4NPFX

High-resolution structure of two tandem b domains of staphylococcal protein a connected by the conserved linker
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
115
structure length
115
Chain Sequence
DNKFNKEQQNAWYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAWYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multiscale conformational heterogeneity in staphylococcal protein a: possible determinant of functional plasticity.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Protein binding
molecule keywords Immunoglobulin G-binding protein A
total genus 49
structure length 115
sequence length 115
chains with identical sequence Y
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npfX01
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4npfX02
3FXEA 5EFWB 2I8DA 4GOEA 1U7MA 4EYYQ 2LXCB 4K3AA 2B88A 2P58A 4ZMDA 4GOFA 1H0TB 1ZW0A 2LXBA 3RGUA 4HKZH 4ASWA 1JM0A 1JMBA 5K5GB 2M5AB 1SS1A 2SPZA 4IOIH 2M0BA 4HB1A 2R44A 1EC5A 4HJGH 2HR3A 1H0TA 2B87B 1LP1A 1DEEG 3ZDMA 4ASVA 1OVRA 2QVAA 2LR2A 3PH0A 1LT1A 2JWDA 1EDLA 2UWJE 4NPEA 4GODA 5DJUB 2B87A 1LP1B 4JBZA 2OTKE 1NVOA 2WMMA 1EDIA 4CPGA 2Q1KA 2KI7B 4K35A 1X0TA 4KJMA 1MFTA 5DJTB 1OVUA 1FC2C 1BDDA 1EDKA 5CBNA 1ZXGA 1Y47A 2RKLA 2KS1B 1Q2NA 2KZIA 2KZJA 3FXDA 2B89A 1U7JA 4MN4C 2QRXA 5CBOA 1OVVA 3MZWB 4ZNCA 1S3JA 2ZAEB 5C39A 2KIKA 4BXLA 2K3RA 4NPDA 4NPFX 2M5AA 3MHVA 4WWIA 3QWOC 2KUBA 1BDCA 3S1KA 1EDJA
chains in the Genus database with same CATH superfamily
3CL3D 3VTPC 1KC8Q 2JR8A 4OWFA 1WMKA 4H44B 1BCCG 1R5LA 2KLVA 2KYVA 3L37A 1EXIA 1T6AA 2P58A 5CHXA 2OGUA 3L70D 3GF7A 1SQQK 2E74D 1H0TA 1NKZB 4GOFA 3L75G 4JYCA 3B71A 5AVTB 3CCMP 1A02J 3CMAP 2IPPA 4U3FD 1NTZG 2LXBA 3RGUA 2B9BA 1EZVG 3H1HG 4EI2A 4ZKPA 5CCGD 4H0LC 5TJHA 1JM0A 3TGUJ 5KAFE 2M5AB 4O9BA 1YTZI 3S9OA 1FE6A 1NTZK 1SQBK 3RK2C 2OYIB 1BE3G 4HH2A 3TNUA 4Y99C 2Z4EA 3GMAA 1SQBD 2MKVA 3CCVP 1USEA 2R5DA 1VQ7P 2B87B 5CJ4A 1LP1A 4IL6H 2CK3H 4EOTA 1N7SD 3B5NB 4UB8E 2PRRA 4Y99B 1NTMD 4RESB 4ASVA 2FXMA 1JY2O 1NTMG 1OVRA 3A3YB 2G3AA 2Q6QA 2QVAA 3CI9A 1L0LK 4M3LA 5AVSB 1URQC 3HE4B 3L36A 3B4SA 2HYNA 5APTA 1KFMA 1SQXK 3B5NC 3CXHE 3KPEA 1LTJC 1S4XA 5AW7B 3H1JD 2W90A 5AW8B 4EDFA 1EDLA 2JJLA 5L8RJ 3OJAB 2UWJE 5KLVD 5KJ7C 1RF1A 1PV3A 1HWTC 1NGMB 5AW2B 1NYHA 2VRSA 1L4AC 3L35A 1FS0E 1JO5A 2H43A 4UB6H 4JBZA 5CCHC 1HVVA 2OTKE 1PGJA 2H88C 3A7OA 3FWNA 3MIWA 2FFDA 3H1HE 1VPCA 3SWKA 1X79B 2KS1A 2P1JA 3AEGC 4R4MA 1L2PA 2WPQA 1GL2A 5KAIE 4PD4E 4KJMA 3H1KG 1NU1D 4PV1C 5AVYB 3BVHA 3BCCG 3V6IA 2K88A 4H13D 3SSUA 4OGQB 2OARA 1AVOA 2QJPB 4LLHA 3Q2YA 5AVQB 3CC2P 1LNQA 3CWBG 1S9KE 3L73J 4D6TJ 1L0LE 1KQSO 1K9MQ 1AVYA 2QJPC 2AEJA 3GHGC 1L0NJ 2QA4P 1IK7A 2N9BA 2OTJP 2V7QH 1RF0C 5CCHA 3A5TA 1Q2NA 2WZ7A 2JDIH 4Y28J 3FXDA 3M91A 2ZVOB 4WY4A 4YXWH 4L75A 3V2RA 3JSVC 3W68A 3VP8A 1G2CB 2E75B 2KP8A 4TLFA 4MN4C 1SQXD 1QL2A 2M3EA 1PGQA 1GTWA 1BCCE 1PPJE 3L74E 1SFCD 4U3FG 5APVA 1NO4A 1VQMP 1K73Q 1H88A 2NPSB 1ZR4A 1VQPP 2OYIC 2FY8A 1YTZT 1JTHB 3H1HJ 3H1KD 3P8CE 1N2DC 2PGDA 3BCCE 3CX5H 5E79E 1S5LH 3H1JJ 4RJTA 1YIJP 2ZT9D 2YO2A 2IBZG 2HLOA 2GUSA 1BE3D 3UIAA 2IBZD 2E74B 2PP6A 2XNXA 3A0BE 1WRGA 3V2QA 1LWUA 1A02F 5C39A 2KIKA 1LTAC 1GMJA 1RQVA 3CWBD 1PGOA 1SQVE 4U7JA 3TSIA 1N73B 2WSCH 1M8OB 3RL0B 2E5TA 3HTKA 2KOGA 1S5LX 1L0ND 1SQQD 2QJYC 3RL0D 4OVNF 2WSCJ 4A7PA 2ITAA 3HE5B 3HUSC 4OH8B 3KZIE 1RE4C 3TGUD 1FAVA 3CCJP 1H89A 3A0HH 3GF3A 1SQVK 1PFIA 1KD1Q 3GLMA 4ZKUA 2ZVNB 3S1KA 2YIUB 1P84E 4KHXA 1GU4A 2DW3A 4DT0A 2L5GB 1EDJA 4L73A 4IFDK 2YXQB 1JY3P 1OXZA 2RN0A 2HODB 1BGYE 1LTGC 2I8DA 1LWUC 3L70J 1NTZD 1U7MA 3LIEA 2O01J 2YO3A 3L71J 3L71D 3OAKA 4YTPC 3V4QA 4OGQC 3PHLA 4ZMDA 2YMKA 1SFCB 2R3SA 1FZEA 1FU1A 2BEQD 3BRVB 3NXSA 1FDIA 3R2PA 2WSEH 4PJ0E 4PV1D 4YPCA 3CD6P 2WITA 2ZXEB 4YXDC 4GIFA 3U1AA 1XTCC 3EQ2A 1DEBA 5KLVJ 1H8AA 3QH9A 2W8ZA 4HKZH 3H1IJ 2KB7P 1DD3A 2WQYC 5K5GB 1SS1A 2ZXXA 3HD7D 3V2NA 1CSBA 2BCCJ 4EIJA 5AVUB 1YJNP 2XV5A 3H1LG 2K9JB 3KHUA 2QSIA 3H1JG 3Q5RA 1NOHA 1NAFA 2HR3A 1KYOH 1M56D 4IFMA 2YMYA 1AQTA 3II6A 3MGNA 3CCQP 1RHZB 2R5BA 2NZ2A 5AW4B 1K05A 2KSEA 5KLVG 3AE2C 3GHGA 1CW5A 2LKMA 1E5WA 1YHQP 1BE3J 2Y0DA 3JCUH 1AQ5A 4H13B 3CMEP 2JWDA 1KORA 3PJSK 3VYIA 3OW2O 5E79H 3RBXA 2O3JA 2W6AA 4NPEA 2C0WA 3L70E 2OYHB 2QE7H 4W80A 3VOPA 2IFNA 3I5CA 1NU1G 3CX5I 4GDOA 5DJUB 1KB9D 1NHLA 3WU2E 1N7SC 4D6TG 1QL1A 5APYA 2FXOA 2A06E 3SFEC 2KI7B 3D6YA 3CXHH 3TNUB 3TYYA 2QIWA 5GTIH 2MJZA 1N7SB 2WSSH 1FZGA 1FJKA 2WPRA 3CCSP 1SQPE 1M1JA 2YNYA 3L4FA 1YBKA 1LGHB 4H0LD 2FYUJ 2IDBA 1VQOP 1SQPJ 2BCCE 3WUUA 1ZN5A 3HD7B 1FZCB 1FDMA 1ZV8A 1HH0A 1AFOA 2N1TD 1N7LA 3H1IE 3I56P 1NTKJ 3CCUP 4Z1MH 3CXHI 1JUNA 1JY2N 2QM8A 1YITP 1S5LE 1RF1B 2R3CA 1JY3O 2HFED 4JQ0D 4W7YA 2Q3EA 5BU5A 1T8ZA 3AECC 2BASA 1K04A 3PTZA 3MUDA 3AEBC 1BSNA 2W6JH 3CLQA 3GG2A 5M1BA 2B89A 5KAIH 2Z5IA 4DOJA 3HUSA 1RF1C 1EZVE 2FFDB 1P84H 1JCDA 4C7NB 4L74A 4WB4A 5AVXB 3VMZA 1NU1E 1JMMA 1HTLC 1N8RQ 1GL2B 2NRGA 2QRXA 2G8YA 2WTYA 1YQ3C 3H1HD 3V2PA 2A06G 2Q3IA 3JCUE 3D6ZA 4WVZA 3AEAC 2D2CD 3RK3B 5CBOA 1ZRTE 1S1CX 2E76D 1J1EC 2RMZA 3AEFC 3L73E 2ZT9C 1FZFA 1Q81Q 1MKMA 1TU3F 1KILA 3RK3E 2P10A 1KYOE 1AJYA 3WMM0 3PLNA 3RL0g 1LTTC 2BCCG 2R32A 5GTIE 4TT3H 4JF7A 1L4AB 3MUDC 1SQVD 1WT6A 1NTMJ 3H32A 1RQUA 3N7NA 4N78E 3TGUG 1VQNP 1M90Q 1G1JA 3L72D 3M0DA 2HPCB 4WY4B 4IL6E 1IZNB 3N4XA 1UIIA 4C7RA 3AE6C 2YXRB 4I7ZC 1Q82Q 4AQRD 3LW5H 4PV1B 2OYHC 4D6TD 2ZJSE 3USSA 3WUVA 1HJ0A 3MD0A 5AVZB 1JB0J 4UB6E 2KUBA 3L71G 4H44C 3VMXA 2IYPA 1VF5C 1BDCA 2WT7B 1PPJD 3L74D 1D7MA 1NU1J 3FXEA 1SQQJ 1PGPA 3E7KA 3PP5A 1J1DB 2N9YB 1CI6B 1NAYA 2XKMA 1IC2A 3M9HA 4GOEA 2OYOA 1VQKP 3CCEP 1FJPA 3R4YA 3HRNA 1HUCA 4K3AA 1ZOYC 2B88A 1KILD 5AW1B 3CCRP 2WPSA 1IO4A 4N6JA 3KZIH 3D70A 4I1LA 1FOSF 3FGAD 1BE3E 1OMIA 1OX3A 1KYOD 2E75C 2KNCB 3AE1C 2Y9YA 1GDTA 3B5NA 4UB8H 3VMYA 1FZAA 1ZW0A 2CPBA 2KLUA 3A0HE 3D71A 2IYOA 1ZMEC 2Q7CA 4ASWA 1LJ2A 1SLQA 1X22A 2ZYDA 3H1KJ 2Q5UA 2M3BA 3L72G 3T97A 1GK6A 2JO1A 1NTME 1L4AD 1LTIC 2AXTE 2SPZA 3HE5A 3LW5J 2M0BA 2IFMA 4HB1A 5BU8B 2N1TC 2QEXP 2R44A 2IX7C 5KJ7D 3A0BH 3L75E 1KQFB 5CCGA 2FFDC 4HJGH 1L0LJ 1T3UA 1X8YA 2GUVA 1EZVI 2FYNC 3AE5C 2FBWC 2PFXA 3H1IG 1GL2C 1SQXJ 3I55P 1NTZJ 3S4RA 1Y8AA 1SQBJ 1G1IA 1JY3N 1KQGB 1SP4A 1OFCX 2YKOA 4PD4D 3WU2H 1ZP0C 2HODA 2AEFA 3EFFK 2WWWA 1VQ4P 3H25A 1KV4A 3L74J 3WUTA 1CZQA 1QEXA 3AE3C 1FDOA 2YKPA 2LR2A 3BATA 1FZBA 1OW8A 1SFCA 2ZYGA 3PH0A 2A45I 4RO0A 1PZQA 3ITKA 1R5SA 3A2AA 3AE4C 4GODA 2GM4A 1BCCJ 1LTJB 5APSA 2JP3A 2B87A 1LP1B 5AW6B 1KB9I 4R4LA 2JWAA 1T2KD 1GL2D 3V4WA 3H6PA 5CCGC 5AVRB 2Q1KA 3AE7C 4WY4C 3L73G 5CCHD 3HE4A 5KLVK 1BSHA 4K35A 1X0TA 2A45H 2XZRA 4GKGA 4I6MC 1KYOI 2D2CB 3RK3D 2Z5HA 1NKNA 4XFJA 4BRYB 1S72P 2AXCA 3W67A 3LIDA 2W6BA 1URQA 1OIPA 1QX8A 2K9YA 1FC2C 1OW6A 2I1JA 1EDKA 4D6TE 5CBNA 1ZR2A 2QG4A 1YI2P 3CC7P 1URQD 5KTBA 4AYCA 1ZXGA 1BGYG 3NTNA 2M8RA 1KN7A 3CX5D 2RKLA 3M0DC 4RKUJ 1FBMA 1SQXE 2KS1B 2OQQA 4PD4H 5B66E 5KAFH 1GZLA 1PPJG 3L74G 4L76A 4XE5B 1M1KQ 2E42A 1JNMA 1GW4A 2J5UA 2O01N 3AE8C 3L71E 4DZOA 1LT9C 3CWBE 1JCCA 3KYQA 2E43A 3M9BA 2KXPB 3BCCD 1AV1A 1MFZA 3SWYA 4WBAA 3CC4P 3IF4A 3O6QA 1IFNA 3EFGA 1L0NG 4H0LB 1LT9B 1MUUA 3KQGA 5H2FH 2FYUE 5APUA 2AEMA 2BCCD 2K1AA 3H1LE 3L73D 5B5EH 3HTKB 3G6EP 1OZHA 3FWLA 2N1TB 2E74C 3MZWB 3SFDC 3U59A 3O8ZA 1E79H 1SQPD 3B8EB 1FZCA 1M1JC 1M7LA 2FYUD 2JEEA 4JPZB 5EFWB 5KLVE 1DH3A 1G2CA 1N73C 1SQQE 1RF0A 3BCCJ 2H7HA 2Y9ZA 2ZAEB 2FYUK 1RE3A 3L72E 4U3FE 3Q5SA 4BXLA 1R8EA 3C9IA 2K3RA 3IR9A 5AW9B 5GTHH 2FXPA 1SQXG 1QVGO 2W83C 2FYZA 2W27A 3CX5E 3JC22 3RBZA 1P84I 2E76C 1P84D 2IBZE 3M0AA 4C7NA 1FOSE 4AUWA 4C46A 4KT0J 4NPFX 2M5AA 3VP9A 3RL0C 1NTKG 3MHVA 1ZRTD 3H1KE 2OYIA 1IFDA 2E76B 2IZ0A 4WWIA 3TF5A 1PP9D 3QWOC 1FZCC 1Q86Q 1HBWA 1LWUB 1U57A 1IK9A 2IBZI 2P67A 1L0NE 3AEDC 1EXJA 1N73A 1SFCC 2V4HA 2J59M 2P2UA 2RH0A 2YIUC 4EYYQ 4N78D 2LXCB 3V5BA 3G4SP 1W5CE 1NH4A 5BVZA 1Y9BA 3H1LJ 2ZYAA 4XA4A 1HJBA 2XDJA 1SQQG 4DCKA 3G9RA 3H1JE 2QJKC 2XU6A 3P7KA 1KTMA 1QGKB 3GHGB 1DIPA 2KSJA 1PP9J 3H1ID 1GW3A 1QLED 2H8PD 1LTBC 1JMBA 4LGDE 1IFIA 5AVWB 1T2KC 2FKWB 1KB9H 1YQ4C 3C8VA 3FX0A 4HYTB 2K37A 1Z56A 3NFQA 4IOIH 3RK3C 4DJGA 2O01H 3P8CD 2C9NY 1VL2A 1EC5A 4LC1A 2ZT9B 2OYHA 4IFFA 5APQA 1EZVD 3OA7A 3L72J 1DEEG 1MV8A 3M06A 2J58A 1YYCA 4H13C 3ZDMA 1L0NK 1PP9G 5GTHE 1CI6A 2CPSA 1HGVA 5KKZB 3BRTB 1ZLLA 2A45G 1GU5A 2NPSC 3U1CA 5APXA 2WVRA 1LT1A 2O1KA 3NMDA 1RH5B 1M57D 1NU1K 5AW3B 1M1JB 1SQVG 1S9KD 1PIXA 1OWAA 1NJIQ 1W2BO 2K9JA 1LTSC 1J2JB 1DD4A 4N3YB 1SQPG 1SVFA 2IZ1A 4IL6X 2KK7A 2Y0CA 1AA0A 2FYUG 3VMAA 1GD2E 3CXHD 1VDFA 3K5BA 4PJ0H 3T97B 3H1LD 1NVOA 2WMMA 1EDIA 2Y0EA 3IAOA 3IN6A 5TISE 4CPGA 1VQLP 3B5ND 1IFJA 3CWBJ 1BGYJ 2WSEJ 2WSFH 3Q1MA 2ZFCA 2E75D 1NTZE 2C0XA 2QJYB 3BASA 4B86A 1BGYD 3HD7C 3L70G 1H0TB 1MFTA 5DJTB 1N86A 1VQ9P 1KZUB 4GT1A 1NTKK 3L75D 1X9VA 2NPSA 1OVUA 3HUSB 1NWQA 3EWKA 1JTHA 1BDDA 3F5HA 2A06D 3E1RA 1VQ5P 1RE3C 1PL5A 1OW7A 1NTKD 2NPSD 3GW6A 1DX7A 3P8MC 1Y47A 2GA1A 5KLIC 3C1LA 1USDA 2AXTH 2QM7A 1VF5D 3P32A 3ABVC 3TDKA 1KILC 3VN0A 1SQPK 3F89A 1N7SA 1NTKE 2O1JA 1KQLA 3KXDA 1Q90D 2XNDH 1LTJA 2KZIA 5AVVB 5KLIB 1SQBG 2KZJA 1UIXA 3IFMA 4I2LC 3RK2B 3TK1A 3SWFA 1HGZA 1KILB 2V7QJ 4U3FJ 1SQVJ 1RY3A 1U7JA 1IFMA 1RE4A 5H2FE 3RK2D 4JYBA 5AW5B 5KJ7A 3CPWO 3Q5PA 1YJ9P 2FYNB 2QJKB 3HD7A 1L4AA 4H44D 4OGQD 1GK4A 1JY2P 1S2EA 5CJ0A 1Q7YQ 1JEKA 2POHA 4BRYA 1W2EA 2HPCA 1KFNA 1BCCD 5AW0B 1URQB 1XTGB 1OVVA 3TGUE 3Q3DA 1IFPA 2H89C 1K8AQ 1VQ6P 4ZNCA 3G3ZA 2HG5D 3M9QA 5B66H 3MP7B 5APWA 3L75J 4W7ZA 1QVFO 2BEZF 1S3JA 3KDPB 4PD4I 1YJWP 1J1EB 1JOCA 1IJDB 2Q9IA 1KMIZ 5KKZC 2WT7A 5CMZA 5TISH 1KB9E 2L91A 1T3JA 3AE9C 3PRJA 4QMAA 4WY4D 1L0LD 2JKVA 2E5YA 1KILE 1L0LG 1HF9A 2PAJA 1NTMK 3E1IA 1EQ7A 2D2CC 2P7JA 1VQ8P 1SQBE 4NPDA 1VF5B 5B5EE 2YKQA 3G71P 1PP9E 2OTLP 3O6QB 2I1KA 2WPVB 4BWNA 1LT9A 3AEEC 2KNCA 4I7ZB 2C9LY 1J1DC 3CCLP 3H32B 3MTUE 2N1TA 2WSFJ 1MZ9A
chains in the Genus database with same CATH topology
3FXEA 5EFWB 2I8DA 4GOEA 1U7MA 4EYYQ 2LXCB 4K3AA 2B88A 2P58A 4ZMDA 4GOFA 1H0TB 1ZW0A 2LXBA 3RGUA 4HKZH 4ASWA 1JM0A 1JMBA 5K5GB 2M5AB 1SS1A 2SPZA 4IOIH 2M0BA 4HB1A 2R44A 1EC5A 4HJGH 2HR3A 1H0TA 2B87B 1LP1A 1DEEG 3ZDMA 4ASVA 1OVRA 2QVAA 2LR2A 3PH0A 1LT1A 2JWDA 1EDLA 2UWJE 4NPEA 4GODA 5DJUB 2B87A 1LP1B 4JBZA 2OTKE 1NVOA 2WMMA 1EDIA 4CPGA 2Q1KA 2KI7B 4K35A 1X0TA 4KJMA 1MFTA 5DJTB 1OVUA 1FC2C 1BDDA 1EDKA 5CBNA 1ZXGA 1Y47A 2RKLA 2KS1B 1Q2NA 2KZIA 2KZJA 3FXDA 2B89A 1U7JA 4MN4C 2QRXA 5CBOA 1OVVA 3MZWB 4ZNCA 1S3JA 2ZAEB 5C39A 2KIKA 4BXLA 2K3RA 4NPDA 4NPFX 2M5AA 3MHVA 4WWIA 3QWOC 2KUBA 1BDCA 3S1KA 1EDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXE A;  5EFW B;  2I8D A;  4GOE A;  1U7M A;  4EYY Q;  2LXC B;  4K3A A;  2B88 A;  2P58 A;  4ZMD A;  4GOF A;  1H0T B;  1ZW0 A;  2LXB A;  3RGU A;  4HKZ H;  4ASW A;  1JM0 A;  1JMB A;  5K5G B;  2M5A B;  1SS1 A;  2SPZ A;  4IOI H;  2M0B A;  4HB1 A;  2R44 A;  1EC5 A;  4HJG H;  2HR3 A;  1H0T A;  2B87 B;  1LP1 A;  1DEE G;  3ZDM A;  4ASV A;  1OVR A;  2QVA A;  2LR2 A;  3PH0 A;  1LT1 A;  2JWD A;  1EDL A;  2UWJ E;  4NPE A;  4GOD A;  5DJU B;  2B87 A;  1LP1 B;  4JBZ A;  2OTK E;  1NVO A;  2WMM A;  1EDI A;  4CPG A;  2Q1K A;  2KI7 B;  4K35 A;  1X0T A;  4KJM A;  1MFT A;  5DJT B;  1OVU A;  1FC2 C;  1BDD A;  1EDK A;  5CBN A;  1ZXG A;  1Y47 A;  2RKL A;  2KS1 B;  1Q2N A;  2KZI A;  2KZJ A;  3FXD A;  2B89 A;  1U7J A;  4MN4 C;  2QRX A;  5CBO A;  1OVV A;  3MZW B;  4ZNC A;  1S3J A;  2ZAE B;  5C39 A;  2KIK A;  4BXL A;  2K3R A;  4NPD A;  4NPF X;  2M5A A;  3MHV A;  4WWI A;  3QWO C;  2KUB A;  1BDC A;  3S1K A;  1EDJ A; 
#chains in the Genus database with same CATH topology
 3CL3 D;  3VTP C;  1KC8 Q;  2JR8 A;  4OWF A;  1WMK A;  4H44 B;  1BCC G;  1R5L A;  2KLV A;  2KYV A;  3L37 A;  1EXI A;  1T6A A;  2P58 A;  5CHX A;  2OGU A;  3L70 D;  3GF7 A;  1SQQ K;  2E74 D;  1H0T A;  1NKZ B;  4GOF A;  3L75 G;  4JYC A;  3B71 A;  5AVT B;  3CCM P;  1A02 J;  3CMA P;  2IPP A;  4U3F D;  1NTZ G;  2LXB A;  3RGU A;  2B9B A;  1EZV G;  3H1H G;  4EI2 A;  4ZKP A;  5CCG D;  4H0L C;  5TJH A;  1JM0 A;  3TGU J;  5KAF E;  2M5A B;  4O9B A;  1YTZ I;  3S9O A;  1FE6 A;  1NTZ K;  1SQB K;  3RK2 C;  2OYI B;  1BE3 G;  4HH2 A;  3TNU A;  4Y99 C;  2Z4E A;  3GMA A;  1SQB D;  2MKV A;  3CCV P;  1USE A;  2R5D A;  1VQ7 P;  2B87 B;  5CJ4 A;  1LP1 A;  4IL6 H;  2CK3 H;  4EOT A;  1N7S D;  3B5N B;  4UB8 E;  2PRR A;  4Y99 B;  1NTM D;  4RES B;  4ASV A;  2FXM A;  1JY2 O;  1NTM G;  1OVR A;  3A3Y B;  2G3A A;  2Q6Q A;  2QVA A;  3CI9 A;  1L0L K;  4M3L A;  5AVS B;  1URQ C;  3HE4 B;  3L36 A;  3B4S A;  2HYN A;  5APT A;  1KFM A;  1SQX K;  3B5N C;  3CXH E;  3KPE A;  1LTJ C;  1S4X A;  5AW7 B;  3H1J D;  2W90 A;  5AW8 B;  4EDF A;  1EDL A;  2JJL A;  5L8R J;  3OJA B;  2UWJ E;  5KLV D;  5KJ7 C;  1RF1 A;  1PV3 A;  1HWT C;  1NGM B;  5AW2 B;  1NYH A;  2VRS A;  1L4A C;  3L35 A;  1FS0 E;  1JO5 A;  2H43 A;  4UB6 H;  4JBZ A;  5CCH C;  1HVV A;  2OTK E;  1PGJ A;  2H88 C;  3A7O A;  3FWN A;  3MIW A;  2FFD A;  3H1H E;  1VPC A;  3SWK A;  1X79 B;  2KS1 A;  2P1J A;  3AEG C;  4R4M A;  1L2P A;  2WPQ A;  1GL2 A;  5KAI E;  4PD4 E;  4KJM A;  3H1K G;  1NU1 D;  4PV1 C;  5AVY B;  3BVH A;  3BCC G;  3V6I A;  2K88 A;  4H13 D;  3SSU A;  4OGQ B;  2OAR A;  1AVO A;  2QJP B;  4LLH A;  3Q2Y A;  5AVQ B;  3CC2 P;  1LNQ A;  3CWB G;  1S9K E;  3L73 J;  4D6T J;  1L0L E;  1KQS O;  1K9M Q;  1AVY A;  2QJP C;  2AEJ A;  3GHG C;  1L0N J;  2QA4 P;  1IK7 A;  2N9B A;  2OTJ P;  2V7Q H;  1RF0 C;  5CCH A;  3A5T A;  1Q2N A;  2WZ7 A;  2JDI H;  4Y28 J;  3FXD A;  3M91 A;  2ZVO B;  4WY4 A;  4YXW H;  4L75 A;  3V2R A;  3JSV C;  3W68 A;  3VP8 A;  1G2C B;  2E75 B;  2KP8 A;  4TLF A;  4MN4 C;  1SQX D;  1QL2 A;  2M3E A;  1PGQ A;  1GTW A;  1BCC E;  1PPJ E;  3L74 E;  1SFC D;  4U3F G;  5APV A;  1NO4 A;  1VQM P;  1K73 Q;  1H88 A;  2NPS B;  1ZR4 A;  1VQP P;  2OYI C;  2FY8 A;  1YTZ T;  1JTH B;  3H1H J;  3H1K D;  3P8C E;  1N2D C;  2PGD A;  3BCC E;  3CX5 H;  5E79 E;  1S5L H;  3H1J J;  4RJT A;  1YIJ P;  2ZT9 D;  2YO2 A;  2IBZ G;  2HLO A;  2GUS A;  1BE3 D;  3UIA A;  2IBZ D;  2E74 B;  2PP6 A;  2XNX A;  3A0B E;  1WRG A;  3V2Q A;  1LWU A;  1A02 F;  5C39 A;  2KIK A;  1LTA C;  1GMJ A;  1RQV A;  3CWB D;  1PGO A;  1SQV E;  4U7J A;  3TSI A;  1N73 B;  2WSC H;  1M8O B;  3RL0 B;  2E5T A;  3HTK A;  2KOG A;  1S5L X;  1L0N D;  1SQQ D;  2QJY C;  3RL0 D;  4OVN F;  2WSC J;  4A7P A;  2ITA A;  3HE5 B;  3HUS C;  4OH8 B;  3KZI E;  1RE4 C;  3TGU D;  1FAV A;  3CCJ P;  1H89 A;  3A0H H;  3GF3 A;  1SQV K;  1PFI A;  1KD1 Q;  3GLM A;  4ZKU A;  2ZVN B;  3S1K A;  2YIU B;  1P84 E;  4KHX A;  1GU4 A;  2DW3 A;  4DT0 A;  2L5G B;  1EDJ A;  4L73 A;  4IFD K;  2YXQ B;  1JY3 P;  1OXZ A;  2RN0 A;  2HOD B;  1BGY E;  1LTG C;  2I8D A;  1LWU C;  3L70 J;  1NTZ D;  1U7M A;  3LIE A;  2O01 J;  2YO3 A;  3L71 J;  3L71 D;  3OAK A;  4YTP C;  3V4Q A;  4OGQ C;  3PHL A;  4ZMD A;  2YMK A;  1SFC B;  2R3S A;  1FZE A;  1FU1 A;  2BEQ D;  3BRV B;  3NXS A;  1FDI A;  3R2P A;  2WSE H;  4PJ0 E;  4PV1 D;  4YPC A;  3CD6 P;  2WIT A;  2ZXE B;  4YXD C;  4GIF A;  3U1A A;  1XTC C;  3EQ2 A;  1DEB A;  5KLV J;  1H8A A;  3QH9 A;  2W8Z A;  4HKZ H;  3H1I J;  2KB7 P;  1DD3 A;  2WQY C;  5K5G B;  1SS1 A;  2ZXX A;  3HD7 D;  3V2N A;  1CSB A;  2BCC J;  4EIJ A;  5AVU B;  1YJN P;  2XV5 A;  3H1L G;  2K9J B;  3KHU A;  2QSI A;  3H1J G;  3Q5R A;  1NOH A;  1NAF A;  2HR3 A;  1KYO H;  1M56 D;  4IFM A;  2YMY A;  1AQT A;  3II6 A;  3MGN A;  3CCQ P;  1RHZ B;  2R5B A;  2NZ2 A;  5AW4 B;  1K05 A;  2KSE A;  5KLV G;  3AE2 C;  3GHG A;  1CW5 A;  2LKM A;  1E5W A;  1YHQ P;  1BE3 J;  2Y0D A;  3JCU H;  1AQ5 A;  4H13 B;  3CME P;  2JWD A;  1KOR A;  3PJS K;  3VYI A;  3OW2 O;  5E79 H;  3RBX A;  2O3J A;  2W6A A;  4NPE A;  2C0W A;  3L70 E;  2OYH B;  2QE7 H;  4W80 A;  3VOP A;  2IFN A;  3I5C A;  1NU1 G;  3CX5 I;  4GDO A;  5DJU B;  1KB9 D;  1NHL A;  3WU2 E;  1N7S C;  4D6T G;  1QL1 A;  5APY A;  2FXO A;  2A06 E;  3SFE C;  2KI7 B;  3D6Y A;  3CXH H;  3TNU B;  3TYY A;  2QIW A;  5GTI H;  2MJZ A;  1N7S B;  2WSS H;  1FZG A;  1FJK A;  2WPR A;  3CCS P;  1SQP E;  1M1J A;  2YNY A;  3L4F A;  1YBK A;  1LGH B;  4H0L D;  2FYU J;  2IDB A;  1VQO P;  1SQP J;  2BCC E;  3WUU A;  1ZN5 A;  3HD7 B;  1FZC B;  1FDM A;  1ZV8 A;  1HH0 A;  1AFO A;  2N1T D;  1N7L A;  3H1I E;  3I56 P;  1NTK J;  3CCU P;  4Z1M H;  3CXH I;  1JUN A;  1JY2 N;  2QM8 A;  1YIT P;  1S5L E;  1RF1 B;  2R3C A;  1JY3 O;  2HFE D;  4JQ0 D;  4W7Y A;  2Q3E A;  5BU5 A;  1T8Z A;  3AEC C;  2BAS A;  1K04 A;  3PTZ A;  3MUD A;  3AEB C;  1BSN A;  2W6J H;  3CLQ A;  3GG2 A;  5M1B A;  2B89 A;  5KAI H;  2Z5I A;  4DOJ A;  3HUS A;  1RF1 C;  1EZV E;  2FFD B;  1P84 H;  1JCD A;  4C7N B;  4L74 A;  4WB4 A;  5AVX B;  3VMZ A;  1NU1 E;  1JMM A;  1HTL C;  1N8R Q;  1GL2 B;  2NRG A;  2QRX A;  2G8Y A;  2WTY A;  1YQ3 C;  3H1H D;  3V2P A;  2A06 G;  2Q3I A;  3JCU E;  3D6Z A;  4WVZ A;  3AEA C;  2D2C D;  3RK3 B;  5CBO A;  1ZRT E;  1S1C X;  2E76 D;  1J1E C;  2RMZ A;  3AEF C;  3L73 E;  2ZT9 C;  1FZF A;  1Q81 Q;  1MKM A;  1TU3 F;  1KIL A;  3RK3 E;  2P10 A;  1KYO E;  1AJY A;  3WMM 0;  3PLN A;  3RL0 g;  1LTT C;  2BCC G;  2R32 A;  5GTI E;  4TT3 H;  4JF7 A;  1L4A B;  3MUD C;  1SQV D;  1WT6 A;  1NTM J;  3H32 A;  1RQU A;  3N7N A;  4N78 E;  3TGU G;  1VQN P;  1M90 Q;  1G1J A;  3L72 D;  3M0D A;  2HPC B;  4WY4 B;  4IL6 E;  1IZN B;  3N4X A;  1UII A;  4C7R A;  3AE6 C;  2YXR B;  4I7Z C;  1Q82 Q;  4AQR D;  3LW5 H;  4PV1 B;  2OYH C;  4D6T D;  2ZJS E;  3USS A;  3WUV A;  1HJ0 A;  3MD0 A;  5AVZ B;  1JB0 J;  4UB6 E;  2KUB A;  3L71 G;  4H44 C;  3VMX A;  2IYP A;  1VF5 C;  1BDC A;  2WT7 B;  1PPJ D;  3L74 D;  1D7M A;  1NU1 J;  3FXE A;  1SQQ J;  1PGP A;  3E7K A;  3PP5 A;  1J1D B;  2N9Y B;  1CI6 B;  1NAY A;  2XKM A;  1IC2 A;  3M9H A;  4GOE A;  2OYO A;  1VQK P;  3CCE P;  1FJP A;  3R4Y A;  3HRN A;  1HUC A;  4K3A A;  1ZOY C;  2B88 A;  1KIL D;  5AW1 B;  3CCR P;  2WPS A;  1IO4 A;  4N6J A;  3KZI H;  3D70 A;  4I1L A;  1FOS F;  3FGA D;  1BE3 E;  1OMI A;  1OX3 A;  1KYO D;  2E75 C;  2KNC B;  3AE1 C;  2Y9Y A;  1GDT A;  3B5N A;  4UB8 H;  3VMY A;  1FZA A;  1ZW0 A;  2CPB A;  2KLU A;  3A0H E;  3D71 A;  2IYO A;  1ZME C;  2Q7C A;  4ASW A;  1LJ2 A;  1SLQ A;  1X22 A;  2ZYD A;  3H1K J;  2Q5U A;  2M3B A;  3L72 G;  3T97 A;  1GK6 A;  2JO1 A;  1NTM E;  1L4A D;  1LTI C;  2AXT E;  2SPZ A;  3HE5 A;  3LW5 J;  2M0B A;  2IFM A;  4HB1 A;  5BU8 B;  2N1T C;  2QEX P;  2R44 A;  2IX7 C;  5KJ7 D;  3A0B H;  3L75 E;  1KQF B;  5CCG A;  2FFD C;  4HJG H;  1L0L J;  1T3U A;  1X8Y A;  2GUV A;  1EZV I;  2FYN C;  3AE5 C;  2FBW C;  2PFX A;  3H1I G;  1GL2 C;  1SQX J;  3I55 P;  1NTZ J;  3S4R A;  1Y8A A;  1SQB J;  1G1I A;  1JY3 N;  1KQG B;  1SP4 A;  1OFC X;  2YKO A;  4PD4 D;  3WU2 H;  1ZP0 C;  2HOD A;  2AEF A;  3EFF K;  2WWW A;  1VQ4 P;  3H25 A;  1KV4 A;  3L74 J;  3WUT A;  1CZQ A;  1QEX A;  3AE3 C;  1FDO A;  2YKP A;  2LR2 A;  3BAT A;  1FZB A;  1OW8 A;  1SFC A;  2ZYG A;  3PH0 A;  2A45 I;  4RO0 A;  1PZQ A;  3ITK A;  1R5S A;  3A2A A;  3AE4 C;  4GOD A;  2GM4 A;  1BCC J;  1LTJ B;  5APS A;  2JP3 A;  2B87 A;  1LP1 B;  5AW6 B;  1KB9 I;  4R4L A;  2JWA A;  1T2K D;  1GL2 D;  3V4W A;  3H6P A;  5CCG C;  5AVR B;  2Q1K A;  3AE7 C;  4WY4 C;  3L73 G;  5CCH D;  3HE4 A;  5KLV K;  1BSH A;  4K35 A;  1X0T A;  2A45 H;  2XZR A;  4GKG A;  4I6M C;  1KYO I;  2D2C B;  3RK3 D;  2Z5H A;  1NKN A;  4XFJ A;  4BRY B;  1S72 P;  2AXC A;  3W67 A;  3LID A;  2W6B A;  1URQ A;  1OIP A;  1QX8 A;  2K9Y A;  1FC2 C;  1OW6 A;  2I1J A;  1EDK A;  4D6T E;  5CBN A;  1ZR2 A;  2QG4 A;  1YI2 P;  3CC7 P;  1URQ D;  5KTB A;  4AYC A;  1ZXG A;  1BGY G;  3NTN A;  2M8R A;  1KN7 A;  3CX5 D;  2RKL A;  3M0D C;  4RKU J;  1FBM A;  1SQX E;  2KS1 B;  2OQQ A;  4PD4 H;  5B66 E;  5KAF H;  1GZL A;  1PPJ G;  3L74 G;  4L76 A;  4XE5 B;  1M1K Q;  2E42 A;  1JNM A;  1GW4 A;  2J5U A;  2O01 N;  3AE8 C;  3L71 E;  4DZO A;  1LT9 C;  3CWB E;  1JCC A;  3KYQ A;  2E43 A;  3M9B A;  2KXP B;  3BCC D;  1AV1 A;  1MFZ A;  3SWY A;  4WBA A;  3CC4 P;  3IF4 A;  3O6Q A;  1IFN A;  3EFG A;  1L0N G;  4H0L B;  1LT9 B;  1MUU A;  3KQG A;  5H2F H;  2FYU E;  5APU A;  2AEM A;  2BCC D;  2K1A A;  3H1L E;  3L73 D;  5B5E H;  3HTK B;  3G6E P;  1OZH A;  3FWL A;  2N1T B;  2E74 C;  3MZW B;  3SFD C;  3U59 A;  3O8Z A;  1E79 H;  1SQP D;  3B8E B;  1FZC A;  1M1J C;  1M7L A;  2FYU D;  2JEE A;  4JPZ B;  5EFW B;  5KLV E;  1DH3 A;  1G2C A;  1N73 C;  1SQQ E;  1RF0 A;  3BCC J;  2H7H A;  2Y9Z A;  2ZAE B;  2FYU K;  1RE3 A;  3L72 E;  4U3F E;  3Q5S A;  4BXL A;  1R8E A;  3C9I A;  2K3R A;  3IR9 A;  5AW9 B;  5GTH H;  2FXP A;  1SQX G;  1QVG O;  2W83 C;  2FYZ A;  2W27 A;  3CX5 E;  3JC2 2;  3RBZ A;  1P84 I;  2E76 C;  1P84 D;  2IBZ E;  3M0A A;  4C7N A;  1FOS E;  4AUW A;  4C46 A;  4KT0 J;  4NPF X;  2M5A A;  3VP9 A;  3RL0 C;  1NTK G;  3MHV A;  1ZRT D;  3H1K E;  2OYI A;  1IFD A;  2E76 B;  2IZ0 A;  4WWI A;  3TF5 A;  1PP9 D;  3QWO C;  1FZC C;  1Q86 Q;  1HBW A;  1LWU B;  1U57 A;  1IK9 A;  2IBZ I;  2P67 A;  1L0N E;  3AED C;  1EXJ A;  1N73 A;  1SFC C;  2V4H A;  2J59 M;  2P2U A;  2RH0 A;  2YIU C;  4EYY Q;  4N78 D;  2LXC B;  3V5B A;  3G4S P;  1W5C E;  1NH4 A;  5BVZ A;  1Y9B A;  3H1L J;  2ZYA A;  4XA4 A;  1HJB A;  2XDJ A;  1SQQ G;  4DCK A;  3G9R A;  3H1J E;  2QJK C;  2XU6 A;  3P7K A;  1KTM A;  1QGK B;  3GHG B;  1DIP A;  2KSJ A;  1PP9 J;  3H1I D;  1GW3 A;  1QLE D;  2H8P D;  1LTB C;  1JMB A;  4LGD E;  1IFI A;  5AVW B;  1T2K C;  2FKW B;  1KB9 H;  1YQ4 C;  3C8V A;  3FX0 A;  4HYT B;  2K37 A;  1Z56 A;  3NFQ A;  4IOI H;  3RK3 C;  4DJG A;  2O01 H;  3P8C D;  2C9N Y;  1VL2 A;  1EC5 A;  4LC1 A;  2ZT9 B;  2OYH A;  4IFF A;  5APQ A;  1EZV D;  3OA7 A;  3L72 J;  1DEE G;  1MV8 A;  3M06 A;  2J58 A;  1YYC A;  4H13 C;  3ZDM A;  1L0N K;  1PP9 G;  5GTH E;  1CI6 A;  2CPS A;  1HGV A;  5KKZ B;  3BRT B;  1ZLL A;  2A45 G;  1GU5 A;  2NPS C;  3U1C A;  5APX A;  2WVR A;  1LT1 A;  2O1K A;  3NMD A;  1RH5 B;  1M57 D;  1NU1 K;  5AW3 B;  1M1J B;  1SQV G;  1S9K D;  1PIX A;  1OWA A;  1NJI Q;  1W2B O;  2K9J A;  1LTS C;  1J2J B;  1DD4 A;  4N3Y B;  1SQP G;  1SVF A;  2IZ1 A;  4IL6 X;  2KK7 A;  2Y0C A;  1AA0 A;  2FYU G;  3VMA A;  1GD2 E;  3CXH D;  1VDF A;  3K5B A;  4PJ0 H;  3T97 B;  3H1L D;  1NVO A;  2WMM A;  1EDI A;  2Y0E A;  3IAO A;  3IN6 A;  5TIS E;  4CPG A;  1VQL P;  3B5N D;  1IFJ A;  3CWB J;  1BGY J;  2WSE J;  2WSF H;  3Q1M A;  2ZFC A;  2E75 D;  1NTZ E;  2C0X A;  2QJY B;  3BAS A;  4B86 A;  1BGY D;  3HD7 C;  3L70 G;  1H0T B;  1MFT A;  5DJT B;  1N86 A;  1VQ9 P;  1KZU B;  4GT1 A;  1NTK K;  3L75 D;  1X9V A;  2NPS A;  1OVU A;  3HUS B;  1NWQ A;  3EWK A;  1JTH A;  1BDD A;  3F5H A;  2A06 D;  3E1R A;  1VQ5 P;  1RE3 C;  1PL5 A;  1OW7 A;  1NTK D;  2NPS D;  3GW6 A;  1DX7 A;  3P8M C;  1Y47 A;  2GA1 A;  5KLI C;  3C1L A;  1USD A;  2AXT H;  2QM7 A;  1VF5 D;  3P32 A;  3ABV C;  3TDK A;  1KIL C;  3VN0 A;  1SQP K;  3F89 A;  1N7S A;  1NTK E;  2O1J A;  1KQL A;  3KXD A;  1Q90 D;  2XND H;  1LTJ A;  2KZI A;  5AVV B;  5KLI B;  1SQB G;  2KZJ A;  1UIX A;  3IFM A;  4I2L C;  3RK2 B;  3TK1 A;  3SWF A;  1HGZ A;  1KIL B;  2V7Q J;  4U3F J;  1SQV J;  1RY3 A;  1U7J A;  1IFM A;  1RE4 A;  5H2F E;  3RK2 D;  4JYB A;  5AW5 B;  5KJ7 A;  3CPW O;  3Q5P A;  1YJ9 P;  2FYN B;  2QJK B;  3HD7 A;  1L4A A;  4H44 D;  4OGQ D;  1GK4 A;  1JY2 P;  1S2E A;  5CJ0 A;  1Q7Y Q;  1JEK A;  2POH A;  4BRY A;  1W2E A;  2HPC A;  1KFN A;  1BCC D;  5AW0 B;  1URQ B;  1XTG B;  1OVV A;  3TGU E;  3Q3D A;  1IFP A;  2H89 C;  1K8A Q;  1VQ6 P;  4ZNC A;  3G3Z A;  2HG5 D;  3M9Q A;  5B66 H;  3MP7 B;  5APW A;  3L75 J;  4W7Z A;  1QVF O;  2BEZ F;  1S3J A;  3KDP B;  4PD4 I;  1YJW P;  1J1E B;  1JOC A;  1IJD B;  2Q9I A;  1KMI Z;  5KKZ C;  2WT7 A;  5CMZ A;  5TIS H;  1KB9 E;  2L91 A;  1T3J A;  3AE9 C;  3PRJ A;  4QMA A;  4WY4 D;  1L0L D;  2JKV A;  2E5Y A;  1KIL E;  1L0L G;  1HF9 A;  2PAJ A;  1NTM K;  3E1I A;  1EQ7 A;  2D2C C;  2P7J A;  1VQ8 P;  1SQB E;  4NPD A;  1VF5 B;  5B5E E;  2YKQ A;  3G71 P;  1PP9 E;  2OTL P;  3O6Q B;  2I1K A;  2WPV B;  4BWN A;  1LT9 A;  3AEE C;  2KNC A;  4I7Z B;  2C9L Y;  1J1D C;  3CCL P;  3H32 B;  3MTU E;  2N1T A;  2WSF J;  1MZ9 A; 
#chains in the Genus database with same CATH homology
 3FXE A;  5EFW B;  2I8D A;  4GOE A;  1U7M A;  4EYY Q;  2LXC B;  4K3A A;  2B88 A;  2P58 A;  4ZMD A;  4GOF A;  1H0T B;  1ZW0 A;  2LXB A;  3RGU A;  4HKZ H;  4ASW A;  1JM0 A;  1JMB A;  5K5G B;  2M5A B;  1SS1 A;  2SPZ A;  4IOI H;  2M0B A;  4HB1 A;  2R44 A;  1EC5 A;  4HJG H;  2HR3 A;  1H0T A;  2B87 B;  1LP1 A;  1DEE G;  3ZDM A;  4ASV A;  1OVR A;  2QVA A;  2LR2 A;  3PH0 A;  1LT1 A;  2JWD A;  1EDL A;  2UWJ E;  4NPE A;  4GOD A;  5DJU B;  2B87 A;  1LP1 B;  4JBZ A;  2OTK E;  1NVO A;  2WMM A;  1EDI A;  4CPG A;  2Q1K A;  2KI7 B;  4K35 A;  1X0T A;  4KJM A;  1MFT A;  5DJT B;  1OVU A;  1FC2 C;  1BDD A;  1EDK A;  5CBN A;  1ZXG A;  1Y47 A;  2RKL A;  2KS1 B;  1Q2N A;  2KZI A;  2KZJ A;  3FXD A;  2B89 A;  1U7J A;  4MN4 C;  2QRX A;  5CBO A;  1OVV A;  3MZW B;  4ZNC A;  1S3J A;  2ZAE B;  5C39 A;  2KIK A;  4BXL A;  2K3R A;  4NPD A;  4NPF X;  2M5A A;  3MHV A;  4WWI A;  3QWO C;  2KUB A;  1BDC A;  3S1K A;  1EDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...