4NPDA

High-resolution structure of c domain of staphylococcal protein a at cryogenic temperature
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
58
structure length
58
Chain Sequence
ADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
total genus 23
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npdA00
2LR2A 4JBZA 1NVOA 2I8DA 2KZJA 3MZWB 2QVAA 3FXEA 4BXLA 5DJTB 4NPDA 1OVUA 4ASWA 4WWIA 3FXDA 2B87A 5EFWB 2KZIA 4ZMDA 1JM0A 5CBNA 3RGUA 1FC2C 1BDDA 4HJGH 1EDLA 4K3AA 4MN4C 1EC5A 2KS1B 4IOIH 2KI7B 2B88A 1LT1A 2QRXA 1OVVA 2M0BA 1U7MA 1EDIA 4NPFX 2B89A 2JWDA 2Q1KA 1OVRA 4HB1A 1LP1A 4ZNCA 5CBOA 1SS1A 1BDCA 2KUBA 3S1KA 1ZXGA 2R44A 2M5AA 3QWOC 1EDJA 2K3RA 4NPEA 2P58A 4CPGA 1ZW0A 4K35A 4GOEA 1Y47A 4GOFA 4ASVA 1DEEG 1EDKA 1U7JA 1MFTA 1H0TB 5K5GB 2HR3A 2M5AB 2UWJE 3MHVA 2LXBA 2KIKA 3ZDMA 3PH0A 2LXCB 1Q2NA 1JMBA 2B87B 2SPZA 4HKZH 2WMMA 2ZAEB 2OTKE 1H0TA 1S3JA 1X0TA 5DJUB 2RKLA 4GODA 4KJMA 4EYYQ 1LP1B 5C39A
chains in the Genus database with same CATH superfamily
1SQBE 2YXQB 1W2EA 2YXRB 3E1RA 4PD4H 4ZKUA 1JB0J 2KZJA 2L91A 5KLIC 3MZWB 2KXPB 3TK1A 2OYHB 3V2RA 1SQPD 1KORA 1TU3F 1G1JA 4H44D 3VMZA 1SQQJ 4XA4A 3CCVP 3KZIH 5DJTB 1GMJA 1YBKA 2ZYGA 1USEA 3CWBG 4H13B 4NPDA 4YXDC 3SWFA 1OVUA 2E5YA 2WQYC 4ASWA 3FXDA 1J1EB 4BWNA 2NPSB 2JDIH 2WTYA 1RF0C 1RQUA 1KFNA 2WSFJ 2Y0EA 2OTJP 3IR9A 3SSUA 2O1KA 1N7SB 4WY4B 1MZ9A 4Y99C 1H89A 3GHGA 3H1HJ 1FJKA 1S4XA 1P84H 1OW6A 1JCCA 1SQQD 1FDOA 1GL2B 3USSA 2WPQA 3N4XA 1GW3A 2G8YA 2E74C 2QJKB 3HUSC 4U3FD 2D2CD 1LT9C 4HJGH 3B5NB 4D6TJ 1YITP 3EWKA 5GTHH 3VP8A 4GT1A 2BEQD 2GUSA 1LJ2A 3HRNA 3HTKA 4Y99B 1AVOA 1EC5A 1NTKJ 2QJPB 4WY4C 1SQBK 1SQXG 3AE8C 2B88A 1G2CA 1VQKP 4XE5B 5B66H 2H88C 3IF4A 3CC2P 2KP8A 1EZVG 1NHLA 3H1KJ 4OH8B 1JY3O 4I7ZC 3MIWA 2E76C 1T2KC 1N7SA 2QIWA 1M7LA 2ITAA 1Y8AA 1ZOYC 1FZCC 2OYHC 2B89A 3IAOA 3L70D 1MKMA 1OVRA 1SQVE 3VMYA 4HB1A 2XU6A 3SWYA 2FFDC 1AQ5A 1VQ5P 3MD0A 3F89A 3L73G 1N2DC 4ZNCA 1KV4A 3P7KA 5KJ7A 2E42A 3FX0A 1FZFA 3L74J 1RHZB 5BU8B 4BRYB 1KYOH 1BCCG 1JTHB 4L74A 1CI6A 5KKZB 3S1KA 1VQPP 1N8RQ 1ZXGA 2H7HA 1XTGB 2XZRA 3WMM0 2JP3A 1NTMG 1L2PA 2WPVB 3A0BH 4TT3H 3L70G 1LNQA 2QE7H 2YO3A 5AVWB 5M1BA 4UB8H 1KQFB 1NU1D 4OGQC 3W68A 2A06E 3M9HA 4R4LA 3TGUD 1NGMB 1X9VA 3MUDC 2WSEH 1PPJG 1YYCA 1URQB 1EXIA 1L0LK 2IFNA 1SQPJ 1FZCB 5CCHC 3MP7B 1L0LD 4WBAA 5CJ4A 1PGOA 2E76B 4I7ZB 3RK2D 4ASVA 1DEEG 1P84E 5KLVJ 1BSHA 2KNCB 2NZ2A 3CLQA 3E7KA 4L73A 4PV1B 5TJHA 4PV1D 1M56D 4EDFA 2QM8A 2WZ7A 1NU1K 3RL0D 1JNMA 1JOCA 3BCCG 1ZLLA 2OYHA 3CXHI 2CPSA 2YNYA 3L74D 5CCHD 1BE3D 3L73D 1KB9E 3HE4A 1SFCD 1L0LE 2R3CA 3Q1MA 3HE4B 1W5CE 3HD7D 1FZBA 3KZIE 3L37A 4WY4A 1S1CX 5AVQB 1KQGB 2YO2A 1GU4A 1NJIQ 1RF1C 1LTJB 1M57D 3T97B 2XV5A 1IFNA 2A45I 2A06D 2L5GB 3U59A 4PD4E 3JCUE 1VQ8P 2BCCJ 1L0NG 3V4WA 1KMIZ 3AE6C 1FDMA 3CL3D 3CWBE 1PGJA 1S5LE 3GHGC 1IFIA 3H1JG 3LW5H 5L8RJ 2J58A 2NPSC 3CCMP 3EFFK 3FGAD 1KB9H 5CHXA 1VQNP 1T2KD 5AVZB 1NTKK 1R5SA 1RE3A 1ZMEC 2K9JA 1Q81Q 2N1TD 5TISE 5AW2B 2PRRA 2ZAEB 4H0LC 2NRGA 3D71A 3CMAP 5AVRB 2M8RA 2HLOA 4U3FJ 1NAYA 2W83C 3PRJA 3L74E 4JQ0D 3SWKA 1DD3A 1OWAA 4JYBA 2N1TC 5KAIH 1CW5A 1X22A 1YIJP 4O9BA 1VQ6P 1VF5D 2BCCE 1SQVJ 4JBZA 1K73Q 2I8DA 1LGHB 2ZJSE 2KYVA 3L4FA 5AW5B 2FYUJ 1JUNA 1VQOP 5APSA 1R8EA 2C9NY 1KZUB 3FXEA 1P84I 3RK3B 1H88A 2IBZE 1PP9E 5AVSB 3FWLA 5APYA 1NTMK 3GW6A 3B71A 2B87A 2R5DA 3W67A 4AYCA 5EFWB 2KLVA 4ZKPA 2HYNA 1GK6A 3H1LG 2WITA 1GK4A 2XNDH 5APQA 2QEXP 1PGQA 2M3EA 2YKPA 3HD7B 1RH5B 4H13D 3RGUA 3L75J 3KHUA 3M06A 1EDLA 4W80A 2E74B 3AE7C 4N3YB 2OYIC 3L70E 2N1TA 1SQVK 1KILE 4K3AA 4IFDK 2KS1B 4PJ0E 3G6EP 1G1IA 1NU1G 3AEEC 3CXHD 4WVZA 3TGUG 1SQBD 3KYQA 5APXA 2AXTE 3L75G 5APWA 3HE5B 5B5EE 3Q5RA 2WSFH 5KAIE 2ZXXA 1NOHA 2CPBA 2M0BA 3SFEC 3JC22 1NTZJ 1U7MA 2O01H 3O8ZA 3H1LJ 3ABVC 3TNUB 1T3UA 2NPSA 1BSNA 1EDIA 3PP5A 1YJWP 3BCCE 3VMXA 3P8MC 3BASA 2Y9ZA 3CCQP 3H1KD 1Q82Q 4IL6E 3BATA 4TLFA 1QVGO 1JCDA 1EQ7A 2WSSH 5CBOA 1VQ9P 3H1KE 3CPWO 2WVRA 2XKMA 3C1LA 3WU2E 5GTIH 2FYUG 4DJGA 3CXHH 1BDCA 2YKQA 2FYZA 5KKZC 1DH3A 1G2CB 1YTZI 2PFXA 2R44A 2M5AA 2N9BA 3QWOC 3PTZA 1NTKE 2HPCB 1IFMA 5KLVK 1NTZG 5AVUB 2WT7B 5AVTB 3RBXA 4M3LA 4C7NB 1QGKB 4D6TE 1AV1A 4K35A 3CC4P 1SQPE 5GTIE 2Q3EA 2O01J 2E43A 1KILD 1NU1J 3TGUJ 3D70A 3I5CA 3G4SP 1IFJA 1ZR2A 3BVHA 2BASA 1VQ7P 1QL1A 4RO0A 1JY3N 2R32A 2E75D 2FY8A 3MUDA 1N73C 1EDKA 3B4SA 4AUWA 2E76D 2E74D 5E79E 1USDA 1ZR4A 1PV3A 3H1JJ 3L35A 3AEFC 1RF1B 1EZVD 1LWUB 3MTUE 2V7QH 1L0NJ 2BCCG 2P1JA 3CWBD 3PLNA 1L4AA 2Z5HA 3RL0g 4QMAA 1SQXE 2I1KA 1HF9A 1LT9B 2HR3A 3H32A 1EZVI 3A3YB 3G3ZA 1N73B 1YHQP 1OIPA 2LXBA 3BRTB 1QVFO 1XTCC 1E79H 2JEEA 3B8EB 3C9IA 2Y0CA 4IL6X 2ZYAA 4EOTA 5KTBA 4DOJA 1FZAA 1KYOE 1WT6A 1X8YA 1MV8A 2KSEA 4GDOA 2HFED 2KLUA 1QL2A 1VF5C 3TYYA 1BE3E 2BCCD 2Y0DA 2HODB 2KK7A 1FU1A 3NTNA 3H1LE 2P67A 1IK9A 1SQVG 2A45H 2B87B 2SPZA 2WSEJ 4H13C 3Q2YA 3M0AA 3O6QB 2IZ1A 3H1LD 1AJYA 5AW1B 4LLHA 1IK7A 2JO1A 3CX5H 3AEAC 5CMZA 1ZP0C 5AW9B 4DZOA 1S3JA 3KPEA 3IFMA 3CX5E 4N78E 2A45G 1X0TA 4U3FG 1M1KQ 3S9OA 3G9RA 3RK3E 3H1JD 4GODA 2OYIA 2Y9YA 2FYUK 4KJMA 4B86A 1IO4A 1KN7A 1J1DC 2IFMA 3JSVC 2ZVOB 3A5TA 2N1TB 1SQXK 1LT9A 1NU1E 3H1HE 3H6PA 3VOPA 1SFCC 1M1JC 1JMMA 2A06G 2LR2A 1R5LA 1NVOA 1HGVA 1SQXD 3HUSA 3L75E 1JY2O 3EQ2A 1VQ4P 2R5BA 2QVAA 3OAKA 4R4MA 3L75D 4XFJA 5C39A 1LTAC 1S72P 1KD1Q 1K04A 4UB6E 1Q86Q 2R3SA 3H1HD 2IYOA 1GZLA 3V6IA 2W8ZA 2Q3IA 3O6QA 5CJ0A 1KILA 4LGDE 4WWIA 4RESB 5GTHE 1K8AQ 1NKZB 3RL0C 1VF5B 4JYCA 1SQVD 2JKVA 4IFFA 3LW5J 2KZIA 4N78D 4ZMDA 5TISH 1KB9D 3H1KG 1RE4C 1JM0A 1UIXA 1QX8A 1RQVA 2ZT9D 5CBNA 1E5WA 3L71D 2AEMA 2B9BA 3E1IA 3IN6A 4Y28J 2OYIB 2YIUC 4A7PA 1HVVA 1PPJD 1PZQA 4HYTB 4IFMA 1HJBA 2Z4EA 3L71E 3WUTA 3BCCJ 3CX5I 1GW4A 2IDBA 1RE4A 1SQXJ 3CCSP 2W90A 1YI2P 1NTKG 2QSIA 3U1CA 3D6ZA 1HUCA 2ZT9C 2C0WA 4HH2A 5KLVG 3CCUP 2DW3A 1NTMD 1W2BO 1LWUC 4IOIH 2KI7B 3RK2B 2IX7C 1CI6B 1KYOI 3V2NA 2D2CB 4D6TG 1KILC 1NTZD 1LT1A 1SQPG 1VDFA 2QJYC 2W6JH 5KAFE 3JCUH 3V2PA 1DX7A 2O01N 1AQTA 2G3AA 2V7QJ 3GF3A 5BVZA 1MFZA 3G71P 4EIJA 4WY4D 2H43A 3CCRP 3L70J 2YKOA 1NTMJ 4I2LC 3V2QA 1LTSC 1Z56A 1FE6A 3WU2H 4GIFA 2Q1KA 1BCCJ 4JPZB 3VMAA 1LP1A 3CWBJ 1BGYE 3M9QA 3L74G 2HODA 3P8CD 4C46A 1HBWA 4L75A 1SQQG 5CCGA 1LTIC 2WSCH 1RF1A 3L73J 3LIEA 4OGQD 3M0DA 3CX5D 3M9BA 2E75B 3KQGA 2KUBA 1KTMA 1WRGA 4OWFA 3D6YA 3L72E 2M3BA 3L72J 1K9MQ 1YJNP 5B5EH 2FYNC 2K3RA 1URQD 3A0BE 3Q3DA 3C8VA 1PIXA 1SQBG 1KC8Q 1S2EA 1JY2P 2H89C 2IBZG 2K9YA 1RY3A 4CPGA 1VQMP 1JY2N 2K88A 2H8PD 3P8CE 4PJ0H 3RBZA 4C7NA 5CCHA 3TF5A 1Y47A 1K05A 2AEJA 3GHGB 1HWTC 2KNCA 1M8OB 2QG4A 3AE3C 2GA1A 1WMKA 1A02J 2C9LY 1CZQA 1OZHA 1LTTC 3NXSA 1KQSO 3GMAA 4U3FE 5CCGC 3B5ND 1L0NK 2P10A 1NWQA 2QA4P 1LTJC 1U7JA 3CCEP 1IC2A 2N9YB 3RK2C 1MFTA 1S9KD 1GL2D 1YQ4C 2J59M 1VL2A 2JJLA 2POHA 3H1HG 4UB6H 5K5GB 5H2FH 5AW6B 2C0XA 5APUA 5CCGD 1N73A 2KB7P 2UWJE 3MHVA 3OW2O 2NPSD 4GKGA 3Q5PA 3CC7P 1GL2C 1CSBA 1FZCA 3ZDMA 1N7SC 3OA7A 3GG2A 5KJ7D 3PH0A 1HTLC 3OJAB 1AA0A 2IPPA 2P7JA 4H0LD 2MKVA 3I55P 2O1JA 2OGUA 4I6MC 3RL0B 2RN0A 2W6BA 1JMBA 1NTKD 1ZV8A 5AW4B 2FBWC 5AW7B 1KQLA 1JEKA 1BGYD 1NTZK 1PGPA 2FYNB 1T6AA 4EI2A 4BRYA 2WMMA 4YPCA 3U1AA 2Q6QA 1H0TA 1S9KE 1NYHA 2FYUE 2ZYDA 3L71G 5DJUB 4LC1A 2E75C 2K37A 3ITKA 2Q9IA 1QLED 1HH0A 2FKWB 3LIDA 3EFGA 3HD7A 2HPCA 1KFMA 3H1IJ 4EYYQ 1ZRTD 1M1JA 1SFCA 3R4YA 4PD4D 1PP9D 1FOSF 2QM7A 3PJSK 1BCCE 1LTBC 1NTZE 1N86A 1T8ZA 3B5NA 3BRVB 3KXDA 2FFDA 2XNXA 3BCCD 1Q7YQ 2GM4A 1OFCX 1Q90D 1NTME 3RK3D 3SFDC 1RF0A 4H0LB 1YTZT 3WUVA 2LKMA 4BXLA 1SP4A 1UIIA 1OW8A 1D7MA 3MGNA 2K9JB 1PPJE 3GF7A 2WT7A 3L72D 2QJYB 3KDPB 3CXHE 5E79H 1U57A 5KLVD 1GDTA 1BGYG 1AVYA 3AECC 2J5UA 3K5BA 3R2PA 1OX3A 2KSJA 1DIPA 1SLQA 2OARA 1KYOD 1L4AB 2ZXEB 4W7YA 1SVFA 3H1IE 3CD6P 3B5NC 1FC2C 3II6A 3L36A 1BDDA 1N7LA 1GTWA 2YIUB 1J2JB 2WPRA 4PD4I 1L0LG 3GLMA 1JY3P 2Q5UA 3HD7C 5AW0B 1GU5A 1X79B 1H8AA 1L4AC 1PP9J 2PP6A 2KOGA 4MN4C 1NH4A 3HTKB 1HGZA 1HJ0A 2AXTH 2RH0A 3UIAA 4YXWH 2QRXA 3A7OA 1J1EC 2HG5D 2CK3H 1OVVA 2IBZD 4UB8E 1BE3G 3VN0A 1L0NE 1SQPK 1AFOA 2RMZA 4KHXA 3VTPC 1OW7A 3H1JE 1NO4A 5AW3B 1PFIA 2W27A 3V5BA 4NPFX 3NMDA 2AXCA 3AE4C 3TNUA 4IL6H 2IBZI 4YTPC 2I1JA 2JWDA 1URQC 3AEBC 1S5LX 2OQQA 4L76A 4DT0A 3H25A 2ZFCA 1M1JB 1SFCB 3PHLA 4D6TD 2JR8A 4RJTA 1YJ9P 1GL2A 4OGQB 4H44B 2MJZA 1SS1A 2JWAA 1FS0E 1M90Q 2WPSA 1P84D 3AE5C 2KS1A 2VRSA 2FXPA 3M91A 4JF7A 1GD2E 2V4HA 4U7JA 1T3JA 1JTHA 4OVNF 3TDKA 1FZEA 1FDIA 3AE9C 3I56P 1EDJA 3F5HA 1DD4A 1RE3C 2ZVNB 1L0ND 1LTJA 1OMIA 3S4RA 4NPEA 3T97A 2P58A 2YMKA 5B66E 3HE5A 1VPCA 1BE3J 2AEFA 3L71J 5H2FE 1ZW0A 3Q5SA 1VQLP 1MUUA 1EXJA 4I1LA 4GOEA 4Z1MH 4AQRD 4GOFA 2FYUD 2FXMA 1FAVA 1EZVE 1FJPA 3N7NA 2IYPA 1PP9G 3TSIA 2P2UA 2FXOA 1L0LJ 5AVYB 3H1ID 1KILB 2D2CC 3CCLP 1QEXA 3V4QA 3VP9A 1A02F 1FBMA 3A2AA 1PL5A 2QJPC 3AE2C 2ZT9B 3AEGC 3L73E 1NKNA 5AVVB 1H0TB 2OTLP 5KLVE 4RKUJ 1ZN5A 2YMYA 2WWWA 3H32B 1JO5A 1BGYJ 2OYOA 2W6AA 2WSCJ 3M0DC 2M5AB 3CI9A 1YQ3C 2E5TA 2QJKC 3HUSB 4N6JA 3TGUE 3FWNA 1KB9I 1URQA 3NFQA 4PV1C 5AVXB 4C7RA 2O3JA 1FZGA 2KIKA 3P32A 2FFDB 2BEZF 2GUVA 3CMEP 1LTGC 2LXCB 1Q2NA 1SQQK 1DEBA 4DCKA 1BCCD 2PAJA 1IFPA 3AEDC 5BU5A 5APVA 1ZRTE 4HKZH 3VYIA 2Q7CA 3CCJP 3RK3C 2XDJA 5APTA 3QH9A 1SQQE 4KT0J 1FOSE 3H1IG 3A0HH 3WUUA 1IZNB 1NAFA 2OTKE 2Z5IA 3A0HE 5KLIB 1LWUA 2RKLA 1L4AD 4W7ZA 1N7SD 1SQBJ 2PGDA 4WB4A 5KJ7C 5AW8B 1S5LH 1LP1B 3L72G 1IJDB 1IFDA 1J1DB 1Y9BA 2K1AA 2IZ0A 4H44C 5KAFH 1OXZA 3AE1C
chains in the Genus database with same CATH topology
2LR2A 4JBZA 1NVOA 2I8DA 2KZJA 3MZWB 2QVAA 3FXEA 4BXLA 5DJTB 4NPDA 1OVUA 4ASWA 4WWIA 3FXDA 2B87A 5EFWB 2KZIA 4ZMDA 1JM0A 5CBNA 3RGUA 1FC2C 1BDDA 4HJGH 1EDLA 4K3AA 4MN4C 1EC5A 2KS1B 4IOIH 2KI7B 2B88A 1LT1A 2QRXA 1OVVA 2M0BA 1U7MA 1EDIA 4NPFX 2B89A 2JWDA 2Q1KA 1OVRA 4HB1A 1LP1A 4ZNCA 5CBOA 1SS1A 1BDCA 2KUBA 3S1KA 1ZXGA 2R44A 2M5AA 3QWOC 1EDJA 2K3RA 4NPEA 2P58A 4CPGA 1ZW0A 4K35A 4GOEA 1Y47A 4GOFA 4ASVA 1DEEG 1EDKA 1U7JA 1MFTA 1H0TB 5K5GB 2HR3A 2M5AB 2UWJE 3MHVA 2LXBA 2KIKA 3ZDMA 3PH0A 2LXCB 1Q2NA 1JMBA 2B87B 2SPZA 4HKZH 2WMMA 2ZAEB 2OTKE 1H0TA 1S3JA 1X0TA 5DJUB 2RKLA 4GODA 4KJMA 4EYYQ 1LP1B 5C39A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LR2 A;  4JBZ A;  1NVO A;  2I8D A;  2KZJ A;  3MZW B;  2QVA A;  3FXE A;  4BXL A;  5DJT B;  4NPD A;  1OVU A;  4ASW A;  4WWI A;  3FXD A;  2B87 A;  5EFW B;  2KZI A;  4ZMD A;  1JM0 A;  5CBN A;  3RGU A;  1FC2 C;  1BDD A;  4HJG H;  1EDL A;  4K3A A;  4MN4 C;  1EC5 A;  2KS1 B;  4IOI H;  2KI7 B;  2B88 A;  1LT1 A;  2QRX A;  1OVV A;  2M0B A;  1U7M A;  1EDI A;  4NPF X;  2B89 A;  2JWD A;  2Q1K A;  1OVR A;  4HB1 A;  1LP1 A;  4ZNC A;  5CBO A;  1SS1 A;  1BDC A;  2KUB A;  3S1K A;  1ZXG A;  2R44 A;  2M5A A;  3QWO C;  1EDJ A;  2K3R A;  4NPE A;  2P58 A;  4CPG A;  1ZW0 A;  4K35 A;  4GOE A;  1Y47 A;  4GOF A;  4ASV A;  1DEE G;  1EDK A;  1U7J A;  1MFT A;  1H0T B;  5K5G B;  2HR3 A;  2M5A B;  2UWJ E;  3MHV A;  2LXB A;  2KIK A;  3ZDM A;  3PH0 A;  2LXC B;  1Q2N A;  1JMB A;  2B87 B;  2SPZ A;  4HKZ H;  2WMM A;  2ZAE B;  2OTK E;  1H0T A;  1S3J A;  1X0T A;  5DJU B;  2RKL A;  4GOD A;  4KJM A;  4EYY Q;  1LP1 B;  5C39 A; 
#chains in the Genus database with same CATH topology
 1SQB E;  2YXQ B;  1W2E A;  2YXR B;  3E1R A;  4PD4 H;  4ZKU A;  1JB0 J;  2KZJ A;  2L91 A;  5KLI C;  3MZW B;  2KXP B;  3TK1 A;  2OYH B;  3V2R A;  1SQP D;  1KOR A;  1TU3 F;  1G1J A;  4H44 D;  3VMZ A;  1SQQ J;  4XA4 A;  3CCV P;  3KZI H;  5DJT B;  1GMJ A;  1YBK A;  2ZYG A;  1USE A;  3CWB G;  4H13 B;  4NPD A;  4YXD C;  3SWF A;  1OVU A;  2E5Y A;  2WQY C;  4ASW A;  3FXD A;  1J1E B;  4BWN A;  2NPS B;  2JDI H;  2WTY A;  1RF0 C;  1RQU A;  1KFN A;  2WSF J;  2Y0E A;  2OTJ P;  3IR9 A;  3SSU A;  2O1K A;  1N7S B;  4WY4 B;  1MZ9 A;  4Y99 C;  1H89 A;  3GHG A;  3H1H J;  1FJK A;  1S4X A;  1P84 H;  1OW6 A;  1JCC A;  1SQQ D;  1FDO A;  1GL2 B;  3USS A;  2WPQ A;  3N4X A;  1GW3 A;  2G8Y A;  2E74 C;  2QJK B;  3HUS C;  4U3F D;  2D2C D;  1LT9 C;  4HJG H;  3B5N B;  4D6T J;  1YIT P;  3EWK A;  5GTH H;  3VP8 A;  4GT1 A;  2BEQ D;  2GUS A;  1LJ2 A;  3HRN A;  3HTK A;  4Y99 B;  1AVO A;  1EC5 A;  1NTK J;  2QJP B;  4WY4 C;  1SQB K;  1SQX G;  3AE8 C;  2B88 A;  1G2C A;  1VQK P;  4XE5 B;  5B66 H;  2H88 C;  3IF4 A;  3CC2 P;  2KP8 A;  1EZV G;  1NHL A;  3H1K J;  4OH8 B;  1JY3 O;  4I7Z C;  3MIW A;  2E76 C;  1T2K C;  1N7S A;  2QIW A;  1M7L A;  2ITA A;  1Y8A A;  1ZOY C;  1FZC C;  2OYH C;  2B89 A;  3IAO A;  3L70 D;  1MKM A;  1OVR A;  1SQV E;  3VMY A;  4HB1 A;  2XU6 A;  3SWY A;  2FFD C;  1AQ5 A;  1VQ5 P;  3MD0 A;  3F89 A;  3L73 G;  1N2D C;  4ZNC A;  1KV4 A;  3P7K A;  5KJ7 A;  2E42 A;  3FX0 A;  1FZF A;  3L74 J;  1RHZ B;  5BU8 B;  4BRY B;  1KYO H;  1BCC G;  1JTH B;  4L74 A;  1CI6 A;  5KKZ B;  3S1K A;  1VQP P;  1N8R Q;  1ZXG A;  2H7H A;  1XTG B;  2XZR A;  3WMM 0;  2JP3 A;  1NTM G;  1L2P A;  2WPV B;  3A0B H;  4TT3 H;  3L70 G;  1LNQ A;  2QE7 H;  2YO3 A;  5AVW B;  5M1B A;  4UB8 H;  1KQF B;  1NU1 D;  4OGQ C;  3W68 A;  2A06 E;  3M9H A;  4R4L A;  3TGU D;  1NGM B;  1X9V A;  3MUD C;  2WSE H;  1PPJ G;  1YYC A;  1URQ B;  1EXI A;  1L0L K;  2IFN A;  1SQP J;  1FZC B;  5CCH C;  3MP7 B;  1L0L D;  4WBA A;  5CJ4 A;  1PGO A;  2E76 B;  4I7Z B;  3RK2 D;  4ASV A;  1DEE G;  1P84 E;  5KLV J;  1BSH A;  2KNC B;  2NZ2 A;  3CLQ A;  3E7K A;  4L73 A;  4PV1 B;  5TJH A;  4PV1 D;  1M56 D;  4EDF A;  2QM8 A;  2WZ7 A;  1NU1 K;  3RL0 D;  1JNM A;  1JOC A;  3BCC G;  1ZLL A;  2OYH A;  3CXH I;  2CPS A;  2YNY A;  3L74 D;  5CCH D;  1BE3 D;  3L73 D;  1KB9 E;  3HE4 A;  1SFC D;  1L0L E;  2R3C A;  3Q1M A;  3HE4 B;  1W5C E;  3HD7 D;  1FZB A;  3KZI E;  3L37 A;  4WY4 A;  1S1C X;  5AVQ B;  1KQG B;  2YO2 A;  1GU4 A;  1NJI Q;  1RF1 C;  1LTJ B;  1M57 D;  3T97 B;  2XV5 A;  1IFN A;  2A45 I;  2A06 D;  2L5G B;  3U59 A;  4PD4 E;  3JCU E;  1VQ8 P;  2BCC J;  1L0N G;  3V4W A;  1KMI Z;  3AE6 C;  1FDM A;  3CL3 D;  3CWB E;  1PGJ A;  1S5L E;  3GHG C;  1IFI A;  3H1J G;  3LW5 H;  5L8R J;  2J58 A;  2NPS C;  3CCM P;  3EFF K;  3FGA D;  1KB9 H;  5CHX A;  1VQN P;  1T2K D;  5AVZ B;  1NTK K;  1R5S A;  1RE3 A;  1ZME C;  2K9J A;  1Q81 Q;  2N1T D;  5TIS E;  5AW2 B;  2PRR A;  2ZAE B;  4H0L C;  2NRG A;  3D71 A;  3CMA P;  5AVR B;  2M8R A;  2HLO A;  4U3F J;  1NAY A;  2W83 C;  3PRJ A;  3L74 E;  4JQ0 D;  3SWK A;  1DD3 A;  1OWA A;  4JYB A;  2N1T C;  5KAI H;  1CW5 A;  1X22 A;  1YIJ P;  4O9B A;  1VQ6 P;  1VF5 D;  2BCC E;  1SQV J;  4JBZ A;  1K73 Q;  2I8D A;  1LGH B;  2ZJS E;  2KYV A;  3L4F A;  5AW5 B;  2FYU J;  1JUN A;  1VQO P;  5APS A;  1R8E A;  2C9N Y;  1KZU B;  3FXE A;  1P84 I;  3RK3 B;  1H88 A;  2IBZ E;  1PP9 E;  5AVS B;  3FWL A;  5APY A;  1NTM K;  3GW6 A;  3B71 A;  2B87 A;  2R5D A;  3W67 A;  4AYC A;  5EFW B;  2KLV A;  4ZKP A;  2HYN A;  1GK6 A;  3H1L G;  2WIT A;  1GK4 A;  2XND H;  5APQ A;  2QEX P;  1PGQ A;  2M3E A;  2YKP A;  3HD7 B;  1RH5 B;  4H13 D;  3RGU A;  3L75 J;  3KHU A;  3M06 A;  1EDL A;  4W80 A;  2E74 B;  3AE7 C;  4N3Y B;  2OYI C;  3L70 E;  2N1T A;  1SQV K;  1KIL E;  4K3A A;  4IFD K;  2KS1 B;  4PJ0 E;  3G6E P;  1G1I A;  1NU1 G;  3AEE C;  3CXH D;  4WVZ A;  3TGU G;  1SQB D;  3KYQ A;  5APX A;  2AXT E;  3L75 G;  5APW A;  3HE5 B;  5B5E E;  3Q5R A;  2WSF H;  5KAI E;  2ZXX A;  1NOH A;  2CPB A;  2M0B A;  3SFE C;  3JC2 2;  1NTZ J;  1U7M A;  2O01 H;  3O8Z A;  3H1L J;  3ABV C;  3TNU B;  1T3U A;  2NPS A;  1BSN A;  1EDI A;  3PP5 A;  1YJW P;  3BCC E;  3VMX A;  3P8M C;  3BAS A;  2Y9Z A;  3CCQ P;  3H1K D;  1Q82 Q;  4IL6 E;  3BAT A;  4TLF A;  1QVG O;  1JCD A;  1EQ7 A;  2WSS H;  5CBO A;  1VQ9 P;  3H1K E;  3CPW O;  2WVR A;  2XKM A;  3C1L A;  3WU2 E;  5GTI H;  2FYU G;  4DJG A;  3CXH H;  1BDC A;  2YKQ A;  2FYZ A;  5KKZ C;  1DH3 A;  1G2C B;  1YTZ I;  2PFX A;  2R44 A;  2M5A A;  2N9B A;  3QWO C;  3PTZ A;  1NTK E;  2HPC B;  1IFM A;  5KLV K;  1NTZ G;  5AVU B;  2WT7 B;  5AVT B;  3RBX A;  4M3L A;  4C7N B;  1QGK B;  4D6T E;  1AV1 A;  4K35 A;  3CC4 P;  1SQP E;  5GTI E;  2Q3E A;  2O01 J;  2E43 A;  1KIL D;  1NU1 J;  3TGU J;  3D70 A;  3I5C A;  3G4S P;  1IFJ A;  1ZR2 A;  3BVH A;  2BAS A;  1VQ7 P;  1QL1 A;  4RO0 A;  1JY3 N;  2R32 A;  2E75 D;  2FY8 A;  3MUD A;  1N73 C;  1EDK A;  3B4S A;  4AUW A;  2E76 D;  2E74 D;  5E79 E;  1USD A;  1ZR4 A;  1PV3 A;  3H1J J;  3L35 A;  3AEF C;  1RF1 B;  1EZV D;  1LWU B;  3MTU E;  2V7Q H;  1L0N J;  2BCC G;  2P1J A;  3CWB D;  3PLN A;  1L4A A;  2Z5H A;  3RL0 g;  4QMA A;  1SQX E;  2I1K A;  1HF9 A;  1LT9 B;  2HR3 A;  3H32 A;  1EZV I;  3A3Y B;  3G3Z A;  1N73 B;  1YHQ P;  1OIP A;  2LXB A;  3BRT B;  1QVF O;  1XTC C;  1E79 H;  2JEE A;  3B8E B;  3C9I A;  2Y0C A;  4IL6 X;  2ZYA A;  4EOT A;  5KTB A;  4DOJ A;  1FZA A;  1KYO E;  1WT6 A;  1X8Y A;  1MV8 A;  2KSE A;  4GDO A;  2HFE D;  2KLU A;  1QL2 A;  1VF5 C;  3TYY A;  1BE3 E;  2BCC D;  2Y0D A;  2HOD B;  2KK7 A;  1FU1 A;  3NTN A;  3H1L E;  2P67 A;  1IK9 A;  1SQV G;  2A45 H;  2B87 B;  2SPZ A;  2WSE J;  4H13 C;  3Q2Y A;  3M0A A;  3O6Q B;  2IZ1 A;  3H1L D;  1AJY A;  5AW1 B;  4LLH A;  1IK7 A;  2JO1 A;  3CX5 H;  3AEA C;  5CMZ A;  1ZP0 C;  5AW9 B;  4DZO A;  1S3J A;  3KPE A;  3IFM A;  3CX5 E;  4N78 E;  2A45 G;  1X0T A;  4U3F G;  1M1K Q;  3S9O A;  3G9R A;  3RK3 E;  3H1J D;  4GOD A;  2OYI A;  2Y9Y A;  2FYU K;  4KJM A;  4B86 A;  1IO4 A;  1KN7 A;  1J1D C;  2IFM A;  3JSV C;  2ZVO B;  3A5T A;  2N1T B;  1SQX K;  1LT9 A;  1NU1 E;  3H1H E;  3H6P A;  3VOP A;  1SFC C;  1M1J C;  1JMM A;  2A06 G;  2LR2 A;  1R5L A;  1NVO A;  1HGV A;  1SQX D;  3HUS A;  3L75 E;  1JY2 O;  3EQ2 A;  1VQ4 P;  2R5B A;  2QVA A;  3OAK A;  4R4M A;  3L75 D;  4XFJ A;  5C39 A;  1LTA C;  1S72 P;  1KD1 Q;  1K04 A;  4UB6 E;  1Q86 Q;  2R3S A;  3H1H D;  2IYO A;  1GZL A;  3V6I A;  2W8Z A;  2Q3I A;  3O6Q A;  5CJ0 A;  1KIL A;  4LGD E;  4WWI A;  4RES B;  5GTH E;  1K8A Q;  1NKZ B;  3RL0 C;  1VF5 B;  4JYC A;  1SQV D;  2JKV A;  4IFF A;  3LW5 J;  2KZI A;  4N78 D;  4ZMD A;  5TIS H;  1KB9 D;  3H1K G;  1RE4 C;  1JM0 A;  1UIX A;  1QX8 A;  1RQV A;  2ZT9 D;  5CBN A;  1E5W A;  3L71 D;  2AEM A;  2B9B A;  3E1I A;  3IN6 A;  4Y28 J;  2OYI B;  2YIU C;  4A7P A;  1HVV A;  1PPJ D;  1PZQ A;  4HYT B;  4IFM A;  1HJB A;  2Z4E A;  3L71 E;  3WUT A;  3BCC J;  3CX5 I;  1GW4 A;  2IDB A;  1RE4 A;  1SQX J;  3CCS P;  2W90 A;  1YI2 P;  1NTK G;  2QSI A;  3U1C A;  3D6Z A;  1HUC A;  2ZT9 C;  2C0W A;  4HH2 A;  5KLV G;  3CCU P;  2DW3 A;  1NTM D;  1W2B O;  1LWU C;  4IOI H;  2KI7 B;  3RK2 B;  2IX7 C;  1CI6 B;  1KYO I;  3V2N A;  2D2C B;  4D6T G;  1KIL C;  1NTZ D;  1LT1 A;  1SQP G;  1VDF A;  2QJY C;  2W6J H;  5KAF E;  3JCU H;  3V2P A;  1DX7 A;  2O01 N;  1AQT A;  2G3A A;  2V7Q J;  3GF3 A;  5BVZ A;  1MFZ A;  3G71 P;  4EIJ A;  4WY4 D;  2H43 A;  3CCR P;  3L70 J;  2YKO A;  1NTM J;  4I2L C;  3V2Q A;  1LTS C;  1Z56 A;  1FE6 A;  3WU2 H;  4GIF A;  2Q1K A;  1BCC J;  4JPZ B;  3VMA A;  1LP1 A;  3CWB J;  1BGY E;  3M9Q A;  3L74 G;  2HOD A;  3P8C D;  4C46 A;  1HBW A;  4L75 A;  1SQQ G;  5CCG A;  1LTI C;  2WSC H;  1RF1 A;  3L73 J;  3LIE A;  4OGQ D;  3M0D A;  3CX5 D;  3M9B A;  2E75 B;  3KQG A;  2KUB A;  1KTM A;  1WRG A;  4OWF A;  3D6Y A;  3L72 E;  2M3B A;  3L72 J;  1K9M Q;  1YJN P;  5B5E H;  2FYN C;  2K3R A;  1URQ D;  3A0B E;  3Q3D A;  3C8V A;  1PIX A;  1SQB G;  1KC8 Q;  1S2E A;  1JY2 P;  2H89 C;  2IBZ G;  2K9Y A;  1RY3 A;  4CPG A;  1VQM P;  1JY2 N;  2K88 A;  2H8P D;  3P8C E;  4PJ0 H;  3RBZ A;  4C7N A;  5CCH A;  3TF5 A;  1Y47 A;  1K05 A;  2AEJ A;  3GHG B;  1HWT C;  2KNC A;  1M8O B;  2QG4 A;  3AE3 C;  2GA1 A;  1WMK A;  1A02 J;  2C9L Y;  1CZQ A;  1OZH A;  1LTT C;  3NXS A;  1KQS O;  3GMA A;  4U3F E;  5CCG C;  3B5N D;  1L0N K;  2P10 A;  1NWQ A;  2QA4 P;  1LTJ C;  1U7J A;  3CCE P;  1IC2 A;  2N9Y B;  3RK2 C;  1MFT A;  1S9K D;  1GL2 D;  1YQ4 C;  2J59 M;  1VL2 A;  2JJL A;  2POH A;  3H1H G;  4UB6 H;  5K5G B;  5H2F H;  5AW6 B;  2C0X A;  5APU A;  5CCG D;  1N73 A;  2KB7 P;  2UWJ E;  3MHV A;  3OW2 O;  2NPS D;  4GKG A;  3Q5P A;  3CC7 P;  1GL2 C;  1CSB A;  1FZC A;  3ZDM A;  1N7S C;  3OA7 A;  3GG2 A;  5KJ7 D;  3PH0 A;  1HTL C;  3OJA B;  1AA0 A;  2IPP A;  2P7J A;  4H0L D;  2MKV A;  3I55 P;  2O1J A;  2OGU A;  4I6M C;  3RL0 B;  2RN0 A;  2W6B A;  1JMB A;  1NTK D;  1ZV8 A;  5AW4 B;  2FBW C;  5AW7 B;  1KQL A;  1JEK A;  1BGY D;  1NTZ K;  1PGP A;  2FYN B;  1T6A A;  4EI2 A;  4BRY A;  2WMM A;  4YPC A;  3U1A A;  2Q6Q A;  1H0T A;  1S9K E;  1NYH A;  2FYU E;  2ZYD A;  3L71 G;  5DJU B;  4LC1 A;  2E75 C;  2K37 A;  3ITK A;  2Q9I A;  1QLE D;  1HH0 A;  2FKW B;  3LID A;  3EFG A;  3HD7 A;  2HPC A;  1KFM A;  3H1I J;  4EYY Q;  1ZRT D;  1M1J A;  1SFC A;  3R4Y A;  4PD4 D;  1PP9 D;  1FOS F;  2QM7 A;  3PJS K;  1BCC E;  1LTB C;  1NTZ E;  1N86 A;  1T8Z A;  3B5N A;  3BRV B;  3KXD A;  2FFD A;  2XNX A;  3BCC D;  1Q7Y Q;  2GM4 A;  1OFC X;  1Q90 D;  1NTM E;  3RK3 D;  3SFD C;  1RF0 A;  4H0L B;  1YTZ T;  3WUV A;  2LKM A;  4BXL A;  1SP4 A;  1UII A;  1OW8 A;  1D7M A;  3MGN A;  2K9J B;  1PPJ E;  3GF7 A;  2WT7 A;  3L72 D;  2QJY B;  3KDP B;  3CXH E;  5E79 H;  1U57 A;  5KLV D;  1GDT A;  1BGY G;  1AVY A;  3AEC C;  2J5U A;  3K5B A;  3R2P A;  1OX3 A;  2KSJ A;  1DIP A;  1SLQ A;  2OAR A;  1KYO D;  1L4A B;  2ZXE B;  4W7Y A;  1SVF A;  3H1I E;  3CD6 P;  3B5N C;  1FC2 C;  3II6 A;  3L36 A;  1BDD A;  1N7L A;  1GTW A;  2YIU B;  1J2J B;  2WPR A;  4PD4 I;  1L0L G;  3GLM A;  1JY3 P;  2Q5U A;  3HD7 C;  5AW0 B;  1GU5 A;  1X79 B;  1H8A A;  1L4A C;  1PP9 J;  2PP6 A;  2KOG A;  4MN4 C;  1NH4 A;  3HTK B;  1HGZ A;  1HJ0 A;  2AXT H;  2RH0 A;  3UIA A;  4YXW H;  2QRX A;  3A7O A;  1J1E C;  2HG5 D;  2CK3 H;  1OVV A;  2IBZ D;  4UB8 E;  1BE3 G;  3VN0 A;  1L0N E;  1SQP K;  1AFO A;  2RMZ A;  4KHX A;  3VTP C;  1OW7 A;  3H1J E;  1NO4 A;  5AW3 B;  1PFI A;  2W27 A;  3V5B A;  4NPF X;  3NMD A;  2AXC A;  3AE4 C;  3TNU A;  4IL6 H;  2IBZ I;  4YTP C;  2I1J A;  2JWD A;  1URQ C;  3AEB C;  1S5L X;  2OQQ A;  4L76 A;  4DT0 A;  3H25 A;  2ZFC A;  1M1J B;  1SFC B;  3PHL A;  4D6T D;  2JR8 A;  4RJT A;  1YJ9 P;  1GL2 A;  4OGQ B;  4H44 B;  2MJZ A;  1SS1 A;  2JWA A;  1FS0 E;  1M90 Q;  2WPS A;  1P84 D;  3AE5 C;  2KS1 A;  2VRS A;  2FXP A;  3M91 A;  4JF7 A;  1GD2 E;  2V4H A;  4U7J A;  1T3J A;  1JTH A;  4OVN F;  3TDK A;  1FZE A;  1FDI A;  3AE9 C;  3I56 P;  1EDJ A;  3F5H A;  1DD4 A;  1RE3 C;  2ZVN B;  1L0N D;  1LTJ A;  1OMI A;  3S4R A;  4NPE A;  3T97 A;  2P58 A;  2YMK A;  5B66 E;  3HE5 A;  1VPC A;  1BE3 J;  2AEF A;  3L71 J;  5H2F E;  1ZW0 A;  3Q5S A;  1VQL P;  1MUU A;  1EXJ A;  4I1L A;  4GOE A;  4Z1M H;  4AQR D;  4GOF A;  2FYU D;  2FXM A;  1FAV A;  1EZV E;  1FJP A;  3N7N A;  2IYP A;  1PP9 G;  3TSI A;  2P2U A;  2FXO A;  1L0L J;  5AVY B;  3H1I D;  1KIL B;  2D2C C;  3CCL P;  1QEX A;  3V4Q A;  3VP9 A;  1A02 F;  1FBM A;  3A2A A;  1PL5 A;  2QJP C;  3AE2 C;  2ZT9 B;  3AEG C;  3L73 E;  1NKN A;  5AVV B;  1H0T B;  2OTL P;  5KLV E;  4RKU J;  1ZN5 A;  2YMY A;  2WWW A;  3H32 B;  1JO5 A;  1BGY J;  2OYO A;  2W6A A;  2WSC J;  3M0D C;  2M5A B;  3CI9 A;  1YQ3 C;  2E5T A;  2QJK C;  3HUS B;  4N6J A;  3TGU E;  3FWN A;  1KB9 I;  1URQ A;  3NFQ A;  4PV1 C;  5AVX B;  4C7R A;  2O3J A;  1FZG A;  2KIK A;  3P32 A;  2FFD B;  2BEZ F;  2GUV A;  3CME P;  1LTG C;  2LXC B;  1Q2N A;  1SQQ K;  1DEB A;  4DCK A;  1BCC D;  2PAJ A;  1IFP A;  3AED C;  5BU5 A;  5APV A;  1ZRT E;  4HKZ H;  3VYI A;  2Q7C A;  3CCJ P;  3RK3 C;  2XDJ A;  5APT A;  3QH9 A;  1SQQ E;  4KT0 J;  1FOS E;  3H1I G;  3A0H H;  3WUU A;  1IZN B;  1NAF A;  2OTK E;  2Z5I A;  3A0H E;  5KLI B;  1LWU A;  2RKL A;  1L4A D;  4W7Z A;  1N7S D;  1SQB J;  2PGD A;  4WB4 A;  5KJ7 C;  5AW8 B;  1S5L H;  1LP1 B;  3L72 G;  1IJD B;  1IFD A;  1J1D B;  1Y9B A;  2K1A A;  2IZ0 A;  4H44 C;  5KAF H;  1OXZ A;  3AE1 C; 
#chains in the Genus database with same CATH homology
 2LR2 A;  4JBZ A;  1NVO A;  2I8D A;  2KZJ A;  3MZW B;  2QVA A;  3FXE A;  4BXL A;  5DJT B;  4NPD A;  1OVU A;  4ASW A;  4WWI A;  3FXD A;  2B87 A;  5EFW B;  2KZI A;  4ZMD A;  1JM0 A;  5CBN A;  3RGU A;  1FC2 C;  1BDD A;  4HJG H;  1EDL A;  4K3A A;  4MN4 C;  1EC5 A;  2KS1 B;  4IOI H;  2KI7 B;  2B88 A;  1LT1 A;  2QRX A;  1OVV A;  2M0B A;  1U7M A;  1EDI A;  4NPF X;  2B89 A;  2JWD A;  2Q1K A;  1OVR A;  4HB1 A;  1LP1 A;  4ZNC A;  5CBO A;  1SS1 A;  1BDC A;  2KUB A;  3S1K A;  1ZXG A;  2R44 A;  2M5A A;  3QWO C;  1EDJ A;  2K3R A;  4NPE A;  2P58 A;  4CPG A;  1ZW0 A;  4K35 A;  4GOE A;  1Y47 A;  4GOF A;  4ASV A;  1DEE G;  1EDK A;  1U7J A;  1MFT A;  1H0T B;  5K5G B;  2HR3 A;  2M5A B;  2UWJ E;  3MHV A;  2LXB A;  2KIK A;  3ZDM A;  3PH0 A;  2LXC B;  1Q2N A;  1JMB A;  2B87 B;  2SPZ A;  4HKZ H;  2WMM A;  2ZAE B;  2OTK E;  1H0T A;  1S3J A;  1X0T A;  5DJU B;  2RKL A;  4GOD A;  4KJM A;  4EYY Q;  1LP1 B;  5C39 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...