2IZ0 A;  1SQX K;  1HWT C;  3GG2 A;  1NOH A;  3G9R A;  4D6T G;  2W83 C;  2QJK C;  1KYO D;  4EI2 A;  4AYC A;  2ZT9 D;  1N73 B;  2KZJ A;  2BCC E;  2MKV A;  1J1D B;  3MD0 A;  2ZJS E;  2HR3 A;  3RBZ A;  2FKW B;  2OYH B;  1L0L G;  1JMM A;  1OW8 A;  1JCD A;  1AQT A;  2KZI A;  3BCC G;  3HD7 A;  2ZYA A;  1SQP G;  3KXD A;  5AVU B;  1NTK K;  1G2C A;  3AE3 C;  1YQ3 C;  2AXT H;  2YIU C;  2Z5H A;  3RL0 B;  4H44 B;  5APW A;  2QSI A;  3H1J E;  3HE5 B;  1HGZ A;  2E74 B;  2FYZ A;  1IK9 A;  2W6B A;  5BU5 A;  1ZP0 C;  3AEG C;  4XA4 A;  4RO0 A;  2OYI A;  2HG5 D;  1S1C X;  3AEA C;  4EYY Q;  2A45 G;  2WSF H;  2A06 D;  2AEJ A;  2IYO A;  2XZR A;  3OAK A;  3P32 A;  3SWF A;  1UIX A;  2YNY A;  1PIX A;  1QVG O;  4K35 A;  4JYB A;  2ZFC A;  1EDI A;  1NO4 A;  1SVF A;  3VN0 A;  1Q82 Q;  3AE8 C;  3M9B A;  3WMM 0;  3F5H A;  4UB6 E;  1JCC A;  2YO3 A;  1G2C B;  2NZ2 A;  5CMZ A;  2QJY C;  4H44 D;  1JOC A;  3GF3 A;  4U3F G;  3N4X A;  2JO1 A;  1M57 D;  1URQ D;  1NVO A;  1HVV A;  2SPZ A;  3A0H E;  4PD4 D;  2Z4E A;  1NAY A;  2J59 M;  2O01 H;  3L75 D;  1BCC E;  2D2C D;  1E5W A;  3AE2 C;  3CCE P;  2BCC J;  2C0X A;  2WSE J;  1JM0 A;  2V7Q J;  4I7Z B;  2XNX A;  1PP9 E;  3H1H E;  1AJY A;  1GL2 D;  3B5N C;  5AW6 B;  1GW3 A;  2Q3I A;  1BE3 J;  4ZMD A;  1CI6 B;  2ZYD A;  5KAF H;  1MUU A;  1YYC A;  3NXS A;  1PV3 A;  3L71 E;  1KC8 Q;  2PFX A;  1T8Z A;  3L72 E;  2Q6Q A;  2QRX A;  3AE5 C;  3Q1M A;  1EDJ A;  3RK3 B;  2V4H A;  1SS1 A;  3L71 G;  2PAJ A;  4R4L A;  1HF9 A;  1KB9 I;  3CXH E;  1L0L K;  3A2A A;  4IL6 X;  3S4R A;  4D6T D;  2Y0C A;  1N86 A;  1JTH A;  1IZN B;  1M56 D;  2XDJ A;  2N1T C;  2OTK E;  1J1D C;  3OJA B;  4EIJ A;  1N2D C;  1SQB E;  2M5A A;  3BCC E;  3MUD C;  4IL6 H;  1KMI Z;  4PJ0 E;  2E5T A;  1T3U A;  1LTA C;  4I6M C;  1QVF O;  4WY4 C;  3CME P;  5KJ7 C;  1EZV G;  1U7M A;  3NFQ A;  3NMD A;  4IFM A;  5GTH E;  2W6A A;  1U57 A;  3MP7 B;  1IJD B;  3BCC J;  3V5B A;  1ZW0 A;  4H13 B;  1FOS E;  3D6Z A;  3CCR P;  2E76 D;  3U1A A;  1T2K C;  3H1K E;  1ZLL A;  1CI6 A;  1ZXG A;  5GTH H;  5M1B A;  1SFC B;  1NTZ D;  2NPS B;  3CWB G;  1FBM A;  4H0L C;  3L70 D;  1LTI C;  1H88 A;  1LJ2 A;  1OVV A;  2B87 B;  5CJ4 A;  4K3A A;  3RK3 D;  3VMX A;  1FZC A;  2K3R A;  3H1I G;  4GOD A;  1LT9 B;  2KYV A;  1NTM J;  1NTK D;  1LTB C;  3B5N D;  1SQX J;  1UII A;  4IFF A;  1M90 Q;  3GW6 A;  1SQB G;  1L0N E;  1S72 P;  2LR2 A;  3CCJ P;  2B88 A;  3RK2 D;  1ZRT E;  1VQN P;  2KS1 B;  1QLE D;  2M3E A;  1PZQ A;  3TGU E;  3CC2 P;  1VQP P;  1LTJ C;  3AED C;  3L73 G;  1S9K E;  3L70 J;  2H7H A;  2FXO A;  1NTZ G;  2XND H;  4H13 D;  3TYY A;  2P1J A;  2Q3E A;  1X79 B;  2E76 B;  5TIS H;  1RH5 B;  4M3L A;  1Q86 Q;  1L2P A;  1NTZ E;  3FWN A;  2N1T D;  3PH0 A;  2OYH C;  3V4Q A;  1PGJ A;  2NPS D;  4C7R A;  2YKQ A;  4OH8 B;  1BCC D;  2B87 A;  5CBO A;  4GT1 A;  1ZR4 A;  1PP9 G;  2G3A A;  1VQK P;  1NTK G;  5KLI B;  1JY2 P;  1VQL P;  3B5N B;  4HYT B;  3ZDM A;  5B66 H;  1T2K D;  4GOE A;  1BE3 E;  1JNM A;  1GDT A;  3MZW B;  4OGQ B;  3E7K A;  4O9B A;  1YTZ I;  4KHX A;  1VDF A;  4HB1 A;  3SFE C;  1BE3 G;  2ZXE B;  1RE3 C;  1SQP J;  2KLU A;  3W67 A;  1SP4 A;  5KLV J;  5AVT B;  2LKM A;  1IO4 A;  1IK7 A;  1BGY D;  4OGQ C;  3OA7 A;  2P67 A;  1YTZ T;  4BXL A;  1M1K Q;  1FC2 C;  1KFM A;  2FXP A;  2OTJ P;  1ZRT D;  5CCG D;  3KQG A;  1P84 H;  3M06 A;  3RL0 D;  1L0N D;  1KOR A;  3IN6 A;  3JCU H;  3HUS B;  1NWQ A;  1YBK A;  3U1C A;  2QVA A;  3TSI A;  5EFW B;  3QWO C;  1URQ A;  4JBZ A;  1USE A;  2KB7 P;  3USS A;  1YJ9 P;  4W80 A;  1LTJ A;  2WPR A;  4EOT A;  1YJW P;  1NKN A;  2WPV B;  1NU1 G;  3O6Q B;  1LT1 A;  2R3C A;  3PTZ A;  1FS0 E;  3WU2 H;  1DH3 A;  1NTM E;  3CX5 D;  4ZNC A;  3CCU P;  4YTP C;  3V2N A;  1AFO A;  2Y9Z A;  4NPF X;  5B5E H;  1OVU A;  2HFE D;  3GHG A;  4RKU J;  3BVH A;  3I5C A;  1M8O B;  2AEF A;  4Y28 J;  1OWA A;  4HJG H;  2JEE A;  2KP8 A;  1GU4 A;  1NTM G;  2D2C C;  3V2P A;  1LTS C;  1SQX G;  4Y99 B;  2BCC G;  5AVY B;  2JWD A;  2QG4 A;  3KYQ A;  4B86 A;  4L75 A;  1NTZ K;  2PRR A;  2WIT A;  1XTG B;  1XTC C;  2IFN A;  2O01 N;  1URQ B;  3TGU J;  1A02 F;  3V4W A;  2QM7 A;  1OVR A;  1SFC C;  3R4Y A;  5CHX A;  1AVO A;  1KN7 A;  3PJS K;  3TF5 A;  2ZXX A;  3L73 J;  1SLQ A;  3L72 D;  2CPS A;  1N7S B;  4PV1 B;  1YJN P;  2PP6 A;  1FE6 A;  1SQX E;  2CK3 H;  2L5G B;  2N1T B;  3M9Q A;  5APS A;  3EQ2 A;  2ITA A;  3JCU E;  1L0N K;  3H1J D;  4JF7 A;  3VOP A;  4N78 E;  3G6E P;  1ZN5 A;  4YXD C;  5KJ7 A;  2A45 I;  4EDF A;  3TDK A;  1GD2 E;  3CXH H;  2FYU G;  3WUT A;  1PPJ G;  2R32 A;  1YI2 P;  2K9J B;  1PP9 J;  2I8D A;  1SFC A;  3AEF C;  3H1K J;  3WUU A;  4Z1M H;  2KS1 A;  2HOD A;  2WT7 A;  3BAS A;  3L73 E;  5AVV B;  1NJI Q;  1FZE A;  3E1R A;  3OW2 O;  1BE3 D;  1EXJ A;  3S9O A;  1FDO A;  3A7O A;  4BRY B;  2WQY C;  3BRT B;  1VF5 C;  1R5S A;  3I55 P;  2ZVO B;  4GOF A;  1H8A A;  4PD4 I;  1Z56 A;  3P8M C;  1N7S D;  1OZH A;  3P8C E;  3C9I A;  4U3F E;  3RK3 C;  3HE4 B;  4N78 D;  2YMY A;  2P10 A;  2IYP A;  3H1I J;  2WVR A;  5AW9 B;  1L0L E;  1T6A A;  4AUW A;  2W27 A;  3A0H H;  1LTG C;  1LP1 A;  1RF0 A;  3AE6 C;  2N9B A;  4DOJ A;  1K9M Q;  2FYN C;  1J1E C;  5C39 A;  1T3J A;  4W7Z A;  1PGO A;  5AW5 B;  2E76 C;  2JJL A;  4ZKP A;  4A7P A;  1GK6 A;  1MKM A;  2LXB A;  3TGU D;  3LIE A;  3Q3D A;  2HOD B;  1HTL C;  1IC2 A;  3L74 G;  4WY4 A;  3H1H J;  2OYH A;  1SQV J;  2IBZ D;  3L35 A;  1NU1 J;  3T97 B;  2OAR A;  1KIL E;  1BDD A;  2Y9Y A;  1J1E B;  4H13 C;  1NTZ J;  1X22 A;  4KJM A;  2WSF J;  3VMA A;  1X0T A;  3G4S P;  2RH0 A;  4GIF A;  2ZYG A;  2FXM A;  2OYI C;  3A0B H;  5B66 E;  1RF0 C;  2NPS C;  2GM4 A;  2OTL P;  2LXC B;  1ZV8 A;  3F89 A;  1EDK A;  1NU1 D;  3RK2 C;  1JY3 P;  1K73 Q;  2OYO A;  3H1K D;  4I7Z C;  1ZR2 A;  2K1A A;  1NTK J;  1NTM D;  1TU3 F;  2E75 B;  3CX5 E;  1PL5 A;  4WWI A;  1NU1 E;  1M1J A;  3M91 A;  2E5Y A;  1W5C E;  3ITK A;  4WY4 B;  1EZV E;  4ZKU A;  2HYN A;  3FGA D;  3O6Q A;  1ZME C;  2FBW C;  3SSU A;  3TGU G;  3FX0 A;  4L76 A;  5AW1 B;  3MUD A;  2ZVN B;  1FAV A;  1LGH B;  5KLV G;  2E75 C;  3Q5S A;  4D6T E;  1AQ5 A;  1HGV A;  3VP9 A;  3CL3 D;  3H1I E;  2IFM A;  2XKM A;  4KT0 J;  5GTI E;  1RY3 A;  1MV8 A;  3AE7 C;  4MN4 C;  3MGN A;  2YO2 A;  3KZI E;  1FZC B;  2KUB A;  3CD6 P;  3GHG B;  3L71 D;  2FYU J;  1Q2N A;  2KNC A;  2ZAE B;  4C7N B;  1M1J B;  3H1K G;  3WU2 E;  3H1L E;  2QIW A;  3EFF K;  2RMZ A;  2Y0D A;  5KLI C;  4JPZ B;  5APV A;  2B9B A;  3C1L A;  1PP9 D;  4QMA A;  3Q2Y A;  4OVN F;  4DCK A;  1KV4 A;  3GHG C;  5CCG A;  4OWF A;  1RQV A;  3HD7 D;  3CMA P;  2Y0E A;  2P7J A;  4UB8 E;  5E79 E;  1BCC G;  3IAO A;  3L75 E;  5AW2 B;  3CI9 A;  2H43 A;  4Y99 C;  3MTU E;  5AVQ B;  1HUC A;  3RL0 C;  1GL2 B;  1QEX A;  4LC1 A;  2W8Z A;  3ABV C;  1OMI A;  3L73 D;  3CC4 P;  4DJG A;  3EWK A;  1SQQ K;  1Y8A A;  1JB0 J;  2J5U A;  2AXT E;  1DX7 A;  3A5T A;  3H1L D;  1CZQ A;  3CC7 P;  4XE5 B;  2P58 A;  3CCS P;  3CCQ P;  1CW5 A;  3AE9 C;  2K9J A;  2CPB A;  1JY3 N;  3B5N A;  2YXQ B;  4HH2 A;  3TK1 A;  4BWN A;  2A06 E;  1KZU B;  2C9N Y;  3H1H G;  3EFG A;  3HTK A;  1DD4 A;  1P84 D;  3AEE C;  1M7L A;  3H1I D;  1NAF A;  1OW6 A;  1SQX D;  2WT7 B;  1K05 A;  1LWU B;  1GL2 A;  2DW3 A;  2A45 H;  1K8A Q;  3PP5 A;  3RGU A;  2IPP A;  4GKG A;  2RN0 A;  3IF4 A;  2M3B A;  3R2P A;  5CJ0 A;  4BRY A;  1RF1 C;  2Q5U A;  1JY2 O;  3E1I A;  1KFN A;  2G8Y A;  2KSE A;  3AEB C;  3K5B A;  4CPG A;  1BDC A;  3KDP B;  1SFC D;  1KQG B;  2O1K A;  3L36 A;  3FXE A;  2IZ1 A;  3P8C D;  4JQ0 D;  1USD A;  1YIT P;  1Q7Y Q;  1N8R Q;  2H8P D;  1EDL A;  1Q90 D;  2FY8 A;  1LP1 B;  2BAS A;  4ASW A;  5B5E E;  3CCM P;  2Q9I A;  2BEQ D;  2KOG A;  1L4A B;  3CCL P;  5DJT B;  4WB4 A;  1W2E A;  1VQO P;  2OYI B;  1HBW A;  2FFD C;  3BCC D;  1RF1 A;  3L74 E;  3AE1 C;  2FYU K;  1WRG A;  2I1J A;  3II6 A;  1N7S C;  3M0D C;  3PHL A;  5AW3 B;  3RK2 B;  2WSC H;  1KIL D;  3G3Z A;  3T97 A;  1LTT C;  3CXH D;  1FZC C;  1EZV I;  1MFZ A;  3N7N A;  3PLN A;  5AVX B;  1KD1 Q;  3H32 B;  1CSB A;  1JEK A;  2QA4 P;  3JC2 2;  1DEB A;  5KLV D;  1EC5 A;  1RE3 A;  4WVZ A;  1NKZ B;  2FYU D;  2FFD A;  1SQV E;  2E74 C;  1S3J A;  2OQQ A;  3L74 J;  4NPE A;  1KB9 H;  5KLV E;  1VQ9 P;  3W68 A;  1KQF B;  1SQV G;  2PGD A;  4U3F D;  2B89 A;  5KAF E;  1FZB A;  3Q5R A;  4U7J A;  4PV1 C;  3D71 A;  3SWK A;  3LW5 H;  4XFJ A;  5KLV K;  1KB9 E;  1X8Y A;  2JP3 A;  4LGD E;  4R4M A;  4YPC A;  1VF5 B;  1MZ9 A;  1S5L E;  1KIL A;  2NRG A;  3CX5 H;  4OGQ D;  5AW4 B;  1KYO I;  2RKL A;  3S1K A;  2J58 A;  5CCG C;  1WMK A;  4HKZ H;  1PPJ E;  1NH4 A;  3VTP C;  1DIP A;  3GLM A;  1YHQ P;  2HPC B;  2W90 A;  1J2J B;  1SQQ G;  3VP8 A;  1DD3 A;  2H88 C;  3NTN A;  5KKZ B;  1R8E A;  3H32 A;  2GA1 A;  3V6I A;  2P2U A;  3A3Y B;  3CCV P;  1Q81 Q;  1PFI A;  2FYN B;  2Q7C A;  1K04 A;  2M5A B;  3D70 A;  1RE4 A;  4I1L A;  2E43 A;  2JDI H;  1L0N G;  3KPE A;  1KIL C;  2XV5 A;  1HJ0 A;  1R5L A;  2M8R A;  5KAI E;  2AXC A;  2WMM A;  1BSH A;  3LW5 J;  1DEE G;  1WT6 A;  3I56 P;  1VQM P;  5KJ7 D;  2AEM A;  5AW8 B;  1BSN A;  2YIU B;  2JKV A;  1BGY J;  2Z5I A;  1YQ4 C;  2ZT9 C;  4UB6 H;  5GTI H;  1D7M A;  2NPS A;  1NYH A;  3GMA A;  3SWY A;  1FZF A;  3Q5P A;  2WSC J;  1VQ8 P;  1NGM B;  3KHU A;  4IFD K;  3H1J G;  1NTM K;  2I1K A;  1BGY E;  3L75 J;  2QJY B;  1OFC X;  5E79 H;  1SQP K;  1VQ5 P;  5KTB A;  1L4A D;  3RK3 E;  1EQ7 A;  1FJK A;  1LWU A;  2L91 A; 
#chains in the Genus database with same CATH homology
 4BXL A;  1FC2 C;  2QVA A;  5EFW B;  3QWO C;  4JBZ A;  3MHV A;  1LT1 A;  4EYY Q;  4ZNC A;  2KI7 B;  4NPF X;  1OVU A;  4K35 A;  1EDI A;  2P58 A;  4HJG H;  4ASV A;  2JWD A;  1NVO A;  2SPZ A;  1U7J A;  3RGU A;  1OVR A;  5K5G B;  1JM0 A;  2KIK A;  4CPG A;  1BDC A;  4ZMD A;  3FXE A;  4NPD A;  1EDL A;  3FXD A;  1LP1 B;  4ASW A;  2QRX A;  1EDJ A;  2I8D A;  1SS1 A;  5DJT B;  1H0T A;  5CBN A;  2OTK E;  1MFT A;  2M5A A;  2R44 A;  4GOF A;  1U7M A;  1EC5 A;  1ZW0 A;  1JMB A;  1S3J A;  1ZXG A;  4NPE A;  1LP1 A;  2B89 A;  1OVV A;  2B87 B;  2M0B A;  4K3A A;  5C39 A;  2K3R A;  4GOD A;  2LXB A;  1H0T B;  2RKL A;  3S1K A;  1BDD A;  2LR2 A;  4HKZ H;  2B88 A;  4KJM A;  5DJU B;  1X0T A;  2KS1 B;  1Y47 A;  2LXC B;  1EDK A;  2UWJ E;  2M5A B;  3PH0 A;  4WWI A;  2WMM A;  1DEE G;  2B87 A;  4IOI H;  5CBO A;  3ZDM A;  2Q1K A;  4GOE A;  3MZW B;  4HB1 A;  4MN4 C;  2KZJ A;  2KUB A;  2HR3 A;  1Q2N A;  2ZAE B;  2KZI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...