4NPFX

High-resolution structure of two tandem b domains of staphylococcal protein a connected by the conserved linker
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
115
structure length
115
Chain Sequence
DNKFNKEQQNAWYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAWYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein A
publication title Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 49
structure length 115
sequence length 115
chains with identical sequence Y
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npfX01
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npfX02
1DEEG 5CBOA 2QVAA 1EDIA 1LT1A 4WWIA 5CBNA 1ZXGA 3MZWB 2ZAEB 1MFTA 2KIKA 4CPGA 4GOEA 4K35A 1NVOA 1JMBA 5DJUB 5K5GB 1EDKA 2KZJA 4HKZH 2Q1KA 4GOFA 4IOIH 1OVVA 4GODA 2LXBA 4ZNCA 2B89A 4NPFX 2UWJE 2I8DA 1SS1A 2KS1B 4NPEA 1OVUA 4HJGH 1Y47A 2KZIA 2SPZA 4JBZA 4BXLA 3QWOC 2P58A 4NPDA 2JWDA 2WMMA 1S3JA 1U7MA 1Q2NA 1H0TA 2R44A 4K3AA 3RGUA 2LR2A 1LP1A 1EDLA 4EYYQ 1EC5A 3S1KA 4KJMA 2B88A 2RKLA 2M0BA 5DJTB 3MHVA 2LXCB 2M5AA 1JM0A 2KI7B 2OTKE 4ZMDA 1BDDA 4HB1A 4ASVA 1OVRA 2B87A 2QRXA 1LP1B 1U7JA 4MN4C 3PH0A 2HR3A 2M5AB 1X0TA 1ZW0A 3ZDMA 1BDCA 1EDJA 2K3RA 2KUBA 5C39A 5EFWB 2B87B 1FC2C 1H0TB 3FXEA 4ASWA 3FXDA
chains in the Genus database with same CATH superfamily
1RF1C 5AVTB 4YTPC 2I1JA 1SQPE 4PV1B 2YKPA 2JO1A 5KTBA 3AECC 1RH5B 4H0LC 1JMBA 4D6TE 5K5GB 1GL2B 2Q1KA 2E42A 2Q3IA 3VYIA 1SQVE 1PV3A 1S1CX 1OW7A 2OYHC 1FBMA 1L4AA 2R5BA 1G2CB 1SS1A 1S5LH 5BU8B 1LT9A 5L8RJ 1RE3C 2IBZE 1EXJA 1GK4A 1VQ5P 2A06G 1S9KD 3VMZA 1NOHA 5KLVD 2YXRB 5CMZA 4Y28J 2QJPC 4Y99C 2ZJSE 1OMIA 1OIPA 3SWKA 1UIIA 4PD4E 1VQKP 1H0TA 3NFQA 2J58A 3RGUA 3HE4B 2OTJP 1BCCJ 4EYYQ 1KD1Q 1OFCX 3BCCD 2B88A 5APVA 3BATA 1X9VA 2M0BA 1FE6A 3MHVA 1LTJB 1CSBA 2BCCJ 3D6YA 3M91A 1N86A 1J1DB 1SQQD 5AVSB 3EWKA 1L0LG 2Y0EA 3JSVC 3PLNA 3CL3D 3IAOA 2BEQD 1IFIA 1QX8A 3CX5I 1USDA 4WB4A 4DOJA 1BCCE 2Y9YA 4AQRD 1KQSO 4DZOA 3CWBG 3PH0A 3SFEC 2JP3A 2O1JA 1QGKB 3CD6P 2W6BA 1LWUC 3F89A 3WU2E 2YO2A 2FYUG 4OGQD 1OX3A 2K37A 1Y9BA 2WPSA 3B5ND 1SQXD 4H13B 2R32A 2QG4A 1LT1A 4XA4A 2QJKB 4CPGA 3H1HD 3E7KA 1NTME 1QVFO 1VQMP 1FOSF 2ZVNB 3V6IA 3T97B 4NPEA 1Y47A 1W2BO 1BE3E 3L74D 3B4SA 1KYOD 2FYNB 1KILE 1Q86Q 5B66H 3AE2C 3PHLA 1U7MA 3WUUA 1KQGB 2E75C 5AVXB 3HUSA 2HODB 5H2FH 1URQA 3H1KG 4XE5B 5GTHE 2GA1A 1ZLLA 1RE4C 1SQBD 5APTA 5KLVK 2O1KA 1FAVA 2IZ0A 1ZN5A 1QL1A 3G3ZA 4GDOA 2HFED 4UB6E 1RHZB 1NTKJ 3H1JG 1L0NG 4R4LA 1BDCA 1WT6A 4RESB 5C39A 1KB9E 3A7OA 4LC1A 2KS1A 2JKVA 2A06D 1ZXGA 4EIJA 1BSNA 2KNCA 2AXTH 3H6PA 1NTKE 2WT7B 1DEBA 1Q81Q 3CCQP 2H89C 5CCGA 4NPFX 1VQLP 4M3LA 3TSIA 1GZLA 2PFXA 3TNUA 4NPDA 3H1LE 2FKWB 3L73G 1BGYG 1YHQP 1KZUB 2FBWC 1L0LD 3HE5B 4PV1C 1AQ5A 1FDMA 1Q2NA 3F5HA 5CCHA 3L36A 1NTMD 3CWBD 5CJ0A 1AQTA 4RO0A 5M1BA 4GT1A 1EQ7A 3L75J 1BE3D 1SQPK 4U7JA 3GG2A 3QH9A 5AW2B 1KILD 1T3JA 1U7JA 3MUDA 3C1LA 1SQVK 1WMKA 2KXPB 3L37A 2N1TA 4B86A 2A45I 3AE5C 1RF0A 1CI6B 2KUBA 1GW4A 2WSEJ 1LTJC 2E76C 1K05A 2NZ2A 3AE7C 1IFJA 1DEEG 5APUA 5KAIE 3V4WA 2OYIB 1NU1G 2WSCH 4N3YB 1GL2D 1ZR4A 5DJUB 4A7PA 1LTBC 1JY2P 3CXHE 3CX5D 1WRGA 4OGQB 3H1KD 4C46A 4ZKPA 3I55P 1PIXA 1SFCA 2W8ZA 4DCKA 3B5NB 3TGUG 1PFIA 3RK3D 3VMAA 4H13C 3VOPA 5AVYB 5KKZC 5APQA 1FZCA 5APYA 1PP9G 3AE4C 2AEFA 3H1JD 1L0ND 2LXCB 2V4HA 2A45G 1OW6A 1JY2O 3Q2YA 2QA4P 1JEKA 1BSHA 3PP5A 2WQYC 2FYNC 3A0HH 2XU6A 2NPSA 3VP9A 3W67A 3Q5PA 1HVVA 4N78D 1NTZG 2KK7A 3TK1A 2RN0A 3Q3DA 1VQ9P 2E74C 3G9RA 4R4MA 3L71E 1KMIZ 3D6ZA 3HTKB 1ZV8A 1MV8A 5KLVJ 2CPSA 2YKOA 3D71A 1Y8AA 3R4YA 2ZAEB 5AVZB 3L73D 4GOEA 1BGYD 3SWYA 1N73B 2AXCA 3V2NA 3BCCJ 2WPVB 4PJ0H 5BVZA 1YTZI 4IOIH 5AVRB 1S4XA 2GUVA 2B89A 2Y9ZA 1S9KE 5CCGD 2D2CD 3B71A 3MD0A 4EOTA 1EZVI 1SQQJ 2P2UA 2OYHA 2KSEA 3S4RA 1N7SD 2Q5UA 1T2KC 2O01J 3BCCE 2FY8A 1LJ2A 1N8RQ 3V2PA 2HLOA 1LP1A 4AYCA 1LGHB 3UIAA 2H88C 4KT0J 4KJMA 1LT9B 1YBKA 1FDOA 3H1HJ 1NJIQ 1P84H 1M1JC 1JCDA 2YMKA 1NU1D 1NTKK 1R8EA 5GTIH 3U1AA 2AEMA 2N1TD 4TLFA 1SQXE 2WSEH 3M9QA 3SSUA 2J59M 3GLMA 3TGUD 3P8MC 2ZYGA 1EZVG 1YQ3C 2C9NY 3LW5J 4KHXA 3H32A 4I7ZC 4I2LC 2KZJA 1DIPA 2WSSH 1SQVJ 3IF4A 2G3AA 4WBAA 1KV4A 2LXBA 4ZNCA 2FFDA 3L74E 1SQBJ 1FOSE 2Q6QA 4IFFA 3CI9A 1OVUA 3L71D 2SPZA 3RL0D 1A02J 4BXLA 2IYPA 5AW7B 3AE6C 2OYIC 2POHA 4JPZB 1HH0A 2R44A 1SQBE 1NKZB 1HUCA 1VPCA 4OGQC 3AE9C 1QVGO 3RK3B 3KYQA 3KZIH 2K9JA 4C7RA 2L5GB 3B5NC 1LNQA 2H43A 1HGVA 2ZT9D 3B8EB 2B87A 2NPSD 3HUSB 1CZQA 3BRVB 2LKMA 3K5BA 1PPJG 2HR3A 2K9YA 3V5BA 1JUNA 2A06E 5AW9B 4JF7A 2FXOA 1FC2C 3FXEA 1YIJP 3I56P 4IL6X 1L0LJ 1GTWA 1JTHB 3M9HA 2YNYA 2BCCG 1NTMJ 3HD7D 3CWBJ 2JEEA 3P8CD 2JDIH 2NRGA 1IFDA 5TISH 2UWJE 3WMM0 2KS1B 1BE3J 1VQ6P 1L0LE 3MGNA 2RH0A 3MTUE 1FZFA 3OJAB 1NYHA 5BU5A 5AW8B 2O01H 5KAFH 4L74A 2IPPA 3CWBE 4OVNF 1SVFA 2CPBA 2BEZF 2FYUE 2D2CB 2HPCA 1HGZA 4DJGA 3NTNA 3GF7A 3CMEP 1IFMA 1FU1A 4JYCA 3SFDC 1YJ9P 1NWQA 3TNUB 1N7SB 1IFNA 3KHUA 2N9BA 1EZVD 2WVRA 3VP8A 1HWTC 1T3UA 2PAJA 3H1KJ 4HH2A 2WTYA 3L35A 1FJKA 1PGQA 2QM8A 1M90Q 2VRSA 1H89A 1UIXA 1KYOH 2OGUA 2YMYA 3HE4A 3TYYA 3CCLP 2QVAA 2WITA 5KJ7D 3A2AA 1PZQA 1A02F 3CX5E 4K35A 2K88A 4UB8E 2YXQB 2MJZA 2W6JH 3H1KE 2N1TB 1OVVA 1L0NJ 3H1JJ 1IK7A 3RK3E 3N4XA 1SQQK 2I8DA 1J1EB 2KSJA 2KZIA 5AW4B 3AEEC 1JY2N 3H1LJ 3Q5RA 2QJYB 2O3JA 2QM7A 3R2PA 1KILC 4PD4H 3M9BA 4EI2A 5CHXA 2WPRA 3H1JE 1L0NE 1P84I 3RL0g 1GD2E 1L4AD 3G6EP 1FS0E 2XDJA 1SQXK 1PPJD 1SFCB 2RKLA 3JCUE 4AUWA 3RL0B 2KI7B 2OTKE 2M3BA 4N78E 3L73J 3OAKA 3T97A 3E1IA 1GL2C 2BCCD 2OARA 4L76A 3H1IG 1X22A 3A0BE 3WU2H 2DW3A 2FYUD 3OW2O 3RK3C 3CC2P 2ZT9B 3L73E 3IR9A 1BGYE 3FXDA 1RQUA 1AJYA 3CCSP 5CBOA 1IZNB 2NPSB 3LIEA 5CBNA 3BRTB 1ZR2A 1MFTA 1VF5D 2QIWA 4JQ0D 3L75G 3KPEA 3HUSC 1IK9A 1SQBK 1K73Q 1YJNP 3L72G 2KLUA 5AVUB 1FZGA 5E79E 2BASA 1VQPP 1MUUA 1J1DC 2O01N 3CCUP 3AEAC 1NU1J 2W27A 3HD7B 4IL6E 1JNMA 1OW8A 3CPWO 5GTHH 1D7MA 1NAYA 3AEFC 3C8VA 3TGUJ 5DJTB 5APSA 4WY4A 3AE8C 1NO4A 1NU1E 1X79B 2KOGA 4HB1A 1H8AA 2QJKC 3AE1C 4BRYA 3CX5H 1URQD 1LP1B 4UB6H 5B5EE 1M1JA 1N7LA 1OWAA 3IFMA 1KTMA 3TGUE 3HE5A 5CCGC 2D2CC 3L71J 1KB9H 3M0DC 3FGAD 1L0LK 4YPCA 1LTGC 2K1AA 1N7SC 4QMAA 1YITP 3V2QA 2E76D 3CLQA 3GHGB 1NTMK 2P67A 1E79H 4H44D 1KQLA 1PP9E 2FYUK 1AVYA 1YQ4C 1NHLA 3VTPC 1Q90D 3JCUH 1VQOP 5AW1B 1EXIA 1HJ0A 1DD4A 1S5LE 5AW5B 3H32B 1AV1A 3S9OA 2P58A 2Q7CA 1NH4A 2OQQA 1RF1A 5KLVG 1NTZE 3U59A 3N7NA 3MUDC 3RBXA 4OWFA 2FFDB 2QEXP 2OYIA 3H1ID 2N1TC 1VQ7P 4IFDK 1USEA 2Z5HA 3AEBC 5AW0B 1QLED 1LTTC 1RE3A 2KP8A 2ZXEB 2ITAA 1RQVA 1VDFA 1SQQG 3B5NA 5CCHD 3EFFK 1J2JB 1L4AB 4ZKUA 3EFGA 3L75D 3RK2D 5AVVB 3ABVC 4RKUJ 3L72D 3Q5SA 1SQXJ 5KLIB 3FWLA 1K8AQ 2K9JB 2M3EA 3L70G 1EDJA 1RY3A 1FDIA 3I5CA 2WSFJ 5EFWB 5KAIH 3GMAA 2B87B 3RL0C 2IBZI 3KXDA 1H0TB 4W7ZA 2XV5A 3P8CE 1ZRTE 1L0NK 4WVZA 3CXHH 2IFNA 4PD4I 3H1HG 2WZ7A 1DH3A 3L74J 4GIFA 3A5TA 1KQFB 1U57A 1LWUA 2L91A 1DD3A 2I1KA 2YKQA 1YJWP 2C0XA 3PJSK 2ZT9C 1HF9A 1VF5B 2YO3A 3G4SP 2JWDA 4U3FG 2NPSC 4N6JA 1SQPG 1AFOA 5B66E 3MP7B 1K9MQ 1EDLA 1PP9D 4D6TG 1SFCD 3S1KA 5H2FE 2FXMA 3G71P 1LTAC 1SQVG 1LTIC 1EZVE 4WY4D 3USSA 1JM0A 4C7NA 2ZVOB 1ZOYC 4ZMDA 4HYTB 2ZYDA 2IBZG 3VMXA 2PGDA 2QRXA 1NTZD 4LGDE 1JMMA 3HD7C 2HPCB 3PRJA 1ZMEC 2A45H 5APWA 1JY3O 2K3RA 1RE4A 1G1IA 2WWWA 4TT3H 2IDBA 1PGJA 2XZRA 4LLHA 3RBZA 1URQB 3MZWB 3CC7P 3VN0A 2KLVA 1HJBA 4HKZH 1X8YA 2H7HA 4YXWH 3U1CA 2AXTE 1SP4A 1BCCG 1XTCC 3CCRP 4BWNA 2Z5IA 1K04A 4HJGH 3O6QA 1NU1K 4JBZA 2E76B 1QEXA 4H44B 1ZRTD 3GHGC 3CMAP 4H0LD 1PPJE 3TDKA 2B9BA 1N2DC 3A3YB 2LR2A 1KILA 1IC2A 2FYUJ 2QE7H 1S2EA 2IZ1A 3TF5A 1GMJA 1NTMG 2YIUB 1KFMA 2M5AA 2PP6A 3L70D 2JWAA 3AEDC 1VQNP 1KB9I 5AVWB 1QL2A 3D70A 2BCCE 2KNCB 3CCVP 2C9LY 5KJ7C 1BE3G 1MFZA 1N73C 1SLQA 2H8PD 2Y0DA 5KKZB 1M7LA 1FZEA 3BASA 2FFDC 1VQ4P 2JJLA 1GL2A 2WSCJ 3CC4P 1Z56A 2XKMA 5AW3B 2Q3EA 2GUSA 2WSFH 1PGOA 1G2CA 3CCEP 3AEGC 1VQ8P 4ASWA 2FXPA 4DT0A 1NTZK 3BVHA 1GU4A 4U3FD 3RK2B 1EDKA 1L4AC 1R5SA 3H25A 4GOFA 1KORA 1SQPD 1S5LX 1YTZT 2FYZA 1H88A 1MZ9A 1DX7A 1LT9C 4D6TD 5KLIC 2E74B 2HG5D 2HYNA 3LW5H 1SQVD 1XTGB 2R5DA 3ITKA 1JCCA 2V7QJ 1LTJA 3HRNA 5AW6B 1M8OB 2IBZD 1T8ZA 4O9BA 1S3JA 3M0AA 1JTHA 3JC22 1NGMB 3FWNA 1FZBA 1NTKG 4PD4D 2Q9IA 3O8ZA 4XFJA 3CCJP 1TU3F 1AVOA 4L75A 2G8YA 1OVRA 1VF5C 1OXZA 3H1LG 3A0HE 2E75D 3CXHI 1JOCA 5AVQB 5TJHA 1BCCD 4WY4B 3E1RA 1M1KQ 4I1LA 4W80A 1BGYJ 4YXDC 2W83C 1LTSC 3M0DA 4BRYB 1FZCB 3OA7A 4EDFA 3NXSA 1HBWA 1M1JB 3H1IJ 1N7SA 3P32A 1JB0J 4GKGA 5APXA 2HODA 4PJ0E 2ZYAA 4W7YA 2J5UA 4L73A 3IN6A 3H1IE 1G1JA 1URQC 4I7ZB 2P1JA 2JR8A 2QSIA 3L72J 4K3AA 2PRRA 3II6A 1M57D 2P7JA 3NMDA 1RF1B 1BDDA 2W6AA 4ASVA 3L75E 4H0LB 3L72E 4PV1D 1P84E 4H44C 2KB7P 2IX7C 4JYBA 4MN4C 2Y0CA 2KYVA 3LIDA 2OYHB 1E5WA 1IO4A 5GTIE 2WT7A 1ZW0A 2ZFCA 4IFMA 2RMZA 3WUTA 2YIUC 1GW3A 3WUVA 2QJPB 4Y99B 1EDIA 1NKNA 4UB8H 1KB9D 2C0WA 1NVOA 1PP9J 3CCMP 3AE3C 2XNDH 4GODA 2R3CA 1T6AA 1NTKD 3W68A 2V7QH 1KFNA 1OZHA 1AA0A 3L71G 1NTZJ 5CCHC 2ZXXA 3V2RA 2P10A 2OYOA 3RK2C 3H1LD 5CJ4A 4Z1MH 1LWUB 2MKVA 3KDPB 4RJTA 3GF3A 2W90A 1KC8Q 1JY3N 2E5YA 3KZIE 1CI6A 2GM4A 3PTZA 1NAFA 4H13D 4OH8B 1R5LA 2R3SA 1M56D 3A0BH 1YI2P 3EQ2A 1RF0C 3BCCG 3HD7A 1HTLC 2OTLP 1X0TA 1J1EC 4I6MC 3ZDMA 1Q82Q 4C7NB 1S72P 1KYOI 2IYOA 1L2PA 5KLVE 2QJYC 4WWIA 3P7KA 3KQGA 1GK6A 2IFMA 1JO5A 2KIKA 2E75B 1YYCA 1P84D 1IFPA 1SFCC 1Q7YQ 5E79H 2E74D 3L70J 3CXHD 4WY4C 5TISE 1SQXG 1SQQE 3QWOC 1GU5A 4IL6H 2N9YB 1FZCC 3Q1MA 2WMMA 1FJPA 1VL2A 5KAFE 3L70E 3GHGA 1EC5A 2E5TA 1PL5A 1MKMA 3O6QB 1IJDB 1PGPA 3MIWA 3L74G 1GDTA 1ZP0C 3HTKA 2M8RA 1W5CE 4U3FJ 3FX0A 1JY3P 1T2KD 3H1HE 5B5EH 1SQPJ 1KILB 2XNXA 3VMYA 5KJ7A 3L4FA 1N73A 1KN7A 4D6TJ 3GW6A 1W2EA 1CW5A 2M5AB 3SWFA 1SQBG 2Z4EA 3C9IA 1FZAA 3V4QA 2CK3H 2WPQA 4U3FE 2AEJA 1KYOE 3M06A 2E43A
chains in the Genus database with same CATH topology
1DEEG 5CBOA 2QVAA 1EDIA 1LT1A 4WWIA 5CBNA 1ZXGA 3MZWB 2ZAEB 1MFTA 2KIKA 4CPGA 4GOEA 4K35A 1NVOA 1JMBA 5DJUB 5K5GB 1EDKA 2KZJA 4HKZH 2Q1KA 4GOFA 4IOIH 1OVVA 4GODA 2LXBA 4ZNCA 2B89A 4NPFX 2UWJE 2I8DA 1SS1A 2KS1B 4NPEA 1OVUA 4HJGH 1Y47A 2KZIA 2SPZA 4JBZA 4BXLA 3QWOC 2P58A 4NPDA 2JWDA 2WMMA 1S3JA 1U7MA 1Q2NA 1H0TA 2R44A 4K3AA 3RGUA 2LR2A 1LP1A 1EDLA 4EYYQ 1EC5A 3S1KA 4KJMA 2B88A 2RKLA 2M0BA 5DJTB 3MHVA 2LXCB 2M5AA 1JM0A 2KI7B 2OTKE 4ZMDA 1BDDA 4HB1A 4ASVA 1OVRA 2B87A 2QRXA 1LP1B 1U7JA 4MN4C 3PH0A 2HR3A 2M5AB 1X0TA 1ZW0A 3ZDMA 1BDCA 1EDJA 2K3RA 2KUBA 5C39A 5EFWB 2B87B 1FC2C 1H0TB 3FXEA 4ASWA 3FXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DEE G;  5CBO A;  2QVA A;  1EDI A;  1LT1 A;  4WWI A;  5CBN A;  1ZXG A;  3MZW B;  2ZAE B;  1MFT A;  2KIK A;  4CPG A;  4GOE A;  4K35 A;  1NVO A;  1JMB A;  5DJU B;  5K5G B;  1EDK A;  2KZJ A;  4HKZ H;  2Q1K A;  4GOF A;  4IOI H;  1OVV A;  4GOD A;  2LXB A;  4ZNC A;  2B89 A;  4NPF X;  2UWJ E;  2I8D A;  1SS1 A;  2KS1 B;  4NPE A;  1OVU A;  4HJG H;  1Y47 A;  2KZI A;  2SPZ A;  4JBZ A;  4BXL A;  3QWO C;  2P58 A;  4NPD A;  2JWD A;  2WMM A;  1S3J A;  1U7M A;  1Q2N A;  1H0T A;  2R44 A;  4K3A A;  3RGU A;  2LR2 A;  1LP1 A;  1EDL A;  4EYY Q;  1EC5 A;  3S1K A;  4KJM A;  2B88 A;  2RKL A;  2M0B A;  5DJT B;  3MHV A;  2LXC B;  2M5A A;  1JM0 A;  2KI7 B;  2OTK E;  4ZMD A;  1BDD A;  4HB1 A;  4ASV A;  1OVR A;  2B87 A;  2QRX A;  1LP1 B;  1U7J A;  4MN4 C;  3PH0 A;  2HR3 A;  2M5A B;  1X0T A;  1ZW0 A;  3ZDM A;  1BDC A;  1EDJ A;  2K3R A;  2KUB A;  5C39 A;  5EFW B;  2B87 B;  1FC2 C;  1H0T B;  3FXE A;  4ASW A;  3FXD A; 
#chains in the Genus database with same CATH topology
 1RF1 C;  5AVT B;  4YTP C;  2I1J A;  1SQP E;  4PV1 B;  2YKP A;  2JO1 A;  5KTB A;  3AEC C;  1RH5 B;  4H0L C;  1JMB A;  4D6T E;  5K5G B;  1GL2 B;  2Q1K A;  2E42 A;  2Q3I A;  3VYI A;  1SQV E;  1PV3 A;  1S1C X;  1OW7 A;  2OYH C;  1FBM A;  1L4A A;  2R5B A;  1G2C B;  1SS1 A;  1S5L H;  5BU8 B;  1LT9 A;  5L8R J;  1RE3 C;  2IBZ E;  1EXJ A;  1GK4 A;  1VQ5 P;  2A06 G;  1S9K D;  3VMZ A;  1NOH A;  5KLV D;  2YXR B;  5CMZ A;  4Y28 J;  2QJP C;  4Y99 C;  2ZJS E;  1OMI A;  1OIP A;  3SWK A;  1UII A;  4PD4 E;  1VQK P;  1H0T A;  3NFQ A;  2J58 A;  3RGU A;  3HE4 B;  2OTJ P;  1BCC J;  4EYY Q;  1KD1 Q;  1OFC X;  3BCC D;  2B88 A;  5APV A;  3BAT A;  1X9V A;  2M0B A;  1FE6 A;  3MHV A;  1LTJ B;  1CSB A;  2BCC J;  3D6Y A;  3M91 A;  1N86 A;  1J1D B;  1SQQ D;  5AVS B;  3EWK A;  1L0L G;  2Y0E A;  3JSV C;  3PLN A;  3CL3 D;  3IAO A;  2BEQ D;  1IFI A;  1QX8 A;  3CX5 I;  1USD A;  4WB4 A;  4DOJ A;  1BCC E;  2Y9Y A;  4AQR D;  1KQS O;  4DZO A;  3CWB G;  3PH0 A;  3SFE C;  2JP3 A;  2O1J A;  1QGK B;  3CD6 P;  2W6B A;  1LWU C;  3F89 A;  3WU2 E;  2YO2 A;  2FYU G;  4OGQ D;  1OX3 A;  2K37 A;  1Y9B A;  2WPS A;  3B5N D;  1SQX D;  4H13 B;  2R32 A;  2QG4 A;  1LT1 A;  4XA4 A;  2QJK B;  4CPG A;  3H1H D;  3E7K A;  1NTM E;  1QVF O;  1VQM P;  1FOS F;  2ZVN B;  3V6I A;  3T97 B;  4NPE A;  1Y47 A;  1W2B O;  1BE3 E;  3L74 D;  3B4S A;  1KYO D;  2FYN B;  1KIL E;  1Q86 Q;  5B66 H;  3AE2 C;  3PHL A;  1U7M A;  3WUU A;  1KQG B;  2E75 C;  5AVX B;  3HUS A;  2HOD B;  5H2F H;  1URQ A;  3H1K G;  4XE5 B;  5GTH E;  2GA1 A;  1ZLL A;  1RE4 C;  1SQB D;  5APT A;  5KLV K;  2O1K A;  1FAV A;  2IZ0 A;  1ZN5 A;  1QL1 A;  3G3Z A;  4GDO A;  2HFE D;  4UB6 E;  1RHZ B;  1NTK J;  3H1J G;  1L0N G;  4R4L A;  1BDC A;  1WT6 A;  4RES B;  5C39 A;  1KB9 E;  3A7O A;  4LC1 A;  2KS1 A;  2JKV A;  2A06 D;  1ZXG A;  4EIJ A;  1BSN A;  2KNC A;  2AXT H;  3H6P A;  1NTK E;  2WT7 B;  1DEB A;  1Q81 Q;  3CCQ P;  2H89 C;  5CCG A;  4NPF X;  1VQL P;  4M3L A;  3TSI A;  1GZL A;  2PFX A;  3TNU A;  4NPD A;  3H1L E;  2FKW B;  3L73 G;  1BGY G;  1YHQ P;  1KZU B;  2FBW C;  1L0L D;  3HE5 B;  4PV1 C;  1AQ5 A;  1FDM A;  1Q2N A;  3F5H A;  5CCH A;  3L36 A;  1NTM D;  3CWB D;  5CJ0 A;  1AQT A;  4RO0 A;  5M1B A;  4GT1 A;  1EQ7 A;  3L75 J;  1BE3 D;  1SQP K;  4U7J A;  3GG2 A;  3QH9 A;  5AW2 B;  1KIL D;  1T3J A;  1U7J A;  3MUD A;  3C1L A;  1SQV K;  1WMK A;  2KXP B;  3L37 A;  2N1T A;  4B86 A;  2A45 I;  3AE5 C;  1RF0 A;  1CI6 B;  2KUB A;  1GW4 A;  2WSE J;  1LTJ C;  2E76 C;  1K05 A;  2NZ2 A;  3AE7 C;  1IFJ A;  1DEE G;  5APU A;  5KAI E;  3V4W A;  2OYI B;  1NU1 G;  2WSC H;  4N3Y B;  1GL2 D;  1ZR4 A;  5DJU B;  4A7P A;  1LTB C;  1JY2 P;  3CXH E;  3CX5 D;  1WRG A;  4OGQ B;  3H1K D;  4C46 A;  4ZKP A;  3I55 P;  1PIX A;  1SFC A;  2W8Z A;  4DCK A;  3B5N B;  3TGU G;  1PFI A;  3RK3 D;  3VMA A;  4H13 C;  3VOP A;  5AVY B;  5KKZ C;  5APQ A;  1FZC A;  5APY A;  1PP9 G;  3AE4 C;  2AEF A;  3H1J D;  1L0N D;  2LXC B;  2V4H A;  2A45 G;  1OW6 A;  1JY2 O;  3Q2Y A;  2QA4 P;  1JEK A;  1BSH A;  3PP5 A;  2WQY C;  2FYN C;  3A0H H;  2XU6 A;  2NPS A;  3VP9 A;  3W67 A;  3Q5P A;  1HVV A;  4N78 D;  1NTZ G;  2KK7 A;  3TK1 A;  2RN0 A;  3Q3D A;  1VQ9 P;  2E74 C;  3G9R A;  4R4M A;  3L71 E;  1KMI Z;  3D6Z A;  3HTK B;  1ZV8 A;  1MV8 A;  5KLV J;  2CPS A;  2YKO A;  3D71 A;  1Y8A A;  3R4Y A;  2ZAE B;  5AVZ B;  3L73 D;  4GOE A;  1BGY D;  3SWY A;  1N73 B;  2AXC A;  3V2N A;  3BCC J;  2WPV B;  4PJ0 H;  5BVZ A;  1YTZ I;  4IOI H;  5AVR B;  1S4X A;  2GUV A;  2B89 A;  2Y9Z A;  1S9K E;  5CCG D;  2D2C D;  3B71 A;  3MD0 A;  4EOT A;  1EZV I;  1SQQ J;  2P2U A;  2OYH A;  2KSE A;  3S4R A;  1N7S D;  2Q5U A;  1T2K C;  2O01 J;  3BCC E;  2FY8 A;  1LJ2 A;  1N8R Q;  3V2P A;  2HLO A;  1LP1 A;  4AYC A;  1LGH B;  3UIA A;  2H88 C;  4KT0 J;  4KJM A;  1LT9 B;  1YBK A;  1FDO A;  3H1H J;  1NJI Q;  1P84 H;  1M1J C;  1JCD A;  2YMK A;  1NU1 D;  1NTK K;  1R8E A;  5GTI H;  3U1A A;  2AEM A;  2N1T D;  4TLF A;  1SQX E;  2WSE H;  3M9Q A;  3SSU A;  2J59 M;  3GLM A;  3TGU D;  3P8M C;  2ZYG A;  1EZV G;  1YQ3 C;  2C9N Y;  3LW5 J;  4KHX A;  3H32 A;  4I7Z C;  4I2L C;  2KZJ A;  1DIP A;  2WSS H;  1SQV J;  3IF4 A;  2G3A A;  4WBA A;  1KV4 A;  2LXB A;  4ZNC A;  2FFD A;  3L74 E;  1SQB J;  1FOS E;  2Q6Q A;  4IFF A;  3CI9 A;  1OVU A;  3L71 D;  2SPZ A;  3RL0 D;  1A02 J;  4BXL A;  2IYP A;  5AW7 B;  3AE6 C;  2OYI C;  2POH A;  4JPZ B;  1HH0 A;  2R44 A;  1SQB E;  1NKZ B;  1HUC A;  1VPC A;  4OGQ C;  3AE9 C;  1QVG O;  3RK3 B;  3KYQ A;  3KZI H;  2K9J A;  4C7R A;  2L5G B;  3B5N C;  1LNQ A;  2H43 A;  1HGV A;  2ZT9 D;  3B8E B;  2B87 A;  2NPS D;  3HUS B;  1CZQ A;  3BRV B;  2LKM A;  3K5B A;  1PPJ G;  2HR3 A;  2K9Y A;  3V5B A;  1JUN A;  2A06 E;  5AW9 B;  4JF7 A;  2FXO A;  1FC2 C;  3FXE A;  1YIJ P;  3I56 P;  4IL6 X;  1L0L J;  1GTW A;  1JTH B;  3M9H A;  2YNY A;  2BCC G;  1NTM J;  3HD7 D;  3CWB J;  2JEE A;  3P8C D;  2JDI H;  2NRG A;  1IFD A;  5TIS H;  2UWJ E;  3WMM 0;  2KS1 B;  1BE3 J;  1VQ6 P;  1L0L E;  3MGN A;  2RH0 A;  3MTU E;  1FZF A;  3OJA B;  1NYH A;  5BU5 A;  5AW8 B;  2O01 H;  5KAF H;  4L74 A;  2IPP A;  3CWB E;  4OVN F;  1SVF A;  2CPB A;  2BEZ F;  2FYU E;  2D2C B;  2HPC A;  1HGZ A;  4DJG A;  3NTN A;  3GF7 A;  3CME P;  1IFM A;  1FU1 A;  4JYC A;  3SFD C;  1YJ9 P;  1NWQ A;  3TNU B;  1N7S B;  1IFN A;  3KHU A;  2N9B A;  1EZV D;  2WVR A;  3VP8 A;  1HWT C;  1T3U A;  2PAJ A;  3H1K J;  4HH2 A;  2WTY A;  3L35 A;  1FJK A;  1PGQ A;  2QM8 A;  1M90 Q;  2VRS A;  1H89 A;  1UIX A;  1KYO H;  2OGU A;  2YMY A;  3HE4 A;  3TYY A;  3CCL P;  2QVA A;  2WIT A;  5KJ7 D;  3A2A A;  1PZQ A;  1A02 F;  3CX5 E;  4K35 A;  2K88 A;  4UB8 E;  2YXQ B;  2MJZ A;  2W6J H;  3H1K E;  2N1T B;  1OVV A;  1L0N J;  3H1J J;  1IK7 A;  3RK3 E;  3N4X A;  1SQQ K;  2I8D A;  1J1E B;  2KSJ A;  2KZI A;  5AW4 B;  3AEE C;  1JY2 N;  3H1L J;  3Q5R A;  2QJY B;  2O3J A;  2QM7 A;  3R2P A;  1KIL C;  4PD4 H;  3M9B A;  4EI2 A;  5CHX A;  2WPR A;  3H1J E;  1L0N E;  1P84 I;  3RL0 g;  1GD2 E;  1L4A D;  3G6E P;  1FS0 E;  2XDJ A;  1SQX K;  1PPJ D;  1SFC B;  2RKL A;  3JCU E;  4AUW A;  3RL0 B;  2KI7 B;  2OTK E;  2M3B A;  4N78 E;  3L73 J;  3OAK A;  3T97 A;  3E1I A;  1GL2 C;  2BCC D;  2OAR A;  4L76 A;  3H1I G;  1X22 A;  3A0B E;  3WU2 H;  2DW3 A;  2FYU D;  3OW2 O;  3RK3 C;  3CC2 P;  2ZT9 B;  3L73 E;  3IR9 A;  1BGY E;  3FXD A;  1RQU A;  1AJY A;  3CCS P;  5CBO A;  1IZN B;  2NPS B;  3LIE A;  5CBN A;  3BRT B;  1ZR2 A;  1MFT A;  1VF5 D;  2QIW A;  4JQ0 D;  3L75 G;  3KPE A;  3HUS C;  1IK9 A;  1SQB K;  1K73 Q;  1YJN P;  3L72 G;  2KLU A;  5AVU B;  1FZG A;  5E79 E;  2BAS A;  1VQP P;  1MUU A;  1J1D C;  2O01 N;  3CCU P;  3AEA C;  1NU1 J;  2W27 A;  3HD7 B;  4IL6 E;  1JNM A;  1OW8 A;  3CPW O;  5GTH H;  1D7M A;  1NAY A;  3AEF C;  3C8V A;  3TGU J;  5DJT B;  5APS A;  4WY4 A;  3AE8 C;  1NO4 A;  1NU1 E;  1X79 B;  2KOG A;  4HB1 A;  1H8A A;  2QJK C;  3AE1 C;  4BRY A;  3CX5 H;  1URQ D;  1LP1 B;  4UB6 H;  5B5E E;  1M1J A;  1N7L A;  1OWA A;  3IFM A;  1KTM A;  3TGU E;  3HE5 A;  5CCG C;  2D2C C;  3L71 J;  1KB9 H;  3M0D C;  3FGA D;  1L0L K;  4YPC A;  1LTG C;  2K1A A;  1N7S C;  4QMA A;  1YIT P;  3V2Q A;  2E76 D;  3CLQ A;  3GHG B;  1NTM K;  2P67 A;  1E79 H;  4H44 D;  1KQL A;  1PP9 E;  2FYU K;  1AVY A;  1YQ4 C;  1NHL A;  3VTP C;  1Q90 D;  3JCU H;  1VQO P;  5AW1 B;  1EXI A;  1HJ0 A;  1DD4 A;  1S5L E;  5AW5 B;  3H32 B;  1AV1 A;  3S9O A;  2P58 A;  2Q7C A;  1NH4 A;  2OQQ A;  1RF1 A;  5KLV G;  1NTZ E;  3U59 A;  3N7N A;  3MUD C;  3RBX A;  4OWF A;  2FFD B;  2QEX P;  2OYI A;  3H1I D;  2N1T C;  1VQ7 P;  4IFD K;  1USE A;  2Z5H A;  3AEB C;  5AW0 B;  1QLE D;  1LTT C;  1RE3 A;  2KP8 A;  2ZXE B;  2ITA A;  1RQV A;  1VDF A;  1SQQ G;  3B5N A;  5CCH D;  3EFF K;  1J2J B;  1L4A B;  4ZKU A;  3EFG A;  3L75 D;  3RK2 D;  5AVV B;  3ABV C;  4RKU J;  3L72 D;  3Q5S A;  1SQX J;  5KLI B;  3FWL A;  1K8A Q;  2K9J B;  2M3E A;  3L70 G;  1EDJ A;  1RY3 A;  1FDI A;  3I5C A;  2WSF J;  5EFW B;  5KAI H;  3GMA A;  2B87 B;  3RL0 C;  2IBZ I;  3KXD A;  1H0T B;  4W7Z A;  2XV5 A;  3P8C E;  1ZRT E;  1L0N K;  4WVZ A;  3CXH H;  2IFN A;  4PD4 I;  3H1H G;  2WZ7 A;  1DH3 A;  3L74 J;  4GIF A;  3A5T A;  1KQF B;  1U57 A;  1LWU A;  2L91 A;  1DD3 A;  2I1K A;  2YKQ A;  1YJW P;  2C0X A;  3PJS K;  2ZT9 C;  1HF9 A;  1VF5 B;  2YO3 A;  3G4S P;  2JWD A;  4U3F G;  2NPS C;  4N6J A;  1SQP G;  1AFO A;  5B66 E;  3MP7 B;  1K9M Q;  1EDL A;  1PP9 D;  4D6T G;  1SFC D;  3S1K A;  5H2F E;  2FXM A;  3G71 P;  1LTA C;  1SQV G;  1LTI C;  1EZV E;  4WY4 D;  3USS A;  1JM0 A;  4C7N A;  2ZVO B;  1ZOY C;  4ZMD A;  4HYT B;  2ZYD A;  2IBZ G;  3VMX A;  2PGD A;  2QRX A;  1NTZ D;  4LGD E;  1JMM A;  3HD7 C;  2HPC B;  3PRJ A;  1ZME C;  2A45 H;  5APW A;  1JY3 O;  2K3R A;  1RE4 A;  1G1I A;  2WWW A;  4TT3 H;  2IDB A;  1PGJ A;  2XZR A;  4LLH A;  3RBZ A;  1URQ B;  3MZW B;  3CC7 P;  3VN0 A;  2KLV A;  1HJB A;  4HKZ H;  1X8Y A;  2H7H A;  4YXW H;  3U1C A;  2AXT E;  1SP4 A;  1BCC G;  1XTC C;  3CCR P;  4BWN A;  2Z5I A;  1K04 A;  4HJG H;  3O6Q A;  1NU1 K;  4JBZ A;  2E76 B;  1QEX A;  4H44 B;  1ZRT D;  3GHG C;  3CMA P;  4H0L D;  1PPJ E;  3TDK A;  2B9B A;  1N2D C;  3A3Y B;  2LR2 A;  1KIL A;  1IC2 A;  2FYU J;  2QE7 H;  1S2E A;  2IZ1 A;  3TF5 A;  1GMJ A;  1NTM G;  2YIU B;  1KFM A;  2M5A A;  2PP6 A;  3L70 D;  2JWA A;  3AED C;  1VQN P;  1KB9 I;  5AVW B;  1QL2 A;  3D70 A;  2BCC E;  2KNC B;  3CCV P;  2C9L Y;  5KJ7 C;  1BE3 G;  1MFZ A;  1N73 C;  1SLQ A;  2H8P D;  2Y0D A;  5KKZ B;  1M7L A;  1FZE A;  3BAS A;  2FFD C;  1VQ4 P;  2JJL A;  1GL2 A;  2WSC J;  3CC4 P;  1Z56 A;  2XKM A;  5AW3 B;  2Q3E A;  2GUS A;  2WSF H;  1PGO A;  1G2C A;  3CCE P;  3AEG C;  1VQ8 P;  4ASW A;  2FXP A;  4DT0 A;  1NTZ K;  3BVH A;  1GU4 A;  4U3F D;  3RK2 B;  1EDK A;  1L4A C;  1R5S A;  3H25 A;  4GOF A;  1KOR A;  1SQP D;  1S5L X;  1YTZ T;  2FYZ A;  1H88 A;  1MZ9 A;  1DX7 A;  1LT9 C;  4D6T D;  5KLI C;  2E74 B;  2HG5 D;  2HYN A;  3LW5 H;  1SQV D;  1XTG B;  2R5D A;  3ITK A;  1JCC A;  2V7Q J;  1LTJ A;  3HRN A;  5AW6 B;  1M8O B;  2IBZ D;  1T8Z A;  4O9B A;  1S3J A;  3M0A A;  1JTH A;  3JC2 2;  1NGM B;  3FWN A;  1FZB A;  1NTK G;  4PD4 D;  2Q9I A;  3O8Z A;  4XFJ A;  3CCJ P;  1TU3 F;  1AVO A;  4L75 A;  2G8Y A;  1OVR A;  1VF5 C;  1OXZ A;  3H1L G;  3A0H E;  2E75 D;  3CXH I;  1JOC A;  5AVQ B;  5TJH A;  1BCC D;  4WY4 B;  3E1R A;  1M1K Q;  4I1L A;  4W80 A;  1BGY J;  4YXD C;  2W83 C;  1LTS C;  3M0D A;  4BRY B;  1FZC B;  3OA7 A;  4EDF A;  3NXS A;  1HBW A;  1M1J B;  3H1I J;  1N7S A;  3P32 A;  1JB0 J;  4GKG A;  5APX A;  2HOD A;  4PJ0 E;  2ZYA A;  4W7Y A;  2J5U A;  4L73 A;  3IN6 A;  3H1I E;  1G1J A;  1URQ C;  4I7Z B;  2P1J A;  2JR8 A;  2QSI A;  3L72 J;  4K3A A;  2PRR A;  3II6 A;  1M57 D;  2P7J A;  3NMD A;  1RF1 B;  1BDD A;  2W6A A;  4ASV A;  3L75 E;  4H0L B;  3L72 E;  4PV1 D;  1P84 E;  4H44 C;  2KB7 P;  2IX7 C;  4JYB A;  4MN4 C;  2Y0C A;  2KYV A;  3LID A;  2OYH B;  1E5W A;  1IO4 A;  5GTI E;  2WT7 A;  1ZW0 A;  2ZFC A;  4IFM A;  2RMZ A;  3WUT A;  2YIU C;  1GW3 A;  3WUV A;  2QJP B;  4Y99 B;  1EDI A;  1NKN A;  4UB8 H;  1KB9 D;  2C0W A;  1NVO A;  1PP9 J;  3CCM P;  3AE3 C;  2XND H;  4GOD A;  2R3C A;  1T6A A;  1NTK D;  3W68 A;  2V7Q H;  1KFN A;  1OZH A;  1AA0 A;  3L71 G;  1NTZ J;  5CCH C;  2ZXX A;  3V2R A;  2P10 A;  2OYO A;  3RK2 C;  3H1L D;  5CJ4 A;  4Z1M H;  1LWU B;  2MKV A;  3KDP B;  4RJT A;  3GF3 A;  2W90 A;  1KC8 Q;  1JY3 N;  2E5Y A;  3KZI E;  1CI6 A;  2GM4 A;  3PTZ A;  1NAF A;  4H13 D;  4OH8 B;  1R5L A;  2R3S A;  1M56 D;  3A0B H;  1YI2 P;  3EQ2 A;  1RF0 C;  3BCC G;  3HD7 A;  1HTL C;  2OTL P;  1X0T A;  1J1E C;  4I6M C;  3ZDM A;  1Q82 Q;  4C7N B;  1S72 P;  1KYO I;  2IYO A;  1L2P A;  5KLV E;  2QJY C;  4WWI A;  3P7K A;  3KQG A;  1GK6 A;  2IFM A;  1JO5 A;  2KIK A;  2E75 B;  1YYC A;  1P84 D;  1IFP A;  1SFC C;  1Q7Y Q;  5E79 H;  2E74 D;  3L70 J;  3CXH D;  4WY4 C;  5TIS E;  1SQX G;  1SQQ E;  3QWO C;  1GU5 A;  4IL6 H;  2N9Y B;  1FZC C;  3Q1M A;  2WMM A;  1FJP A;  1VL2 A;  5KAF E;  3L70 E;  3GHG A;  1EC5 A;  2E5T A;  1PL5 A;  1MKM A;  3O6Q B;  1IJD B;  1PGP A;  3MIW A;  3L74 G;  1GDT A;  1ZP0 C;  3HTK A;  2M8R A;  1W5C E;  4U3F J;  3FX0 A;  1JY3 P;  1T2K D;  3H1H E;  5B5E H;  1SQP J;  1KIL B;  2XNX A;  3VMY A;  5KJ7 A;  3L4F A;  1N73 A;  1KN7 A;  4D6T J;  3GW6 A;  1W2E A;  1CW5 A;  2M5A B;  3SWF A;  1SQB G;  2Z4E A;  3C9I A;  1FZA A;  3V4Q A;  2CK3 H;  2WPQ A;  4U3F E;  2AEJ A;  1KYO E;  3M06 A;  2E43 A; 
#chains in the Genus database with same CATH homology
 1DEE G;  5CBO A;  2QVA A;  1EDI A;  1LT1 A;  4WWI A;  5CBN A;  1ZXG A;  3MZW B;  2ZAE B;  1MFT A;  2KIK A;  4CPG A;  4GOE A;  4K35 A;  1NVO A;  1JMB A;  5DJU B;  5K5G B;  1EDK A;  2KZJ A;  4HKZ H;  2Q1K A;  4GOF A;  4IOI H;  1OVV A;  4GOD A;  2LXB A;  4ZNC A;  2B89 A;  4NPF X;  2UWJ E;  2I8D A;  1SS1 A;  2KS1 B;  4NPE A;  1OVU A;  4HJG H;  1Y47 A;  2KZI A;  2SPZ A;  4JBZ A;  4BXL A;  3QWO C;  2P58 A;  4NPD A;  2JWD A;  2WMM A;  1S3J A;  1U7M A;  1Q2N A;  1H0T A;  2R44 A;  4K3A A;  3RGU A;  2LR2 A;  1LP1 A;  1EDL A;  4EYY Q;  1EC5 A;  3S1K A;  4KJM A;  2B88 A;  2RKL A;  2M0B A;  5DJT B;  3MHV A;  2LXC B;  2M5A A;  1JM0 A;  2KI7 B;  2OTK E;  4ZMD A;  1BDD A;  4HB1 A;  4ASV A;  1OVR A;  2B87 A;  2QRX A;  1LP1 B;  1U7J A;  4MN4 C;  3PH0 A;  2HR3 A;  2M5A B;  1X0T A;  1ZW0 A;  3ZDM A;  1BDC A;  1EDJ A;  2K3R A;  2KUB A;  5C39 A;  5EFW B;  2B87 B;  1FC2 C;  1H0T B;  3FXE A;  4ASW A;  3FXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...