4NPFX

High-resolution structure of two tandem b domains of staphylococcal protein a connected by the conserved linker
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
115
structure length
115
Chain Sequence
DNKFNKEQQNAWYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAWYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin G-binding protein A
publication title Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
total genus 49
structure length 115
sequence length 115
chains with identical sequence Y
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npfX01
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npfX02
4NPEA 1OVRA 3FXDA 1H0TB 1S3JA 1LT1A 2M0BA 1BDDA 1U7JA 2RKLA 4K35A 2P58A 2QVAA 3MZWB 4CPGA 1U7MA 3QWOC 4WWIA 2I8DA 2B89A 4HB1A 3RGUA 2Q1KA 1MFTA 1NVOA 5DJUB 4K3AA 2UWJE 2LR2A 4GOFA 2KI7B 4ASVA 4MN4C 1EDJA 1Q2NA 1EDKA 1ZXGA 5CBOA 1EDLA 1JM0A 1FC2C 2SPZA 2KIKA 4HKZH 1Y47A 5EFWB 2B87B 4NPFX 3PH0A 4JBZA 2ZAEB 2LXCB 2K3RA 5DJTB 4NPDA 2B87A 2JWDA 5C39A 2M5AA 4ASWA 4GODA 3ZDMA 1X0TA 4EYYQ 5K5GB 1LP1A 2WMMA 2R44A 1DEEG 1BDCA 4ZMDA 1OVVA 2LXBA 1OVUA 1ZW0A 2QRXA 4BXLA 1SS1A 1EDIA 2KS1B 2M5AB 4IOIH 4KJMA 4HJGH 4ZNCA 3FXEA 1LP1B 4GOEA 2KUBA 2B88A 2OTKE 2KZJA 1H0TA 1EC5A 2KZIA 5CBNA 1JMBA 2HR3A 3S1KA 3MHVA
chains in the Genus database with same CATH superfamily
2R5BA 4NPEA 2KNCA 5AW2B 3L74E 4O9BA 1AFOA 1FDMA 1JCCA 1SQPK 2I1JA 3AEAC 1X9VA 3HTKA 3Q5PA 1CW5A 2BASA 5KAIE 2I8DA 2O01N 1AQ5A 2AXTE 4Y28J 5TJHA 4QMAA 1SQXK 2A06E 1MV8A 4RKUJ 3SWYA 1VQ6P 2QIWA 3CC7P 3H1LE 4U3FG 3SFDC 1AVOA 1SQPD 3A0BH 3AE6C 2WPSA 3E1IA 3A5TA 4NPDA 1XTGB 1L4AB 3N7NA 1NTZK 2FFDA 4YXWH 2RN0A 2Q5UA 4BRYB 1ZW0A 3L74J 2R5DA 1YJNP 3M0AA 3PJSK 3CXHH 2YKQA 4GOEA 1GD2E 3VP9A 5CCGA 1YJWP 5AW3B 3IR9A 1YIJP 1URQB 1SQPE 1ZV8A 1N2DC 1JO5A 1GMJA 5KAFE 1EXIA 1NAYA 3P8MC 1LWUB 4Z1MH 1U7JA 1P84I 3H1LJ 1SQXE 2RKLA 5KLIB 2NPSC 3SWFA 2E74D 3D71A 2W8ZA 3RL0g 2JJLA 2N1TC 1H88A 4IFFA 1SFCC 1SQBG 1J1EC 1ZXGA 4UB8H 1N7SC 2ZYDA 1HUCA 1LTAC 1YBKA 5EFWB 3GF3A 1NTZE 1S9KD 2PGDA 3L75D 3G3ZA 2ZAEB 3H25A 2IFNA 1K04A 1VQ7P 1W2EA 5AVXB 1FBMA 2K88A 1X0TA 1NU1G 1SQPJ 2HPCB 2WT7B 1BDCA 4L75A 1N73A 3LIDA 1VQ8P 3L70D 2YO2A 2W6BA 1SQXJ 1YYCA 2K9JA 3VP8A 2KOGA 3G9RA 1HJ0A 5AVRB 2BEZF 2RMZA 1GK4A 1S9KE 3L75E 4PV1B 2E75C 1JTHA 1S3JA 2VRSA 1NTKK 2E5YA 1RE3C 2NPSA 1Q81Q 4IFDK 1NTMK 1CI6A 4D6TG 1NTZJ 3KPEA 4H13B 1OW8A 2N1TA 3H1KE 3L70E 2A45I 1SFCA 3AECC 3HRNA 4Y99B 1IFPA 2OYHB 2J58A 1VQ4P 3D6ZA 1EDJA 1N7SA 1Q82Q 4H0LD 3TYYA 4M3LA 4C7NA 3PP5A 2V7QH 1MZ9A 3LW5J 1NTKD 3H32B 1NTMD 3OJAB 5M1BA 5DJTB 1EZVE 2QJYB 4UB6H 2W90A 5C39A 3L36A 3HE4B 5AVUB 1LP1A 3CLQA 3L75J 1YHQP 2ZVOB 1LGHB 2OYIC 3O6QA 1IFIA 1ZOYC 2FYUG 1BSHA 1SS1A 4EIJA 1LTJB 2IBZD 3L73D 1URQC 3TDKA 4OGQB 1G2CB 1KB9D 3FWNA 1L0NK 1EC5A 3CWBD 3CX5D 1RF0A 3M06A 3H1KJ 2CK3H 1DX7A 1NTKE 1DH3A 5KLVK 1S5LE 3TSIA 1NTME 3S1KA 1QL1A 1NGMB 3CCQP 1RF1C 1JY2P 4XFJA 3VTPC 3G4SP 5AW8B 2WZ7A 1RE3A 1IO4A 4YTPC 1DEBA 2BCCG 3P8CD 2XV5A 1BE3G 2P58A 3CC4P 5AVYB 4HH2A 4CPGA 1U7MA 2WQYC 1GW4A 4I7ZB 3TGUE 4LLHA 1BGYJ 1JOCA 3PRJA 5H2FH 2W27A 4IL6X 1EXJA 1KB9E 5KLVD 1EDKA 1J1DC 3HD7D 5B66H 3KDPB 3CWBE 5CCHC 1FC2C 1HVVA 3RK3C 4OWFA 3L4FA 3A0HH 1JY3P 3GMAA 4BRYA 2HFED 1VQMP 1GK6A 2Y0DA 3EWKA 3P8CE 1UIIA 4GIFA 3CCRP 4XE5B 1NTKJ 1SQBJ 2OYIA 3JSVC 1AA0A 2ZT9B 3LIEA 1L0NE 1PP9G 1FAVA 1G1IA 4BXLA 2W6AA 1URQA 2N1TD 1JY2N 1NKZB 3U1AA 5KLVE 4WY4D 1FZCC 4PV1C 3E1RA 2OTJP 3TGUJ 3T97B 1N7SD 2AEMA 1RF1A 2KZIA 2FYZA 1QL2A 1L0LD 2IDBA 3FXDA 1H0TB 2O01J 2HYNA 3CCLP 1RE4C 3EQ2A 1T8ZA 4Y99C 1X22A 3O8ZA 3GW6A 2OYHC 4HB1A 3V2PA 4PD4H 1FJPA 2QM7A 5AW0B 3P32A 1QVGO 1VQ5P 1PPJD 5AW6B 4N78D 4B86A 5CCHA 3CCUP 3AEEC 3A3YB 4H44B 5CBOA 1Q7YQ 2FXOA 2XKMA 2M3BA 1L0NJ 4AQRD 4HKZH 3D6YA 3H1JD 1N86A 2HPCA 2GM4A 5KLVJ 1YQ3C 3C9IA 1ZRTE 1RHZB 3Q3DA 2E75D 3NFQA 2JWDA 1LT9C 2HODA 3H1HJ 2P2UA 4KT0J 1FDOA 2WMMA 4PD4I 1ZR4A 2WPVB 5AW9B 2ZYAA 3HUSB 1PPJE 4N78E 3WU2E 4KJMA 3FGAD 1FZCA 2JDIH 2WSFH 1GL2B 2OTKE 1HJBA 3RK2C 3UIAA 4XA4A 2H7HA 1VQOP 3Q1MA 3H1JE 4KHXA 2KSEA 1VDFA 1RE4A 2A45G 1DD4A 4TLFA 3GF7A 2A06D 1LTTC 2OYHA 2KSJA 3L72J 4EOTA 3H1LD 2WSEH 2XZRA 2D2CD 3CXHD 3M0DC 4I2LC 3ITKA 1OFCX 3H32A 1IFJA 2Z5IA 3WMM0 1JM0A 2KXPB 3A0BE 2QSIA 1DD3A 2SPZA 3HE4A 4DJGA 2KK7A 2P7JA 2WSCJ 3PH0A 3GHGB 2E76C 4L76A 5APQA 1PGPA 3C8VA 1VF5C 1LT9A 2B87A 3RBZA 1VL2A 5AW5B 3BCCE 2IZ0A 2L5GB 3ZDMA 3H1JJ 1IK7A 2R3CA 4N3YB 1FJKA 3CXHE 3C1LA 3R4YA 2KS1B 2Z5HA 2K37A 1BCCG 3B5NC 2JO1A 1KILB 3B4SA 1K8AQ 5CCHD 2QE7H 4U7JA 1SQXD 1WRGA 1P84H 1HGZA 1T3JA 3RK3D 3PTZA 3H1IE 2QG4A 4JF7A 3CCVP 3L70G 4ZKUA 1R5SA 3S9OA 1KQFB 3GG2A 5CJ0A 2OYOA 1S72P 3M0DA 3CMEP 3G71P 1NTZD 3KZIH 4K3AA 2KLVA 3BCCJ 2LR2A 4UB8E 3VMXA 3AE3C 3KQGA 3W68A 3NTNA 2LKMA 1KZUB 1EDLA 1HBWA 1MUUA 3RK3E 3Q5SA 1M1JC 2M3EA 4OVNF 2G3AA 2GUVA 1JEKA 1PL5A 1T6AA 3P7KA 1ZMEC 2FBWC 4YXDC 2JWAA 1DEEG 2O3JA 3H1IJ 3L71G 3OA7A 4JPZB 3B5NA 1RY3A 3MD0A 1PIXA 1JMMA 1NTMG 5APTA 1H0TA 1PV3A 4I1LA 1YQ4C 4A7PA 1QLED 3CC2P 5AVWB 3AEGC 4C46A 2CPBA 3BASA 3AE9C 3H1KD 2A45H 2M0BA 2IBZG 3L73G 3QWOC 2YIUB 5AVTB 2C9NY 3CWBG 2O1JA 1BGYD 1EZVD 4WB4A 1KC8Q 5KJ7C 1SQBK 1KYOD 3GHGC 3RK2D 2QJKB 1M1JA 2E5TA 1Y47A 2DW3A 1FE6A 3KXDA 1EQ7A 1VQPP 4UB6E 2M8RA 2E74B 2JR8A 2MJZA 3OAKA 3RL0D 1M1KQ 2CPSA 2HLOA 1CSBA 2R44A 1RQUA 4DOJA 1L4AC 1PGOA 1OVVA 5CCGD 1KILC 1SQBD 1SQQG 3MTUE 2GA1A 1QGKB 1EDIA 2M5AB 5E79E 1BGYE 1GU5A 1S2EA 1KYOE 4GKGA 1CZQA 1S5LX 2O1KA 2BEQD 1E79H 1H8AA 1N8RQ 3S4RA 3TGUD 2PRRA 2N9YB 5APWA 4U3FJ 2E76D 5CHXA 3HTKB 4EDFA 1VF5D 1KQLA 2V7QJ 2YMKA 2ZVNB 5AVQB 5AW1B 5H2FE 1LWUC 1SQBE 3CPWO 3H6PA 1KV4A 2JKVA 3AE5C 5KLIC 1QEXA 5B66E 5KJ7A 3GHGA 1Z56A 1L0LG 1KD1Q 2WVRA 3B5ND 1Y8AA 3L37A 1SQVG 3A0HE 4R4MA 1PGJA 2H8PD 4W80A 5AVSB 1GZLA 1OX3A 1AVYA 4WVZA 2P67A 1L0ND 5KKZB 3AEFC 1OW6A 2K9YA 2KS1A 2WPRA 1U57A 1HH0A 1KMIZ 2WTYA 1L4AA 5K5GB 2RH0A 1KILA 2AEJA 3H1HD 2PAJA 1W5CE 4PJ0H 4WBAA 2XDJA 2FYUK 4H0LB 3V2NA 1ZLLA 5APXA 1MFZA 1DIPA 1X8YA 3CCJP 2NPSD 3N4XA 1JMBA 1A02J 1Q90D 2HR3A 3IAOA 5AW7B 3AE2C 5CMZA 1KQSO 3M9QA 1SFCD 3AE1C 4W7ZA 2FYUD 1YJ9P 3B71A 1LWUA 3H1HE 4LGDE 2WWWA 3L74G 3AEDC 3CX5H 2B89A 4HYTB 3EFFK 1NU1J 3L72D 2WITA 5GTHE 2QJKC 2W6JH 5B5EH 3V2RA 2Y9YA 1ZRTD 4H13C 3VOPA 1USDA 2H89C 1VQ9P 4IL6H 2HG5D 1JNMA 2A06G 3R2PA 2IZ1A 2IBZI 2Y0EA 3H1LG 3BRTB 5TISH 1KB9I 2FYUE 3MP7B 1N73B 2Z4EA 1FZAA 3CI9A 3CX5I 4ZKPA 2QJYC 4N6JA 1NWQA 2IYOA 3L72E 2IPPA 3HD7B 4D6TJ 2QRXA 1T2KC 3V2QA 1USEA 2WT7A 1K05A 4HJGH 3F5HA 4JQ0D 5KJ7D 1LTJC 2Y9ZA 5GTIH 2POHA 4OGQC 1SLQA 1BE3E 2ZXXA 1OVRA 3L35A 1FZEA 1AV1A 2IX7C 1SQPG 2IFMA 1K73Q 2WSSH 1ZP0C 2N1TB 1ZR2A 4K35A 3MUDC 4WY4B 3I55P 1L4AD 1J1EB 2Q3EA 1SP4A 1SQXG 1N7SB 3VMZA 4C7RA 2ZYGA 2FY8A 2FYUJ 4I7ZC 3JCUH 1IFDA 4RO0A 1Q2NA 3BCCD 1P84D 1IC2A 1WT6A 2WSFJ 1J2JB 1GU4A 4JBZA 2NZ2A 2K3RA 1NAFA 2KB7P 3TF5A 1NKNA 3IFMA 2K1AA 1NTZG 2M5AA 1URQD 4ASWA 3WU2H 3O6QB 4LC1A 3JC22 2BCCJ 1BE3J 1PGQA 2C0XA 1KILE 5AVZB 1LTGC 3Q2YA 2E43A 3M9BA 1FZGA 2AXCA 2PP6A 2R32A 3H1ID 1YTZI 3FXEA 2ZT9C 1LTJA 2WSEJ 1P84E 3V6IA 2ZXEB 1Q86Q 2E75B 1G2CA 2Q9IA 1HTLC 2YKPA 3MHVA 3FWLA 3L75G 2KYVA 3MUDA 2QVAA 3MZWB 1FDIA 4L74A 4WWIA 3KZIE 1BSNA 3RGUA 3II6A 2Q1KA 3CCMP 1MFTA 3E7KA 2FKWB 5KAIH 1KORA 1PP9J 2KI7B 2AXTH 3K5BA 3QH9A 4MN4C 3H1KG 3BATA 1T3UA 4JYBA 1NOHA 1HGVA 4H44C 3MGNA 1N73C 1XTCC 1FS0E 2C0WA 1JUNA 2XNXA 2OYIB 3HD7C 2D2CB 2GUSA 4JYCA 5KTBA 2R3SA 2OGUA 4EYYQ 1IK9A 4PV1D 1BGYG 1EZVG 2YXRB 2J59M 5CJ4A 3CL3D 4I6MC 1VPCA 1RQVA 2FYNB 4ZNCA 1OIPA 3G6EP 4H13D 2B88A 3HUSC 1RF1B 1ZN5A 2AEFA 3AEBC 5APSA 2G8YA 3AE8C 5CBNA 1GL2C 2C9LY 3V4WA 3CXHI 3T97A 1FOSE 5L8RJ 4WY4C 2YO3A 1NTKG 2ZFCA 3TNUB 1VQNP 4U3FD 1OZHA 1BDDA 5KAFH 1M8OB 4AUWA 3F89A 1N7LA 5APVA 1BCCD 1D7MA 3MIWA 4EI2A 1J1DB 3NXSA 1T2KD 3SSUA 1VQKP 3VMAA 1S4XA 2OARA 2Q3IA 3RK3B 1IFMA 1X79B 3TGUG 3VYIA 3VN0A 1W2BO 3M9HA 4OGQD 1JY2O 2HODB 1FOSF 3HD7A 1M7LA 3W67A 4U3FE 3HE5B 1QVFO 1KTMA 3Q5RA 1RF0C 1BCCE 5APYA 2QJPB 3OW2O 2FXPA 1FZCB 1AJYA 4W7YA 4IOIH 3HUSA 3LW5H 1YTZT 2KUBA 2QM8A 1L0NG 1FZFA 1GL2A 3BVHA 1NU1K 2FXMA 2XU6A 5KLVG 2JP3A 1JY3O 1UIXA 2MKVA 4WY4A 1HWTC 4GT1A 3H1HG 3A7OA 2Y0CA 3L71D 4OH8B 3SWKA 1M56D 2Q6QA 4RESB 2KNCB 1GTWA 2P1JA 4DZOA 4L73A 1VQLP 1NVOA 5DJUB 1KQGB 2UWJE 1OWAA 2XNDH 1NU1D 5AW4B 4GDOA 2ZT9D 3FX0A 1BCCJ 3CCEP 2KIKA 1Y9BA 2D2CC 3PLNA 3USSA 5BU5A 1LT9B 3D70A 2B87B 4NPFX 2LXCB 2L91A 3L72G 3L71E 5E79H 2KP8A 1OMIA 1KYOH 2FYNC 3EFGA 3L70J 4PJ0E 1FZBA 2B9BA 4ZMDA 2LXBA 1OVUA 3RK2B 1SQQK 2YMYA 3IN6A 1NU1E 3RBXA 2Q7CA 2QA4P 4D6TD 2E42A 2FFDB 1TU3F 1LTBC 1GDTA 1LNQA 1NHLA 3AE7C 1PPJG 2YXQB 4PD4D 4DCKA 3WUVA 1HF9A 2N9BA 3RL0B 4H44D 2NRGA 1AQTA 2IBZE 3L73E 1S5LH 1A02F 3H1JG 1M90Q 1EZVI 1LT1A 1SQQD 1YITP 1H89A 1KYOI 2PFXA 3CX5E 3I5CA 1S1CX 2I1KA 5B5EE 1JB0J 4R4LA 1LTIC 1RH5B 3L71J 4D6TE 3B8EB 2YIUC 3WUUA 4AYCA 4IL6E 1L0LK 2YNYA 3A2AA 2E76B 2JEEA 1KB9H 4PD4E 1VF5B 1NTMJ 1SVFA 1YI2P 1SQVK 2O01H 5APUA 3U1CA 4TT3H 2W83C 1GL2D 1LTSC 2V4HA 5TISE 1R5LA 5BU8B 2QJPC 1SQQE 1WMKA 3M91A 4DT0A 2E74C 1NJIQ 3KYQA 3B5NB 3BCCG 3L73J 3AE4C 2BCCD 1BE3D 3BRVB 1SQVD 3ABVC 3CWBJ 3CMAP 2YKOA 1PFIA 5GTIE 3NMDA 1KFNA 3GLMA 3TNUA 1M57D 1JCDA 5BVZA 1FU1A 3TK1A 2QEXP 2J5UA 1JY3N 2K9JB 1R8EA 5GTHH 2H88C 1G1JA 4YPCA 3H1IG 1IJDB 3WUTA 1MKMA 2ZJSE 2IYPA 1L0LE 5AVVB 3CCSP 3U59A 2BCCE 1JTHB 3JCUE 1NH4A 3KHUA 1SQVE 1SQQJ 4GOFA 3SFEC 1IZNB 3CD6P 2NPSB 4ASVA 1OXZA 1CI6B 1M1JB 1OW7A 1NO4A 1PP9D 2H43A 3HE5A 4RJTA 2P10A 1SFCB 2KLUA 3V5BA 1KILD 1GW3A 1LJ2A 3VMYA 3PHLA 3L74D 4BWNA 1QX8A 1KN7A 4GODA 4C7NB 3IF4A 5KKZC 1NYHA 2FFDC 2OTLP 1E5WA 1K9MQ 1LP1B 3RL0C 2ITAA 1PP9E 1L2PA 2WSCH 2KZJA 2WPQA 1KFMA 3I56P 4H0LC 1L0LJ 4IFMA 1IFNA 1PZQA 5CCGC 1SQVJ 3V4QA 2OQQA
chains in the Genus database with same CATH topology
4NPEA 1OVRA 3FXDA 1H0TB 1S3JA 1LT1A 2M0BA 1BDDA 1U7JA 2RKLA 4K35A 2P58A 2QVAA 3MZWB 4CPGA 1U7MA 3QWOC 4WWIA 2I8DA 2B89A 4HB1A 3RGUA 2Q1KA 1MFTA 1NVOA 5DJUB 4K3AA 2UWJE 2LR2A 4GOFA 2KI7B 4ASVA 4MN4C 1EDJA 1Q2NA 1EDKA 1ZXGA 5CBOA 1EDLA 1JM0A 1FC2C 2SPZA 2KIKA 4HKZH 1Y47A 5EFWB 2B87B 4NPFX 3PH0A 4JBZA 2ZAEB 2LXCB 2K3RA 5DJTB 4NPDA 2B87A 2JWDA 5C39A 2M5AA 4ASWA 4GODA 3ZDMA 1X0TA 4EYYQ 5K5GB 1LP1A 2WMMA 2R44A 1DEEG 1BDCA 4ZMDA 1OVVA 2LXBA 1OVUA 1ZW0A 2QRXA 4BXLA 1SS1A 1EDIA 2KS1B 2M5AB 4IOIH 4KJMA 4HJGH 4ZNCA 3FXEA 1LP1B 4GOEA 2KUBA 2B88A 2OTKE 2KZJA 1H0TA 1EC5A 2KZIA 5CBNA 1JMBA 2HR3A 3S1KA 3MHVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPE A;  1OVR A;  3FXD A;  1H0T B;  1S3J A;  1LT1 A;  2M0B A;  1BDD A;  1U7J A;  2RKL A;  4K35 A;  2P58 A;  2QVA A;  3MZW B;  4CPG A;  1U7M A;  3QWO C;  4WWI A;  2I8D A;  2B89 A;  4HB1 A;  3RGU A;  2Q1K A;  1MFT A;  1NVO A;  5DJU B;  4K3A A;  2UWJ E;  2LR2 A;  4GOF A;  2KI7 B;  4ASV A;  4MN4 C;  1EDJ A;  1Q2N A;  1EDK A;  1ZXG A;  5CBO A;  1EDL A;  1JM0 A;  1FC2 C;  2SPZ A;  2KIK A;  4HKZ H;  1Y47 A;  5EFW B;  2B87 B;  4NPF X;  3PH0 A;  4JBZ A;  2ZAE B;  2LXC B;  2K3R A;  5DJT B;  4NPD A;  2B87 A;  2JWD A;  5C39 A;  2M5A A;  4ASW A;  4GOD A;  3ZDM A;  1X0T A;  4EYY Q;  5K5G B;  1LP1 A;  2WMM A;  2R44 A;  1DEE G;  1BDC A;  4ZMD A;  1OVV A;  2LXB A;  1OVU A;  1ZW0 A;  2QRX A;  4BXL A;  1SS1 A;  1EDI A;  2KS1 B;  2M5A B;  4IOI H;  4KJM A;  4HJG H;  4ZNC A;  3FXE A;  1LP1 B;  4GOE A;  2KUB A;  2B88 A;  2OTK E;  2KZJ A;  1H0T A;  1EC5 A;  2KZI A;  5CBN A;  1JMB A;  2HR3 A;  3S1K A;  3MHV A; 
#chains in the Genus database with same CATH topology
 2R5B A;  4NPE A;  2KNC A;  5AW2 B;  3L74 E;  4O9B A;  1AFO A;  1FDM A;  1JCC A;  1SQP K;  2I1J A;  3AEA C;  1X9V A;  3HTK A;  3Q5P A;  1CW5 A;  2BAS A;  5KAI E;  2I8D A;  2O01 N;  1AQ5 A;  2AXT E;  4Y28 J;  5TJH A;  4QMA A;  1SQX K;  2A06 E;  1MV8 A;  4RKU J;  3SWY A;  1VQ6 P;  2QIW A;  3CC7 P;  3H1L E;  4U3F G;  3SFD C;  1AVO A;  1SQP D;  3A0B H;  3AE6 C;  2WPS A;  3E1I A;  3A5T A;  4NPD A;  1XTG B;  1L4A B;  3N7N A;  1NTZ K;  2FFD A;  4YXW H;  2RN0 A;  2Q5U A;  4BRY B;  1ZW0 A;  3L74 J;  2R5D A;  1YJN P;  3M0A A;  3PJS K;  3CXH H;  2YKQ A;  4GOE A;  1GD2 E;  3VP9 A;  5CCG A;  1YJW P;  5AW3 B;  3IR9 A;  1YIJ P;  1URQ B;  1SQP E;  1ZV8 A;  1N2D C;  1JO5 A;  1GMJ A;  5KAF E;  1EXI A;  1NAY A;  3P8M C;  1LWU B;  4Z1M H;  1U7J A;  1P84 I;  3H1L J;  1SQX E;  2RKL A;  5KLI B;  2NPS C;  3SWF A;  2E74 D;  3D71 A;  2W8Z A;  3RL0 g;  2JJL A;  2N1T C;  1H88 A;  4IFF A;  1SFC C;  1SQB G;  1J1E C;  1ZXG A;  4UB8 H;  1N7S C;  2ZYD A;  1HUC A;  1LTA C;  1YBK A;  5EFW B;  3GF3 A;  1NTZ E;  1S9K D;  2PGD A;  3L75 D;  3G3Z A;  2ZAE B;  3H25 A;  2IFN A;  1K04 A;  1VQ7 P;  1W2E A;  5AVX B;  1FBM A;  2K88 A;  1X0T A;  1NU1 G;  1SQP J;  2HPC B;  2WT7 B;  1BDC A;  4L75 A;  1N73 A;  3LID A;  1VQ8 P;  3L70 D;  2YO2 A;  2W6B A;  1SQX J;  1YYC A;  2K9J A;  3VP8 A;  2KOG A;  3G9R A;  1HJ0 A;  5AVR B;  2BEZ F;  2RMZ A;  1GK4 A;  1S9K E;  3L75 E;  4PV1 B;  2E75 C;  1JTH A;  1S3J A;  2VRS A;  1NTK K;  2E5Y A;  1RE3 C;  2NPS A;  1Q81 Q;  4IFD K;  1NTM K;  1CI6 A;  4D6T G;  1NTZ J;  3KPE A;  4H13 B;  1OW8 A;  2N1T A;  3H1K E;  3L70 E;  2A45 I;  1SFC A;  3AEC C;  3HRN A;  4Y99 B;  1IFP A;  2OYH B;  2J58 A;  1VQ4 P;  3D6Z A;  1EDJ A;  1N7S A;  1Q82 Q;  4H0L D;  3TYY A;  4M3L A;  4C7N A;  3PP5 A;  2V7Q H;  1MZ9 A;  3LW5 J;  1NTK D;  3H32 B;  1NTM D;  3OJA B;  5M1B A;  5DJT B;  1EZV E;  2QJY B;  4UB6 H;  2W90 A;  5C39 A;  3L36 A;  3HE4 B;  5AVU B;  1LP1 A;  3CLQ A;  3L75 J;  1YHQ P;  2ZVO B;  1LGH B;  2OYI C;  3O6Q A;  1IFI A;  1ZOY C;  2FYU G;  1BSH A;  1SS1 A;  4EIJ A;  1LTJ B;  2IBZ D;  3L73 D;  1URQ C;  3TDK A;  4OGQ B;  1G2C B;  1KB9 D;  3FWN A;  1L0N K;  1EC5 A;  3CWB D;  3CX5 D;  1RF0 A;  3M06 A;  3H1K J;  2CK3 H;  1DX7 A;  1NTK E;  1DH3 A;  5KLV K;  1S5L E;  3TSI A;  1NTM E;  3S1K A;  1QL1 A;  1NGM B;  3CCQ P;  1RF1 C;  1JY2 P;  4XFJ A;  3VTP C;  3G4S P;  5AW8 B;  2WZ7 A;  1RE3 A;  1IO4 A;  4YTP C;  1DEB A;  2BCC G;  3P8C D;  2XV5 A;  1BE3 G;  2P58 A;  3CC4 P;  5AVY B;  4HH2 A;  4CPG A;  1U7M A;  2WQY C;  1GW4 A;  4I7Z B;  3TGU E;  4LLH A;  1BGY J;  1JOC A;  3PRJ A;  5H2F H;  2W27 A;  4IL6 X;  1EXJ A;  1KB9 E;  5KLV D;  1EDK A;  1J1D C;  3HD7 D;  5B66 H;  3KDP B;  3CWB E;  5CCH C;  1FC2 C;  1HVV A;  3RK3 C;  4OWF A;  3L4F A;  3A0H H;  1JY3 P;  3GMA A;  4BRY A;  2HFE D;  1VQM P;  1GK6 A;  2Y0D A;  3EWK A;  3P8C E;  1UII A;  4GIF A;  3CCR P;  4XE5 B;  1NTK J;  1SQB J;  2OYI A;  3JSV C;  1AA0 A;  2ZT9 B;  3LIE A;  1L0N E;  1PP9 G;  1FAV A;  1G1I A;  4BXL A;  2W6A A;  1URQ A;  2N1T D;  1JY2 N;  1NKZ B;  3U1A A;  5KLV E;  4WY4 D;  1FZC C;  4PV1 C;  3E1R A;  2OTJ P;  3TGU J;  3T97 B;  1N7S D;  2AEM A;  1RF1 A;  2KZI A;  2FYZ A;  1QL2 A;  1L0L D;  2IDB A;  3FXD A;  1H0T B;  2O01 J;  2HYN A;  3CCL P;  1RE4 C;  3EQ2 A;  1T8Z A;  4Y99 C;  1X22 A;  3O8Z A;  3GW6 A;  2OYH C;  4HB1 A;  3V2P A;  4PD4 H;  1FJP A;  2QM7 A;  5AW0 B;  3P32 A;  1QVG O;  1VQ5 P;  1PPJ D;  5AW6 B;  4N78 D;  4B86 A;  5CCH A;  3CCU P;  3AEE C;  3A3Y B;  4H44 B;  5CBO A;  1Q7Y Q;  2FXO A;  2XKM A;  2M3B A;  1L0N J;  4AQR D;  4HKZ H;  3D6Y A;  3H1J D;  1N86 A;  2HPC A;  2GM4 A;  5KLV J;  1YQ3 C;  3C9I A;  1ZRT E;  1RHZ B;  3Q3D A;  2E75 D;  3NFQ A;  2JWD A;  1LT9 C;  2HOD A;  3H1H J;  2P2U A;  4KT0 J;  1FDO A;  2WMM A;  4PD4 I;  1ZR4 A;  2WPV B;  5AW9 B;  2ZYA A;  3HUS B;  1PPJ E;  4N78 E;  3WU2 E;  4KJM A;  3FGA D;  1FZC A;  2JDI H;  2WSF H;  1GL2 B;  2OTK E;  1HJB A;  3RK2 C;  3UIA A;  4XA4 A;  2H7H A;  1VQO P;  3Q1M A;  3H1J E;  4KHX A;  2KSE A;  1VDF A;  1RE4 A;  2A45 G;  1DD4 A;  4TLF A;  3GF7 A;  2A06 D;  1LTT C;  2OYH A;  2KSJ A;  3L72 J;  4EOT A;  3H1L D;  2WSE H;  2XZR A;  2D2C D;  3CXH D;  3M0D C;  4I2L C;  3ITK A;  1OFC X;  3H32 A;  1IFJ A;  2Z5I A;  3WMM 0;  1JM0 A;  2KXP B;  3A0B E;  2QSI A;  1DD3 A;  2SPZ A;  3HE4 A;  4DJG A;  2KK7 A;  2P7J A;  2WSC J;  3PH0 A;  3GHG B;  2E76 C;  4L76 A;  5APQ A;  1PGP A;  3C8V A;  1VF5 C;  1LT9 A;  2B87 A;  3RBZ A;  1VL2 A;  5AW5 B;  3BCC E;  2IZ0 A;  2L5G B;  3ZDM A;  3H1J J;  1IK7 A;  2R3C A;  4N3Y B;  1FJK A;  3CXH E;  3C1L A;  3R4Y A;  2KS1 B;  2Z5H A;  2K37 A;  1BCC G;  3B5N C;  2JO1 A;  1KIL B;  3B4S A;  1K8A Q;  5CCH D;  2QE7 H;  4U7J A;  1SQX D;  1WRG A;  1P84 H;  1HGZ A;  1T3J A;  3RK3 D;  3PTZ A;  3H1I E;  2QG4 A;  4JF7 A;  3CCV P;  3L70 G;  4ZKU A;  1R5S A;  3S9O A;  1KQF B;  3GG2 A;  5CJ0 A;  2OYO A;  1S72 P;  3M0D A;  3CME P;  3G71 P;  1NTZ D;  3KZI H;  4K3A A;  2KLV A;  3BCC J;  2LR2 A;  4UB8 E;  3VMX A;  3AE3 C;  3KQG A;  3W68 A;  3NTN A;  2LKM A;  1KZU B;  1EDL A;  1HBW A;  1MUU A;  3RK3 E;  3Q5S A;  1M1J C;  2M3E A;  4OVN F;  2G3A A;  2GUV A;  1JEK A;  1PL5 A;  1T6A A;  3P7K A;  1ZME C;  2FBW C;  4YXD C;  2JWA A;  1DEE G;  2O3J A;  3H1I J;  3L71 G;  3OA7 A;  4JPZ B;  3B5N A;  1RY3 A;  3MD0 A;  1PIX A;  1JMM A;  1NTM G;  5APT A;  1H0T A;  1PV3 A;  4I1L A;  1YQ4 C;  4A7P A;  1QLE D;  3CC2 P;  5AVW B;  3AEG C;  4C46 A;  2CPB A;  3BAS A;  3AE9 C;  3H1K D;  2A45 H;  2M0B A;  2IBZ G;  3L73 G;  3QWO C;  2YIU B;  5AVT B;  2C9N Y;  3CWB G;  2O1J A;  1BGY D;  1EZV D;  4WB4 A;  1KC8 Q;  5KJ7 C;  1SQB K;  1KYO D;  3GHG C;  3RK2 D;  2QJK B;  1M1J A;  2E5T A;  1Y47 A;  2DW3 A;  1FE6 A;  3KXD A;  1EQ7 A;  1VQP P;  4UB6 E;  2M8R A;  2E74 B;  2JR8 A;  2MJZ A;  3OAK A;  3RL0 D;  1M1K Q;  2CPS A;  2HLO A;  1CSB A;  2R44 A;  1RQU A;  4DOJ A;  1L4A C;  1PGO A;  1OVV A;  5CCG D;  1KIL C;  1SQB D;  1SQQ G;  3MTU E;  2GA1 A;  1QGK B;  1EDI A;  2M5A B;  5E79 E;  1BGY E;  1GU5 A;  1S2E A;  1KYO E;  4GKG A;  1CZQ A;  1S5L X;  2O1K A;  2BEQ D;  1E79 H;  1H8A A;  1N8R Q;  3S4R A;  3TGU D;  2PRR A;  2N9Y B;  5APW A;  4U3F J;  2E76 D;  5CHX A;  3HTK B;  4EDF A;  1VF5 D;  1KQL A;  2V7Q J;  2YMK A;  2ZVN B;  5AVQ B;  5AW1 B;  5H2F E;  1LWU C;  1SQB E;  3CPW O;  3H6P A;  1KV4 A;  2JKV A;  3AE5 C;  5KLI C;  1QEX A;  5B66 E;  5KJ7 A;  3GHG A;  1Z56 A;  1L0L G;  1KD1 Q;  2WVR A;  3B5N D;  1Y8A A;  3L37 A;  1SQV G;  3A0H E;  4R4M A;  1PGJ A;  2H8P D;  4W80 A;  5AVS B;  1GZL A;  1OX3 A;  1AVY A;  4WVZ A;  2P67 A;  1L0N D;  5KKZ B;  3AEF C;  1OW6 A;  2K9Y A;  2KS1 A;  2WPR A;  1U57 A;  1HH0 A;  1KMI Z;  2WTY A;  1L4A A;  5K5G B;  2RH0 A;  1KIL A;  2AEJ A;  3H1H D;  2PAJ A;  1W5C E;  4PJ0 H;  4WBA A;  2XDJ A;  2FYU K;  4H0L B;  3V2N A;  1ZLL A;  5APX A;  1MFZ A;  1DIP A;  1X8Y A;  3CCJ P;  2NPS D;  3N4X A;  1JMB A;  1A02 J;  1Q90 D;  2HR3 A;  3IAO A;  5AW7 B;  3AE2 C;  5CMZ A;  1KQS O;  3M9Q A;  1SFC D;  3AE1 C;  4W7Z A;  2FYU D;  1YJ9 P;  3B71 A;  1LWU A;  3H1H E;  4LGD E;  2WWW A;  3L74 G;  3AED C;  3CX5 H;  2B89 A;  4HYT B;  3EFF K;  1NU1 J;  3L72 D;  2WIT A;  5GTH E;  2QJK C;  2W6J H;  5B5E H;  3V2R A;  2Y9Y A;  1ZRT D;  4H13 C;  3VOP A;  1USD A;  2H89 C;  1VQ9 P;  4IL6 H;  2HG5 D;  1JNM A;  2A06 G;  3R2P A;  2IZ1 A;  2IBZ I;  2Y0E A;  3H1L G;  3BRT B;  5TIS H;  1KB9 I;  2FYU E;  3MP7 B;  1N73 B;  2Z4E A;  1FZA A;  3CI9 A;  3CX5 I;  4ZKP A;  2QJY C;  4N6J A;  1NWQ A;  2IYO A;  3L72 E;  2IPP A;  3HD7 B;  4D6T J;  2QRX A;  1T2K C;  3V2Q A;  1USE A;  2WT7 A;  1K05 A;  4HJG H;  3F5H A;  4JQ0 D;  5KJ7 D;  1LTJ C;  2Y9Z A;  5GTI H;  2POH A;  4OGQ C;  1SLQ A;  1BE3 E;  2ZXX A;  1OVR A;  3L35 A;  1FZE A;  1AV1 A;  2IX7 C;  1SQP G;  2IFM A;  1K73 Q;  2WSS H;  1ZP0 C;  2N1T B;  1ZR2 A;  4K35 A;  3MUD C;  4WY4 B;  3I55 P;  1L4A D;  1J1E B;  2Q3E A;  1SP4 A;  1SQX G;  1N7S B;  3VMZ A;  4C7R A;  2ZYG A;  2FY8 A;  2FYU J;  4I7Z C;  3JCU H;  1IFD A;  4RO0 A;  1Q2N A;  3BCC D;  1P84 D;  1IC2 A;  1WT6 A;  2WSF J;  1J2J B;  1GU4 A;  4JBZ A;  2NZ2 A;  2K3R A;  1NAF A;  2KB7 P;  3TF5 A;  1NKN A;  3IFM A;  2K1A A;  1NTZ G;  2M5A A;  1URQ D;  4ASW A;  3WU2 H;  3O6Q B;  4LC1 A;  3JC2 2;  2BCC J;  1BE3 J;  1PGQ A;  2C0X A;  1KIL E;  5AVZ B;  1LTG C;  3Q2Y A;  2E43 A;  3M9B A;  1FZG A;  2AXC A;  2PP6 A;  2R32 A;  3H1I D;  1YTZ I;  3FXE A;  2ZT9 C;  1LTJ A;  2WSE J;  1P84 E;  3V6I A;  2ZXE B;  1Q86 Q;  2E75 B;  1G2C A;  2Q9I A;  1HTL C;  2YKP A;  3MHV A;  3FWL A;  3L75 G;  2KYV A;  3MUD A;  2QVA A;  3MZW B;  1FDI A;  4L74 A;  4WWI A;  3KZI E;  1BSN A;  3RGU A;  3II6 A;  2Q1K A;  3CCM P;  1MFT A;  3E7K A;  2FKW B;  5KAI H;  1KOR A;  1PP9 J;  2KI7 B;  2AXT H;  3K5B A;  3QH9 A;  4MN4 C;  3H1K G;  3BAT A;  1T3U A;  4JYB A;  1NOH A;  1HGV A;  4H44 C;  3MGN A;  1N73 C;  1XTC C;  1FS0 E;  2C0W A;  1JUN A;  2XNX A;  2OYI B;  3HD7 C;  2D2C B;  2GUS A;  4JYC A;  5KTB A;  2R3S A;  2OGU A;  4EYY Q;  1IK9 A;  4PV1 D;  1BGY G;  1EZV G;  2YXR B;  2J59 M;  5CJ4 A;  3CL3 D;  4I6M C;  1VPC A;  1RQV A;  2FYN B;  4ZNC A;  1OIP A;  3G6E P;  4H13 D;  2B88 A;  3HUS C;  1RF1 B;  1ZN5 A;  2AEF A;  3AEB C;  5APS A;  2G8Y A;  3AE8 C;  5CBN A;  1GL2 C;  2C9L Y;  3V4W A;  3CXH I;  3T97 A;  1FOS E;  5L8R J;  4WY4 C;  2YO3 A;  1NTK G;  2ZFC A;  3TNU B;  1VQN P;  4U3F D;  1OZH A;  1BDD A;  5KAF H;  1M8O B;  4AUW A;  3F89 A;  1N7L A;  5APV A;  1BCC D;  1D7M A;  3MIW A;  4EI2 A;  1J1D B;  3NXS A;  1T2K D;  3SSU A;  1VQK P;  3VMA A;  1S4X A;  2OAR A;  2Q3I A;  3RK3 B;  1IFM A;  1X79 B;  3TGU G;  3VYI A;  3VN0 A;  1W2B O;  3M9H A;  4OGQ D;  1JY2 O;  2HOD B;  1FOS F;  3HD7 A;  1M7L A;  3W67 A;  4U3F E;  3HE5 B;  1QVF O;  1KTM A;  3Q5R A;  1RF0 C;  1BCC E;  5APY A;  2QJP B;  3OW2 O;  2FXP A;  1FZC B;  1AJY A;  4W7Y A;  4IOI H;  3HUS A;  3LW5 H;  1YTZ T;  2KUB A;  2QM8 A;  1L0N G;  1FZF A;  1GL2 A;  3BVH A;  1NU1 K;  2FXM A;  2XU6 A;  5KLV G;  2JP3 A;  1JY3 O;  1UIX A;  2MKV A;  4WY4 A;  1HWT C;  4GT1 A;  3H1H G;  3A7O A;  2Y0C A;  3L71 D;  4OH8 B;  3SWK A;  1M56 D;  2Q6Q A;  4RES B;  2KNC B;  1GTW A;  2P1J A;  4DZO A;  4L73 A;  1VQL P;  1NVO A;  5DJU B;  1KQG B;  2UWJ E;  1OWA A;  2XND H;  1NU1 D;  5AW4 B;  4GDO A;  2ZT9 D;  3FX0 A;  1BCC J;  3CCE P;  2KIK A;  1Y9B A;  2D2C C;  3PLN A;  3USS A;  5BU5 A;  1LT9 B;  3D70 A;  2B87 B;  4NPF X;  2LXC B;  2L91 A;  3L72 G;  3L71 E;  5E79 H;  2KP8 A;  1OMI A;  1KYO H;  2FYN C;  3EFG A;  3L70 J;  4PJ0 E;  1FZB A;  2B9B A;  4ZMD A;  2LXB A;  1OVU A;  3RK2 B;  1SQQ K;  2YMY A;  3IN6 A;  1NU1 E;  3RBX A;  2Q7C A;  2QA4 P;  4D6T D;  2E42 A;  2FFD B;  1TU3 F;  1LTB C;  1GDT A;  1LNQ A;  1NHL A;  3AE7 C;  1PPJ G;  2YXQ B;  4PD4 D;  4DCK A;  3WUV A;  1HF9 A;  2N9B A;  3RL0 B;  4H44 D;  2NRG A;  1AQT A;  2IBZ E;  3L73 E;  1S5L H;  1A02 F;  3H1J G;  1M90 Q;  1EZV I;  1LT1 A;  1SQQ D;  1YIT P;  1H89 A;  1KYO I;  2PFX A;  3CX5 E;  3I5C A;  1S1C X;  2I1K A;  5B5E E;  1JB0 J;  4R4L A;  1LTI C;  1RH5 B;  3L71 J;  4D6T E;  3B8E B;  2YIU C;  3WUU A;  4AYC A;  4IL6 E;  1L0L K;  2YNY A;  3A2A A;  2E76 B;  2JEE A;  1KB9 H;  4PD4 E;  1VF5 B;  1NTM J;  1SVF A;  1YI2 P;  1SQV K;  2O01 H;  5APU A;  3U1C A;  4TT3 H;  2W83 C;  1GL2 D;  1LTS C;  2V4H A;  5TIS E;  1R5L A;  5BU8 B;  2QJP C;  1SQQ E;  1WMK A;  3M91 A;  4DT0 A;  2E74 C;  1NJI Q;  3KYQ A;  3B5N B;  3BCC G;  3L73 J;  3AE4 C;  2BCC D;  1BE3 D;  3BRV B;  1SQV D;  3ABV C;  3CWB J;  3CMA P;  2YKO A;  1PFI A;  5GTI E;  3NMD A;  1KFN A;  3GLM A;  3TNU A;  1M57 D;  1JCD A;  5BVZ A;  1FU1 A;  3TK1 A;  2QEX P;  2J5U A;  1JY3 N;  2K9J B;  1R8E A;  5GTH H;  2H88 C;  1G1J A;  4YPC A;  3H1I G;  1IJD B;  3WUT A;  1MKM A;  2ZJS E;  2IYP A;  1L0L E;  5AVV B;  3CCS P;  3U59 A;  2BCC E;  1JTH B;  3JCU E;  1NH4 A;  3KHU A;  1SQV E;  1SQQ J;  4GOF A;  3SFE C;  1IZN B;  3CD6 P;  2NPS B;  4ASV A;  1OXZ A;  1CI6 B;  1M1J B;  1OW7 A;  1NO4 A;  1PP9 D;  2H43 A;  3HE5 A;  4RJT A;  2P10 A;  1SFC B;  2KLU A;  3V5B A;  1KIL D;  1GW3 A;  1LJ2 A;  3VMY A;  3PHL A;  3L74 D;  4BWN A;  1QX8 A;  1KN7 A;  4GOD A;  4C7N B;  3IF4 A;  5KKZ C;  1NYH A;  2FFD C;  2OTL P;  1E5W A;  1K9M Q;  1LP1 B;  3RL0 C;  2ITA A;  1PP9 E;  1L2P A;  2WSC H;  2KZJ A;  2WPQ A;  1KFM A;  3I56 P;  4H0L C;  1L0L J;  4IFM A;  1IFN A;  1PZQ A;  5CCG C;  1SQV J;  3V4Q A;  2OQQ A; 
#chains in the Genus database with same CATH homology
 4NPE A;  1OVR A;  3FXD A;  1H0T B;  1S3J A;  1LT1 A;  2M0B A;  1BDD A;  1U7J A;  2RKL A;  4K35 A;  2P58 A;  2QVA A;  3MZW B;  4CPG A;  1U7M A;  3QWO C;  4WWI A;  2I8D A;  2B89 A;  4HB1 A;  3RGU A;  2Q1K A;  1MFT A;  1NVO A;  5DJU B;  4K3A A;  2UWJ E;  2LR2 A;  4GOF A;  2KI7 B;  4ASV A;  4MN4 C;  1EDJ A;  1Q2N A;  1EDK A;  1ZXG A;  5CBO A;  1EDL A;  1JM0 A;  1FC2 C;  2SPZ A;  2KIK A;  4HKZ H;  1Y47 A;  5EFW B;  2B87 B;  4NPF X;  3PH0 A;  4JBZ A;  2ZAE B;  2LXC B;  2K3R A;  5DJT B;  4NPD A;  2B87 A;  2JWD A;  5C39 A;  2M5A A;  4ASW A;  4GOD A;  3ZDM A;  1X0T A;  4EYY Q;  5K5G B;  1LP1 A;  2WMM A;  2R44 A;  1DEE G;  1BDC A;  4ZMD A;  1OVV A;  2LXB A;  1OVU A;  1ZW0 A;  2QRX A;  4BXL A;  1SS1 A;  1EDI A;  2KS1 B;  2M5A B;  4IOI H;  4KJM A;  4HJG H;  4ZNC A;  3FXE A;  1LP1 B;  4GOE A;  2KUB A;  2B88 A;  2OTK E;  2KZJ A;  1H0T A;  1EC5 A;  2KZI A;  5CBN A;  1JMB A;  2HR3 A;  3S1K A;  3MHV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...