4NPFX

High-resolution structure of two tandem b domains of staphylococcal protein a connected by the conserved linker
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
115
structure length
115
Chain Sequence
b'DNKFNKEQQNAWYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAWYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein A
publication title Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 49
structure length 115
sequence length 115
chains with identical sequence Y
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npfX01
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npfX02
4MN4C 1BDDA 2QRXA 1JMBA 4HJGH 4GODA 2KI7B 2KIKA 2LXCB 3RGUA 1ZW0A 3S1KA 5CBNA 1Q2NA 1H0TA 2B87B 4JBZA 1EDIA 2SPZA 3PH0A 1X0TA 1ZXGA 2LR2A 2UWJE 4ZMDA 4ASVA 2M5AB 2HR3A 4GOFA 1EDJA 1JM0A 2QVAA 4EYYQ 1DEEG 3FXEA 2OTKE 2B88A 1Y47A 2I8DA 1S3JA 2RKLA 4WWIA 2JWDA 1OVUA 1EC5A 4BXLA 1FC2C 1LT1A 4NPFX 5C39A 3FXDA 2ZAEB 5K5GB 2R44A 1OVVA 4NPDA 4K35A 4ZNCA 2Q1KA 2P58A 5EFWB 1H0TB 4HB1A 1LP1A 4KJMA 4GOEA 2B89A 5CBOA 1U7MA 1EDKA 2KZJA 4ASWA 1LP1B 2WMMA 2KZIA 2B87A 3QWOC 4HKZH 2M5AA 4IOIH 5DJUB 2K3RA 2KUBA 1U7JA 3MHVA 2M0BA 1SS1A 4NPEA 4K3AA 3ZDMA 1OVRA 2LXBA 1BDCA 5DJTB 1EDLA 4CPGA 3MZWB 1MFTA 1NVOA 2KS1B
chains in the Genus database with same CATH superfamily
5TISE 4MN4C 4L73A 2K9JB 5APYA 4EIJA 3FGAD 3TDKA 1DD3A 2E74B 1TU3F 3D71A 1BCCG 1JY3O 1K73Q 2RN0A 1SQPK 4ASVA 1WRGA 2I1KA 1NTMK 3H32A 5AW2B 1KYOE 1YJNP 3LW5H 1JM0A 4YXDC 1ZR4A 3K5BA 1LGHB 1K8AQ 2W6AA 2O01N 1AV1A 1M90Q 1PGQA 4L76A 4NPFX 1LTSC 2OYIB 4Z1MH 1URQB 1KFNA 3KHUA 5AW8B 1SQXJ 5BU8B 4D6TD 5EFWB 2V7QJ 1Q90D 1OFCX 3RL0D 2QJYC 2R32A 2WPQA 2IBZI 1CI6B 3TGUJ 3WU2H 3L35A 2Y9YA 3B8EB 2KLVA 1FDOA 2B9BA 2ITAA 3D70A 3CPWO 2GA1A 2KK7A 2KSJA 3P8MC 5AW4B 2M5AA 3CC7P 1OWAA 4C7RA 3A0BE 1HVVA 3H1JE 1P84D 1LNQA 2OYHA 3BCCD 3T97A 1PL5A 2PRRA 3L72E 5DJTB 1T6AA 1YI2P 2OTJP 4GODA 4JPZB 3L74D 3SFDC 1QL2A 2LXCB 4ZKPA 1H88A 3RGUA 1FJPA 1LT9B 5B66H 2WSEH 1ZLLA 5KLIC 4EYYQ 3AE1C 3CC4P 1KFMA 1VF5D 2I8DA 1SQXG 2XNXA 2HPCB 1USEA 1VQ5P 2VRSA 4BXLA 5C39A 3D6YA 1FJKA 1HBWA 1U57A 2ZAEB 1SQPE 1KQLA 2E5TA 3GHGC 2R44A 1NTME 1JCDA 3CLQA 1YYCA 5AVXB 2NZ2A 3TGUG 1XTGB 3U1AA 4JYCA 4H13C 1S2EA 1SQQK 3GHGA 4LC1A 4HYTB 1JB0J 1VQNP 1ZRTD 3AE5C 2Z5HA 1NHLA 1GMJA 5CJ4A 4DT0A 1GZLA 2KUBA 1U7JA 3OW2O 2WVRA 3M9HA 3MZWB 5CCGC 5B5EH 4JYBA 1NYHA 1QLED 1N7SB 2G8YA 4H44D 1K04A 3S1KA 3WUUA 1FZCC 4UB8H 3B5ND 3CCMP 5CCGA 5BVZA 3I5CA 1M1KQ 4ZMDA 1M8OB 5B66E 1S4XA 2D2CC 1LJ2A 1W5CE 1FZCA 3RK3B 2N1TD 1ZP0C 1OVUA 3H1JD 2J5UA 1DX7A 2JWAA 4YXWH 3V4QA 2NPSD 3KPEA 5AW0B 5KLVE 3LW5J 1M56D 3L71D 2B89A 2J59M 3SWYA 5CBOA 3H32B 5H2FH 1EDKA 1K05A 3MUDA 1HH0A 2QEXP 2KXPB 3PLNA 1XTCC 3CXHI 1PP9D 2IZ0A 3AE4C 3CWBJ 5KJ7D 2J58A 1SQPD 1IFDA 4KT0J 1PFIA 1NTMD 3H1LD 1GTWA 2OYIC 5APXA 2QSIA 4A7PA 3L75D 3GLMA 4DCKA 1SP4A 2QIWA 5APSA 2M5AB 2QJYB 4UB8E 2A06D 2CK3H 1IK9A 2L91A 1OW7A 1NTZJ 2OTKE 2OYHB 3T97B 2MKVA 3GF7A 1FZFA 1PV3A 4RO0A 3CCLP 4WWIA 3L73J 2ZXEB 1PPJG 1RE4C 3TYYA 4EOTA 2IYPA 2WSEJ 1MFZA 3R4YA 3RBZA 3HD7D 1J1DB 1RE4A 4TLFA 2PP6A 3SWFA 1EZVD 1ZV8A 1HF9A 5H2FE 2AEMA 4Y99C 3CWBG 2GUVA 1T2KD 5KLVJ 1S9KE 3M0DC 1KN7A 2AEFA 1LTAC 1NTKJ 1DH3A 2Y0EA 1AQTA 2IZ1A 3VMZA 2KI7B 4C7NA 4IL6H 3GHGB 3AE3C 3RL0C 3MGNA 2NRGA 2KP8A 3V2NA 3V4WA 1G2CA 1NU1D 1NTZG 4H13B 2HR3A 1YJ9P 1SQVJ 3EWKA 2KNCA 3L73G 3PP5A 2H7HA 3CMEP 2YO3A 2W6JH 1VQPP 4PJ0H 1BSHA 3NFQA 3AE2C 3H6PA 1EC5A 3I55P 1SQQD 1SQXE 3Q3DA 1IFJA 3Q2YA 1JY2O 5AVRB 4KHXA 2IFMA 5AVTB 1S1CX 1NO4A 2BEZF 4PV1D 5KLVG 3TGUE 5AW3B 1N2DC 4B86A 2QG4A 1FZCB 3CX5I 3II6A 1NTKG 3GF3A 1BCCD 3CCEP 1BGYJ 4LLHA 3C1LA 1EXJA 1VF5C 1MUUA 2YO2A 1L0NJ 1HJBA 2D2CB 3L70D 3V2RA 3CC2P 2XDJA 5APTA 3CL3D 3GW6A 1YITP 5AW6B 1QGKB 5AVUB 1SQVG 2O01H 5CBNA 1Q2NA 4IL6E 1ZXGA 1PGPA 4I7ZC 2IYOA 3H1KE 5KTBA 5E79H 2Z4EA 1SQBJ 1GD2E 1FDIA 3BATA 4U3FD 3RK3E 3N4XA 1NKNA 1Y9BA 3VP9A 1L4AD 2E76D 2N9YB 3P7KA 2JKVA 4ZNCA 3CCQP 3CXHH 1NAYA 4R4MA 3OJAB 4GOEA 3TF5A 1BSNA 2E75D 3AE8C 4LGDE 3KYQA 4D6TJ 4N3YB 1S5LE 1BGYG 1X79B 3B5NC 3VMAA 2LKMA 5APQA 2Q5UA 4OH8B 1N7LA 1L0NG 2JDIH 1QEXA 1LWUC 1AVOA 2O1KA 4ZKUA 2P1JA 3MHVA 2C0XA 3ZDMA 2BEQD 3B5NA 4OGQD 4N78E 2OYHC 1L2PA 1BDDA 1KB9D 1ZMEC 1LWUA 1KZUB 1KILD 2NPSC 3BCCJ 4O9BA 2Q7CA 2XKMA 1NTZK 1NJIQ 3MD0A 2WSFH 4AYCA 1OIPA 3I56P 2JP3A 1N73B 4PD4D 1SQBG 2C9LY 1Y8AA 1P84I 5CCHD 4PD4I 3L74J 3TGUD 1HJ0A 2E43A 1EDJA 3NXSA 1J1DC 2H88C 2NPSA 4H0LD 2HG5D 1JNMA 2B88A 3W67A 1NOHA 2KB7P 5E79E 4Y99B 4UB6H 5KAFH 4C7NB 3NTNA 1WMKA 3H1KJ 5APUA 2Q3EA 2BCCD 4D6TG 2IBZG 1PPJE 5KLVK 1G2CB 3S4RA 5KJ7A 3A0HH 3WUVA 2KNCB 1SVFA 1JY2N 1NTKK 2ZT9D 2B87A 4U7JA 3RL0B 1QX8A 1L0LE 2R5DA 1FZBA 2M0BA 1SFCD 3VTPC 3SFEC 2W6BA 2H43A 1JO5A 3CWBE 5AVYB 3BCCG 3RK2D 3Q5RA 4GIFA 3WU2E 1SQVK 1BE3J 5KKZC 1FE6A 3VOPA 2FXPA 1KYOD 1VDFA 3JCUH 3TK1A 2KIKA 3H1HE 1PIXA 3L74G 1ZW0A 3AEEC 1GDTA 3HD7C 2WPSA 2XZRA 5GTHH 1AQ5A 2JEEA 4GOFA 3P8CE 2M3BA 1A02J 2HFED 4DZOA 1RQUA 1T2KC 3PTZA 1AJYA 1NTZE 4TT3H 4WY4D 1Q81Q 3KZIH 3HD7A 3H1KG 2O01J 3L73E 3EFFK 4N78D 2YMYA 1Q7YQ 5KAFE 1VF5B 3CX5H 5CJ0A 1M57D 3FWLA 2QA4P 1E5WA 5AVQB 4L74A 3VN0A 5AW5B 2IDBA 2FYUJ 5AW7B 1JY2P 1L0NK 1OMIA 2WMMA 3MUDC 3L72D 1S5LX 3AE7C 3A0HE 3H25A 1YQ3C 2ZYAA 1IFPA 2WPVB 2Y0DA 2JR8A 5AVZB 5DJUB 1LTTC 4I7ZB 2WWWA 1BE3G 1IZNB 1BDCA 1R8EA 1PP9J 1NTKE 3AEBC 4M3LA 1L0LJ 1QVGO 1SQBK 3LIDA 3V5BA 1EXIA 2PFXA 1QVFO 1JTHB 2LR2A 3H1LJ 3FWNA 1VPCA 2XNDH 1SQVE 3OA7A 2YKOA 2W83C 4H44B 1JMMA 5B5EE 2QJKC 2WPRA 3H1HJ 3B5NB 3B71A 1ZN5A 1LWUB 1FC2C 1DEBA 3TNUA 2XU6A 2WSFJ 5L8RJ 4GDOA 2YKQA 1ZR2A 3CWBD 2FY8A 3HE5A 5AVSB 3CI9A 2FYUG 1SQXK 2N1TB 2IFNA 4N6JA 3H1IE 3U1CA 4RJTA 1RF1C 2MJZA 2NPSB 3G6EP 1T3UA 1FS0E 3IR9A 3U59A 3WUTA 2H8PD 1KD1Q 1N73C 1GL2D 1PP9G 2WZ7A 4W7ZA 1BGYE 1RF1A 1L0LG 1OVRA 1WT6A 1EDLA 2AXCA 1MV8A 3B4SA 1L0NE 1RHZB 5GTIH 5AVWB 1H8AA 1P84H 1N86A 4PD4H 1N73A 1X8YA 1EZVI 1OW8A 3SSUA 1L4AC 1LTJB 3H1LG 2POHA 4RKUJ 1Q86Q 1DD4A 1PGOA 2B87B 1J1EC 2M3EA 1EDIA 3PH0A 3H1HG 2WITA 2AXTH 3HE4A 1L4AA 3N7NA 1FDMA 1DEEG 2XV5A 1Q82Q 3HUSA 1CSBA 1SQBE 1NU1J 3SWKA 2W27A 2JJLA 2RKLA 5KLVD 2Y9ZA 3GG2A 4EI2A 3USSA 1IFIA 3IFMA 3CCJP 2IPPA 5AVVB 4NPDA 4Y28J 1KV4A 4K35A 4OGQC 1NTKD 3AEFC 2Q1KA 1YHQP 2KS1A 4KJMA 1M7LA 1FBMA 5TISH 1KILC 5KKZB 2KSEA 4WVZA 1U7MA 1DIPA 1A02F 4ASWA 1GK4A 4D6TE 2IBZE 3JSVC 2KZIA 2P7JA 3QWOC 2ZJSE 3HD7B 5CCHC 2WQYC 1KILA 3IN6A 3H1IJ 1NGMB 2E74D 1IO4A 2LXBA 2GUSA 3TSIA 3CCRP 1CW5A 1VQ8P 1MFTA 1BCCJ 1LTIC 5CCHA 3NMDA 5GTIE 1MKMA 4DJGA 1YTZI 5KAIH 1P84E 3UIAA 3BCCE 3L70J 4WB4A 1JOCA 3CCUP 1AA0A 2Q9IA 1H0TA 2E5YA 1RH5B 2YIUC 2UWJE 1NU1G 3A5TA 1OW6A 3L74E 2QVAA 3L36A 1URQD 2ZT9C 1HGVA 2KLUA 2HYNA 2FFDA 3JC22 1SFCC 2QJPC 2FBWC 2FYUK 2K1AA 4U3FJ 3A0BH 3RK2C 2Y0CA 1Z56A 3R2PA 5TJHA 4WBAA 1SFCA 1HTLC 3IAOA 1LTGC 1S9KD 4PJ0E 1X9VA 3H1IG 4HKZH 3Q5PA 2ZYDA 1L0LK 1ZOYC 4PV1B 3TNUB 3V2QA 1SS1A 3HRNA 1SQBD 3HE5B 2QJKB 4WY4C 4H44C 1K9MQ 1ZRTE 4JF7A 3L70G 3M06A 4W7YA 1J2JB 3C9IA 3Q5SA 1BE3E 1JTHA 1JMBA 3L37A 1T3JA 3A2AA 3D6ZA 3KDPB 4WY4A 5KAIE 2W8ZA 1W2EA 1IJDB 1X0TA 2N1TC 4L75A 3EFGA 1G1JA 4XFJA 2WSCH 2IBZD 1AFOA 1RF1B 3VMXA 4HH2A 2P10A 1KB9I 3PJSK 1SQXD 3E1RA 4I6MC 4U3FG 2N1TA 3L4FA 2FYZA 2A45H 1VQ7P 2AEJA 1YBKA 1FZGA 2QM7A 3HE4B 1L4AB 3AECC 3AEDC 2E76B 2BCCJ 3KXDA 1LTJC 2FYUE 4DOJA 2WT7B 3M0AA 4XE5B 3HUSB 5KJ7C 2FXMA 4OWFA 1OZHA 3L71E 3E7KA 1J1EB 2JO1A 2E75B 4IOIH 4NPEA 3CXHE 4K3AA 4R4LA 2E42A 1N7SD 2I1JA 1LTJA 2ZYGA 1GW4A 1PP9E 1RF0C 2KS1B 1JUNA 4C46A 2HODA 5BU5A 1N8RQ 3P32A 1R5LA 3MIWA 2K88A 4HJGH 3H1KD 2HLOA 1NU1K 4OGQB 3G4SP 3RK3D 2SPZA 1RF0A 3CCSP 3BRVB 3BRTB 2CPSA 3H1LE 2RH0A 4AQRD 1R5SA 1KILB 4QMAA 1EQ7A 2R5BA 1IFNA 3L75E 3FXEA 1OXZA 3F89A 1VQKP 3OAKA 1GL2C 1KYOI 1QL1A 5CMZA 3FXDA 5APVA 2A06E 4IL6X 5K5GB 1RY3A 2O1JA 4BRYA 1GW3A 4H0LB 3BASA 3O8ZA 1H0TB 4HB1A 4GKGA 2BCCG 1HGZA 4YPCA 1X22A 1GL2A 1BE3D 4IFDK 2ZFCA 1JEKA 2YXRB 5APWA 2KZJA 1AVYA 4XA4A 1LP1B 3PRJA 3HTKA 2ZXXA 4UB6E 2FFDB 3W68A 2Q3IA 3F5HA 2IX7C 2P2UA 2YIUB 3GMAA 4GT1A 2K3RA 3G71P 1M1JB 3H1JJ 1EZVE 1PGJA 1HWTC 3O6QA 1MZ9A 3L72J 2M8RA 2ZT9B 1UIIA 3LIEA 1KC8Q 2W90A 2FKWB 1JY3N 3L71J 1UIXA 2QRXA 2RMZA 1KQGB 1SFCB 2QJPB 4I1LA 3FX0A 2FYNB 2PGDA 4YTPC 3RK2B 3G3ZA 4JBZA 1GU5A 3RL0g 1W2BO 2FYUD 1KTMA 1Y47A 1NU1E 1NKZB 1PPJD 3JCUE 1S72P 1SQPJ 2QM8A 3CXHD 3Q1MA 1YTZT 2Z5IA 3E1IA 1NTMJ 2E74C 4PV1C 1H89A 1FZAA 2P58A 3L75J 5CHXA 3PHLA 4WY4B 5GTHE 2V4HA 2WSCJ 2QE7H 1GU4A 2K9JA 1L0LD 2OTLP 1SQQE 5AW1B 1IC2A 2C9NY 2OYOA 3KZIE 3AE6C 3AEGC 3H1JG 3A3YB 2YXQB 1VQMP 3L72G 4W80A 1D7MA 1URQC 3CX5E 1RE3C 2CPBA 3L71G 2L5GB 1OX3A 3M91A 3H1HD 3BVHA 1JY3P 2A45I 2ZVNB 1BCCE 1FOSF 3CCVP 4H13D 2OYIA 1GK6A 1URQA 3P8CD 1RE3A 1KB9H 3AEAC 1IK7A 2N9BA 3L70E 1NTZD 2OQQA 2V7QH 2FXOA 1CI6A 2P67A 1YIJP 3L73D 1SQPG 1YJWP 2E76C 1CZQA 2WSSH 1NH4A 1NTMG 2YKPA 3C8VA 1VQ4P 1E79H 3HUSC 3CMAP 5CCGD 3M9QA 2HODB 3L75G 1LT1A 3A7OA 2E75C 3CD6P 2WTYA 4U3FE 1LT9C 1PZQA 3ABVC 2WT7A 1NAFA 2A06G 1IFMA 1G1IA 5KLIB 1YQ4C 1VQOP 2A45G 2G3AA 3EQ2A 2OARA 1NWQA 3VYIA 2D2CD 3M9BA 1LT9A 2H89C 3AE9C 2C0WA 1HUCA 3M0DA 2YMKA 1FZEA 1RQVA 1SQQJ 1FU1A 4IFFA 4BRYB 4CPGA 1VQ6P 2HPCA 1EZVG 1GL2B 1KORA 2OGUA 3MP7B 3MTUE 1KMIZ 4JQ0D 3KQGA 1KQFB 1SQVD 1VQLP 4OVNF 2GM4A 3HTKB 4H0LC 3G9RA 3ITKA 1KYOH 3IF4A 1KB9E 1USDA 3S9OA 1KILE 3VMYA 4BWNA 3O6QB 1SLQA 3WMM0 4PD4E 1S3JA 1FAVA 1S5LH 2BASA 2JWDA 2K9YA 2FFDC 3V2PA 3CX5D 3H1ID 2O3JA 2PAJA 1N7SC 1OVVA 1M1JC 2YNYA 2K37A 1LP1A 3RBXA 2AXTE 4EDFA 2R3SA 1LTBC 5AW9B 3V6IA 1FOSE 2R3CA 1N7SA 3VP8A 2DW3A 1BGYD 1M1JA 2BCCE 1VQ9P 4RESB 1T8ZA 2KYVA 3QH9A 1VL2A 2FYNC 3RK3C 2ZVOB 2KOGA 1KQSO 1L0ND 1SQQG 4AUWA 4IFMA 4I2LC 5M1BA 2Q6QA 1JCCA 1NVOA
chains in the Genus database with same CATH topology
4MN4C 1BDDA 2QRXA 1JMBA 4HJGH 4GODA 2KI7B 2KIKA 2LXCB 3RGUA 1ZW0A 3S1KA 5CBNA 1Q2NA 1H0TA 2B87B 4JBZA 1EDIA 2SPZA 3PH0A 1X0TA 1ZXGA 2LR2A 2UWJE 4ZMDA 4ASVA 2M5AB 2HR3A 4GOFA 1EDJA 1JM0A 2QVAA 4EYYQ 1DEEG 3FXEA 2OTKE 2B88A 1Y47A 2I8DA 1S3JA 2RKLA 4WWIA 2JWDA 1OVUA 1EC5A 4BXLA 1FC2C 1LT1A 4NPFX 5C39A 3FXDA 2ZAEB 5K5GB 2R44A 1OVVA 4NPDA 4K35A 4ZNCA 2Q1KA 2P58A 5EFWB 1H0TB 4HB1A 1LP1A 4KJMA 4GOEA 2B89A 5CBOA 1U7MA 1EDKA 2KZJA 4ASWA 1LP1B 2WMMA 2KZIA 2B87A 3QWOC 4HKZH 2M5AA 4IOIH 5DJUB 2K3RA 2KUBA 1U7JA 3MHVA 2M0BA 1SS1A 4NPEA 4K3AA 3ZDMA 1OVRA 2LXBA 1BDCA 5DJTB 1EDLA 4CPGA 3MZWB 1MFTA 1NVOA 2KS1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN4 C;  1BDD A;  2QRX A;  1JMB A;  4HJG H;  4GOD A;  2KI7 B;  2KIK A;  2LXC B;  3RGU A;  1ZW0 A;  3S1K A;  5CBN A;  1Q2N A;  1H0T A;  2B87 B;  4JBZ A;  1EDI A;  2SPZ A;  3PH0 A;  1X0T A;  1ZXG A;  2LR2 A;  2UWJ E;  4ZMD A;  4ASV A;  2M5A B;  2HR3 A;  4GOF A;  1EDJ A;  1JM0 A;  2QVA A;  4EYY Q;  1DEE G;  3FXE A;  2OTK E;  2B88 A;  1Y47 A;  2I8D A;  1S3J A;  2RKL A;  4WWI A;  2JWD A;  1OVU A;  1EC5 A;  4BXL A;  1FC2 C;  1LT1 A;  4NPF X;  5C39 A;  3FXD A;  2ZAE B;  5K5G B;  2R44 A;  1OVV A;  4NPD A;  4K35 A;  4ZNC A;  2Q1K A;  2P58 A;  5EFW B;  1H0T B;  4HB1 A;  1LP1 A;  4KJM A;  4GOE A;  2B89 A;  5CBO A;  1U7M A;  1EDK A;  2KZJ A;  4ASW A;  1LP1 B;  2WMM A;  2KZI A;  2B87 A;  3QWO C;  4HKZ H;  2M5A A;  4IOI H;  5DJU B;  2K3R A;  2KUB A;  1U7J A;  3MHV A;  2M0B A;  1SS1 A;  4NPE A;  4K3A A;  3ZDM A;  1OVR A;  2LXB A;  1BDC A;  5DJT B;  1EDL A;  4CPG A;  3MZW B;  1MFT A;  1NVO A;  2KS1 B; 
#chains in the Genus database with same CATH topology
 5TIS E;  4MN4 C;  4L73 A;  2K9J B;  5APY A;  4EIJ A;  3FGA D;  3TDK A;  1DD3 A;  2E74 B;  1TU3 F;  3D71 A;  1BCC G;  1JY3 O;  1K73 Q;  2RN0 A;  1SQP K;  4ASV A;  1WRG A;  2I1K A;  1NTM K;  3H32 A;  5AW2 B;  1KYO E;  1YJN P;  3LW5 H;  1JM0 A;  4YXD C;  1ZR4 A;  3K5B A;  1LGH B;  1K8A Q;  2W6A A;  2O01 N;  1AV1 A;  1M90 Q;  1PGQ A;  4L76 A;  4NPF X;  1LTS C;  2OYI B;  4Z1M H;  1URQ B;  1KFN A;  3KHU A;  5AW8 B;  1SQX J;  5BU8 B;  4D6T D;  5EFW B;  2V7Q J;  1Q90 D;  1OFC X;  3RL0 D;  2QJY C;  2R32 A;  2WPQ A;  2IBZ I;  1CI6 B;  3TGU J;  3WU2 H;  3L35 A;  2Y9Y A;  3B8E B;  2KLV A;  1FDO A;  2B9B A;  2ITA A;  3D70 A;  3CPW O;  2GA1 A;  2KK7 A;  2KSJ A;  3P8M C;  5AW4 B;  2M5A A;  3CC7 P;  1OWA A;  4C7R A;  3A0B E;  1HVV A;  3H1J E;  1P84 D;  1LNQ A;  2OYH A;  3BCC D;  3T97 A;  1PL5 A;  2PRR A;  3L72 E;  5DJT B;  1T6A A;  1YI2 P;  2OTJ P;  4GOD A;  4JPZ B;  3L74 D;  3SFD C;  1QL2 A;  2LXC B;  4ZKP A;  1H88 A;  3RGU A;  1FJP A;  1LT9 B;  5B66 H;  2WSE H;  1ZLL A;  5KLI C;  4EYY Q;  3AE1 C;  3CC4 P;  1KFM A;  1VF5 D;  2I8D A;  1SQX G;  2XNX A;  2HPC B;  1USE A;  1VQ5 P;  2VRS A;  4BXL A;  5C39 A;  3D6Y A;  1FJK A;  1HBW A;  1U57 A;  2ZAE B;  1SQP E;  1KQL A;  2E5T A;  3GHG C;  2R44 A;  1NTM E;  1JCD A;  3CLQ A;  1YYC A;  5AVX B;  2NZ2 A;  3TGU G;  1XTG B;  3U1A A;  4JYC A;  4H13 C;  1S2E A;  1SQQ K;  3GHG A;  4LC1 A;  4HYT B;  1JB0 J;  1VQN P;  1ZRT D;  3AE5 C;  2Z5H A;  1NHL A;  1GMJ A;  5CJ4 A;  4DT0 A;  1GZL A;  2KUB A;  1U7J A;  3OW2 O;  2WVR A;  3M9H A;  3MZW B;  5CCG C;  5B5E H;  4JYB A;  1NYH A;  1QLE D;  1N7S B;  2G8Y A;  4H44 D;  1K04 A;  3S1K A;  3WUU A;  1FZC C;  4UB8 H;  3B5N D;  3CCM P;  5CCG A;  5BVZ A;  3I5C A;  1M1K Q;  4ZMD A;  1M8O B;  5B66 E;  1S4X A;  2D2C C;  1LJ2 A;  1W5C E;  1FZC A;  3RK3 B;  2N1T D;  1ZP0 C;  1OVU A;  3H1J D;  2J5U A;  1DX7 A;  2JWA A;  4YXW H;  3V4Q A;  2NPS D;  3KPE A;  5AW0 B;  5KLV E;  3LW5 J;  1M56 D;  3L71 D;  2B89 A;  2J59 M;  3SWY A;  5CBO A;  3H32 B;  5H2F H;  1EDK A;  1K05 A;  3MUD A;  1HH0 A;  2QEX P;  2KXP B;  3PLN A;  1XTC C;  3CXH I;  1PP9 D;  2IZ0 A;  3AE4 C;  3CWB J;  5KJ7 D;  2J58 A;  1SQP D;  1IFD A;  4KT0 J;  1PFI A;  1NTM D;  3H1L D;  1GTW A;  2OYI C;  5APX A;  2QSI A;  4A7P A;  3L75 D;  3GLM A;  4DCK A;  1SP4 A;  2QIW A;  5APS A;  2M5A B;  2QJY B;  4UB8 E;  2A06 D;  2CK3 H;  1IK9 A;  2L91 A;  1OW7 A;  1NTZ J;  2OTK E;  2OYH B;  3T97 B;  2MKV A;  3GF7 A;  1FZF A;  1PV3 A;  4RO0 A;  3CCL P;  4WWI A;  3L73 J;  2ZXE B;  1PPJ G;  1RE4 C;  3TYY A;  4EOT A;  2IYP A;  2WSE J;  1MFZ A;  3R4Y A;  3RBZ A;  3HD7 D;  1J1D B;  1RE4 A;  4TLF A;  2PP6 A;  3SWF A;  1EZV D;  1ZV8 A;  1HF9 A;  5H2F E;  2AEM A;  4Y99 C;  3CWB G;  2GUV A;  1T2K D;  5KLV J;  1S9K E;  3M0D C;  1KN7 A;  2AEF A;  1LTA C;  1NTK J;  1DH3 A;  2Y0E A;  1AQT A;  2IZ1 A;  3VMZ A;  2KI7 B;  4C7N A;  4IL6 H;  3GHG B;  3AE3 C;  3RL0 C;  3MGN A;  2NRG A;  2KP8 A;  3V2N A;  3V4W A;  1G2C A;  1NU1 D;  1NTZ G;  4H13 B;  2HR3 A;  1YJ9 P;  1SQV J;  3EWK A;  2KNC A;  3L73 G;  3PP5 A;  2H7H A;  3CME P;  2YO3 A;  2W6J H;  1VQP P;  4PJ0 H;  1BSH A;  3NFQ A;  3AE2 C;  3H6P A;  1EC5 A;  3I55 P;  1SQQ D;  1SQX E;  3Q3D A;  1IFJ A;  3Q2Y A;  1JY2 O;  5AVR B;  4KHX A;  2IFM A;  5AVT B;  1S1C X;  1NO4 A;  2BEZ F;  4PV1 D;  5KLV G;  3TGU E;  5AW3 B;  1N2D C;  4B86 A;  2QG4 A;  1FZC B;  3CX5 I;  3II6 A;  1NTK G;  3GF3 A;  1BCC D;  3CCE P;  1BGY J;  4LLH A;  3C1L A;  1EXJ A;  1VF5 C;  1MUU A;  2YO2 A;  1L0N J;  1HJB A;  2D2C B;  3L70 D;  3V2R A;  3CC2 P;  2XDJ A;  5APT A;  3CL3 D;  3GW6 A;  1YIT P;  5AW6 B;  1QGK B;  5AVU B;  1SQV G;  2O01 H;  5CBN A;  1Q2N A;  4IL6 E;  1ZXG A;  1PGP A;  4I7Z C;  2IYO A;  3H1K E;  5KTB A;  5E79 H;  2Z4E A;  1SQB J;  1GD2 E;  1FDI A;  3BAT A;  4U3F D;  3RK3 E;  3N4X A;  1NKN A;  1Y9B A;  3VP9 A;  1L4A D;  2E76 D;  2N9Y B;  3P7K A;  2JKV A;  4ZNC A;  3CCQ P;  3CXH H;  1NAY A;  4R4M A;  3OJA B;  4GOE A;  3TF5 A;  1BSN A;  2E75 D;  3AE8 C;  4LGD E;  3KYQ A;  4D6T J;  4N3Y B;  1S5L E;  1BGY G;  1X79 B;  3B5N C;  3VMA A;  2LKM A;  5APQ A;  2Q5U A;  4OH8 B;  1N7L A;  1L0N G;  2JDI H;  1QEX A;  1LWU C;  1AVO A;  2O1K A;  4ZKU A;  2P1J A;  3MHV A;  2C0X A;  3ZDM A;  2BEQ D;  3B5N A;  4OGQ D;  4N78 E;  2OYH C;  1L2P A;  1BDD A;  1KB9 D;  1ZME C;  1LWU A;  1KZU B;  1KIL D;  2NPS C;  3BCC J;  4O9B A;  2Q7C A;  2XKM A;  1NTZ K;  1NJI Q;  3MD0 A;  2WSF H;  4AYC A;  1OIP A;  3I56 P;  2JP3 A;  1N73 B;  4PD4 D;  1SQB G;  2C9L Y;  1Y8A A;  1P84 I;  5CCH D;  4PD4 I;  3L74 J;  3TGU D;  1HJ0 A;  2E43 A;  1EDJ A;  3NXS A;  1J1D C;  2H88 C;  2NPS A;  4H0L D;  2HG5 D;  1JNM A;  2B88 A;  3W67 A;  1NOH A;  2KB7 P;  5E79 E;  4Y99 B;  4UB6 H;  5KAF H;  4C7N B;  3NTN A;  1WMK A;  3H1K J;  5APU A;  2Q3E A;  2BCC D;  4D6T G;  2IBZ G;  1PPJ E;  5KLV K;  1G2C B;  3S4R A;  5KJ7 A;  3A0H H;  3WUV A;  2KNC B;  1SVF A;  1JY2 N;  1NTK K;  2ZT9 D;  2B87 A;  4U7J A;  3RL0 B;  1QX8 A;  1L0L E;  2R5D A;  1FZB A;  2M0B A;  1SFC D;  3VTP C;  3SFE C;  2W6B A;  2H43 A;  1JO5 A;  3CWB E;  5AVY B;  3BCC G;  3RK2 D;  3Q5R A;  4GIF A;  3WU2 E;  1SQV K;  1BE3 J;  5KKZ C;  1FE6 A;  3VOP A;  2FXP A;  1KYO D;  1VDF A;  3JCU H;  3TK1 A;  2KIK A;  3H1H E;  1PIX A;  3L74 G;  1ZW0 A;  3AEE C;  1GDT A;  3HD7 C;  2WPS A;  2XZR A;  5GTH H;  1AQ5 A;  2JEE A;  4GOF A;  3P8C E;  2M3B A;  1A02 J;  2HFE D;  4DZO A;  1RQU A;  1T2K C;  3PTZ A;  1AJY A;  1NTZ E;  4TT3 H;  4WY4 D;  1Q81 Q;  3KZI H;  3HD7 A;  3H1K G;  2O01 J;  3L73 E;  3EFF K;  4N78 D;  2YMY A;  1Q7Y Q;  5KAF E;  1VF5 B;  3CX5 H;  5CJ0 A;  1M57 D;  3FWL A;  2QA4 P;  1E5W A;  5AVQ B;  4L74 A;  3VN0 A;  5AW5 B;  2IDB A;  2FYU J;  5AW7 B;  1JY2 P;  1L0N K;  1OMI A;  2WMM A;  3MUD C;  3L72 D;  1S5L X;  3AE7 C;  3A0H E;  3H25 A;  1YQ3 C;  2ZYA A;  1IFP A;  2WPV B;  2Y0D A;  2JR8 A;  5AVZ B;  5DJU B;  1LTT C;  4I7Z B;  2WWW A;  1BE3 G;  1IZN B;  1BDC A;  1R8E A;  1PP9 J;  1NTK E;  3AEB C;  4M3L A;  1L0L J;  1QVG O;  1SQB K;  3LID A;  3V5B A;  1EXI A;  2PFX A;  1QVF O;  1JTH B;  2LR2 A;  3H1L J;  3FWN A;  1VPC A;  2XND H;  1SQV E;  3OA7 A;  2YKO A;  2W83 C;  4H44 B;  1JMM A;  5B5E E;  2QJK C;  2WPR A;  3H1H J;  3B5N B;  3B71 A;  1ZN5 A;  1LWU B;  1FC2 C;  1DEB A;  3TNU A;  2XU6 A;  2WSF J;  5L8R J;  4GDO A;  2YKQ A;  1ZR2 A;  3CWB D;  2FY8 A;  3HE5 A;  5AVS B;  3CI9 A;  2FYU G;  1SQX K;  2N1T B;  2IFN A;  4N6J A;  3H1I E;  3U1C A;  4RJT A;  1RF1 C;  2MJZ A;  2NPS B;  3G6E P;  1T3U A;  1FS0 E;  3IR9 A;  3U59 A;  3WUT A;  2H8P D;  1KD1 Q;  1N73 C;  1GL2 D;  1PP9 G;  2WZ7 A;  4W7Z A;  1BGY E;  1RF1 A;  1L0L G;  1OVR A;  1WT6 A;  1EDL A;  2AXC A;  1MV8 A;  3B4S A;  1L0N E;  1RHZ B;  5GTI H;  5AVW B;  1H8A A;  1P84 H;  1N86 A;  4PD4 H;  1N73 A;  1X8Y A;  1EZV I;  1OW8 A;  3SSU A;  1L4A C;  1LTJ B;  3H1L G;  2POH A;  4RKU J;  1Q86 Q;  1DD4 A;  1PGO A;  2B87 B;  1J1E C;  2M3E A;  1EDI A;  3PH0 A;  3H1H G;  2WIT A;  2AXT H;  3HE4 A;  1L4A A;  3N7N A;  1FDM A;  1DEE G;  2XV5 A;  1Q82 Q;  3HUS A;  1CSB A;  1SQB E;  1NU1 J;  3SWK A;  2W27 A;  2JJL A;  2RKL A;  5KLV D;  2Y9Z A;  3GG2 A;  4EI2 A;  3USS A;  1IFI A;  3IFM A;  3CCJ P;  2IPP A;  5AVV B;  4NPD A;  4Y28 J;  1KV4 A;  4K35 A;  4OGQ C;  1NTK D;  3AEF C;  2Q1K A;  1YHQ P;  2KS1 A;  4KJM A;  1M7L A;  1FBM A;  5TIS H;  1KIL C;  5KKZ B;  2KSE A;  4WVZ A;  1U7M A;  1DIP A;  1A02 F;  4ASW A;  1GK4 A;  4D6T E;  2IBZ E;  3JSV C;  2KZI A;  2P7J A;  3QWO C;  2ZJS E;  3HD7 B;  5CCH C;  2WQY C;  1KIL A;  3IN6 A;  3H1I J;  1NGM B;  2E74 D;  1IO4 A;  2LXB A;  2GUS A;  3TSI A;  3CCR P;  1CW5 A;  1VQ8 P;  1MFT A;  1BCC J;  1LTI C;  5CCH A;  3NMD A;  5GTI E;  1MKM A;  4DJG A;  1YTZ I;  5KAI H;  1P84 E;  3UIA A;  3BCC E;  3L70 J;  4WB4 A;  1JOC A;  3CCU P;  1AA0 A;  2Q9I A;  1H0T A;  2E5Y A;  1RH5 B;  2YIU C;  2UWJ E;  1NU1 G;  3A5T A;  1OW6 A;  3L74 E;  2QVA A;  3L36 A;  1URQ D;  2ZT9 C;  1HGV A;  2KLU A;  2HYN A;  2FFD A;  3JC2 2;  1SFC C;  2QJP C;  2FBW C;  2FYU K;  2K1A A;  4U3F J;  3A0B H;  3RK2 C;  2Y0C A;  1Z56 A;  3R2P A;  5TJH A;  4WBA A;  1SFC A;  1HTL C;  3IAO A;  1LTG C;  1S9K D;  4PJ0 E;  1X9V A;  3H1I G;  4HKZ H;  3Q5P A;  2ZYD A;  1L0L K;  1ZOY C;  4PV1 B;  3TNU B;  3V2Q A;  1SS1 A;  3HRN A;  1SQB D;  3HE5 B;  2QJK B;  4WY4 C;  4H44 C;  1K9M Q;  1ZRT E;  4JF7 A;  3L70 G;  3M06 A;  4W7Y A;  1J2J B;  3C9I A;  3Q5S A;  1BE3 E;  1JTH A;  1JMB A;  3L37 A;  1T3J A;  3A2A A;  3D6Z A;  3KDP B;  4WY4 A;  5KAI E;  2W8Z A;  1W2E A;  1IJD B;  1X0T A;  2N1T C;  4L75 A;  3EFG A;  1G1J A;  4XFJ A;  2WSC H;  2IBZ D;  1AFO A;  1RF1 B;  3VMX A;  4HH2 A;  2P10 A;  1KB9 I;  3PJS K;  1SQX D;  3E1R A;  4I6M C;  4U3F G;  2N1T A;  3L4F A;  2FYZ A;  2A45 H;  1VQ7 P;  2AEJ A;  1YBK A;  1FZG A;  2QM7 A;  3HE4 B;  1L4A B;  3AEC C;  3AED C;  2E76 B;  2BCC J;  3KXD A;  1LTJ C;  2FYU E;  4DOJ A;  2WT7 B;  3M0A A;  4XE5 B;  3HUS B;  5KJ7 C;  2FXM A;  4OWF A;  1OZH A;  3L71 E;  3E7K A;  1J1E B;  2JO1 A;  2E75 B;  4IOI H;  4NPE A;  3CXH E;  4K3A A;  4R4L A;  2E42 A;  1N7S D;  2I1J A;  1LTJ A;  2ZYG A;  1GW4 A;  1PP9 E;  1RF0 C;  2KS1 B;  1JUN A;  4C46 A;  2HOD A;  5BU5 A;  1N8R Q;  3P32 A;  1R5L A;  3MIW A;  2K88 A;  4HJG H;  3H1K D;  2HLO A;  1NU1 K;  4OGQ B;  3G4S P;  3RK3 D;  2SPZ A;  1RF0 A;  3CCS P;  3BRV B;  3BRT B;  2CPS A;  3H1L E;  2RH0 A;  4AQR D;  1R5S A;  1KIL B;  4QMA A;  1EQ7 A;  2R5B A;  1IFN A;  3L75 E;  3FXE A;  1OXZ A;  3F89 A;  1VQK P;  3OAK A;  1GL2 C;  1KYO I;  1QL1 A;  5CMZ A;  3FXD A;  5APV A;  2A06 E;  4IL6 X;  5K5G B;  1RY3 A;  2O1J A;  4BRY A;  1GW3 A;  4H0L B;  3BAS A;  3O8Z A;  1H0T B;  4HB1 A;  4GKG A;  2BCC G;  1HGZ A;  4YPC A;  1X22 A;  1GL2 A;  1BE3 D;  4IFD K;  2ZFC A;  1JEK A;  2YXR B;  5APW A;  2KZJ A;  1AVY A;  4XA4 A;  1LP1 B;  3PRJ A;  3HTK A;  2ZXX A;  4UB6 E;  2FFD B;  3W68 A;  2Q3I A;  3F5H A;  2IX7 C;  2P2U A;  2YIU B;  3GMA A;  4GT1 A;  2K3R A;  3G71 P;  1M1J B;  3H1J J;  1EZV E;  1PGJ A;  1HWT C;  3O6Q A;  1MZ9 A;  3L72 J;  2M8R A;  2ZT9 B;  1UII A;  3LIE A;  1KC8 Q;  2W90 A;  2FKW B;  1JY3 N;  3L71 J;  1UIX A;  2QRX A;  2RMZ A;  1KQG B;  1SFC B;  2QJP B;  4I1L A;  3FX0 A;  2FYN B;  2PGD A;  4YTP C;  3RK2 B;  3G3Z A;  4JBZ A;  1GU5 A;  3RL0 g;  1W2B O;  2FYU D;  1KTM A;  1Y47 A;  1NU1 E;  1NKZ B;  1PPJ D;  3JCU E;  1S72 P;  1SQP J;  2QM8 A;  3CXH D;  3Q1M A;  1YTZ T;  2Z5I A;  3E1I A;  1NTM J;  2E74 C;  4PV1 C;  1H89 A;  1FZA A;  2P58 A;  3L75 J;  5CHX A;  3PHL A;  4WY4 B;  5GTH E;  2V4H A;  2WSC J;  2QE7 H;  1GU4 A;  2K9J A;  1L0L D;  2OTL P;  1SQQ E;  5AW1 B;  1IC2 A;  2C9N Y;  2OYO A;  3KZI E;  3AE6 C;  3AEG C;  3H1J G;  3A3Y B;  2YXQ B;  1VQM P;  3L72 G;  4W80 A;  1D7M A;  1URQ C;  3CX5 E;  1RE3 C;  2CPB A;  3L71 G;  2L5G B;  1OX3 A;  3M91 A;  3H1H D;  3BVH A;  1JY3 P;  2A45 I;  2ZVN B;  1BCC E;  1FOS F;  3CCV P;  4H13 D;  2OYI A;  1GK6 A;  1URQ A;  3P8C D;  1RE3 A;  1KB9 H;  3AEA C;  1IK7 A;  2N9B A;  3L70 E;  1NTZ D;  2OQQ A;  2V7Q H;  2FXO A;  1CI6 A;  2P67 A;  1YIJ P;  3L73 D;  1SQP G;  1YJW P;  2E76 C;  1CZQ A;  2WSS H;  1NH4 A;  1NTM G;  2YKP A;  3C8V A;  1VQ4 P;  1E79 H;  3HUS C;  3CMA P;  5CCG D;  3M9Q A;  2HOD B;  3L75 G;  1LT1 A;  3A7O A;  2E75 C;  3CD6 P;  2WTY A;  4U3F E;  1LT9 C;  1PZQ A;  3ABV C;  2WT7 A;  1NAF A;  2A06 G;  1IFM A;  1G1I A;  5KLI B;  1YQ4 C;  1VQO P;  2A45 G;  2G3A A;  3EQ2 A;  2OAR A;  1NWQ A;  3VYI A;  2D2C D;  3M9B A;  1LT9 A;  2H89 C;  3AE9 C;  2C0W A;  1HUC A;  3M0D A;  2YMK A;  1FZE A;  1RQV A;  1SQQ J;  1FU1 A;  4IFF A;  4BRY B;  4CPG A;  1VQ6 P;  2HPC A;  1EZV G;  1GL2 B;  1KOR A;  2OGU A;  3MP7 B;  3MTU E;  1KMI Z;  4JQ0 D;  3KQG A;  1KQF B;  1SQV D;  1VQL P;  4OVN F;  2GM4 A;  3HTK B;  4H0L C;  3G9R A;  3ITK A;  1KYO H;  3IF4 A;  1KB9 E;  1USD A;  3S9O A;  1KIL E;  3VMY A;  4BWN A;  3O6Q B;  1SLQ A;  3WMM 0;  4PD4 E;  1S3J A;  1FAV A;  1S5L H;  2BAS A;  2JWD A;  2K9Y A;  2FFD C;  3V2P A;  3CX5 D;  3H1I D;  2O3J A;  2PAJ A;  1N7S C;  1OVV A;  1M1J C;  2YNY A;  2K37 A;  1LP1 A;  3RBX A;  2AXT E;  4EDF A;  2R3S A;  1LTB C;  5AW9 B;  3V6I A;  1FOS E;  2R3C A;  1N7S A;  3VP8 A;  2DW3 A;  1BGY D;  1M1J A;  2BCC E;  1VQ9 P;  4RES B;  1T8Z A;  2KYV A;  3QH9 A;  1VL2 A;  2FYN C;  3RK3 C;  2ZVO B;  2KOG A;  1KQS O;  1L0N D;  1SQQ G;  4AUW A;  4IFM A;  4I2L C;  5M1B A;  2Q6Q A;  1JCC A;  1NVO A; 
#chains in the Genus database with same CATH homology
 4MN4 C;  1BDD A;  2QRX A;  1JMB A;  4HJG H;  4GOD A;  2KI7 B;  2KIK A;  2LXC B;  3RGU A;  1ZW0 A;  3S1K A;  5CBN A;  1Q2N A;  1H0T A;  2B87 B;  4JBZ A;  1EDI A;  2SPZ A;  3PH0 A;  1X0T A;  1ZXG A;  2LR2 A;  2UWJ E;  4ZMD A;  4ASV A;  2M5A B;  2HR3 A;  4GOF A;  1EDJ A;  1JM0 A;  2QVA A;  4EYY Q;  1DEE G;  3FXE A;  2OTK E;  2B88 A;  1Y47 A;  2I8D A;  1S3J A;  2RKL A;  4WWI A;  2JWD A;  1OVU A;  1EC5 A;  4BXL A;  1FC2 C;  1LT1 A;  4NPF X;  5C39 A;  3FXD A;  2ZAE B;  5K5G B;  2R44 A;  1OVV A;  4NPD A;  4K35 A;  4ZNC A;  2Q1K A;  2P58 A;  5EFW B;  1H0T B;  4HB1 A;  1LP1 A;  4KJM A;  4GOE A;  2B89 A;  5CBO A;  1U7M A;  1EDK A;  2KZJ A;  4ASW A;  1LP1 B;  2WMM A;  2KZI A;  2B87 A;  3QWO C;  4HKZ H;  2M5A A;  4IOI H;  5DJU B;  2K3R A;  2KUB A;  1U7J A;  3MHV A;  2M0B A;  1SS1 A;  4NPE A;  4K3A A;  3ZDM A;  1OVR A;  2LXB A;  1BDC A;  5DJT B;  1EDL A;  4CPG A;  3MZW B;  1MFT A;  1NVO A;  2KS1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...