4NPDA

High-resolution structure of c domain of staphylococcal protein a at cryogenic temperature
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
58
structure length
58
Chain Sequence
ADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
total genus 23
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npdA00
2UWJE 2OTKE 2P58A 3ZDMA 3S1KA 3MZWB 2B88A 2KI7B 1LP1B 3RGUA 1JM0A 4KJMA 2LR2A 2RKLA 4MN4C 1OVUA 3FXEA 2B89A 4HB1A 3QWOC 2LXCB 4HKZH 4CPGA 1LT1A 2B87B 2K3RA 5EFWB 5K5GB 5DJTB 2Q1KA 4NPFX 4GOFA 2QVAA 1ZW0A 1U7MA 2KIKA 1X0TA 4ASWA 1EDKA 1H0TB 4WWIA 2HR3A 1LP1A 4GOEA 1NVOA 4K3AA 4ZMDA 2WMMA 4BXLA 1OVVA 2SPZA 5C39A 1H0TA 4GODA 2KZIA 5CBNA 1FC2C 2M5AA 4JBZA 2KS1B 1EDJA 1U7JA 4NPDA 2R44A 2ZAEB 4IOIH 2B87A 2LXBA 3PH0A 2I8DA 2JWDA 1BDDA 4ASVA 2QRXA 1S3JA 5CBOA 1SS1A 4EYYQ 1EC5A 4K35A 4HJGH 1BDCA 3MHVA 1JMBA 2M5AB 4NPEA 1DEEG 1Y47A 3FXDA 5DJUB 1EDIA 1ZXGA 1OVRA 2M0BA 1Q2NA 1EDLA 2KUBA 4ZNCA 2KZJA 1MFTA
chains in the Genus database with same CATH superfamily
2YO2A 3L72D 1S9KE 2OTKE 3AE4C 3OW2O 4H13D 3S1KA 5KTBA 1NTMD 2BEZF 4WVZA 2G3AA 3GHGB 4WY4D 2M3EA 3KQGA 1RQVA 1EZVG 3VMZA 1LP1B 1RF1B 1IFNA 5CJ4A 1NTMJ 1JM0A 1XTGB 3HE5A 3M9BA 1QVGO 2IBZD 3A2AA 3GMAA 3H1IE 1L0NG 3C9IA 1LTAC 2PGDA 5KLIC 3L75J 1JY2P 1J1EC 1X22A 1BGYJ 2ZXEB 1S5LE 2ZT9B 3LIEA 2KK7A 1LTJC 2J58A 4OVNF 3LIDA 4PD4I 3W68A 1URQA 3CC7P 4RKUJ 4GDOA 1JUNA 2JJLA 2B89A 2BCCD 5CHXA 1J1DC 1DD3A 1VQKP 3P8CE 1G1JA 2P67A 1N7SC 2G8YA 1KILE 1LT1A 3HE4A 4C46A 4L73A 2B87B 2D2CC 1PZQA 1X8YA 1KYOE 2N1TD 2E74B 3C8VA 3HE5B 1N2DC 5DJTB 2Q1KA 3L71J 3D6YA 5APTA 1SQPJ 1MKMA 1BE3J 1YTZT 1VF5D 3CX5H 3VOPA 2KIKA 2PRRA 1YQ4C 1M8OB 2CK3H 3P7KA 2NPSC 1BE3E 1EDKA 1LJ2A 1LWUA 2C0XA 4EDFA 2FFDC 3CXHE 1YIJP 3HTKB 3M9QA 4Z1MH 2HR3A 2IYOA 2QJKB 1QGKB 3CLQA 3L75G 4PV1D 1W5CE 2QA4P 5CCHA 3L73G 1GZLA 2HODA 2QM7A 2GUVA 3GHGC 3RK3B 3VTPC 1PGQA 2WSEJ 4WY4C 2NPSB 1NO4A 1FZEA 3VN0A 1YI2P 2YO3A 2IFMA 2A45I 2QM8A 2W6AA 3MD0A 1BGYE 2HLOA 4IL6X 1OVVA 1PIXA 2A06G 3UIAA 4D6TD 1PFIA 3SFEC 1HH0A 2WQYC 4R4LA 3CCMP 2AEFA 2WPQA 5KAFH 1M57D 1SLQA 1JY2N 3CX5E 1K8AQ 5B5EE 1L4AC 1SP4A 2GUSA 1JTHA 1SQBD 1RE4C 1SQXJ 4JQ0D 3RL0B 5APYA 3Q3DA 3CMAP 3TGUE 1FZCB 5CBNA 3AEEC 1FC2C 4AUWA 1IJDB 4YTPC 3TGUJ 1KYOH 1Q86Q 1MFZA 1PP9E 5AVVB 2MJZA 1KILB 1PGJA 1NHLA 2I8DA 2R32A 1OX3A 3SSUA 2D2CD 4IFMA 3TF5A 1NU1K 3GW6A 2N1TC 1L0LD 3BRTB 3L70J 5AW3B 1S4XA 5AW7B 5GTHE 2FXOA 3GF7A 2FFDB 1VQ9P 1SQPD 3D70A 1S3JA 1SQVE 2XKMA 2XDJA 1URQD 1URQB 3L74G 2A06D 4D6TG 3RK2D 1S5LX 2WSFJ 5AVRB 4K35A 1FZAA 2ZFCA 4QMAA 1X9VA 3NTNA 1JO5A 3CL3D 4XA4A 3A0BE 5APWA 3M06A 4C7RA 1L0LK 1HGZA 3SWKA 3H1IG 5CCGA 1RF1A 1YQ3C 5E79H 1DEEG 3OJAB 1K73Q 3L72G 1SQVJ 1VL2A 1GD2E 3MUDC 2Z5HA 1EZVE 3HUSA 3NXSA 1VQOP 2IPPA 1EDIA 1T6AA 1ZXGA 1L4AB 5AW5B 5M1BA 3RBZA 5KAIH 5KKZB 1DX7A 1L0LG 3H32B 3MIWA 3AEDC 2HPCB 4I7ZC 1SQBK 2OARA 1SQQJ 4IFFA 2FYUD 1BE3G 3H1LD 3Q2YA 4O9BA 1SQXK 4A7PA 2KZJA 3V4WA 3OA7A 2KB7P 3LW5J 3H1HG 2HPCA 1WRGA 2IYPA 2M3BA 3PTZA 3SFDC 2QJYB 2L91A 3VP9A 1P84E 3A3YB 1CSBA 2JKVA 1LT9B 2ZVNB 3H1HJ 4L76A 4TLFA 2B88A 3WMM0 3KZIH 1XTCC 2QG4A 4I1LA 1DEBA 1NTKD 2JO1A 3L75D 1M1KQ 1NKZB 4W7YA 3WU2H 1P84H 1KILC 5KJ7C 2OYHB 1NTZK 5AVYB 2ZYDA 4KJMA 2WSEH 2FYNC 2JWAA 1IFDA 2YKPA 4DZOA 1CI6B 1NTME 1GK6A 1EZVI 1GW3A 1LTGC 2JP3A 1QEXA 4EOTA 1BCCJ 1ZV8A 3P8MC 3R2PA 4N78E 5GTIE 5KLVD 3OAKA 3V2QA 1IC2A 1YHQP 2KS1A 3T97B 2IFNA 1L0NE 1H8AA 2IBZE 2YKQA 2E74D 3L71E 4OWFA 4Y99B 1N73A 4HKZH 1Q81Q 3TK1A 1FZCA 4LC1A 4JYCA 1A02J 2YIUB 3CWBE 2JDIH 3CX5I 1GW4A 1HJ0A 2K3RA 3A0BH 3CWBJ 3M91A 4H0LB 4UB6H 3TNUA 2FYUK 1AVYA 4NPFX 4GOFA 1FZGA 3L70G 5CMZA 3CCEP 2H8PD 1HTLC 2W8ZA 1FAVA 1U7MA 3VMAA 3P32A 3G6EP 5KAFE 4N6JA 4DJGA 5AVUB 1CZQA 1X79B 2NPSA 2AEJA 2ZT9D 5B5EH 3B5NC 1SFCC 2O01H 3AE7C 2FBWC 2ZYAA 1KYOD 3L74E 4N3YB 1OZHA 3CCUP 2Q7CA 2OTJP 3TDKA 1W2BO 4U3FD 1SQBG 2OYIC 1AA0A 1AV1A 2OQQA 1SQQK 3SWFA 3A7OA 3NMDA 4BXLA 1LWUB 3AE8C 3IFMA 1NTMK 3Q5RA 1Q7YQ 4C7NB 2Y9YA 3H1JG 1H89A 2E42A 2GA1A 3CWBG 4LLHA 1PPJG 1RE3A 1EXIA 5C39A 3FWNA 1NTZE 4KT0J 4GT1A 3HTKA 1H0TA 1J2JB 1EQ7A 3CC2P 1KYOI 2WSCH 3CC4P 3MTUE 2FY8A 1VQ5P 2ZVOB 2WPVB 5CJ0A 2H7HA 2Y9ZA 2W6BA 3H6PA 2IZ1A 1T3JA 4XE5B 2QIWA 2YMYA 4JBZA 3E1RA 2KS1B 1ZOYC 3H1KD 1EDJA 4UB6E 2ZAEB 4IOIH 2I1KA 2JEEA 3B8EB 2N9YB 3RK2B 1SQXE 2B87A 2ITAA 3M9HA 1KB9I 3PH0A 3HE4B 3KDPB 5L8RJ 1OW6A 3A0HE 1YJWP 2JWDA 1CI6A 2JR8A 1SQBE 1HJBA 2P2UA 4WBAA 3Q1MA 1FDIA 2XU6A 3AEBC 5AVWB 3U1AA 3G71P 1PPJD 3AEGC 2QSIA 2QRXA 3CXHH 1T8ZA 1LTTC 3V2NA 3V2RA 3CPWO 3CCSP 3H1JD 4PJ0H 1Z56A 1HGVA 4HYTB 1M1JC 2K88A 3EWKA 3NFQA 1AJYA 1EC5A 2WSCJ 3L4FA 2BEQD 4Y28J 1J1DB 1SQQD 2FYNB 1NU1J 2Q3IA 5CCGD 5CCHC 1DH3A 1FJKA 2ZXXA 3L70E 2C9LY 2LKMA 2W27A 3BCCJ 3MHVA 3O8ZA 1L0LE 2WVRA 5AVXB 3RL0D 3M0DA 1L0LJ 2E5TA 5TISH 1YJNP 3AEFC 1BSNA 2OYIB 1FOSE 1Y47A 4RO0A 1R5LA 1JY3P 2FYZA 2VRSA 3L72E 1S9KD 4EIJA 1SQVK 3FGAD 1KB9D 2C0WA 5DJUB 5GTHH 4C7NA 1GDTA 1LTIC 3ZDMA 1K04A 2WTYA 2DW3A 1L0NJ 2IX7C 3ITKA 1Q2NA 3HUSB 3PHLA 1KQFB 1G2CA 2HFED 3E1IA 2R3SA 2O01J 1BCCE 3H1ID 1NU1E 1S1CX 1L4AD 2KLUA 1AQ5A 3AEAC 1WMKA 3C1LA 5AVQB 2NRGA 1YITP 2Z5IA 1D7MA 3VMYA 3WUTA 2HODB 3MZWB 2KI7B 5APXA 1R8EA 3N7NA 2O01N 5E79E 1NJIQ 1N7LA 1OW8A 1SVFA 1UIXA 2NZ2A 1KFNA 2BCCE 2ZJSE 3B71A 1ZRTD 2WITA 4Y99C 1NAFA 2AXCA 3RGUA 3HRNA 4PV1B 2D2CB 4GKGA 2OGUA 1VPCA 2A45G 4YXDC 2LR2A 1U57A 1OW7A 2Q3EA 3H1HE 2H43A 3HD7C 1PV3A 5AVSB 2N9BA 1M1JB 1VQ8P 4MN4C 1LTJA 2YMKA 1USDA 1FDMA 2QJPB 1JCDA 1URQC 2XZRA 3CI9A 1OVUA 3EQ2A 3IN6A 4H44C 4KHXA 2WSFH 3TNUB 3AE6C 4HB1A 2POHA 2WT7B 2H88C 4U3FJ 1VQNP 3O6QA 1N7SA 1BE3D 4CPGA 1TU3F 2PFXA 3BCCE 1YYCA 1N73B 1GL2C 5KLIB 1IFIA 4PD4E 1FU1A 1CW5A 1IK9A 5K5GB 2IZ0A 1N86A 3VMXA 4OGQC 4N78D 4DCKA 3AE9C 2QVAA 2XNXA 5KLVE 2NPSD 2V4HA 3CD6P 4B86A 4PD4H 5AW6B 1L0ND 3GG2A 2WWWA 1H88A 3LW5H 1ZR4A 4JPZB 4ZKUA 1VF5C 1QLED 1FJPA 3JSVC 4I2LC 4D6TE 1W2EA 2AXTH 2O1JA 4WWIA 1FZBA 1JMMA 1KZUB 1SQVG 3E7KA 3B5ND 3V6IA 1LP1A 1OWAA 4GOEA 1T2KC 2K9JB 2KP8A 2YKOA 3H1IJ 3I5CA 4WB4A 2ZYGA 3Q5SA 2BASA 3I56P 1LT9A 3RK3D 4ZMDA 2OYHC 2HYNA 2HG5D 2WMMA 3H32A 1SFCB 3KYQA 1Q90D 1SQPG 1VF5B 2AEMA 4L74A 1ZR2A 2FKWB 2Y0EA 3H1KJ 3GLMA 4H13B 1VQ6P 3F89A 3L36A 4DOJA 1KN7A 3CXHD 2SPZA 5KJ7D 3HUSC 4H0LD 4AYCA 4BWNA 3GF3A 5GTIH 2RH0A 5AW4B 3L74D 2XNDH 3D6ZA 2YNYA 2KOGA 1L4AA 2KSEA 1RE4A 3HD7D 5BU8B 1ZMEC 1VQLP 1HWTC 3FWLA 2KZIA 1VQMP 4H13C 2N1TB 4EI2A 1JY2O 1SQVD 2IDBA 5AW8B 2KYVA 3CCRP 2C9NY 1Q82Q 1R5SA 2A06E 2OTLP 1S72P 2R44A 1K05A 1BGYG 2E74C 3CXHI 1RQUA 2YXRB 2LXBA 2P7JA 2YIUC 3CX5D 1GL2D 4OH8B 4U7JA 1PGPA 1RF0A 3BATA 4AQRD 1WT6A 3U1CA 1ZLLA 3BCCG 1SQXG 3B4SA 3O6QB 2V7QH 3R4YA 1HF9A 1FOSF 2FYUG 3H1LG 2CPSA 4M3LA 2Q5UA 1BDDA 1NTKK 1LTSC 1G1IA 2O1KA 3TGUD 1N8RQ 1KC8Q 2K37A 2L5GB 4JYBA 3G4SP 2FFDA 2W6JH 1JY3N 1HUCA 2IBZG 1EZVD 1M1JA 2P1JA 3JCUH 3ABVC 5APUA 4RJTA 3H25A 1A02F 2ZT9C 5BU5A 1IFJA 3H1KG 1GU4A 3WU2E 5AVZB 3L73D 1NTKG 2KNCB 4TT3H 1KD1Q 1N7SD 3K5BA 3PLNA 1NTZG 1GL2B 2R5DA 2M5AB 1PPJE 3L73J 1SQPE 2OYHA 4PJ0E 5BVZA 3RK3C 3U59A 1N73C 2BCCG 2IBZI 3H1JE 4XFJA 3RL0g 1VQ4P 3VP8A 2GM4A 1PGOA 2E76C 3FXDA 1T3UA 2E5YA 2WSSH 3G9RA 1JTHB 1OIPA 1P84I 1KQLA 1HBWA 3KHUA 1OVRA 2M0BA 3TYYA 4ZKPA 5APVA 3L70D 4H0LC 2KUBA 4UB8H 5APQA 5TJHA 1Y8AA 2XV5A 1K9MQ 2I1JA 3G3ZA 4ZNCA 4YPCA 1NU1G 1G2CB 2J59M 4DT0A 2OYOA 3B5NA 4PV1C 2UWJE 1LNQA 3KXDA 2K9YA 5KAIE 3V2PA 1E5WA 2P58A 5AW2B 4YXWH 3A0HH 2KNCA 5AW0B 2KXPB 2WZ7A 3M0AA 3W67A 1VQPP 1FBMA 2OYIA 3S4RA 1HVVA 3CCLP 3EFGA 4RESB 1SQQG 2RN0A 2W90A 1BCCD 1NYHA 3P8CD 1M56D 4BRYB 3FX0A 3JCUE 1KILD 3AE5C 1KFMA 1RE3C 1ZP0C 1KMIZ 2Q6QA 3CWBD 3L35A 1NWQA 3II6A 1P84D 2RKLA 3KZIE 3D71A 3HD7A 2BCCJ 3TSIA 4IFDK 1KV4A 1IK7A 5H2FE 3MGNA 1GMJA 3AE3C 1KQGB 3CCQP 3FXEA 1JCCA 1USEA 1NTMG 1OFCX 1M90Q 3QWOC 3A5TA 1NTKJ 2LXCB 1E79H 3M0DC 3L37A 1FZCC 1BSHA 3RL0C 3H1HD 2O3JA 2WPRA 3EFFK 3L74J 5EFWB 4H44B 3H1JJ 1IFPA 3CMEP 2PAJA 2QEXP 5KKZC 2FYUJ 1IFMA 3F5HA 2E76D 1OXZA 3H1LJ 1PP9G 3HD7B 2N1TA 3IR9A 4LGDE 4U3FE 1ZW0A 3VYIA 5KLVK 5TISE 3L71D 4GIFA 3Q5PA 1BCCG 1X0TA 1LWUC 1BGYD 4W7ZA 4ASWA 4BRYA 3BCCD 1SFCA 3SWYA 1DIPA 2KLVA 4WY4B 1H0TB 1MV8A 1JY3O 3TGUG 1QL1A 4PD4D 1KQSO 1AVOA 1AFOA 1FS0E 2K9JA 4I6MC 4R4MA 1LGHB 1RHZB 3GHGA 2QJYC 1NVOA 1NGMB 1FZFA 1IZNB 1LT9C 4K3AA 5KLVG 2Y0DA 4WY4A 3N4XA 3CCVP 1T2KD 2Q9IA 2Y0CA 5KJ7A 4IL6H 2Z4EA 2FXMA 2E76B 3B5NB 1RF1C 1GU5A 3PP5A 2AXTE 2FXPA 2QJKC 2E43A 4I7ZB 3BASA 1SQXD 3IF4A 5APSA 1PP9D 3BRVB 3S9OA 3T97A 1RY3A 1GK4A 2E75D 2A45H 3PJSK 4GODA 1Y9BA 3RK3E 1QX8A 3PRJA 1NAYA 3V4QA 1JEKA 2B9BA 2QJPC 3WUVA 1N7SB 1GTWA 2PP6A 4H44D 1MZ9A 1NH4A 1ZN5A 2M5AA 5B66E 3BVHA 3I55P 3USSA 1U7JA 1GL2A 3IAOA 4HH2A 1RH5B 4NPDA 3L72J 1NTZD 1AQTA 3V5BA 1SQQE 1JNMA 2K1AA 1EXJA 5KLVJ 1RF0C 3AE2C 1IO4A 4OGQB 1NTZJ 2QE7H 1KILA 3AECC 3CCJP 5H2FH 3AE1C 1DD4A 1MUUA 1NOHA 3L71G 4OGQD 3QH9A 5AVTB 3RK2C 2CPBA 4ASVA 5CBOA 1VDFA 1YTZI 2RMZA 3H1KE 4UB8E 2WT7A 1PL5A 1QL2A 1SS1A 1LTJB 2MKVA 4JF7A 3WUUA 1KB9E 4D6TJ 1JOCA 1UIIA 4EYYQ 1S5LH 1QVFO 1VQ7P 1J1EB 5B66H 1LTBC 1OMIA 2M8RA 4HJGH 1BDCA 4U3FG 1SQPK 2FYUE 3H1LE 1JMBA 1SQBJ 1KB9H 2R5BA 5CCGC 2KSJA 1L2PA 1NKNA 1NU1D 2W83C 3MP7B 5CCHD 4L75A 5AW9B 2E75B 4NPEA 2P10A 1M7LA 2H89C 2WPSA 3KPEA 2V7QJ 3MUDA 5AW1B 1JB0J 1YJ9P 2J5UA 2YXQB 1FE6A 2R3CA 4IL6E 1L0NK 1FDOA 3L73E 1KORA 1EDLA 3RBXA 1NTKE 1YBKA 3JC22 3L75E 1PP9J 1SFCD 1ZRTE 4W80A 1S2EA 2E75C 1KTMA 1MFTA
chains in the Genus database with same CATH topology
2UWJE 2OTKE 2P58A 3ZDMA 3S1KA 3MZWB 2B88A 2KI7B 1LP1B 3RGUA 1JM0A 4KJMA 2LR2A 2RKLA 4MN4C 1OVUA 3FXEA 2B89A 4HB1A 3QWOC 2LXCB 4HKZH 4CPGA 1LT1A 2B87B 2K3RA 5EFWB 5K5GB 5DJTB 2Q1KA 4NPFX 4GOFA 2QVAA 1ZW0A 1U7MA 2KIKA 1X0TA 4ASWA 1EDKA 1H0TB 4WWIA 2HR3A 1LP1A 4GOEA 1NVOA 4K3AA 4ZMDA 2WMMA 4BXLA 1OVVA 2SPZA 5C39A 1H0TA 4GODA 2KZIA 5CBNA 1FC2C 2M5AA 4JBZA 2KS1B 1EDJA 1U7JA 4NPDA 2R44A 2ZAEB 4IOIH 2B87A 2LXBA 3PH0A 2I8DA 2JWDA 1BDDA 4ASVA 2QRXA 1S3JA 5CBOA 1SS1A 4EYYQ 1EC5A 4K35A 4HJGH 1BDCA 3MHVA 1JMBA 2M5AB 4NPEA 1DEEG 1Y47A 3FXDA 5DJUB 1EDIA 1ZXGA 1OVRA 2M0BA 1Q2NA 1EDLA 2KUBA 4ZNCA 2KZJA 1MFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UWJ E;  2OTK E;  2P58 A;  3ZDM A;  3S1K A;  3MZW B;  2B88 A;  2KI7 B;  1LP1 B;  3RGU A;  1JM0 A;  4KJM A;  2LR2 A;  2RKL A;  4MN4 C;  1OVU A;  3FXE A;  2B89 A;  4HB1 A;  3QWO C;  2LXC B;  4HKZ H;  4CPG A;  1LT1 A;  2B87 B;  2K3R A;  5EFW B;  5K5G B;  5DJT B;  2Q1K A;  4NPF X;  4GOF A;  2QVA A;  1ZW0 A;  1U7M A;  2KIK A;  1X0T A;  4ASW A;  1EDK A;  1H0T B;  4WWI A;  2HR3 A;  1LP1 A;  4GOE A;  1NVO A;  4K3A A;  4ZMD A;  2WMM A;  4BXL A;  1OVV A;  2SPZ A;  5C39 A;  1H0T A;  4GOD A;  2KZI A;  5CBN A;  1FC2 C;  2M5A A;  4JBZ A;  2KS1 B;  1EDJ A;  1U7J A;  4NPD A;  2R44 A;  2ZAE B;  4IOI H;  2B87 A;  2LXB A;  3PH0 A;  2I8D A;  2JWD A;  1BDD A;  4ASV A;  2QRX A;  1S3J A;  5CBO A;  1SS1 A;  4EYY Q;  1EC5 A;  4K35 A;  4HJG H;  1BDC A;  3MHV A;  1JMB A;  2M5A B;  4NPE A;  1DEE G;  1Y47 A;  3FXD A;  5DJU B;  1EDI A;  1ZXG A;  1OVR A;  2M0B A;  1Q2N A;  1EDL A;  2KUB A;  4ZNC A;  2KZJ A;  1MFT A; 
#chains in the Genus database with same CATH topology
 2YO2 A;  3L72 D;  1S9K E;  2OTK E;  3AE4 C;  3OW2 O;  4H13 D;  3S1K A;  5KTB A;  1NTM D;  2BEZ F;  4WVZ A;  2G3A A;  3GHG B;  4WY4 D;  2M3E A;  3KQG A;  1RQV A;  1EZV G;  3VMZ A;  1LP1 B;  1RF1 B;  1IFN A;  5CJ4 A;  1NTM J;  1JM0 A;  1XTG B;  3HE5 A;  3M9B A;  1QVG O;  2IBZ D;  3A2A A;  3GMA A;  3H1I E;  1L0N G;  3C9I A;  1LTA C;  2PGD A;  5KLI C;  3L75 J;  1JY2 P;  1J1E C;  1X22 A;  1BGY J;  2ZXE B;  1S5L E;  2ZT9 B;  3LIE A;  2KK7 A;  1LTJ C;  2J58 A;  4OVN F;  3LID A;  4PD4 I;  3W68 A;  1URQ A;  3CC7 P;  4RKU J;  4GDO A;  1JUN A;  2JJL A;  2B89 A;  2BCC D;  5CHX A;  1J1D C;  1DD3 A;  1VQK P;  3P8C E;  1G1J A;  2P67 A;  1N7S C;  2G8Y A;  1KIL E;  1LT1 A;  3HE4 A;  4C46 A;  4L73 A;  2B87 B;  2D2C C;  1PZQ A;  1X8Y A;  1KYO E;  2N1T D;  2E74 B;  3C8V A;  3HE5 B;  1N2D C;  5DJT B;  2Q1K A;  3L71 J;  3D6Y A;  5APT A;  1SQP J;  1MKM A;  1BE3 J;  1YTZ T;  1VF5 D;  3CX5 H;  3VOP A;  2KIK A;  2PRR A;  1YQ4 C;  1M8O B;  2CK3 H;  3P7K A;  2NPS C;  1BE3 E;  1EDK A;  1LJ2 A;  1LWU A;  2C0X A;  4EDF A;  2FFD C;  3CXH E;  1YIJ P;  3HTK B;  3M9Q A;  4Z1M H;  2HR3 A;  2IYO A;  2QJK B;  1QGK B;  3CLQ A;  3L75 G;  4PV1 D;  1W5C E;  2QA4 P;  5CCH A;  3L73 G;  1GZL A;  2HOD A;  2QM7 A;  2GUV A;  3GHG C;  3RK3 B;  3VTP C;  1PGQ A;  2WSE J;  4WY4 C;  2NPS B;  1NO4 A;  1FZE A;  3VN0 A;  1YI2 P;  2YO3 A;  2IFM A;  2A45 I;  2QM8 A;  2W6A A;  3MD0 A;  1BGY E;  2HLO A;  4IL6 X;  1OVV A;  1PIX A;  2A06 G;  3UIA A;  4D6T D;  1PFI A;  3SFE C;  1HH0 A;  2WQY C;  4R4L A;  3CCM P;  2AEF A;  2WPQ A;  5KAF H;  1M57 D;  1SLQ A;  1JY2 N;  3CX5 E;  1K8A Q;  5B5E E;  1L4A C;  1SP4 A;  2GUS A;  1JTH A;  1SQB D;  1RE4 C;  1SQX J;  4JQ0 D;  3RL0 B;  5APY A;  3Q3D A;  3CMA P;  3TGU E;  1FZC B;  5CBN A;  3AEE C;  1FC2 C;  4AUW A;  1IJD B;  4YTP C;  3TGU J;  1KYO H;  1Q86 Q;  1MFZ A;  1PP9 E;  5AVV B;  2MJZ A;  1KIL B;  1PGJ A;  1NHL A;  2I8D A;  2R32 A;  1OX3 A;  3SSU A;  2D2C D;  4IFM A;  3TF5 A;  1NU1 K;  3GW6 A;  2N1T C;  1L0L D;  3BRT B;  3L70 J;  5AW3 B;  1S4X A;  5AW7 B;  5GTH E;  2FXO A;  3GF7 A;  2FFD B;  1VQ9 P;  1SQP D;  3D70 A;  1S3J A;  1SQV E;  2XKM A;  2XDJ A;  1URQ D;  1URQ B;  3L74 G;  2A06 D;  4D6T G;  3RK2 D;  1S5L X;  2WSF J;  5AVR B;  4K35 A;  1FZA A;  2ZFC A;  4QMA A;  1X9V A;  3NTN A;  1JO5 A;  3CL3 D;  4XA4 A;  3A0B E;  5APW A;  3M06 A;  4C7R A;  1L0L K;  1HGZ A;  3SWK A;  3H1I G;  5CCG A;  1RF1 A;  1YQ3 C;  5E79 H;  1DEE G;  3OJA B;  1K73 Q;  3L72 G;  1SQV J;  1VL2 A;  1GD2 E;  3MUD C;  2Z5H A;  1EZV E;  3HUS A;  3NXS A;  1VQO P;  2IPP A;  1EDI A;  1T6A A;  1ZXG A;  1L4A B;  5AW5 B;  5M1B A;  3RBZ A;  5KAI H;  5KKZ B;  1DX7 A;  1L0L G;  3H32 B;  3MIW A;  3AED C;  2HPC B;  4I7Z C;  1SQB K;  2OAR A;  1SQQ J;  4IFF A;  2FYU D;  1BE3 G;  3H1L D;  3Q2Y A;  4O9B A;  1SQX K;  4A7P A;  2KZJ A;  3V4W A;  3OA7 A;  2KB7 P;  3LW5 J;  3H1H G;  2HPC A;  1WRG A;  2IYP A;  2M3B A;  3PTZ A;  3SFD C;  2QJY B;  2L91 A;  3VP9 A;  1P84 E;  3A3Y B;  1CSB A;  2JKV A;  1LT9 B;  2ZVN B;  3H1H J;  4L76 A;  4TLF A;  2B88 A;  3WMM 0;  3KZI H;  1XTC C;  2QG4 A;  4I1L A;  1DEB A;  1NTK D;  2JO1 A;  3L75 D;  1M1K Q;  1NKZ B;  4W7Y A;  3WU2 H;  1P84 H;  1KIL C;  5KJ7 C;  2OYH B;  1NTZ K;  5AVY B;  2ZYD A;  4KJM A;  2WSE H;  2FYN C;  2JWA A;  1IFD A;  2YKP A;  4DZO A;  1CI6 B;  1NTM E;  1GK6 A;  1EZV I;  1GW3 A;  1LTG C;  2JP3 A;  1QEX A;  4EOT A;  1BCC J;  1ZV8 A;  3P8M C;  3R2P A;  4N78 E;  5GTI E;  5KLV D;  3OAK A;  3V2Q A;  1IC2 A;  1YHQ P;  2KS1 A;  3T97 B;  2IFN A;  1L0N E;  1H8A A;  2IBZ E;  2YKQ A;  2E74 D;  3L71 E;  4OWF A;  4Y99 B;  1N73 A;  4HKZ H;  1Q81 Q;  3TK1 A;  1FZC A;  4LC1 A;  4JYC A;  1A02 J;  2YIU B;  3CWB E;  2JDI H;  3CX5 I;  1GW4 A;  1HJ0 A;  2K3R A;  3A0B H;  3CWB J;  3M91 A;  4H0L B;  4UB6 H;  3TNU A;  2FYU K;  1AVY A;  4NPF X;  4GOF A;  1FZG A;  3L70 G;  5CMZ A;  3CCE P;  2H8P D;  1HTL C;  2W8Z A;  1FAV A;  1U7M A;  3VMA A;  3P32 A;  3G6E P;  5KAF E;  4N6J A;  4DJG A;  5AVU B;  1CZQ A;  1X79 B;  2NPS A;  2AEJ A;  2ZT9 D;  5B5E H;  3B5N C;  1SFC C;  2O01 H;  3AE7 C;  2FBW C;  2ZYA A;  1KYO D;  3L74 E;  4N3Y B;  1OZH A;  3CCU P;  2Q7C A;  2OTJ P;  3TDK A;  1W2B O;  4U3F D;  1SQB G;  2OYI C;  1AA0 A;  1AV1 A;  2OQQ A;  1SQQ K;  3SWF A;  3A7O A;  3NMD A;  4BXL A;  1LWU B;  3AE8 C;  3IFM A;  1NTM K;  3Q5R A;  1Q7Y Q;  4C7N B;  2Y9Y A;  3H1J G;  1H89 A;  2E42 A;  2GA1 A;  3CWB G;  4LLH A;  1PPJ G;  1RE3 A;  1EXI A;  5C39 A;  3FWN A;  1NTZ E;  4KT0 J;  4GT1 A;  3HTK A;  1H0T A;  1J2J B;  1EQ7 A;  3CC2 P;  1KYO I;  2WSC H;  3CC4 P;  3MTU E;  2FY8 A;  1VQ5 P;  2ZVO B;  2WPV B;  5CJ0 A;  2H7H A;  2Y9Z A;  2W6B A;  3H6P A;  2IZ1 A;  1T3J A;  4XE5 B;  2QIW A;  2YMY A;  4JBZ A;  3E1R A;  2KS1 B;  1ZOY C;  3H1K D;  1EDJ A;  4UB6 E;  2ZAE B;  4IOI H;  2I1K A;  2JEE A;  3B8E B;  2N9Y B;  3RK2 B;  1SQX E;  2B87 A;  2ITA A;  3M9H A;  1KB9 I;  3PH0 A;  3HE4 B;  3KDP B;  5L8R J;  1OW6 A;  3A0H E;  1YJW P;  2JWD A;  1CI6 A;  2JR8 A;  1SQB E;  1HJB A;  2P2U A;  4WBA A;  3Q1M A;  1FDI A;  2XU6 A;  3AEB C;  5AVW B;  3U1A A;  3G71 P;  1PPJ D;  3AEG C;  2QSI A;  2QRX A;  3CXH H;  1T8Z A;  1LTT C;  3V2N A;  3V2R A;  3CPW O;  3CCS P;  3H1J D;  4PJ0 H;  1Z56 A;  1HGV A;  4HYT B;  1M1J C;  2K88 A;  3EWK A;  3NFQ A;  1AJY A;  1EC5 A;  2WSC J;  3L4F A;  2BEQ D;  4Y28 J;  1J1D B;  1SQQ D;  2FYN B;  1NU1 J;  2Q3I A;  5CCG D;  5CCH C;  1DH3 A;  1FJK A;  2ZXX A;  3L70 E;  2C9L Y;  2LKM A;  2W27 A;  3BCC J;  3MHV A;  3O8Z A;  1L0L E;  2WVR A;  5AVX B;  3RL0 D;  3M0D A;  1L0L J;  2E5T A;  5TIS H;  1YJN P;  3AEF C;  1BSN A;  2OYI B;  1FOS E;  1Y47 A;  4RO0 A;  1R5L A;  1JY3 P;  2FYZ A;  2VRS A;  3L72 E;  1S9K D;  4EIJ A;  1SQV K;  3FGA D;  1KB9 D;  2C0W A;  5DJU B;  5GTH H;  4C7N A;  1GDT A;  1LTI C;  3ZDM A;  1K04 A;  2WTY A;  2DW3 A;  1L0N J;  2IX7 C;  3ITK A;  1Q2N A;  3HUS B;  3PHL A;  1KQF B;  1G2C A;  2HFE D;  3E1I A;  2R3S A;  2O01 J;  1BCC E;  3H1I D;  1NU1 E;  1S1C X;  1L4A D;  2KLU A;  1AQ5 A;  3AEA C;  1WMK A;  3C1L A;  5AVQ B;  2NRG A;  1YIT P;  2Z5I A;  1D7M A;  3VMY A;  3WUT A;  2HOD B;  3MZW B;  2KI7 B;  5APX A;  1R8E A;  3N7N A;  2O01 N;  5E79 E;  1NJI Q;  1N7L A;  1OW8 A;  1SVF A;  1UIX A;  2NZ2 A;  1KFN A;  2BCC E;  2ZJS E;  3B71 A;  1ZRT D;  2WIT A;  4Y99 C;  1NAF A;  2AXC A;  3RGU A;  3HRN A;  4PV1 B;  2D2C B;  4GKG A;  2OGU A;  1VPC A;  2A45 G;  4YXD C;  2LR2 A;  1U57 A;  1OW7 A;  2Q3E A;  3H1H E;  2H43 A;  3HD7 C;  1PV3 A;  5AVS B;  2N9B A;  1M1J B;  1VQ8 P;  4MN4 C;  1LTJ A;  2YMK A;  1USD A;  1FDM A;  2QJP B;  1JCD A;  1URQ C;  2XZR A;  3CI9 A;  1OVU A;  3EQ2 A;  3IN6 A;  4H44 C;  4KHX A;  2WSF H;  3TNU B;  3AE6 C;  4HB1 A;  2POH A;  2WT7 B;  2H88 C;  4U3F J;  1VQN P;  3O6Q A;  1N7S A;  1BE3 D;  4CPG A;  1TU3 F;  2PFX A;  3BCC E;  1YYC A;  1N73 B;  1GL2 C;  5KLI B;  1IFI A;  4PD4 E;  1FU1 A;  1CW5 A;  1IK9 A;  5K5G B;  2IZ0 A;  1N86 A;  3VMX A;  4OGQ C;  4N78 D;  4DCK A;  3AE9 C;  2QVA A;  2XNX A;  5KLV E;  2NPS D;  2V4H A;  3CD6 P;  4B86 A;  4PD4 H;  5AW6 B;  1L0N D;  3GG2 A;  2WWW A;  1H88 A;  3LW5 H;  1ZR4 A;  4JPZ B;  4ZKU A;  1VF5 C;  1QLE D;  1FJP A;  3JSV C;  4I2L C;  4D6T E;  1W2E A;  2AXT H;  2O1J A;  4WWI A;  1FZB A;  1JMM A;  1KZU B;  1SQV G;  3E7K A;  3B5N D;  3V6I A;  1LP1 A;  1OWA A;  4GOE A;  1T2K C;  2K9J B;  2KP8 A;  2YKO A;  3H1I J;  3I5C A;  4WB4 A;  2ZYG A;  3Q5S A;  2BAS A;  3I56 P;  1LT9 A;  3RK3 D;  4ZMD A;  2OYH C;  2HYN A;  2HG5 D;  2WMM A;  3H32 A;  1SFC B;  3KYQ A;  1Q90 D;  1SQP G;  1VF5 B;  2AEM A;  4L74 A;  1ZR2 A;  2FKW B;  2Y0E A;  3H1K J;  3GLM A;  4H13 B;  1VQ6 P;  3F89 A;  3L36 A;  4DOJ A;  1KN7 A;  3CXH D;  2SPZ A;  5KJ7 D;  3HUS C;  4H0L D;  4AYC A;  4BWN A;  3GF3 A;  5GTI H;  2RH0 A;  5AW4 B;  3L74 D;  2XND H;  3D6Z A;  2YNY A;  2KOG A;  1L4A A;  2KSE A;  1RE4 A;  3HD7 D;  5BU8 B;  1ZME C;  1VQL P;  1HWT C;  3FWL A;  2KZI A;  1VQM P;  4H13 C;  2N1T B;  4EI2 A;  1JY2 O;  1SQV D;  2IDB A;  5AW8 B;  2KYV A;  3CCR P;  2C9N Y;  1Q82 Q;  1R5S A;  2A06 E;  2OTL P;  1S72 P;  2R44 A;  1K05 A;  1BGY G;  2E74 C;  3CXH I;  1RQU A;  2YXR B;  2LXB A;  2P7J A;  2YIU C;  3CX5 D;  1GL2 D;  4OH8 B;  4U7J A;  1PGP A;  1RF0 A;  3BAT A;  4AQR D;  1WT6 A;  3U1C A;  1ZLL A;  3BCC G;  1SQX G;  3B4S A;  3O6Q B;  2V7Q H;  3R4Y A;  1HF9 A;  1FOS F;  2FYU G;  3H1L G;  2CPS A;  4M3L A;  2Q5U A;  1BDD A;  1NTK K;  1LTS C;  1G1I A;  2O1K A;  3TGU D;  1N8R Q;  1KC8 Q;  2K37 A;  2L5G B;  4JYB A;  3G4S P;  2FFD A;  2W6J H;  1JY3 N;  1HUC A;  2IBZ G;  1EZV D;  1M1J A;  2P1J A;  3JCU H;  3ABV C;  5APU A;  4RJT A;  3H25 A;  1A02 F;  2ZT9 C;  5BU5 A;  1IFJ A;  3H1K G;  1GU4 A;  3WU2 E;  5AVZ B;  3L73 D;  1NTK G;  2KNC B;  4TT3 H;  1KD1 Q;  1N7S D;  3K5B A;  3PLN A;  1NTZ G;  1GL2 B;  2R5D A;  2M5A B;  1PPJ E;  3L73 J;  1SQP E;  2OYH A;  4PJ0 E;  5BVZ A;  3RK3 C;  3U59 A;  1N73 C;  2BCC G;  2IBZ I;  3H1J E;  4XFJ A;  3RL0 g;  1VQ4 P;  3VP8 A;  2GM4 A;  1PGO A;  2E76 C;  3FXD A;  1T3U A;  2E5Y A;  2WSS H;  3G9R A;  1JTH B;  1OIP A;  1P84 I;  1KQL A;  1HBW A;  3KHU A;  1OVR A;  2M0B A;  3TYY A;  4ZKP A;  5APV A;  3L70 D;  4H0L C;  2KUB A;  4UB8 H;  5APQ A;  5TJH A;  1Y8A A;  2XV5 A;  1K9M Q;  2I1J A;  3G3Z A;  4ZNC A;  4YPC A;  1NU1 G;  1G2C B;  2J59 M;  4DT0 A;  2OYO A;  3B5N A;  4PV1 C;  2UWJ E;  1LNQ A;  3KXD A;  2K9Y A;  5KAI E;  3V2P A;  1E5W A;  2P58 A;  5AW2 B;  4YXW H;  3A0H H;  2KNC A;  5AW0 B;  2KXP B;  2WZ7 A;  3M0A A;  3W67 A;  1VQP P;  1FBM A;  2OYI A;  3S4R A;  1HVV A;  3CCL P;  3EFG A;  4RES B;  1SQQ G;  2RN0 A;  2W90 A;  1BCC D;  1NYH A;  3P8C D;  1M56 D;  4BRY B;  3FX0 A;  3JCU E;  1KIL D;  3AE5 C;  1KFM A;  1RE3 C;  1ZP0 C;  1KMI Z;  2Q6Q A;  3CWB D;  3L35 A;  1NWQ A;  3II6 A;  1P84 D;  2RKL A;  3KZI E;  3D71 A;  3HD7 A;  2BCC J;  3TSI A;  4IFD K;  1KV4 A;  1IK7 A;  5H2F E;  3MGN A;  1GMJ A;  3AE3 C;  1KQG B;  3CCQ P;  3FXE A;  1JCC A;  1USE A;  1NTM G;  1OFC X;  1M90 Q;  3QWO C;  3A5T A;  1NTK J;  2LXC B;  1E79 H;  3M0D C;  3L37 A;  1FZC C;  1BSH A;  3RL0 C;  3H1H D;  2O3J A;  2WPR A;  3EFF K;  3L74 J;  5EFW B;  4H44 B;  3H1J J;  1IFP A;  3CME P;  2PAJ A;  2QEX P;  5KKZ C;  2FYU J;  1IFM A;  3F5H A;  2E76 D;  1OXZ A;  3H1L J;  1PP9 G;  3HD7 B;  2N1T A;  3IR9 A;  4LGD E;  4U3F E;  1ZW0 A;  3VYI A;  5KLV K;  5TIS E;  3L71 D;  4GIF A;  3Q5P A;  1BCC G;  1X0T A;  1LWU C;  1BGY D;  4W7Z A;  4ASW A;  4BRY A;  3BCC D;  1SFC A;  3SWY A;  1DIP A;  2KLV A;  4WY4 B;  1H0T B;  1MV8 A;  1JY3 O;  3TGU G;  1QL1 A;  4PD4 D;  1KQS O;  1AVO A;  1AFO A;  1FS0 E;  2K9J A;  4I6M C;  4R4M A;  1LGH B;  1RHZ B;  3GHG A;  2QJY C;  1NVO A;  1NGM B;  1FZF A;  1IZN B;  1LT9 C;  4K3A A;  5KLV G;  2Y0D A;  4WY4 A;  3N4X A;  3CCV P;  1T2K D;  2Q9I A;  2Y0C A;  5KJ7 A;  4IL6 H;  2Z4E A;  2FXM A;  2E76 B;  3B5N B;  1RF1 C;  1GU5 A;  3PP5 A;  2AXT E;  2FXP A;  2QJK C;  2E43 A;  4I7Z B;  3BAS A;  1SQX D;  3IF4 A;  5APS A;  1PP9 D;  3BRV B;  3S9O A;  3T97 A;  1RY3 A;  1GK4 A;  2E75 D;  2A45 H;  3PJS K;  4GOD A;  1Y9B A;  3RK3 E;  1QX8 A;  3PRJ A;  1NAY A;  3V4Q A;  1JEK A;  2B9B A;  2QJP C;  3WUV A;  1N7S B;  1GTW A;  2PP6 A;  4H44 D;  1MZ9 A;  1NH4 A;  1ZN5 A;  2M5A A;  5B66 E;  3BVH A;  3I55 P;  3USS A;  1U7J A;  1GL2 A;  3IAO A;  4HH2 A;  1RH5 B;  4NPD A;  3L72 J;  1NTZ D;  1AQT A;  3V5B A;  1SQQ E;  1JNM A;  2K1A A;  1EXJ A;  5KLV J;  1RF0 C;  3AE2 C;  1IO4 A;  4OGQ B;  1NTZ J;  2QE7 H;  1KIL A;  3AEC C;  3CCJ P;  5H2F H;  3AE1 C;  1DD4 A;  1MUU A;  1NOH A;  3L71 G;  4OGQ D;  3QH9 A;  5AVT B;  3RK2 C;  2CPB A;  4ASV A;  5CBO A;  1VDF A;  1YTZ I;  2RMZ A;  3H1K E;  4UB8 E;  2WT7 A;  1PL5 A;  1QL2 A;  1SS1 A;  1LTJ B;  2MKV A;  4JF7 A;  3WUU A;  1KB9 E;  4D6T J;  1JOC A;  1UII A;  4EYY Q;  1S5L H;  1QVF O;  1VQ7 P;  1J1E B;  5B66 H;  1LTB C;  1OMI A;  2M8R A;  4HJG H;  1BDC A;  4U3F G;  1SQP K;  2FYU E;  3H1L E;  1JMB A;  1SQB J;  1KB9 H;  2R5B A;  5CCG C;  2KSJ A;  1L2P A;  1NKN A;  1NU1 D;  2W83 C;  3MP7 B;  5CCH D;  4L75 A;  5AW9 B;  2E75 B;  4NPE A;  2P10 A;  1M7L A;  2H89 C;  2WPS A;  3KPE A;  2V7Q J;  3MUD A;  5AW1 B;  1JB0 J;  1YJ9 P;  2J5U A;  2YXQ B;  1FE6 A;  2R3C A;  4IL6 E;  1L0N K;  1FDO A;  3L73 E;  1KOR A;  1EDL A;  3RBX A;  1NTK E;  1YBK A;  3JC2 2;  3L75 E;  1PP9 J;  1SFC D;  1ZRT E;  4W80 A;  1S2E A;  2E75 C;  1KTM A;  1MFT A; 
#chains in the Genus database with same CATH homology
 2UWJ E;  2OTK E;  2P58 A;  3ZDM A;  3S1K A;  3MZW B;  2B88 A;  2KI7 B;  1LP1 B;  3RGU A;  1JM0 A;  4KJM A;  2LR2 A;  2RKL A;  4MN4 C;  1OVU A;  3FXE A;  2B89 A;  4HB1 A;  3QWO C;  2LXC B;  4HKZ H;  4CPG A;  1LT1 A;  2B87 B;  2K3R A;  5EFW B;  5K5G B;  5DJT B;  2Q1K A;  4NPF X;  4GOF A;  2QVA A;  1ZW0 A;  1U7M A;  2KIK A;  1X0T A;  4ASW A;  1EDK A;  1H0T B;  4WWI A;  2HR3 A;  1LP1 A;  4GOE A;  1NVO A;  4K3A A;  4ZMD A;  2WMM A;  4BXL A;  1OVV A;  2SPZ A;  5C39 A;  1H0T A;  4GOD A;  2KZI A;  5CBN A;  1FC2 C;  2M5A A;  4JBZ A;  2KS1 B;  1EDJ A;  1U7J A;  4NPD A;  2R44 A;  2ZAE B;  4IOI H;  2B87 A;  2LXB A;  3PH0 A;  2I8D A;  2JWD A;  1BDD A;  4ASV A;  2QRX A;  1S3J A;  5CBO A;  1SS1 A;  4EYY Q;  1EC5 A;  4K35 A;  4HJG H;  1BDC A;  3MHV A;  1JMB A;  2M5A B;  4NPE A;  1DEE G;  1Y47 A;  3FXD A;  5DJU B;  1EDI A;  1ZXG A;  1OVR A;  2M0B A;  1Q2N A;  1EDL A;  2KUB A;  4ZNC A;  2KZJ A;  1MFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...