4NPFX

High-resolution structure of two tandem b domains of staphylococcal protein a connected by the conserved linker
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
115
structure length
115
Chain Sequence
DNKFNKEQQNAWYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAWYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
total genus 49
structure length 115
sequence length 115
chains with identical sequence Y
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npfX01
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npfX02
1ZW0A 3MHVA 1DEEG 4HKZH 1ZXGA 4CPGA 1U7JA 1JMBA 3FXDA 2LXBA 4GOFA 2LR2A 1H0TB 4IOIH 2HR3A 2KIKA 2B89A 5C39A 1H0TA 1OVRA 2OTKE 4ASVA 1OVVA 2Q1KA 2KUBA 4GODA 4WWIA 2KI7B 2M5AB 4ZMDA 1NVOA 1X0TA 1Q2NA 4EYYQ 3ZDMA 2QRXA 1Y47A 1BDDA 2KS1B 5EFWB 2UWJE 4NPEA 1MFTA 4BXLA 1EC5A 1LP1B 2KZJA 4MN4C 3PH0A 4JBZA 2K3RA 4K35A 2KZIA 2P58A 3FXEA 5DJTB 4ASWA 1U7MA 2M5AA 2B87B 1LT1A 2R44A 2WMMA 1OVUA 2I8DA 5DJUB 4ZNCA 3QWOC 5CBOA 1EDKA 1S3JA 1LP1A 4HB1A 2RKLA 2ZAEB 4HJGH 1BDCA 2B88A 3MZWB 3RGUA 5CBNA 2LXCB 1EDJA 2QVAA 3S1KA 1FC2C 4K3AA 1JM0A 2M0BA 2SPZA 1SS1A 4NPFX 1EDLA 2B87A 1EDIA 4KJMA 5K5GB 4NPDA 4GOEA 2JWDA
chains in the Genus database with same CATH superfamily
3JSVC 3OJAB 3U59A 1LTJB 1DEEG 4U3FE 3NMDA 2Q7CA 1JY2P 2PRRA 3M0DA 1JY2N 3KZIE 1U7JA 1JMBA 4H0LC 2GA1A 2LXBA 4JPZB 2QA4P 1H0TB 3Q1MA 3D70A 2IBZE 3CXHE 3F5HA 5TISH 2W83C 2Q6QA 5BU8B 1VF5C 2KSJA 4H0LD 2MKVA 3H25A 1KC8Q 1NGMB 1RQVA 1LNQA 3CLQA 1FZCA 3VMXA 3SWYA 4YXDC 1RQUA 1VF5D 3HE4A 3W68A 1YJWP 1N73C 1A02J 2ZYAA 1JNMA 3CC2P 2HPCA 1SQQJ 3JCUE 2OTKE 1NTKK 1NTMG 1L0LK 3KQGA 4ASVA 2FYZA 3MD0A 3I55P 3OW2O 2QIWA 5CCHA 1K73Q 1LWUB 2V4HA 1OXZA 1ZMEC 1NU1K 1IFPA 2KSEA 2J58A 5KLVE 1PPJG 5AW0B 5CCGA 3Q5PA 1SQXJ 5AW1B 5CHXA 5BU5A 1X8YA 3CWBD 3TGUD 4WWIA 3JC22 2IX7C 3B8EB 2KI7B 1YQ4C 3CL3D 3S9OA 1RF1A 2M5AB 1HUCA 3P32A 2CPBA 2OTLP 1X0TA 1FDIA 3WUTA 3G4SP 4EYYQ 2Y0EA 1VQ5P 1LTSC 1VQOP 5B66E 3L73D 4UB6E 5TISE 5KAIE 3AE1C 1N73A 2Q5UA 3HE5B 3W67A 2WPQA 3TGUE 1M8OB 2KS1B 4N6JA 3SFDC 1BSHA 5KLVG 1X79B 2PP6A 1GL2A 3V2NA 3L70J 1KYOI 4I2LC 1JY3O 1EC5A 1IFNA 1PGPA 2BEQD 1SQXE 1T2KC 3UIAA 1VQNP 3JCUH 2ZT9C 1SQVG 2I1JA 2QJYC 4BRYA 2J5UA 2WWWA 1EQ7A 1N7SA 2K3RA 1HWTC 2ZJSE 1LWUA 1NAYA 4PD4H 3U1AA 1SQPJ 1KFMA 1L2PA 5AW5B 2P1JA 3MTUE 5KJ7A 2D2CB 2XZRA 3B5ND 3L36A 3GG2A 3CCVP 3IN6A 1YHQP 4U3FG 1GL2D 3KHUA 2KLUA 3H6PA 3BATA 2M5AA 3EQ2A 3MP7B 4L75A 5KLVK 1RY3A 1SQBE 2WSEJ 3P8MC 3RK2D 3TDKA 1CZQA 2O3JA 3A2AA 1OZHA 1NTZJ 3CCMP 2I8DA 3AE6C 3B4SA 3Q3DA 2OQQA 2RMZA 4RKUJ 1JOCA 1FDOA 1PGJA 1KB9H 2ZVOB 3VP8A 1GU5A 4GT1A 1PPJE 1QEXA 4OGQD 1Y8AA 3RK2B 2JEEA 3HUSB 2G8YA 3CXHH 4N78D 5B66H 3A0HH 2QJPB 1BE3E 1KILC 1J1EB 1LTTC 5KKZB 4HB1A 4W80A 2WSFH 4PD4E 3H32A 5CCGD 2A45H 1VQ9P 3CD6P 1NU1D 1OW6A 1M90Q 1CI6A 3V5BA 4TLFA 2FXMA 2JR8A 5KLVJ 4RO0A 2HODB 3IAOA 1UIIA 1FC2C 3LW5H 2YNYA 4H13C 1HTLC 2GM4A 4PV1C 2WPSA 4Z1MH 2YIUB 1SQVJ 2D2CD 3B5NB 3FX0A 1VQMP 1J2JB 1PV3A 2GUVA 1BE3D 3AEAC 4IFFA 4PV1D 1S9KE 3CMEP 2SPZA 1Q90D 1SFCA 4KT0J 1BGYJ 4NPFX 3M0AA 1SQXG 4AYCA 1USDA 2H7HA 1BE3G 2BCCD 2IPPA 1YTZT 2N1TA 1M1JC 4JYCA 4YPCA 5H2FH 1GTWA 1KV4A 3H1KJ 3E7KA 3EWKA 4AUWA 1JY3P 1QL1A 1SQPK 1S1CX 1PIXA 1PL5A 1RHZB 3G71P 2BCCG 2L91A 2YMYA 3V4WA 1RF0A 1FBMA 3AE8C 4A7PA 1ZW0A 2M8RA 3VOPA 1NU1G 3GF3A 4HKZH 5AVYB 1GW4A 4ZKUA 2R5BA 1L0LE 1T6AA 2W8ZA 1YTZI 4KHXA 2YKPA 3SSUA 1NTZK 2POHA 4GIFA 2HPCB 2JJLA 3U1CA 1GD2E 4GOFA 2LR2A 2A06G 3TYYA 1PGOA 1L0NK 4H44C 2HR3A 2YO2A 4OH8B 4I1LA 4OGQC 4U3FD 5TJHA 5GTIE 2XU6A 1IFIA 1KMIZ 1OIPA 2AEMA 3MUDC 4N78E 4PJ0H 3VMAA 1FJPA 2K9YA 3AE7C 4YTPC 1W5CE 2B89A 3H1HD 1PP9D 3LIDA 4HYTB 1VF5B 1JY2O 1IFMA 2QJPC 4D6TE 4RJTA 3CX5D 1KILB 2GUSA 4XA4A 1L4AA 1OVRA 2KOGA 2QM8A 1KB9I 2WSEH 2OYIA 1WT6A 1KN7A 4B86A 1IJDB 1UIXA 1GZLA 1OVVA 5BVZA 1RF1B 3CC4P 1QGKB 1G1JA 3SFEC 3TGUJ 3KPEA 1IK9A 4H13D 3V2QA 3H1HE 1VQ4P 2BEZF 1SQVK 4H44B 3MIWA 4JYBA 5APTA 1M1KQ 1BE3J 1KFNA 2A45I 4PV1B 5KJ7C 1LTJA 1HBWA 3H1KG 3G3ZA 3ITKA 3EFFK 1IC2A 2A06D 2M3BA 2C9NY 1VL2A 3L75J 3RK3C 3CCRP 1W2BO 5AVUB 2WT7A 5CJ0A 1PZQA 2R5DA 3L75D 3M9BA 1FU1A 1M1JB 5M1BA 1KQFB 3NFQA 1GMJA 1NTMJ 2YKOA 3Q5RA 2OYHB 1JEKA 2OYOA 3AECC 3HTKB 5APYA 2OYIC 2KNCB 3KYQA 1SQBJ 3HD7B 4TT3H 1KYOH 2KK7A 2UWJE 1LT9A 3FGAD 1MFTA 5KLIC 5AW6B 3PH0A 4JBZA 4WVZA 5CJ4A 3H1KE 2MJZA 3WUVA 3H1IJ 1NHLA 3PTZA 2IFMA 4K35A 1P84I 1RE4A 4EDFA 1MFZA 2YXRB 2KZIA 2PAJA 3AE3C 3FXEA 5KAFE 2P2UA 2O1KA 1E5WA 1URQC 1EXJA 4DCKA 1NTZD 3I5CA 4ASWA 3TGUG 1U7MA 1FE6A 1NTKJ 3PP5A 2W90A 1LTAC 4QMAA 1URQD 1ZRTE 4IL6H 3WU2H 1L0ND 2R44A 1P84E 1L4AC 1ZOYC 5APQA 5KAIH 4Y99B 1SQVE 2AEFA 2H8PD 2LKMA 5DJUB 1LT9C 2H88C 2YO3A 1CI6B 2ZVNB 3TNUB 3F89A 2XNDH 2IBZI 3CXHI 1SQBD 3QWOC 1SQPG 3D6YA 1S4XA 2V7QJ 4AQRD 5CBOA 3IF4A 2KYVA 1GL2B 3S4RA 3RK3D 4WY4A 4WB4A 2JO1A 2FFDA 1GK6A 1T3UA 5AW4B 3V4QA 1P84D 1AA0A 1BCCG 3L70D 1BGYD 1SQBG 1J1EC 3KZIH 4U7JA 4Y28J 2Y0DA 5AVQB 3H1HG 1NTZG 1NJIQ 2NPSB 2E74B 2XDJA 1T8ZA 2P7JA 3BCCD 3OA7A 4K3AA 1FAVA 2M3EA 1U57A 5KAFH 3CMAP 1FZCC 1LJ2A 2M0BA 1KQLA 1SQXD 4H13B 5KLVD 1KTMA 1X9VA 2IYPA 2YMKA 4XFJA 1QLED 2YIUC 3FWLA 5AW2B 4C7RA 3AE9C 1EDIA 4KJMA 5AVTB 4EOTA 1Q7YQ 1JCDA 2K1AA 4C7NB 1IO4A 3TSIA 3RGUA 1SFCC 2B9BA 1NWQA 1TU3F 1N7SC 3GHGB 2JP3A 2P10A 3O6QA 2PFXA 4N3YB 4D6TJ 2FFDC 1NOHA 2E74C 5AW7B 1SQQG 2Y0CA 3PLNA 3VYIA 1ZV8A 1GW3A 2R32A 1KORA 3AEFC 3IR9A 1YIJP 1DD4A 1JUNA 3CI9A 4OVNF 5APWA 1FZCB 2FYUJ 2KB7P 2XNXA 1PPJD 3H32B 3G9RA 4R4LA 1DIPA 2ZT9D 3FXDA 1R5SA 1AFOA 2WSCH 1OW7A 1L4AB 3L72J 4IL6X 3GW6A 4IOIH 1S5LH 2W6AA 1J1DC 2K88A 1WRGA 2OGUA 5AVSB 1VQ8P 1GK4A 1YITP 3GHGC 4R4MA 3RL0D 2BCCJ 1L0NG 2QJYB 4LC1A 1NTKD 2WPVB 3MUDA 5H2FE 1GL2C 4PD4D 3C1LA 1NTMK 2FYUD 1MKMA 1NU1E 3L70E 3Q2YA 2H43A 1R5LA 2N1TB 1Q81Q 2Q3IA 1L0LG 3WUUA 1QVFO 1JO5A 2R3SA 3CPWO 1KQSO 1FZAA 1SQBK 2Q1KA 2ZFCA 2NZ2A 1S9KD 1GU4A 1DD3A 4D6TD 2K9JA 3L71D 1IFDA 2ITAA 2NPSC 3CX5E 4DT0A 3Q5SA 1J1DB 2J59M 2WPRA 3L72E 1FZGA 1NKZB 1GDTA 4L76A 2NPSD 3BRTB 4GDOA 1MZ9A 1ZN5A 2KNCA 5GTIH 4ZMDA 1NVOA 3P8CD 3AEBC 1PP9G 4D6TG 4O9BA 3H1LG 1EZVI 3CCJP 1SP4A 2N1TC 3ZDMA 2RN0A 3RK3B 1IZNB 1CSBA 4L73A 1N7SB 1NTMD 4U3FJ 2YKQA 2FYUG 3T97A 3CCQP 2N9YB 1BDDA 5KKZC 4I7ZB 1YJNP 2OYHC 3KDPB 1OFCX 2DW3A 2PGDA 3HD7D 4NPEA 1H8AA 1LP1B 1KILA 2KZJA 5APXA 3L74J 4WY4C 2OYIB 1N73B 3N4XA 1QX8A 3HD7C 1VPCA 4LGDE 3H1JJ 5AVWB 2G3AA 4W7ZA 1FOSF 1PFIA 1T2KD 4WY4D 3AE2C 3AEEC 1L0NJ 1RE3C 1PP9E 2KS1A 3B5NC 1AVYA 2IZ1A 3E1RA 3GF7A 3H1IE 5KLIB 2K9JB 3VMZA 1FZBA 1KILE 1AQTA 3BASA 2IDBA 1LTBC 3C8VA 3VTPC 3H1KD 5DJTB 2HLOA 2QG4A 3L74D 5GTHH 2ZYGA 1Q86Q 2FYUE 3M9HA 2E5YA 3M06A 1FOSE 2B87B 2Z5HA 3L70G 5CBNA 2WT7B 2W27A 3H1JD 2WMMA 1OVUA 1DEBA 1MUUA 3EFGA 4WY4B 3E1IA 1M1JA 1QL2A 2OYHA 1YI2P 2R3CA 3BCCG 3L71E 2O01N 3L74E 2IBZD 3CXHD 3CWBG 1KILD 3T97B 1G2CB 2FXPA 3TF5A 1KB9D 1XTGB 1VQ6P 1YYCA 3HD7A 3H1LJ 1L0NE 2NPSA 1S3JA 3L72G 5KTBA 2WVRA 3RBZA 1HJ0A 3TK1A 4BWNA 4EI2A 3CCLP 1LP1A 2W6BA 1K04A 2RKLA 2ZAEB 5B5EE 1H89A 3L37A 1BDCA 1LGHB 2QEXP 4GKGA 2C0XA 1EDJA 5CCGC 2QM7A 3CCSP 2ZT9B 2O01H 1YQ3C 1D7MA 1EZVE 1OMIA 1HJBA 3R2PA 1NH4A 1JM0A 1K8AQ 3GHGA 1S5LX 3H1JG 1M7LA 4I7ZC 3CWBE 3A7OA 3L71J 4PJ0E 1NKNA 3I56P 2ZXXA 3D71A 2D2CC 1SQPE 1SS1A 1NYHA 2AXTH 3AEGC 2B87A 3RL0g 1EXIA 1EDLA 4I6MC 5K5GB 2IBZG 3CX5I 2VRSA 3HRNA 3H1LE 4UB8H 5AVXB 1R8EA 4OWFA 5E79H 1HVVA 4IFMA 2WSCJ 1JY3N 1BCCE 1EZVD 1X22A 1VQLP 1SQPD 2AXCA 1G2CA 2O01J 3H1HJ 4DZOA 1A02F 1NTZE 3MHVA 3OAKA 1HF9A 1EZVG 2XKMA 3AE5C 3M0DC 4H0LB 2Q3EA 1USEA 3V2PA 4C46A 1ZXGA 4CPGA 3RK2C 1H88A 3WMM0 2FFDB 3H1JE 2FXOA 3H1LD 3BVHA 4DJGA 2E5TA 2A45G 1KYOD 3N7NA 1JB0J 1BCCD 1FS0E 2KIKA 2O1JA 3L74G 2Y9YA 3L35A 3HE5A 4HH2A 5B5EH 1DX7A 2H89C 2QE7H 4JF7A 1G1IA 1M57D 2P67A 2RH0A 3KXDA 4H44D 1BGYE 3CX5H 3L75G 1VQ7P 1JMMA 1ZR2A 5C39A 3II6A 1OW8A 1SQQE 3MGNA 3PJSK 1H0TA 1BSNA 2E75D 1IFJA 1SLQA 1Z56A 2ZXEB 3NXSA 2HYNA 3G6EP 1ZP0C 1DH3A 1S72P 1KYOE 1L4AD 3BCCE 2KUBA 1RF0C 1N86A 3HE4B 3L71G 1NTKE 1URQB 3O6QB 2C9LY 1ZRTD 2OARA 4GODA 4RESB 2YXQB 5AW9B 3RL0B 2IZ0A 4L74A 1HH0A 1NAFA 1ZR4A 1SQVD 1VQKP 3BCCJ 5AVZB 2BASA 2IFNA 4JQ0D 3CCEP 2HFED 2E76B 4Y99C 1CW5A 1Y9BA 1S5LE 2CK3H 2Y9ZA 1LT9B 3IFMA 3BRVB 1RF1C 1Q2NA 2CPSA 2Z5IA 3B71A 3GLMA 1SQQK 2QRXA 3K5BA 3RK3E 1Y47A 1Q82Q 1L0LJ 2FKWB 3L73G 3VN0A 2WSSH 1PGQA 2FY8A 2K37A 3AE4C 1WMKA 3GMAA 3HUSA 3LW5J 5GTHE 1NTKG 4OGQB 2FBWC 5EFWB 2Q9IA 1AJYA 1OWAA 2JDIH 4BXLA 3CCUP 1VQPP 2JWAA 2FYUK 2FYNC 3A0HE 3PHLA 4LLHA 2JKVA 2N9BA 4MN4C 5APSA 5CCHC 3FWNA 2WSFJ 3A5TA 3CC7P 2L5GB 3HTKA 3WU2E 3SWFA 1JTHA 2C0WA 2WQYC 1PP9J 1SFCD 1HGVA 2HODA 3NTNA 1KZUB 3M91A 1FZEA 1MV8A 1RH5B 1URQA 1K05A 4PD4I 5AVRB 5E79E 5AW3B 1YJ9P 2QSIA 1RE3A 2P58A 3A0BH 3B5NA 2Z4EA 1E79H 2KXPB 2E74D 1RE4C 1N7LA 2WITA 3RBXA 3ABVC 1SQQD 3TNUA 4BRYB 3LIEA 2E43A 3V6IA 1SFCB 1S2EA 2E75C 3H1ID 4M3LA 5AVVB 1LT1A 1YBKA 3SWKA 2FYNB 1NO4A 3PRJA 3HUSC 5L8RJ 1QVGO 5AW8B 1L0LD 4XE5B 4UB6H 3D6ZA 4EIJA 4ZNCA 2OTJP 3L72D 3P8CE 4DOJA 1N8RQ 5KJ7D 3H1IG 2AEJA 1FZFA 3VMYA 2I1KA 1EDKA 1BGYG 1OX3A 2ZYDA 1W2EA 1JCCA 2AXTE 3L75E 3O8ZA 2E76D 3RL0C 3USSA 1IK7A 3L4FA 2KLVA 2KP8A 4UB8E 4YXWH 1NTME 4HJGH 2V7QH 3L73J 1LTGC 2E76C 1N2DC 1ZLLA 2B88A 2BCCE 1LWUC 2E75B 2NRGA 2QJKB 3MZWB 4IL6E 2W6JH 5APVA 1KB9E 2LXCB 1JTHB 1P84H 2QVAA 3S1KA 1M56D 1LTIC 1FDMA 1KD1Q 1SVFA 1NU1J 3QH9A 4C7NA 1LTJC 3R4YA 2E42A 1SQXK 3A0BE 5APUA 3VP9A 3C9IA 3CWBJ 3V2RA 1AQ5A 1VDFA 1T3JA 1AV1A 4W7YA 2IYOA 1HGZA 3P7KA 2WTYA 5CCHD 1K9MQ 2A06E 1FJKA 1N7SD 4NPDA 2XV5A 4ZKPA 2WZ7A 4GOEA 1KQGB 2JWDA 4WBAA 2QJKC 1AVOA 3A3YB 1XTCC 2HG5D 1BCCJ 2N1TD 5CMZA 3M9QA 3L73E 3AEDC 4IFDK
chains in the Genus database with same CATH topology
1ZW0A 3MHVA 1DEEG 4HKZH 1ZXGA 4CPGA 1U7JA 1JMBA 3FXDA 2LXBA 4GOFA 2LR2A 1H0TB 4IOIH 2HR3A 2KIKA 2B89A 5C39A 1H0TA 1OVRA 2OTKE 4ASVA 1OVVA 2Q1KA 2KUBA 4GODA 4WWIA 2KI7B 2M5AB 4ZMDA 1NVOA 1X0TA 1Q2NA 4EYYQ 3ZDMA 2QRXA 1Y47A 1BDDA 2KS1B 5EFWB 2UWJE 4NPEA 1MFTA 4BXLA 1EC5A 1LP1B 2KZJA 4MN4C 3PH0A 4JBZA 2K3RA 4K35A 2KZIA 2P58A 3FXEA 5DJTB 4ASWA 1U7MA 2M5AA 2B87B 1LT1A 2R44A 2WMMA 1OVUA 2I8DA 5DJUB 4ZNCA 3QWOC 5CBOA 1EDKA 1S3JA 1LP1A 4HB1A 2RKLA 2ZAEB 4HJGH 1BDCA 2B88A 3MZWB 3RGUA 5CBNA 2LXCB 1EDJA 2QVAA 3S1KA 1FC2C 4K3AA 1JM0A 2M0BA 2SPZA 1SS1A 4NPFX 1EDLA 2B87A 1EDIA 4KJMA 5K5GB 4NPDA 4GOEA 2JWDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZW0 A;  3MHV A;  1DEE G;  4HKZ H;  1ZXG A;  4CPG A;  1U7J A;  1JMB A;  3FXD A;  2LXB A;  4GOF A;  2LR2 A;  1H0T B;  4IOI H;  2HR3 A;  2KIK A;  2B89 A;  5C39 A;  1H0T A;  1OVR A;  2OTK E;  4ASV A;  1OVV A;  2Q1K A;  2KUB A;  4GOD A;  4WWI A;  2KI7 B;  2M5A B;  4ZMD A;  1NVO A;  1X0T A;  1Q2N A;  4EYY Q;  3ZDM A;  2QRX A;  1Y47 A;  1BDD A;  2KS1 B;  5EFW B;  2UWJ E;  4NPE A;  1MFT A;  4BXL A;  1EC5 A;  1LP1 B;  2KZJ A;  4MN4 C;  3PH0 A;  4JBZ A;  2K3R A;  4K35 A;  2KZI A;  2P58 A;  3FXE A;  5DJT B;  4ASW A;  1U7M A;  2M5A A;  2B87 B;  1LT1 A;  2R44 A;  2WMM A;  1OVU A;  2I8D A;  5DJU B;  4ZNC A;  3QWO C;  5CBO A;  1EDK A;  1S3J A;  1LP1 A;  4HB1 A;  2RKL A;  2ZAE B;  4HJG H;  1BDC A;  2B88 A;  3MZW B;  3RGU A;  5CBN A;  2LXC B;  1EDJ A;  2QVA A;  3S1K A;  1FC2 C;  4K3A A;  1JM0 A;  2M0B A;  2SPZ A;  1SS1 A;  4NPF X;  1EDL A;  2B87 A;  1EDI A;  4KJM A;  5K5G B;  4NPD A;  4GOE A;  2JWD A; 
#chains in the Genus database with same CATH topology
 3JSV C;  3OJA B;  3U59 A;  1LTJ B;  1DEE G;  4U3F E;  3NMD A;  2Q7C A;  1JY2 P;  2PRR A;  3M0D A;  1JY2 N;  3KZI E;  1U7J A;  1JMB A;  4H0L C;  2GA1 A;  2LXB A;  4JPZ B;  2QA4 P;  1H0T B;  3Q1M A;  3D70 A;  2IBZ E;  3CXH E;  3F5H A;  5TIS H;  2W83 C;  2Q6Q A;  5BU8 B;  1VF5 C;  2KSJ A;  4H0L D;  2MKV A;  3H25 A;  1KC8 Q;  1NGM B;  1RQV A;  1LNQ A;  3CLQ A;  1FZC A;  3VMX A;  3SWY A;  4YXD C;  1RQU A;  1VF5 D;  3HE4 A;  3W68 A;  1YJW P;  1N73 C;  1A02 J;  2ZYA A;  1JNM A;  3CC2 P;  2HPC A;  1SQQ J;  3JCU E;  2OTK E;  1NTK K;  1NTM G;  1L0L K;  3KQG A;  4ASV A;  2FYZ A;  3MD0 A;  3I55 P;  3OW2 O;  2QIW A;  5CCH A;  1K73 Q;  1LWU B;  2V4H A;  1OXZ A;  1ZME C;  1NU1 K;  1IFP A;  2KSE A;  2J58 A;  5KLV E;  1PPJ G;  5AW0 B;  5CCG A;  3Q5P A;  1SQX J;  5AW1 B;  5CHX A;  5BU5 A;  1X8Y A;  3CWB D;  3TGU D;  4WWI A;  3JC2 2;  2IX7 C;  3B8E B;  2KI7 B;  1YQ4 C;  3CL3 D;  3S9O A;  1RF1 A;  2M5A B;  1HUC A;  3P32 A;  2CPB A;  2OTL P;  1X0T A;  1FDI A;  3WUT A;  3G4S P;  4EYY Q;  2Y0E A;  1VQ5 P;  1LTS C;  1VQO P;  5B66 E;  3L73 D;  4UB6 E;  5TIS E;  5KAI E;  3AE1 C;  1N73 A;  2Q5U A;  3HE5 B;  3W67 A;  2WPQ A;  3TGU E;  1M8O B;  2KS1 B;  4N6J A;  3SFD C;  1BSH A;  5KLV G;  1X79 B;  2PP6 A;  1GL2 A;  3V2N A;  3L70 J;  1KYO I;  4I2L C;  1JY3 O;  1EC5 A;  1IFN A;  1PGP A;  2BEQ D;  1SQX E;  1T2K C;  3UIA A;  1VQN P;  3JCU H;  2ZT9 C;  1SQV G;  2I1J A;  2QJY C;  4BRY A;  2J5U A;  2WWW A;  1EQ7 A;  1N7S A;  2K3R A;  1HWT C;  2ZJS E;  1LWU A;  1NAY A;  4PD4 H;  3U1A A;  1SQP J;  1KFM A;  1L2P A;  5AW5 B;  2P1J A;  3MTU E;  5KJ7 A;  2D2C B;  2XZR A;  3B5N D;  3L36 A;  3GG2 A;  3CCV P;  3IN6 A;  1YHQ P;  4U3F G;  1GL2 D;  3KHU A;  2KLU A;  3H6P A;  3BAT A;  2M5A A;  3EQ2 A;  3MP7 B;  4L75 A;  5KLV K;  1RY3 A;  1SQB E;  2WSE J;  3P8M C;  3RK2 D;  3TDK A;  1CZQ A;  2O3J A;  3A2A A;  1OZH A;  1NTZ J;  3CCM P;  2I8D A;  3AE6 C;  3B4S A;  3Q3D A;  2OQQ A;  2RMZ A;  4RKU J;  1JOC A;  1FDO A;  1PGJ A;  1KB9 H;  2ZVO B;  3VP8 A;  1GU5 A;  4GT1 A;  1PPJ E;  1QEX A;  4OGQ D;  1Y8A A;  3RK2 B;  2JEE A;  3HUS B;  2G8Y A;  3CXH H;  4N78 D;  5B66 H;  3A0H H;  2QJP B;  1BE3 E;  1KIL C;  1J1E B;  1LTT C;  5KKZ B;  4HB1 A;  4W80 A;  2WSF H;  4PD4 E;  3H32 A;  5CCG D;  2A45 H;  1VQ9 P;  3CD6 P;  1NU1 D;  1OW6 A;  1M90 Q;  1CI6 A;  3V5B A;  4TLF A;  2FXM A;  2JR8 A;  5KLV J;  4RO0 A;  2HOD B;  3IAO A;  1UII A;  1FC2 C;  3LW5 H;  2YNY A;  4H13 C;  1HTL C;  2GM4 A;  4PV1 C;  2WPS A;  4Z1M H;  2YIU B;  1SQV J;  2D2C D;  3B5N B;  3FX0 A;  1VQM P;  1J2J B;  1PV3 A;  2GUV A;  1BE3 D;  3AEA C;  4IFF A;  4PV1 D;  1S9K E;  3CME P;  2SPZ A;  1Q90 D;  1SFC A;  4KT0 J;  1BGY J;  4NPF X;  3M0A A;  1SQX G;  4AYC A;  1USD A;  2H7H A;  1BE3 G;  2BCC D;  2IPP A;  1YTZ T;  2N1T A;  1M1J C;  4JYC A;  4YPC A;  5H2F H;  1GTW A;  1KV4 A;  3H1K J;  3E7K A;  3EWK A;  4AUW A;  1JY3 P;  1QL1 A;  1SQP K;  1S1C X;  1PIX A;  1PL5 A;  1RHZ B;  3G71 P;  2BCC G;  2L91 A;  2YMY A;  3V4W A;  1RF0 A;  1FBM A;  3AE8 C;  4A7P A;  1ZW0 A;  2M8R A;  3VOP A;  1NU1 G;  3GF3 A;  4HKZ H;  5AVY B;  1GW4 A;  4ZKU A;  2R5B A;  1L0L E;  1T6A A;  2W8Z A;  1YTZ I;  4KHX A;  2YKP A;  3SSU A;  1NTZ K;  2POH A;  4GIF A;  2HPC B;  2JJL A;  3U1C A;  1GD2 E;  4GOF A;  2LR2 A;  2A06 G;  3TYY A;  1PGO A;  1L0N K;  4H44 C;  2HR3 A;  2YO2 A;  4OH8 B;  4I1L A;  4OGQ C;  4U3F D;  5TJH A;  5GTI E;  2XU6 A;  1IFI A;  1KMI Z;  1OIP A;  2AEM A;  3MUD C;  4N78 E;  4PJ0 H;  3VMA A;  1FJP A;  2K9Y A;  3AE7 C;  4YTP C;  1W5C E;  2B89 A;  3H1H D;  1PP9 D;  3LID A;  4HYT B;  1VF5 B;  1JY2 O;  1IFM A;  2QJP C;  4D6T E;  4RJT A;  3CX5 D;  1KIL B;  2GUS A;  4XA4 A;  1L4A A;  1OVR A;  2KOG A;  2QM8 A;  1KB9 I;  2WSE H;  2OYI A;  1WT6 A;  1KN7 A;  4B86 A;  1IJD B;  1UIX A;  1GZL A;  1OVV A;  5BVZ A;  1RF1 B;  3CC4 P;  1QGK B;  1G1J A;  3SFE C;  3TGU J;  3KPE A;  1IK9 A;  4H13 D;  3V2Q A;  3H1H E;  1VQ4 P;  2BEZ F;  1SQV K;  4H44 B;  3MIW A;  4JYB A;  5APT A;  1M1K Q;  1BE3 J;  1KFN A;  2A45 I;  4PV1 B;  5KJ7 C;  1LTJ A;  1HBW A;  3H1K G;  3G3Z A;  3ITK A;  3EFF K;  1IC2 A;  2A06 D;  2M3B A;  2C9N Y;  1VL2 A;  3L75 J;  3RK3 C;  3CCR P;  1W2B O;  5AVU B;  2WT7 A;  5CJ0 A;  1PZQ A;  2R5D A;  3L75 D;  3M9B A;  1FU1 A;  1M1J B;  5M1B A;  1KQF B;  3NFQ A;  1GMJ A;  1NTM J;  2YKO A;  3Q5R A;  2OYH B;  1JEK A;  2OYO A;  3AEC C;  3HTK B;  5APY A;  2OYI C;  2KNC B;  3KYQ A;  1SQB J;  3HD7 B;  4TT3 H;  1KYO H;  2KK7 A;  2UWJ E;  1LT9 A;  3FGA D;  1MFT A;  5KLI C;  5AW6 B;  3PH0 A;  4JBZ A;  4WVZ A;  5CJ4 A;  3H1K E;  2MJZ A;  3WUV A;  3H1I J;  1NHL A;  3PTZ A;  2IFM A;  4K35 A;  1P84 I;  1RE4 A;  4EDF A;  1MFZ A;  2YXR B;  2KZI A;  2PAJ A;  3AE3 C;  3FXE A;  5KAF E;  2P2U A;  2O1K A;  1E5W A;  1URQ C;  1EXJ A;  4DCK A;  1NTZ D;  3I5C A;  4ASW A;  3TGU G;  1U7M A;  1FE6 A;  1NTK J;  3PP5 A;  2W90 A;  1LTA C;  4QMA A;  1URQ D;  1ZRT E;  4IL6 H;  3WU2 H;  1L0N D;  2R44 A;  1P84 E;  1L4A C;  1ZOY C;  5APQ A;  5KAI H;  4Y99 B;  1SQV E;  2AEF A;  2H8P D;  2LKM A;  5DJU B;  1LT9 C;  2H88 C;  2YO3 A;  1CI6 B;  2ZVN B;  3TNU B;  3F89 A;  2XND H;  2IBZ I;  3CXH I;  1SQB D;  3QWO C;  1SQP G;  3D6Y A;  1S4X A;  2V7Q J;  4AQR D;  5CBO A;  3IF4 A;  2KYV A;  1GL2 B;  3S4R A;  3RK3 D;  4WY4 A;  4WB4 A;  2JO1 A;  2FFD A;  1GK6 A;  1T3U A;  5AW4 B;  3V4Q A;  1P84 D;  1AA0 A;  1BCC G;  3L70 D;  1BGY D;  1SQB G;  1J1E C;  3KZI H;  4U7J A;  4Y28 J;  2Y0D A;  5AVQ B;  3H1H G;  1NTZ G;  1NJI Q;  2NPS B;  2E74 B;  2XDJ A;  1T8Z A;  2P7J A;  3BCC D;  3OA7 A;  4K3A A;  1FAV A;  2M3E A;  1U57 A;  5KAF H;  3CMA P;  1FZC C;  1LJ2 A;  2M0B A;  1KQL A;  1SQX D;  4H13 B;  5KLV D;  1KTM A;  1X9V A;  2IYP A;  2YMK A;  4XFJ A;  1QLE D;  2YIU C;  3FWL A;  5AW2 B;  4C7R A;  3AE9 C;  1EDI A;  4KJM A;  5AVT B;  4EOT A;  1Q7Y Q;  1JCD A;  2K1A A;  4C7N B;  1IO4 A;  3TSI A;  3RGU A;  1SFC C;  2B9B A;  1NWQ A;  1TU3 F;  1N7S C;  3GHG B;  2JP3 A;  2P10 A;  3O6Q A;  2PFX A;  4N3Y B;  4D6T J;  2FFD C;  1NOH A;  2E74 C;  5AW7 B;  1SQQ G;  2Y0C A;  3PLN A;  3VYI A;  1ZV8 A;  1GW3 A;  2R32 A;  1KOR A;  3AEF C;  3IR9 A;  1YIJ P;  1DD4 A;  1JUN A;  3CI9 A;  4OVN F;  5APW A;  1FZC B;  2FYU J;  2KB7 P;  2XNX A;  1PPJ D;  3H32 B;  3G9R A;  4R4L A;  1DIP A;  2ZT9 D;  3FXD A;  1R5S A;  1AFO A;  2WSC H;  1OW7 A;  1L4A B;  3L72 J;  4IL6 X;  3GW6 A;  4IOI H;  1S5L H;  2W6A A;  1J1D C;  2K88 A;  1WRG A;  2OGU A;  5AVS B;  1VQ8 P;  1GK4 A;  1YIT P;  3GHG C;  4R4M A;  3RL0 D;  2BCC J;  1L0N G;  2QJY B;  4LC1 A;  1NTK D;  2WPV B;  3MUD A;  5H2F E;  1GL2 C;  4PD4 D;  3C1L A;  1NTM K;  2FYU D;  1MKM A;  1NU1 E;  3L70 E;  3Q2Y A;  2H43 A;  1R5L A;  2N1T B;  1Q81 Q;  2Q3I A;  1L0L G;  3WUU A;  1QVF O;  1JO5 A;  2R3S A;  3CPW O;  1KQS O;  1FZA A;  1SQB K;  2Q1K A;  2ZFC A;  2NZ2 A;  1S9K D;  1GU4 A;  1DD3 A;  4D6T D;  2K9J A;  3L71 D;  1IFD A;  2ITA A;  2NPS C;  3CX5 E;  4DT0 A;  3Q5S A;  1J1D B;  2J59 M;  2WPR A;  3L72 E;  1FZG A;  1NKZ B;  1GDT A;  4L76 A;  2NPS D;  3BRT B;  4GDO A;  1MZ9 A;  1ZN5 A;  2KNC A;  5GTI H;  4ZMD A;  1NVO A;  3P8C D;  3AEB C;  1PP9 G;  4D6T G;  4O9B A;  3H1L G;  1EZV I;  3CCJ P;  1SP4 A;  2N1T C;  3ZDM A;  2RN0 A;  3RK3 B;  1IZN B;  1CSB A;  4L73 A;  1N7S B;  1NTM D;  4U3F J;  2YKQ A;  2FYU G;  3T97 A;  3CCQ P;  2N9Y B;  1BDD A;  5KKZ C;  4I7Z B;  1YJN P;  2OYH C;  3KDP B;  1OFC X;  2DW3 A;  2PGD A;  3HD7 D;  4NPE A;  1H8A A;  1LP1 B;  1KIL A;  2KZJ A;  5APX A;  3L74 J;  4WY4 C;  2OYI B;  1N73 B;  3N4X A;  1QX8 A;  3HD7 C;  1VPC A;  4LGD E;  3H1J J;  5AVW B;  2G3A A;  4W7Z A;  1FOS F;  1PFI A;  1T2K D;  4WY4 D;  3AE2 C;  3AEE C;  1L0N J;  1RE3 C;  1PP9 E;  2KS1 A;  3B5N C;  1AVY A;  2IZ1 A;  3E1R A;  3GF7 A;  3H1I E;  5KLI B;  2K9J B;  3VMZ A;  1FZB A;  1KIL E;  1AQT A;  3BAS A;  2IDB A;  1LTB C;  3C8V A;  3VTP C;  3H1K D;  5DJT B;  2HLO A;  2QG4 A;  3L74 D;  5GTH H;  2ZYG A;  1Q86 Q;  2FYU E;  3M9H A;  2E5Y A;  3M06 A;  1FOS E;  2B87 B;  2Z5H A;  3L70 G;  5CBN A;  2WT7 B;  2W27 A;  3H1J D;  2WMM A;  1OVU A;  1DEB A;  1MUU A;  3EFG A;  4WY4 B;  3E1I A;  1M1J A;  1QL2 A;  2OYH A;  1YI2 P;  2R3C A;  3BCC G;  3L71 E;  2O01 N;  3L74 E;  2IBZ D;  3CXH D;  3CWB G;  1KIL D;  3T97 B;  1G2C B;  2FXP A;  3TF5 A;  1KB9 D;  1XTG B;  1VQ6 P;  1YYC A;  3HD7 A;  3H1L J;  1L0N E;  2NPS A;  1S3J A;  3L72 G;  5KTB A;  2WVR A;  3RBZ A;  1HJ0 A;  3TK1 A;  4BWN A;  4EI2 A;  3CCL P;  1LP1 A;  2W6B A;  1K04 A;  2RKL A;  2ZAE B;  5B5E E;  1H89 A;  3L37 A;  1BDC A;  1LGH B;  2QEX P;  4GKG A;  2C0X A;  1EDJ A;  5CCG C;  2QM7 A;  3CCS P;  2ZT9 B;  2O01 H;  1YQ3 C;  1D7M A;  1EZV E;  1OMI A;  1HJB A;  3R2P A;  1NH4 A;  1JM0 A;  1K8A Q;  3GHG A;  1S5L X;  3H1J G;  1M7L A;  4I7Z C;  3CWB E;  3A7O A;  3L71 J;  4PJ0 E;  1NKN A;  3I56 P;  2ZXX A;  3D71 A;  2D2C C;  1SQP E;  1SS1 A;  1NYH A;  2AXT H;  3AEG C;  2B87 A;  3RL0 g;  1EXI A;  1EDL A;  4I6M C;  5K5G B;  2IBZ G;  3CX5 I;  2VRS A;  3HRN A;  3H1L E;  4UB8 H;  5AVX B;  1R8E A;  4OWF A;  5E79 H;  1HVV A;  4IFM A;  2WSC J;  1JY3 N;  1BCC E;  1EZV D;  1X22 A;  1VQL P;  1SQP D;  2AXC A;  1G2C A;  2O01 J;  3H1H J;  4DZO A;  1A02 F;  1NTZ E;  3MHV A;  3OAK A;  1HF9 A;  1EZV G;  2XKM A;  3AE5 C;  3M0D C;  4H0L B;  2Q3E A;  1USE A;  3V2P A;  4C46 A;  1ZXG A;  4CPG A;  3RK2 C;  1H88 A;  3WMM 0;  2FFD B;  3H1J E;  2FXO A;  3H1L D;  3BVH A;  4DJG A;  2E5T A;  2A45 G;  1KYO D;  3N7N A;  1JB0 J;  1BCC D;  1FS0 E;  2KIK A;  2O1J A;  3L74 G;  2Y9Y A;  3L35 A;  3HE5 A;  4HH2 A;  5B5E H;  1DX7 A;  2H89 C;  2QE7 H;  4JF7 A;  1G1I A;  1M57 D;  2P67 A;  2RH0 A;  3KXD A;  4H44 D;  1BGY E;  3CX5 H;  3L75 G;  1VQ7 P;  1JMM A;  1ZR2 A;  5C39 A;  3II6 A;  1OW8 A;  1SQQ E;  3MGN A;  3PJS K;  1H0T A;  1BSN A;  2E75 D;  1IFJ A;  1SLQ A;  1Z56 A;  2ZXE B;  3NXS A;  2HYN A;  3G6E P;  1ZP0 C;  1DH3 A;  1S72 P;  1KYO E;  1L4A D;  3BCC E;  2KUB A;  1RF0 C;  1N86 A;  3HE4 B;  3L71 G;  1NTK E;  1URQ B;  3O6Q B;  2C9L Y;  1ZRT D;  2OAR A;  4GOD A;  4RES B;  2YXQ B;  5AW9 B;  3RL0 B;  2IZ0 A;  4L74 A;  1HH0 A;  1NAF A;  1ZR4 A;  1SQV D;  1VQK P;  3BCC J;  5AVZ B;  2BAS A;  2IFN A;  4JQ0 D;  3CCE P;  2HFE D;  2E76 B;  4Y99 C;  1CW5 A;  1Y9B A;  1S5L E;  2CK3 H;  2Y9Z A;  1LT9 B;  3IFM A;  3BRV B;  1RF1 C;  1Q2N A;  2CPS A;  2Z5I A;  3B71 A;  3GLM A;  1SQQ K;  2QRX A;  3K5B A;  3RK3 E;  1Y47 A;  1Q82 Q;  1L0L J;  2FKW B;  3L73 G;  3VN0 A;  2WSS H;  1PGQ A;  2FY8 A;  2K37 A;  3AE4 C;  1WMK A;  3GMA A;  3HUS A;  3LW5 J;  5GTH E;  1NTK G;  4OGQ B;  2FBW C;  5EFW B;  2Q9I A;  1AJY A;  1OWA A;  2JDI H;  4BXL A;  3CCU P;  1VQP P;  2JWA A;  2FYU K;  2FYN C;  3A0H E;  3PHL A;  4LLH A;  2JKV A;  2N9B A;  4MN4 C;  5APS A;  5CCH C;  3FWN A;  2WSF J;  3A5T A;  3CC7 P;  2L5G B;  3HTK A;  3WU2 E;  3SWF A;  1JTH A;  2C0W A;  2WQY C;  1PP9 J;  1SFC D;  1HGV A;  2HOD A;  3NTN A;  1KZU B;  3M91 A;  1FZE A;  1MV8 A;  1RH5 B;  1URQ A;  1K05 A;  4PD4 I;  5AVR B;  5E79 E;  5AW3 B;  1YJ9 P;  2QSI A;  1RE3 A;  2P58 A;  3A0B H;  3B5N A;  2Z4E A;  1E79 H;  2KXP B;  2E74 D;  1RE4 C;  1N7L A;  2WIT A;  3RBX A;  3ABV C;  1SQQ D;  3TNU A;  4BRY B;  3LIE A;  2E43 A;  3V6I A;  1SFC B;  1S2E A;  2E75 C;  3H1I D;  4M3L A;  5AVV B;  1LT1 A;  1YBK A;  3SWK A;  2FYN B;  1NO4 A;  3PRJ A;  3HUS C;  5L8R J;  1QVG O;  5AW8 B;  1L0L D;  4XE5 B;  4UB6 H;  3D6Z A;  4EIJ A;  4ZNC A;  2OTJ P;  3L72 D;  3P8C E;  4DOJ A;  1N8R Q;  5KJ7 D;  3H1I G;  2AEJ A;  1FZF A;  3VMY A;  2I1K A;  1EDK A;  1BGY G;  1OX3 A;  2ZYD A;  1W2E A;  1JCC A;  2AXT E;  3L75 E;  3O8Z A;  2E76 D;  3RL0 C;  3USS A;  1IK7 A;  3L4F A;  2KLV A;  2KP8 A;  4UB8 E;  4YXW H;  1NTM E;  4HJG H;  2V7Q H;  3L73 J;  1LTG C;  2E76 C;  1N2D C;  1ZLL A;  2B88 A;  2BCC E;  1LWU C;  2E75 B;  2NRG A;  2QJK B;  3MZW B;  4IL6 E;  2W6J H;  5APV A;  1KB9 E;  2LXC B;  1JTH B;  1P84 H;  2QVA A;  3S1K A;  1M56 D;  1LTI C;  1FDM A;  1KD1 Q;  1SVF A;  1NU1 J;  3QH9 A;  4C7N A;  1LTJ C;  3R4Y A;  2E42 A;  1SQX K;  3A0B E;  5APU A;  3VP9 A;  3C9I A;  3CWB J;  3V2R A;  1AQ5 A;  1VDF A;  1T3J A;  1AV1 A;  4W7Y A;  2IYO A;  1HGZ A;  3P7K A;  2WTY A;  5CCH D;  1K9M Q;  2A06 E;  1FJK A;  1N7S D;  4NPD A;  2XV5 A;  4ZKP A;  2WZ7 A;  4GOE A;  1KQG B;  2JWD A;  4WBA A;  2QJK C;  1AVO A;  3A3Y B;  1XTC C;  2HG5 D;  1BCC J;  2N1T D;  5CMZ A;  3M9Q A;  3L73 E;  3AED C;  4IFD K; 
#chains in the Genus database with same CATH homology
 1ZW0 A;  3MHV A;  1DEE G;  4HKZ H;  1ZXG A;  4CPG A;  1U7J A;  1JMB A;  3FXD A;  2LXB A;  4GOF A;  2LR2 A;  1H0T B;  4IOI H;  2HR3 A;  2KIK A;  2B89 A;  5C39 A;  1H0T A;  1OVR A;  2OTK E;  4ASV A;  1OVV A;  2Q1K A;  2KUB A;  4GOD A;  4WWI A;  2KI7 B;  2M5A B;  4ZMD A;  1NVO A;  1X0T A;  1Q2N A;  4EYY Q;  3ZDM A;  2QRX A;  1Y47 A;  1BDD A;  2KS1 B;  5EFW B;  2UWJ E;  4NPE A;  1MFT A;  4BXL A;  1EC5 A;  1LP1 B;  2KZJ A;  4MN4 C;  3PH0 A;  4JBZ A;  2K3R A;  4K35 A;  2KZI A;  2P58 A;  3FXE A;  5DJT B;  4ASW A;  1U7M A;  2M5A A;  2B87 B;  1LT1 A;  2R44 A;  2WMM A;  1OVU A;  2I8D A;  5DJU B;  4ZNC A;  3QWO C;  5CBO A;  1EDK A;  1S3J A;  1LP1 A;  4HB1 A;  2RKL A;  2ZAE B;  4HJG H;  1BDC A;  2B88 A;  3MZW B;  3RGU A;  5CBN A;  2LXC B;  1EDJ A;  2QVA A;  3S1K A;  1FC2 C;  4K3A A;  1JM0 A;  2M0B A;  2SPZ A;  1SS1 A;  4NPF X;  1EDL A;  2B87 A;  1EDI A;  4KJM A;  5K5G B;  4NPD A;  4GOE A;  2JWD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...