4NPDA

High-resolution structure of c domain of staphylococcal protein a at cryogenic temperature
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
58
structure length
58
Chain Sequence
ADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein A
publication title Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 23
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npdA00
2M5AA 4NPEA 5DJTB 3MHVA 1NVOA 3ZDMA 1BDCA 2UWJE 1OVVA 4MN4C 5K5GB 4HJGH 2QRXA 2B87A 5CBNA 2R44A 3RGUA 4K3AA 2JWDA 3MZWB 1U7MA 2OTKE 1DEEG 1EDJA 1FC2C 3FXDA 1X0TA 2RKLA 2LXBA 1LT1A 2ZAEB 4EYYQ 4ASVA 2KZIA 2Q1KA 1EDLA 1EDIA 2HR3A 1OVRA 4HB1A 2SPZA 3S1KA 4IOIH 4HKZH 1H0TB 4CPGA 4GODA 3QWOC 1EC5A 1Q2NA 5CBOA 3PH0A 2KIKA 1ZW0A 2KUBA 2LR2A 1ZXGA 2I8DA 4NPFX 5DJUB 1H0TA 2P58A 4KJMA 5EFWB 1SS1A 2WMMA 1LP1B 2LXCB 1S3JA 2B88A 4ZMDA 2QVAA 1JM0A 4K35A 2M0BA 1MFTA 1OVUA 2B89A 1LP1A 1Y47A 2KS1B 2KZJA 2B87B 4ASWA 1EDKA 4GOFA 4BXLA 4WWIA 4ZNCA 1U7JA 5C39A 1JMBA 2K3RA 1BDDA 2M5AB 4JBZA 4GOEA 3FXEA 2KI7B 4NPDA
chains in the Genus database with same CATH superfamily
1NTZJ 1FS0E 1CI6A 1NVOA 3MHVA 4AQRD 3I55P 1FBMA 1BDCA 1P84D 2KLVA 4W7YA 2E76B 3CL3D 1LTTC 1VQMP 4WBAA 3H25A 2WTYA 2Q6QA 1L4AB 3HE5A 2ZXEB 3GHGA 4N78E 1Y9BA 3AE8C 3MUDA 3H1HE 1KB9E 3AE5C 3B4SA 4OWFA 4M3LA 3W68A 1RE4A 1JO5A 2A45G 1DH3A 3H1LJ 3CMAP 2K37A 1LTGC 2QJPB 3RBXA 1SQPD 1L0LJ 1PFIA 1JY2O 4CPGA 1MV8A 2LR2A 1DIPA 4NPFX 1H0TA 1QVFO 4U3FD 3VMZA 1PGOA 2IX7C 3AE1C 1RE3C 1KYOE 2OGUA 3USSA 3KZIE 3LW5J 3B71A 5AVTB 1K05A 1IK7A 1VQ6P 3AE3C 3HRNA 5CJ0A 5GTIH 2KYVA 1FJKA 5TISH 1NTMK 2BCCG 2HLOA 1FDMA 1VF5B 2N1TB 4GOFA 1LT9C 4BXLA 2KS1A 1JMBA 2O1JA 3LW5H 1CSBA 5KLVD 2QSIA 1SQBD 2IBZG 2YMYA 5AW1B 1KQLA 1S1CX 3JCUE 3E1IA 3ZDMA 2E76D 3KPEA 1HJ0A 1HGZA 5AVVB 5CBNA 2R44A 3RK2B 2H43A 1LWUC 3L73D 2WPVB 3BVHA 5KJ7A 1IK9A 1FJPA 3TDKA 1SQBK 3B8EB 4LGDE 3WU2H 2XNXA 3O6QB 3A2AA 2J59M 2A45H 2AXTE 2FYUE 1WMKA 3HD7C 3L70G 2BCCJ 1BGYE 2KUBA 3L72E 5B5EH 3D6ZA 3KXDA 1QL1A 1LT9B 2A45I 2D2CD 1ZR2A 4C7NB 1BE3D 4YPCA 4WY4B 2IZ1A 3L74D 1VF5D 2L5GB 1PIXA 1K04A 2QG4A 1BCCD 1EXIA 3V2PA 3TGUE 1CW5A 4TT3H 4Y28J 3M91A 1BDDA 4WVZA 3K5BA 1W2EA 4JYBA 1SQPE 3SSUA 3VMAA 5AW5B 1LTJA 1VPCA 5AW8B 3MUDC 1X8YA 3IFMA 2QRXA 3A5TA 3RK2D 2XKMA 4U3FE 1RE4C 1YHQP 3CC4P 1NTMG 2IBZI 4OH8B 1XTGB 3L70J 1PGJA 1X22A 3FXDA 3F89A 1NTKG 1YJNP 1EDLA 2WQYC 1USEA 1E79H 1VQ4P 3H32A 4D6TD 4I1LA 5KLVE 1JY3P 4R4LA 1SQBE 2MJZA 1RY3A 2ZVNB 2QJKB 2H8PD 1PP9D 1PPJG 3G6EP 1N2DC 1ZOYC 5CCGA 2E5YA 1N7SA 1L0NG 3CCJP 5AW4B 4IFFA 3O8ZA 1HTLC 1FZCA 1QX8A 1QVGO 3H1KD 3B5NA 2VRSA 3L73E 3TSIA 3BCCG 1SQXD 1W5CE 1U7JA 1NTZD 1GW3A 3FXEA 1NTMJ 4UB8E 3H1IE 3C9IA 1FOSE 4GDOA 1VQ9P 3GG2A 1AA0A 1NTKJ 2WVRA 1VQ5P 3VN0A 1URQA 1YJ9P 1IFDA 2OTKE 1BE3E 3HD7D 3H1LD 1KD1Q 2ZVOB 1T6AA 2OARA 1KZUB 1YIJP 3A0HH 5E79E 1L0LD 2ZFCA 3HE4A 2ZT9C 1BCCE 1HJBA 1EZVD 5H2FE 3V5BA 4I7ZB 1L0NJ 3PH0A 4OVNF 4L75A 2XU6A 1USDA 1N73C 2OYIA 2AEMA 3BCCJ 2P58A 4EIJA 3RL0C 4OGQC 3CXHH 1H88A 1M56D 1RF0A 2K9JB 1KQSO 1EDKA 1LTJC 2AEFA 3FX0A 3AEBC 3CXHI 2M5AB 3C8VA 1GU5A 4GOEA 3L75D 1N86A 1W2BO 1FZFA 4Y99C 1G2CB 1SQQD 4D6TE 1Q86Q 1M1JA 1KTMA 1MUUA 1IFIA 1K73Q 1X79B 3TYYA 1IO4A 1PP9E 2P7JA 2E75B 3ITKA 1EDJA 1ZR4A 2W90A 4ZKUA 1AVOA 1RQVA 3AEAC 3KDPB 2IYOA 3S9OA 2ZXXA 3H1JG 3H1KE 2KZIA 2PFXA 1N73B 1SQQK 1SQXE 1KORA 3RL0B 3WUVA 2L91A 1NU1K 1JCCA 1EC5A 3L71G 1N7SC 1VQPP 3Q5PA 1FZCC 2FFDA 3VOPA 2GM4A 1M90Q 2YMKA 3SWYA 3B5NC 1K9MQ 2G3AA 3TF5A 1LTJB 2HPCA 3P8CD 1VQLP 3BRVB 1OVUA 1MZ9A 2IFMA 1IZNB 4BRYB 2XZRA 4ASWA 1JTHB 2WSSH 1SQVD 4RO0A 4Y99B 4H44C 3RBZA 5KAFH 3II6A 4AUWA 1S5LX 4KHXA 3RL0g 1IFPA 1NO4A 4JPZB 3U1AA 1VQ8P 1S5LE 4PV1C 1EZVE 1URQC 2XV5A 1R8EA 2FXPA 3QH9A 5KLIC 5KAIH 2KSEA 3H1JJ 1OW6A 3CX5D 2ZT9D 2A06G 2N9YB 1SQVK 2E75D 2H89C 2YIUB 3AE2C 1AJYA 3M0DA 1QGKB 2FYZA 3L71J 1G1IA 3CLQA 1PZQA 3TNUA 1N7SB 1OX3A 3AEFC 3RL0D 4OGQD 3UIAA 2OYIC 5AVXB 3F5HA 1M57D 2FYUK 2GUVA 2XNDH 1NH4A 4W80A 3GW6A 3L75E 1YJWP 3CC2P 1H89A 1RF0C 1YI2P 1SQQE 4H44B 1NOHA 1J1DC 1LP1B 4ZMDA 1NU1E 2NPSA 3H1HG 3G3ZA 1MFZA 5KKZC 3VMXA 1D7MA 4JQ0D 1URQB 1NYHA 4PV1B 1YQ4C 2NZ2A 5KLIB 1IFJA 3IR9A 1LJ2A 2PRRA 3VYIA 3G4SP 2YKOA 2D2CB 1FZBA 1DD4A 1SQPK 2O01J 2V4HA 2RH0A 3CCSP 3OAKA 3FWNA 2C0WA 1FZAA 3GMAA 2Q7CA 2OYHC 1A02F 2HODB 2R3CA 4HH2A 4H0LC 1N7LA 1Y8AA 5AVSB 4ZKPA 3P8CE 1BSNA 1JOCA 2O01H 1N7SD 5APVA 3WUUA 2G8YA 2Z5IA 1GK6A 1VL2A 1EDIA 3B5ND 4PJ0E 3T97A 1SQVE 3MD0A 2JJLA 3AEDC 1LNQA 1J1DB 2FFDC 4HKZH 1UIIA 2H88C 3H1HJ 1M8OB 5KLVK 5KKZB 1Q81Q 4H44D 3NTNA 5TJHA 5B66E 2FXMA 1QLED 3G71P 3IF4A 1S72P 2KNCB 3CX5E 4PV1D 1URQD 1KB9H 3CWBD 2PGDA 1S9KD 3R4YA 4UB6E 1GW4A 5C39A 1P84E 3A7OA 2OYHB 2N9BA 2OYOA 3HTKA 4RESB 2FYUG 1VQNP 5AW9B 1Z56A 1KILA 2R5BA 1X9VA 1KB9I 4NPEA 1BGYG 1FOSF 3L72G 4IL6X 1OVVA 1GU4A 3M0DC 2KB7P 4IL6E 1PGQA 3L37A 2M3EA 1R5SA 1HH0A 1KYOH 1T2KC 2WT7B 3KZIH 4GIFA 1LWUB 3GHGC 2HPCB 3TGUG 2Q1KA 2ZJSE 2DW3A 3A3YB 2IDBA 3S1KA 1KYOI 1SLQA 4PD4D 1PL5A 1SQPG 3JCUH 3HD7B 1ZXGA 2NPSC 4KJMA 1RF1A 1SS1A 2JDIH 1SFCA 2Q9IA 4RKUJ 4WB4A 4U3FG 1KMIZ 1GK4A 3R2PA 2FYUJ 2GA1A 2Y0EA 2PAJA 1BGYJ 3V2QA 3L72J 3LIDA 1DD3A 3HUSA 4WWIA 1IJDB 2AXTH 3KQGA 4JBZA 1CI6B 4C7RA 1LTBC 4H0LD 2CPSA 1PGPA 2KI7B 3KHUA 5KLVG 4DT0A 3M9HA 3Q2YA 1J2JB 1SQBG 5CHXA 2UWJE 3D70A 3HE5B 5CMZA 5K5GB 3TGUJ 3GHGB 1OIPA 2B87A 3RGUA 3JC22 3EQ2A 4YXWH 2JWDA 2I1JA 3N7NA 3CCMP 1KQFB 4H13C 3SFEC 1GZLA 1SQPJ 1L4AA 2Y0CA 5AW3B 1JNMA 2V7QJ 3L73G 2P67A 2W6JH 3CWBE 2Q5UA 4HB1A 5KJ7C 1R5LA 1WRGA 1YTZT 1P84I 1A02J 1AVYA 2O01N 1S9KE 1SQXK 4U3FJ 3CCLP 1ZV8A 1H0TB 1RQUA 1YQ3C 3KYQA 3QWOC 1NTZK 3H1IG 3P7KA 3CMEP 2CPBA 2V7QH 2C0XA 1T3JA 2R3SA 1GDTA 1LTIC 3L74E 3AECC 4EDFA 2J5UA 4K35A 3PP5A 3RK3C 2ZYGA 1BE3G 2KS1B 1FU1A 5KLVJ 2POHA 1SQBJ 3BATA 1KILC 4HYTB 2ITAA 5AW0B 3V6IA 2N1TA 1BCCG 1T2KD 2QM7A 1L0LK 2HYNA 2QJYC 1HWTC 5DJTB 4PD4E 5AW6B 4H13B 1GD2E 3NXSA 3L73J 1UIXA 2Y0DA 5GTHE 2C9NY 2JEEA 5AVRB 1DEBA 2FYNC 2Z5HA 3EFFK 2FXOA 2WSEJ 2YKQA 2WPQA 4YXDC 3EFGA 2RKLA 3P8MC 2E74C 3BRTB 3M9QA 3V4WA 3H1IJ 2NPSD 1NJIQ 2OQQA 4N78D 3FWLA 3IN6A 1JY2P 3A0BE 4YTPC 1RF1C 3V2RA 2ZT9B 2WSEH 1SFCC 2ZYAA 2AXCA 1NKNA 1BE3J 1RE3A 2XDJA 3RK3B 3TK1A 4D6TG 1ZW0A 4UB8H 1IFMA 2JWAA 4AYCA 1NAYA 4GKGA 5AVYB 3VP9A 2M3BA 1NAFA 1S3JA 5APSA 1M1KQ 1SP4A 1BCCJ 2BCCD 3U59A 4OGQB 1PP9G 3HUSC 3OA7A 2B89A 2K88A 1NTZE 4C7NA 4RJTA 2QJYB 4WY4A 3D71A 5CCGC 1CZQA 1QEXA 5CJ4A 5E79H 3H1KG 2IBZD 1SQXG 2K3RA 3VMYA 1FDOA 5H2FH 2FYNB 2BEQD 2GUSA 4H13D 3NMDA 4U7JA 2E76C 1NHLA 2Z4EA 4DJGA 3JSVC 4C46A 3H1LE 1L4AC 5KJ7D 1JEKA 1L0LE 2I1KA 1FE6A 3Q5RA 1ZLLA 3M9BA 5AW2B 5GTIE 5TISE 1SFCB 2W83C 1X0TA 1AFOA 4D6TJ 4EYYQ 3H32B 1OVRA 1M7LA 2QA4P 3L70D 1PP9J 1YBKA 1OMIA 3RK3D 3HUSB 1EZVG 2IFNA 1GMJA 1EQ7A 1MKMA 3Q1MA 2HG5D 2Q3IA 1T3UA 1KILD 3H1KJ 1FZCB 5APUA 1Q7YQ 1EXJA 1SQXJ 1JM0A 3L4FA 1E5WA 3B5NB 2P1JA 2N1TC 1OFCX 2B87B 3WU2E 4I6MC 2Y9YA 2KK7A 1KN7A 2PP6A 3AEGC 2OTLP 2QEXP 2MKVA 3TGUD 1H8AA 3ABVC 2O1KA 5B5EE 2E74D 3L75G 1S2EA 4L74A 3RK2C 1VQKP 1SQQG 1Q82Q 1NTMD 2JO1A 2YNYA 4B86A 1NU1G 3E7KA 4DOJA 1M1JC 1YTZI 1PV3A 1SFCD 2BCCE 2IZ0A 1NTKD 4KT0J 2Q3EA 3Q3DA 3HE4B 1LT1A 2ZAEB 3V2NA 3CCEP 3EWKA 1G1JA 3AE9C 2SPZA 4EI2A 2E42A 4DCKA 2IBZE 3CPWO 2R32A 2OYIB 1ZRTD 3M0AA 4GODA 5AVZB 1S5LH 2B9BA 5CCGD 3GF7A 3CXHD 3C1LA 1PPJD 1NGMB 1VDFA 4XE5B 1OXZA 5M1BA 2Y9ZA 1NTKK 2W27A 4WY4C 1L0ND 3CCQP 4N6JA 1YITP 4L76A 3AE6C 3BCCD 1VQOP 2WPRA 5APWA 3VP8A 4IFMA 5L8RJ 1EZVI 4IFDK 3L75J 2YKPA 1GL2A 1L4AD 2K9JA 3AE4C 1SQQJ 1SQVG 2K9YA 2IPPA 3Q5SA 5BU5A 2JP3A 2YO2A 2ZYDA 1NU1J 1L0NK 2FBWC 3L70E 1M1JB 5APTA 3CC7P 2M5AA 1OWAA 3RK3E 3PHLA 3W67A 4JF7A 1G2CA 2RN0A 3M06A 3VTPC 1IC2A 3CCUP 1KILE 2BASA 3H1ID 5APYA 3GLMA 1DX7A 4H0LB 5CCHA 1FC2C 2LXBA 3I5CA 2W6BA 3PJSK 1VQ7P 4I2LC 4A7PA 4XFJA 1N73A 2CK3H 1L2PA 2N1TD 2FFDB 1ZP0C 2WZ7A 1LGHB 1Q2NA 5CBOA 2YXQB 2JR8A 2QJKC 3CI9A 3WMM0 2LXCB 1KFNA 1SQVJ 4O9BA 1IFNA 2M0BA 1NTME 2KOGA 5AW7B 1LTSC 3A0HE 4LLHA 4BRYA 1NTKE 5KTBA 3MTUE 1HGVA 4TLFA 1JTHA 4PJ0H 1OW8A 1RH5B 3V4QA 4NPDA 3P32A 1FZEA 1S4XA 1ZRTE 5APQA 2P2UA 2E43A 3CXHE 5B66H 1PPJE 2QE7H 1N8RQ 3N4XA 1L0NE 3BASA 3GF3A 1HBWA 1KV4A 2P10A 2QIWA 3TNUB 3CX5H 3H1JD 1ZMEC 3BCCE 3MP7B 5AVQB 2OTJP 2WSFJ 4WY4D 1FAVA 5APXA 4UB6H 4I7ZC 1AQ5A 1P84H 3IAOA 3L35A 3L71D 1LTAC 2FY8A 3CX5I 2WSCJ 1HF9A 3H6PA 2FKWB 2BEZF 1JB0J 2WSFH 3PRJA 2WMMA 2NPSB 4IL6H 2QVAA 2K1AA 3CD6P 1GL2C 1LP1A 1Y47A 2KZJA 2H7HA 3SWKA 2WSCH 3NFQA 3CWBG 2IYPA 2WITA 1KC8Q 1TU3F 1GTWA 2YXRB 1BSHA 2RMZA 4XA4A 1ZN5A 2AEJA 1U57A 2A06D 3L74G 3LIEA 4HJGH 5CCHC 3I56P 1JY3N 2E75C 3S4RA 1OW7A 1AQTA 4K3AA 2KP8A 3MZWB 3FGAD 3MGNA 1J1EC 1Q90D 2HODA 3T97B 4BWNA 5KAFE 2M8RA 2HR3A 2C9LY 2W6AA 4IOIH 2LKMA 4GT1A 1FZGA 1GL2B 2R5DA 5KAIE 2I8DA 5DJUB 1WT6A 5AVWB 3CWBJ 1K8AQ 3H1HD 1KB9D 2B88A 1JMMA 1FDIA 1T8ZA 1HUCA 3O6QA 3OJAB 5BVZA 2HFED 2KNCA 1AV1A 3H1JE 4EOTA 1JY3O 3HTKB 1NU1D 3U1CA 3L74J 1NKZB 4QMAA 1KILB 1KQGB 1LT9A 4JYCA 2OYHA 1YYCA 3L71E 4W7ZA 4DZOA 1KYOD 1J1EB 3MIWA 4MN4C 3SFDC 3PLNA 2YIUC 3SWFA 2WWWA 1U7MA 2KSJA 3PTZA 1DEEG 3L36A 1NTZG 2WT7A 3AE7C 2E5TA 1RHZB 2KLUA 4N3YB 3AEEC 3D6YA 1XTCC 4ASVA 2E74B 1LWUA 3E1RA 2QM8A 2O3JA 1QL2A 1GL2D 2KXPB 2JKVA 3G9RA 1RF1B 4R4MA 1HVVA 2YO3A 3OW2O 2KIKA 5BU8B 4L73A 4PD4H 2WPSA 2NRGA 2QJPC 5EFWB 1OZHA 3H1LG 5AVUB 5GTHH 3HD7A 2A06E 1JCDA 1L0LG 1MFTA 2J58A 1JUNA 1KFMA 1JY2N 4LC1A 4PD4I 4Z1MH 1SVFA 1NWQA 2FYUD 4ZNCA 5CCHD 2D2CC 3CCVP 2W8ZA 3A0BH 1BGYD 3L72D 3CCRP 1VF5C 3WUTA
chains in the Genus database with same CATH topology
2M5AA 4NPEA 5DJTB 3MHVA 1NVOA 3ZDMA 1BDCA 2UWJE 1OVVA 4MN4C 5K5GB 4HJGH 2QRXA 2B87A 5CBNA 2R44A 3RGUA 4K3AA 2JWDA 3MZWB 1U7MA 2OTKE 1DEEG 1EDJA 1FC2C 3FXDA 1X0TA 2RKLA 2LXBA 1LT1A 2ZAEB 4EYYQ 4ASVA 2KZIA 2Q1KA 1EDLA 1EDIA 2HR3A 1OVRA 4HB1A 2SPZA 3S1KA 4IOIH 4HKZH 1H0TB 4CPGA 4GODA 3QWOC 1EC5A 1Q2NA 5CBOA 3PH0A 2KIKA 1ZW0A 2KUBA 2LR2A 1ZXGA 2I8DA 4NPFX 5DJUB 1H0TA 2P58A 4KJMA 5EFWB 1SS1A 2WMMA 1LP1B 2LXCB 1S3JA 2B88A 4ZMDA 2QVAA 1JM0A 4K35A 2M0BA 1MFTA 1OVUA 2B89A 1LP1A 1Y47A 2KS1B 2KZJA 2B87B 4ASWA 1EDKA 4GOFA 4BXLA 4WWIA 4ZNCA 1U7JA 5C39A 1JMBA 2K3RA 1BDDA 2M5AB 4JBZA 4GOEA 3FXEA 2KI7B 4NPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5A A;  4NPE A;  5DJT B;  3MHV A;  1NVO A;  3ZDM A;  1BDC A;  2UWJ E;  1OVV A;  4MN4 C;  5K5G B;  4HJG H;  2QRX A;  2B87 A;  5CBN A;  2R44 A;  3RGU A;  4K3A A;  2JWD A;  3MZW B;  1U7M A;  2OTK E;  1DEE G;  1EDJ A;  1FC2 C;  3FXD A;  1X0T A;  2RKL A;  2LXB A;  1LT1 A;  2ZAE B;  4EYY Q;  4ASV A;  2KZI A;  2Q1K A;  1EDL A;  1EDI A;  2HR3 A;  1OVR A;  4HB1 A;  2SPZ A;  3S1K A;  4IOI H;  4HKZ H;  1H0T B;  4CPG A;  4GOD A;  3QWO C;  1EC5 A;  1Q2N A;  5CBO A;  3PH0 A;  2KIK A;  1ZW0 A;  2KUB A;  2LR2 A;  1ZXG A;  2I8D A;  4NPF X;  5DJU B;  1H0T A;  2P58 A;  4KJM A;  5EFW B;  1SS1 A;  2WMM A;  1LP1 B;  2LXC B;  1S3J A;  2B88 A;  4ZMD A;  2QVA A;  1JM0 A;  4K35 A;  2M0B A;  1MFT A;  1OVU A;  2B89 A;  1LP1 A;  1Y47 A;  2KS1 B;  2KZJ A;  2B87 B;  4ASW A;  1EDK A;  4GOF A;  4BXL A;  4WWI A;  4ZNC A;  1U7J A;  5C39 A;  1JMB A;  2K3R A;  1BDD A;  2M5A B;  4JBZ A;  4GOE A;  3FXE A;  2KI7 B;  4NPD A; 
#chains in the Genus database with same CATH topology
 1NTZ J;  1FS0 E;  1CI6 A;  1NVO A;  3MHV A;  4AQR D;  3I55 P;  1FBM A;  1BDC A;  1P84 D;  2KLV A;  4W7Y A;  2E76 B;  3CL3 D;  1LTT C;  1VQM P;  4WBA A;  3H25 A;  2WTY A;  2Q6Q A;  1L4A B;  3HE5 A;  2ZXE B;  3GHG A;  4N78 E;  1Y9B A;  3AE8 C;  3MUD A;  3H1H E;  1KB9 E;  3AE5 C;  3B4S A;  4OWF A;  4M3L A;  3W68 A;  1RE4 A;  1JO5 A;  2A45 G;  1DH3 A;  3H1L J;  3CMA P;  2K37 A;  1LTG C;  2QJP B;  3RBX A;  1SQP D;  1L0L J;  1PFI A;  1JY2 O;  4CPG A;  1MV8 A;  2LR2 A;  1DIP A;  4NPF X;  1H0T A;  1QVF O;  4U3F D;  3VMZ A;  1PGO A;  2IX7 C;  3AE1 C;  1RE3 C;  1KYO E;  2OGU A;  3USS A;  3KZI E;  3LW5 J;  3B71 A;  5AVT B;  1K05 A;  1IK7 A;  1VQ6 P;  3AE3 C;  3HRN A;  5CJ0 A;  5GTI H;  2KYV A;  1FJK A;  5TIS H;  1NTM K;  2BCC G;  2HLO A;  1FDM A;  1VF5 B;  2N1T B;  4GOF A;  1LT9 C;  4BXL A;  2KS1 A;  1JMB A;  2O1J A;  3LW5 H;  1CSB A;  5KLV D;  2QSI A;  1SQB D;  2IBZ G;  2YMY A;  5AW1 B;  1KQL A;  1S1C X;  3JCU E;  3E1I A;  3ZDM A;  2E76 D;  3KPE A;  1HJ0 A;  1HGZ A;  5AVV B;  5CBN A;  2R44 A;  3RK2 B;  2H43 A;  1LWU C;  3L73 D;  2WPV B;  3BVH A;  5KJ7 A;  1IK9 A;  1FJP A;  3TDK A;  1SQB K;  3B8E B;  4LGD E;  3WU2 H;  2XNX A;  3O6Q B;  3A2A A;  2J59 M;  2A45 H;  2AXT E;  2FYU E;  1WMK A;  3HD7 C;  3L70 G;  2BCC J;  1BGY E;  2KUB A;  3L72 E;  5B5E H;  3D6Z A;  3KXD A;  1QL1 A;  1LT9 B;  2A45 I;  2D2C D;  1ZR2 A;  4C7N B;  1BE3 D;  4YPC A;  4WY4 B;  2IZ1 A;  3L74 D;  1VF5 D;  2L5G B;  1PIX A;  1K04 A;  2QG4 A;  1BCC D;  1EXI A;  3V2P A;  3TGU E;  1CW5 A;  4TT3 H;  4Y28 J;  3M91 A;  1BDD A;  4WVZ A;  3K5B A;  1W2E A;  4JYB A;  1SQP E;  3SSU A;  3VMA A;  5AW5 B;  1LTJ A;  1VPC A;  5AW8 B;  3MUD C;  1X8Y A;  3IFM A;  2QRX A;  3A5T A;  3RK2 D;  2XKM A;  4U3F E;  1RE4 C;  1YHQ P;  3CC4 P;  1NTM G;  2IBZ I;  4OH8 B;  1XTG B;  3L70 J;  1PGJ A;  1X22 A;  3FXD A;  3F89 A;  1NTK G;  1YJN P;  1EDL A;  2WQY C;  1USE A;  1E79 H;  1VQ4 P;  3H32 A;  4D6T D;  4I1L A;  5KLV E;  1JY3 P;  4R4L A;  1SQB E;  2MJZ A;  1RY3 A;  2ZVN B;  2QJK B;  2H8P D;  1PP9 D;  1PPJ G;  3G6E P;  1N2D C;  1ZOY C;  5CCG A;  2E5Y A;  1N7S A;  1L0N G;  3CCJ P;  5AW4 B;  4IFF A;  3O8Z A;  1HTL C;  1FZC A;  1QX8 A;  1QVG O;  3H1K D;  3B5N A;  2VRS A;  3L73 E;  3TSI A;  3BCC G;  1SQX D;  1W5C E;  1U7J A;  1NTZ D;  1GW3 A;  3FXE A;  1NTM J;  4UB8 E;  3H1I E;  3C9I A;  1FOS E;  4GDO A;  1VQ9 P;  3GG2 A;  1AA0 A;  1NTK J;  2WVR A;  1VQ5 P;  3VN0 A;  1URQ A;  1YJ9 P;  1IFD A;  2OTK E;  1BE3 E;  3HD7 D;  3H1L D;  1KD1 Q;  2ZVO B;  1T6A A;  2OAR A;  1KZU B;  1YIJ P;  3A0H H;  5E79 E;  1L0L D;  2ZFC A;  3HE4 A;  2ZT9 C;  1BCC E;  1HJB A;  1EZV D;  5H2F E;  3V5B A;  4I7Z B;  1L0N J;  3PH0 A;  4OVN F;  4L75 A;  2XU6 A;  1USD A;  1N73 C;  2OYI A;  2AEM A;  3BCC J;  2P58 A;  4EIJ A;  3RL0 C;  4OGQ C;  3CXH H;  1H88 A;  1M56 D;  1RF0 A;  2K9J B;  1KQS O;  1EDK A;  1LTJ C;  2AEF A;  3FX0 A;  3AEB C;  3CXH I;  2M5A B;  3C8V A;  1GU5 A;  4GOE A;  3L75 D;  1N86 A;  1W2B O;  1FZF A;  4Y99 C;  1G2C B;  1SQQ D;  4D6T E;  1Q86 Q;  1M1J A;  1KTM A;  1MUU A;  1IFI A;  1K73 Q;  1X79 B;  3TYY A;  1IO4 A;  1PP9 E;  2P7J A;  2E75 B;  3ITK A;  1EDJ A;  1ZR4 A;  2W90 A;  4ZKU A;  1AVO A;  1RQV A;  3AEA C;  3KDP B;  2IYO A;  3S9O A;  2ZXX A;  3H1J G;  3H1K E;  2KZI A;  2PFX A;  1N73 B;  1SQQ K;  1SQX E;  1KOR A;  3RL0 B;  3WUV A;  2L91 A;  1NU1 K;  1JCC A;  1EC5 A;  3L71 G;  1N7S C;  1VQP P;  3Q5P A;  1FZC C;  2FFD A;  3VOP A;  2GM4 A;  1M90 Q;  2YMK A;  3SWY A;  3B5N C;  1K9M Q;  2G3A A;  3TF5 A;  1LTJ B;  2HPC A;  3P8C D;  1VQL P;  3BRV B;  1OVU A;  1MZ9 A;  2IFM A;  1IZN B;  4BRY B;  2XZR A;  4ASW A;  1JTH B;  2WSS H;  1SQV D;  4RO0 A;  4Y99 B;  4H44 C;  3RBZ A;  5KAF H;  3II6 A;  4AUW A;  1S5L X;  4KHX A;  3RL0 g;  1IFP A;  1NO4 A;  4JPZ B;  3U1A A;  1VQ8 P;  1S5L E;  4PV1 C;  1EZV E;  1URQ C;  2XV5 A;  1R8E A;  2FXP A;  3QH9 A;  5KLI C;  5KAI H;  2KSE A;  3H1J J;  1OW6 A;  3CX5 D;  2ZT9 D;  2A06 G;  2N9Y B;  1SQV K;  2E75 D;  2H89 C;  2YIU B;  3AE2 C;  1AJY A;  3M0D A;  1QGK B;  2FYZ A;  3L71 J;  1G1I A;  3CLQ A;  1PZQ A;  3TNU A;  1N7S B;  1OX3 A;  3AEF C;  3RL0 D;  4OGQ D;  3UIA A;  2OYI C;  5AVX B;  3F5H A;  1M57 D;  2FYU K;  2GUV A;  2XND H;  1NH4 A;  4W80 A;  3GW6 A;  3L75 E;  1YJW P;  3CC2 P;  1H89 A;  1RF0 C;  1YI2 P;  1SQQ E;  4H44 B;  1NOH A;  1J1D C;  1LP1 B;  4ZMD A;  1NU1 E;  2NPS A;  3H1H G;  3G3Z A;  1MFZ A;  5KKZ C;  3VMX A;  1D7M A;  4JQ0 D;  1URQ B;  1NYH A;  4PV1 B;  1YQ4 C;  2NZ2 A;  5KLI B;  1IFJ A;  3IR9 A;  1LJ2 A;  2PRR A;  3VYI A;  3G4S P;  2YKO A;  2D2C B;  1FZB A;  1DD4 A;  1SQP K;  2O01 J;  2V4H A;  2RH0 A;  3CCS P;  3OAK A;  3FWN A;  2C0W A;  1FZA A;  3GMA A;  2Q7C A;  2OYH C;  1A02 F;  2HOD B;  2R3C A;  4HH2 A;  4H0L C;  1N7L A;  1Y8A A;  5AVS B;  4ZKP A;  3P8C E;  1BSN A;  1JOC A;  2O01 H;  1N7S D;  5APV A;  3WUU A;  2G8Y A;  2Z5I A;  1GK6 A;  1VL2 A;  1EDI A;  3B5N D;  4PJ0 E;  3T97 A;  1SQV E;  3MD0 A;  2JJL A;  3AED C;  1LNQ A;  1J1D B;  2FFD C;  4HKZ H;  1UII A;  2H88 C;  3H1H J;  1M8O B;  5KLV K;  5KKZ B;  1Q81 Q;  4H44 D;  3NTN A;  5TJH A;  5B66 E;  2FXM A;  1QLE D;  3G71 P;  3IF4 A;  1S72 P;  2KNC B;  3CX5 E;  4PV1 D;  1URQ D;  1KB9 H;  3CWB D;  2PGD A;  1S9K D;  3R4Y A;  4UB6 E;  1GW4 A;  5C39 A;  1P84 E;  3A7O A;  2OYH B;  2N9B A;  2OYO A;  3HTK A;  4RES B;  2FYU G;  1VQN P;  5AW9 B;  1Z56 A;  1KIL A;  2R5B A;  1X9V A;  1KB9 I;  4NPE A;  1BGY G;  1FOS F;  3L72 G;  4IL6 X;  1OVV A;  1GU4 A;  3M0D C;  2KB7 P;  4IL6 E;  1PGQ A;  3L37 A;  2M3E A;  1R5S A;  1HH0 A;  1KYO H;  1T2K C;  2WT7 B;  3KZI H;  4GIF A;  1LWU B;  3GHG C;  2HPC B;  3TGU G;  2Q1K A;  2ZJS E;  2DW3 A;  3A3Y B;  2IDB A;  3S1K A;  1KYO I;  1SLQ A;  4PD4 D;  1PL5 A;  1SQP G;  3JCU H;  3HD7 B;  1ZXG A;  2NPS C;  4KJM A;  1RF1 A;  1SS1 A;  2JDI H;  1SFC A;  2Q9I A;  4RKU J;  4WB4 A;  4U3F G;  1KMI Z;  1GK4 A;  3R2P A;  2FYU J;  2GA1 A;  2Y0E A;  2PAJ A;  1BGY J;  3V2Q A;  3L72 J;  3LID A;  1DD3 A;  3HUS A;  4WWI A;  1IJD B;  2AXT H;  3KQG A;  4JBZ A;  1CI6 B;  4C7R A;  1LTB C;  4H0L D;  2CPS A;  1PGP A;  2KI7 B;  3KHU A;  5KLV G;  4DT0 A;  3M9H A;  3Q2Y A;  1J2J B;  1SQB G;  5CHX A;  2UWJ E;  3D70 A;  3HE5 B;  5CMZ A;  5K5G B;  3TGU J;  3GHG B;  1OIP A;  2B87 A;  3RGU A;  3JC2 2;  3EQ2 A;  4YXW H;  2JWD A;  2I1J A;  3N7N A;  3CCM P;  1KQF B;  4H13 C;  3SFE C;  1GZL A;  1SQP J;  1L4A A;  2Y0C A;  5AW3 B;  1JNM A;  2V7Q J;  3L73 G;  2P67 A;  2W6J H;  3CWB E;  2Q5U A;  4HB1 A;  5KJ7 C;  1R5L A;  1WRG A;  1YTZ T;  1P84 I;  1A02 J;  1AVY A;  2O01 N;  1S9K E;  1SQX K;  4U3F J;  3CCL P;  1ZV8 A;  1H0T B;  1RQU A;  1YQ3 C;  3KYQ A;  3QWO C;  1NTZ K;  3H1I G;  3P7K A;  3CME P;  2CPB A;  2V7Q H;  2C0X A;  1T3J A;  2R3S A;  1GDT A;  1LTI C;  3L74 E;  3AEC C;  4EDF A;  2J5U A;  4K35 A;  3PP5 A;  3RK3 C;  2ZYG A;  1BE3 G;  2KS1 B;  1FU1 A;  5KLV J;  2POH A;  1SQB J;  3BAT A;  1KIL C;  4HYT B;  2ITA A;  5AW0 B;  3V6I A;  2N1T A;  1BCC G;  1T2K D;  2QM7 A;  1L0L K;  2HYN A;  2QJY C;  1HWT C;  5DJT B;  4PD4 E;  5AW6 B;  4H13 B;  1GD2 E;  3NXS A;  3L73 J;  1UIX A;  2Y0D A;  5GTH E;  2C9N Y;  2JEE A;  5AVR B;  1DEB A;  2FYN C;  2Z5H A;  3EFF K;  2FXO A;  2WSE J;  2YKQ A;  2WPQ A;  4YXD C;  3EFG A;  2RKL A;  3P8M C;  2E74 C;  3BRT B;  3M9Q A;  3V4W A;  3H1I J;  2NPS D;  1NJI Q;  2OQQ A;  4N78 D;  3FWL A;  3IN6 A;  1JY2 P;  3A0B E;  4YTP C;  1RF1 C;  3V2R A;  2ZT9 B;  2WSE H;  1SFC C;  2ZYA A;  2AXC A;  1NKN A;  1BE3 J;  1RE3 A;  2XDJ A;  3RK3 B;  3TK1 A;  4D6T G;  1ZW0 A;  4UB8 H;  1IFM A;  2JWA A;  4AYC A;  1NAY A;  4GKG A;  5AVY B;  3VP9 A;  2M3B A;  1NAF A;  1S3J A;  5APS A;  1M1K Q;  1SP4 A;  1BCC J;  2BCC D;  3U59 A;  4OGQ B;  1PP9 G;  3HUS C;  3OA7 A;  2B89 A;  2K88 A;  1NTZ E;  4C7N A;  4RJT A;  2QJY B;  4WY4 A;  3D71 A;  5CCG C;  1CZQ A;  1QEX A;  5CJ4 A;  5E79 H;  3H1K G;  2IBZ D;  1SQX G;  2K3R A;  3VMY A;  1FDO A;  5H2F H;  2FYN B;  2BEQ D;  2GUS A;  4H13 D;  3NMD A;  4U7J A;  2E76 C;  1NHL A;  2Z4E A;  4DJG A;  3JSV C;  4C46 A;  3H1L E;  1L4A C;  5KJ7 D;  1JEK A;  1L0L E;  2I1K A;  1FE6 A;  3Q5R A;  1ZLL A;  3M9B A;  5AW2 B;  5GTI E;  5TIS E;  1SFC B;  2W83 C;  1X0T A;  1AFO A;  4D6T J;  4EYY Q;  3H32 B;  1OVR A;  1M7L A;  2QA4 P;  3L70 D;  1PP9 J;  1YBK A;  1OMI A;  3RK3 D;  3HUS B;  1EZV G;  2IFN A;  1GMJ A;  1EQ7 A;  1MKM A;  3Q1M A;  2HG5 D;  2Q3I A;  1T3U A;  1KIL D;  3H1K J;  1FZC B;  5APU A;  1Q7Y Q;  1EXJ A;  1SQX J;  1JM0 A;  3L4F A;  1E5W A;  3B5N B;  2P1J A;  2N1T C;  1OFC X;  2B87 B;  3WU2 E;  4I6M C;  2Y9Y A;  2KK7 A;  1KN7 A;  2PP6 A;  3AEG C;  2OTL P;  2QEX P;  2MKV A;  3TGU D;  1H8A A;  3ABV C;  2O1K A;  5B5E E;  2E74 D;  3L75 G;  1S2E A;  4L74 A;  3RK2 C;  1VQK P;  1SQQ G;  1Q82 Q;  1NTM D;  2JO1 A;  2YNY A;  4B86 A;  1NU1 G;  3E7K A;  4DOJ A;  1M1J C;  1YTZ I;  1PV3 A;  1SFC D;  2BCC E;  2IZ0 A;  1NTK D;  4KT0 J;  2Q3E A;  3Q3D A;  3HE4 B;  1LT1 A;  2ZAE B;  3V2N A;  3CCE P;  3EWK A;  1G1J A;  3AE9 C;  2SPZ A;  4EI2 A;  2E42 A;  4DCK A;  2IBZ E;  3CPW O;  2R32 A;  2OYI B;  1ZRT D;  3M0A A;  4GOD A;  5AVZ B;  1S5L H;  2B9B A;  5CCG D;  3GF7 A;  3CXH D;  3C1L A;  1PPJ D;  1NGM B;  1VDF A;  4XE5 B;  1OXZ A;  5M1B A;  2Y9Z A;  1NTK K;  2W27 A;  4WY4 C;  1L0N D;  3CCQ P;  4N6J A;  1YIT P;  4L76 A;  3AE6 C;  3BCC D;  1VQO P;  2WPR A;  5APW A;  3VP8 A;  4IFM A;  5L8R J;  1EZV I;  4IFD K;  3L75 J;  2YKP A;  1GL2 A;  1L4A D;  2K9J A;  3AE4 C;  1SQQ J;  1SQV G;  2K9Y A;  2IPP A;  3Q5S A;  5BU5 A;  2JP3 A;  2YO2 A;  2ZYD A;  1NU1 J;  1L0N K;  2FBW C;  3L70 E;  1M1J B;  5APT A;  3CC7 P;  2M5A A;  1OWA A;  3RK3 E;  3PHL A;  3W67 A;  4JF7 A;  1G2C A;  2RN0 A;  3M06 A;  3VTP C;  1IC2 A;  3CCU P;  1KIL E;  2BAS A;  3H1I D;  5APY A;  3GLM A;  1DX7 A;  4H0L B;  5CCH A;  1FC2 C;  2LXB A;  3I5C A;  2W6B A;  3PJS K;  1VQ7 P;  4I2L C;  4A7P A;  4XFJ A;  1N73 A;  2CK3 H;  1L2P A;  2N1T D;  2FFD B;  1ZP0 C;  2WZ7 A;  1LGH B;  1Q2N A;  5CBO A;  2YXQ B;  2JR8 A;  2QJK C;  3CI9 A;  3WMM 0;  2LXC B;  1KFN A;  1SQV J;  4O9B A;  1IFN A;  2M0B A;  1NTM E;  2KOG A;  5AW7 B;  1LTS C;  3A0H E;  4LLH A;  4BRY A;  1NTK E;  5KTB A;  3MTU E;  1HGV A;  4TLF A;  1JTH A;  4PJ0 H;  1OW8 A;  1RH5 B;  3V4Q A;  4NPD A;  3P32 A;  1FZE A;  1S4X A;  1ZRT E;  5APQ A;  2P2U A;  2E43 A;  3CXH E;  5B66 H;  1PPJ E;  2QE7 H;  1N8R Q;  3N4X A;  1L0N E;  3BAS A;  3GF3 A;  1HBW A;  1KV4 A;  2P10 A;  2QIW A;  3TNU B;  3CX5 H;  3H1J D;  1ZME C;  3BCC E;  3MP7 B;  5AVQ B;  2OTJ P;  2WSF J;  4WY4 D;  1FAV A;  5APX A;  4UB6 H;  4I7Z C;  1AQ5 A;  1P84 H;  3IAO A;  3L35 A;  3L71 D;  1LTA C;  2FY8 A;  3CX5 I;  2WSC J;  1HF9 A;  3H6P A;  2FKW B;  2BEZ F;  1JB0 J;  2WSF H;  3PRJ A;  2WMM A;  2NPS B;  4IL6 H;  2QVA A;  2K1A A;  3CD6 P;  1GL2 C;  1LP1 A;  1Y47 A;  2KZJ A;  2H7H A;  3SWK A;  2WSC H;  3NFQ A;  3CWB G;  2IYP A;  2WIT A;  1KC8 Q;  1TU3 F;  1GTW A;  2YXR B;  1BSH A;  2RMZ A;  4XA4 A;  1ZN5 A;  2AEJ A;  1U57 A;  2A06 D;  3L74 G;  3LIE A;  4HJG H;  5CCH C;  3I56 P;  1JY3 N;  2E75 C;  3S4R A;  1OW7 A;  1AQT A;  4K3A A;  2KP8 A;  3MZW B;  3FGA D;  3MGN A;  1J1E C;  1Q90 D;  2HOD A;  3T97 B;  4BWN A;  5KAF E;  2M8R A;  2HR3 A;  2C9L Y;  2W6A A;  4IOI H;  2LKM A;  4GT1 A;  1FZG A;  1GL2 B;  2R5D A;  5KAI E;  2I8D A;  5DJU B;  1WT6 A;  5AVW B;  3CWB J;  1K8A Q;  3H1H D;  1KB9 D;  2B88 A;  1JMM A;  1FDI A;  1T8Z A;  1HUC A;  3O6Q A;  3OJA B;  5BVZ A;  2HFE D;  2KNC A;  1AV1 A;  3H1J E;  4EOT A;  1JY3 O;  3HTK B;  1NU1 D;  3U1C A;  3L74 J;  1NKZ B;  4QMA A;  1KIL B;  1KQG B;  1LT9 A;  4JYC A;  2OYH A;  1YYC A;  3L71 E;  4W7Z A;  4DZO A;  1KYO D;  1J1E B;  3MIW A;  4MN4 C;  3SFD C;  3PLN A;  2YIU C;  3SWF A;  2WWW A;  1U7M A;  2KSJ A;  3PTZ A;  1DEE G;  3L36 A;  1NTZ G;  2WT7 A;  3AE7 C;  2E5T A;  1RHZ B;  2KLU A;  4N3Y B;  3AEE C;  3D6Y A;  1XTC C;  4ASV A;  2E74 B;  1LWU A;  3E1R A;  2QM8 A;  2O3J A;  1QL2 A;  1GL2 D;  2KXP B;  2JKV A;  3G9R A;  1RF1 B;  4R4M A;  1HVV A;  2YO3 A;  3OW2 O;  2KIK A;  5BU8 B;  4L73 A;  4PD4 H;  2WPS A;  2NRG A;  2QJP C;  5EFW B;  1OZH A;  3H1L G;  5AVU B;  5GTH H;  3HD7 A;  2A06 E;  1JCD A;  1L0L G;  1MFT A;  2J58 A;  1JUN A;  1KFM A;  1JY2 N;  4LC1 A;  4PD4 I;  4Z1M H;  1SVF A;  1NWQ A;  2FYU D;  4ZNC A;  5CCH D;  2D2C C;  3CCV P;  2W8Z A;  3A0B H;  1BGY D;  3L72 D;  3CCR P;  1VF5 C;  3WUT A; 
#chains in the Genus database with same CATH homology
 2M5A A;  4NPE A;  5DJT B;  3MHV A;  1NVO A;  3ZDM A;  1BDC A;  2UWJ E;  1OVV A;  4MN4 C;  5K5G B;  4HJG H;  2QRX A;  2B87 A;  5CBN A;  2R44 A;  3RGU A;  4K3A A;  2JWD A;  3MZW B;  1U7M A;  2OTK E;  1DEE G;  1EDJ A;  1FC2 C;  3FXD A;  1X0T A;  2RKL A;  2LXB A;  1LT1 A;  2ZAE B;  4EYY Q;  4ASV A;  2KZI A;  2Q1K A;  1EDL A;  1EDI A;  2HR3 A;  1OVR A;  4HB1 A;  2SPZ A;  3S1K A;  4IOI H;  4HKZ H;  1H0T B;  4CPG A;  4GOD A;  3QWO C;  1EC5 A;  1Q2N A;  5CBO A;  3PH0 A;  2KIK A;  1ZW0 A;  2KUB A;  2LR2 A;  1ZXG A;  2I8D A;  4NPF X;  5DJU B;  1H0T A;  2P58 A;  4KJM A;  5EFW B;  1SS1 A;  2WMM A;  1LP1 B;  2LXC B;  1S3J A;  2B88 A;  4ZMD A;  2QVA A;  1JM0 A;  4K35 A;  2M0B A;  1MFT A;  1OVU A;  2B89 A;  1LP1 A;  1Y47 A;  2KS1 B;  2KZJ A;  2B87 B;  4ASW A;  1EDK A;  4GOF A;  4BXL A;  4WWI A;  4ZNC A;  1U7J A;  5C39 A;  1JMB A;  2K3R A;  1BDD A;  2M5A B;  4JBZ A;  4GOE A;  3FXE A;  2KI7 B;  4NPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...