4NPKA

Extended-synaptotagmin 2, c2a- and c2b-domains, calcium bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
280
structure length
269
Chain Sequence
FPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSRVIKENLSPKWNEVYEALVYEHPGQELEIELFDEDPDKDDFLGSLMIDLIEVEKERLLDEWFTLDEVPKGKLHLRLEWLTLMPNVSNLDKVLTDIKADGLSSALLILYLDSARNLPSSNPNPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and ca(2+)-binding properties of the tandem c2 domains of e-syt2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords Extended synaptotagmin-2
total genus 53
structure length 269
sequence length 280
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4npkA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4npkA02
2NQ3A 4BFRA 1TJMA 5CCJA 3PFQA 2CHXA 2FJUB 2RD0A 2WXHA 3APFA 3F00A 3HN8A 3PRZA 4WAFA 4ANXA 4DK5A 3R7RA 2BWQA 4OVUA 5H4ZA 3R7QA 1E90A 4OVVA 1WFJA 3LJ3A 4L23A 4AJWA 3F05A 3RDJA 4FA6A 3HHMA 3DBSA 4EZLA 4QAMB 2Q3XA 2YRBA 2CHWA 5CCHE 3GPEA 4FADA 3NZUA 2Q0ZX 1DJHA 5EDSA 3OAWA 4GB9A 1BYNA 4URKA 1E8ZA 1UOVA 3ZIMA 2V4LA 4PS3A 4KITB 3FDWA 4XE0A 3M7FB 1WFMA 4FLHA 3TL5A 3L13A 4AOFA 1E8WA 2CHDA 4PS8A 1DJWA 3ZVVA 3MJWA 4ICWA 5H4YA 3SD5A 2WXNA 2CM6A 4FHKA 4ICXA 4MJJA 4WWPA 3CSFA 3L4CA 3QK0A 3L9BA 5KJ7E 2FK9A 1RH8A 4L1LA 1DSYA 3IM1A 3OHMB 3QR0A 2KI6A 3KWUA 3PS6A 3S2AA 2Y3AA 1BDYA 1BCIA 5G2NA 4TUUA 3DPDA 4Y1TA 2K4AA 4F93B 3N5AA 2WXPA 1UOWA 1RLWA 4FHJA 4IHBA 4FJZA 4V11A 4FULA 3W56A 5JHBA 2WXLA 3P2BA 4F91B 1V27A 3ML8A 3APDA 1DJXA 3B7YA 4GNKB 4NS0A 1DQVA 4WEEA 2WXKA 5CCGE 4F92B 3W57A 2QZ5A 5JHAA 2QZQA 1W16A 4JPSA 4Y1SA 4ANWA 3F01A 2UZPA 4KZ0A 3PYCA 4NPKA 4NP9A 4TV3A 4IQHA 1E7UA 3NZSA 4EZKA 3APCA 4BGDA 2X38A 2WXJA 4F1SA 4QJ3B 4HVBA 4QJ4B 1HE8A 1GMIA 2ENJA 3QAQA 4KZCA 5T8IA 4G11A 2B3RA 2DMGA 4LT7A 2A4ZA 4XZ4A 4PS7A 3L17A 1DJGA 1TJXA 3KWTA 3T8MA 2WXMA 4L1BA 4EZJA 2JQZA 2WXOA 4LDCA 1UGKA 4A55A 1RSYA 3FBKA 3HIZA 4ANVA 2YOAA 2N1TE 2ZKMX 4HLEA 2NCEA 3L08A 1QASA 4XX5A 1K5WA 5G55A 3TJPA 2A5UA 2Z0UA 3ENEA 2CJTA 2CHZA 2D8KA 2R83A 3L16A 2WXQA 2DMHA 1DJYA 4TS6A 4WWOA 4QJ5B 2NSQA 4DNLA 2WXRA 3ML9A 3NSJA 4ANUA 4L2YA 4J6IA 2CM5A 4WWNA 1DJZA 3CSTA 3IBEA 3JZYA 3L54A 2EP6A 3QARA 2ISDA 2K3HA 4LCVA 1QATA 4FJYA 1E8XA 1A25A 3ZW3A 1E7VA 2ENPA 2ENQA 2K8MA 3RPBA 2CJSA 1W15A 2LHAA 1DJIA 1YRKA 2WXIA 2WXFA 3PREA 3QR1A 1CJYA 3QJZA 1E8YA 3TWYA 4NPJA 2K45A 3F04A 2WXGA
chains in the Genus database with same CATH superfamily
3IRZA 4XBEH 3OQ3B 4M48L 4TQEL 4AC2A 5I1HH 1JGIA 2A4EA 1EJ8A 5FECA 1OD9A 3KJ4C 1QRKA 4HJTA 4IU3A 4Q6YA 4G8FB 5B1BB 1JNNH 1DJHA 5IV2A 4JG1H 2VZSA 4U4BA 4HC1A 4M8QA 5D1QA 4JG5A 1KENL 2CPUA 3QFJB 1EANA 1G7JA 2V7NA 5DRZB 2V8LA 3TASA 2XKNA 1VESA 3VXUD 3X1BA 4I9WD 3E8VA 3DV6B 1K3IA 3A4FA 2YA1A 2Y3AA 5AVTB 3KGTA 2BZCA 1N4XH 1X5JA 4X8CA 1HOEA 4LEBA 1JYVA 5EB9A 3ZHKA 1I8MB 3QHFH 5I15L 1G4RA 1P7QA 4OM1L 1ND0A 4UM8A 4BINA 3E2HC 2IWFA 4YDVA 3O9WA 1VFAA 1U3ZA 4L9LA 4ZAKA 5KS9F 3WNPA 2YQ3A 1FN4A 4OQ1A 1CLZH 4YL4A 3BLPX 3A4EA 4BZ2H 5GS1C 4Y2DA 3SQRA 5K9JL 1TSRA 5IHBA 4OLYH 4IIQA 3S2CA 5CAYB 2Y9RT 3K0YA 4RNRA 3TEUA 1TJIL 3GF8A 5E6IB 1QFWH 4EAEA 3PWVA 1MRDH 3F7PC 1FVCB 5F1IB 2OKMA 2XA8L 3WKQA 1FORL 4X4XA 2YZ1A 3EJUA 2KC0A 2XWEA 4QRPE 4PS7A 4MB1A 5DD5L 5IMMA 5I0YA 4U3SA 1IO4C 1T1ZB 3AWFA 1I3GH 3V6OE 1HXMB 3L08A 4JFQA 3ZZLA 3V6OC 1MEXH 4ZMTA 1KXQE 1HOCB 5FHAH 3QH3A 1XFPA 4BH8B 5KSAA 2NTSP 2HMID 3QORA 4ODTH 2F53D 1QFOA 3KJ4B 1YDPA 5E56A 4JRXE 3EJPA 1AY1L 2CQVA 4HIHA 4O2FB 4M8UA 4WENB 1M6OB 5AW6B 3MBEB 5INDB 2OMZA 3UYPA 5L2KD 2XTJC 1E7VA 3DX6B 1LO4H 2ZX5A 4NQCB 1AACA 3O3EA 3MGTB 2FQDA 5IBLD 3S5YA 1IFRA 1EBAA 2MIZA 1PNCA 2Q6WA 5IEHA 3WGUB 2Q7AA 3LRSB 5I8KH 2ZPKL 4WCYL 5EO9A 4Z76A 1G43A 5GGRA 4ALAH 4JQIH 4HS6B 4QHPA 4NUGH 4EEEA 1Z5YD 3WY3A 1E4KA 1BPLB 3UZEA 4BCYA 2NUTA 1DBMH 2EXYC 1Y6KR 2VO5A 3NIGB 3AFLA 3CSGA 3NQKA 5GRZA 5DTFB 5C0BE 3VI4B 1ZY9A 4OCWL 4LPVA 4ICXA 2CZNA 1RIHH 4I18C 1HSAA 1GCFA 2PCXA 3B4NA 3HI5H 3SDYH 5A7EA 5DZ9A 4KNUA 3O11A 4R7DB 3WXWL 4H2CA 1KOAA 1YA5A 3HNVL 4YDIL 5SX4H 2VDLL 3F7YA 4IHOA 5LBVA 4AQAA 2HYMA 3ZKSD 1NFDB 1DVFD 3OKKB 4NQSA 3T4AA 3QBTB 3TN0B 1CVRA 1YPZA 4XH2B 3HW7A 3MRGA 4ZPVB 3HUJB 5BRZA 1PZAA 1VFOA 5EU6E 1XF3B 1DO6A 3QVAA 4XP6H 3WE6A 4FQ1L 1F13A 2XRAL 1UEYA 5IJKC 1J0YA 2F5BL 3BGMB 3CZLA 1OALA 1E7UA 4HDIB 4WFFE 4MJID 4U1HB 2DQDH 1TO5A 2H32H 4N2DA 1QSZA 5C0AB 2VRAA 4JJ5B 1T83C 1U6AL 3T09A 3MLWH 3I85A 3LRGA 1IAKA 2BCMA 3ZKXC 1VZHA 5SWSB 1QBMH 3HHSB 2ARWA 1SJMA 3J27A 4RFEB 1CFMA 4E9VA 1MG2C 4GO6B 3O4OC 3S35L 1JRHL 3L9YA 1EHLH 1NTDA 2DWYA 3KWWA 4RZKA 1OAKL 3HBGA 3VD5A 2E47A 3PGCA 4AEHL 4F7EA 1YNTF 2G60L 2Y25A 3ARXA 4W4NA 2WIIB 4EI6A 4PJDA 4MAYA 5EHFA 1K8IB 2UZIL 5DJ6A 4XAWL 1SVZA 4POZC 5FUCC 3UIYA 5ID0B 1OP5H 4JFFE 2DQIL 3QJQB 5FYJH 2BLFA 2IBBA 3GTNA 1PJWA 5GJTL 1P7KA 1U8CB 1UTDA 3B56A 3FZUD 4UT7H 4XI5C 3S35X 4LSQL 4YBHA 4FFZA 1NIEA 3BW9B 4RGOH 5C0JB 1ZT7B 3QR1A 1OQXA 1CIDA 4LARH 1MJUL 1UWEH 4LOUD 5C07E 2WTRB 3KS0J 4N0FB 3Q48A 2PWGA 2XTJB 4WUUA 1U95A 3NZ8A 3T3ME 5ANMB 3OJMB 3QUXC 3VRIA 1AJ7L 4Y4KA 3VFSA 5AFAA 3ARDD 4MNQE 4ZUSB 5HYFA 2OR9H 1F4XL 4KUCD 4LCUB 5HVHC 3KYNA 3GLEA 1Q1JH 1MFMA 2ROXA 4WWKB 4NNXB 4OLWH 2W0FB 3UZQA 2COVD 4ACTA 3NJKA 2FUQA 2XWTA 2WBJC 3DV4A 3LCYA 4YR6B 5HYQA 4TULH 3S8FB 4NRXB 3SDDD 4UDUB 4J12A 4BHUI 5AVYB 1INEH 4PVMA 4JFZL 4P2QD 4NERA 4N6RA 4G1EA 2O6CA 1MJ7L 2YSSA 4YAQB 2J5LC 4GH7B 3SE8H 3MZGB 1TEGA 4RX4D 3Q2CA 5JQHC 3ZKNC 4GXUN 4FFVD 1ZS2A 2DYRB 2D0HA 4WW2A 4LESA 5EUOA 1X6LA 3WEOA 4P2RA 3EYUL 4MB5A 1F1AA 2PCFB 4AH2A 3I6GB 3UPAA 1XB6A 4IDJL 4P2RD 5BJTA 3PV6B 5IW1B 1L5GA 2OBGA 3VFVA 2X6BA 1JZIA 3DX7A 2Q7YA 1B90A 4WGVB 3V4PL 4NENB 3JWNE 4QRRE 3SQOL 1KTCA 2BFGA 2WNXA 5CIPB 3QEHB 4ODHH 1N67A 3AGVA 4F27A 3MPCA 4ILDA 4OGXL 4F7CA 1ZLEA 3O0LA 4R0LA 4XRCB 4Y4FB 5JDSA 1ECYA 1IJ9A 5DDHA 3ZKMC 3UZQB 3B8YA 5DHVH 1GTNA 4EI5D 1CYWA 3D09A 4LFHD 4AV5A 5DK3A 4A6YL 5EIVA 1DFBH 2ZXBA 3BXNA 4AIZB 4ETQA 2A3TA 1AKPA 1JZ6A 3O2VL 2YMTA 1RZIB 1BECA 2WLJA 4JHAH 1P5VA 5T5NF 1QLFA 4DGVL 1PG7L 1G9NC 4BRVA 4QWWD 1QSFA 1FYTE 2WXRA 3UJJL 2BNUA 4I3SH 1CTNA 4LBEA 1JVLA 4R90H 1ACYH 4TLSA 1MPAH 5LBGA 3HC2A 2B4CH 1A6TA 3JZYA 5I8CA 3TCXA 2CPCA 3CPUA 2KPNA 5DHVA 4YXHL 3VE0B 1LO3L 2H45A 4GRMA 3X1NA 3QQ4B 1LK2B 1UOKA 1W8OA 3LQZA 2YAQA 4P3DB 4L0YA 1NWOA 5DFTA 4QLRA 4A67A 4JG1L 4E41B 4R26H 3VFNA 4BZ1A 1HH6B 3CAFA 3D3VE 4BFRA 4HX1A 1CDBA 2R0KL 2YQGA 1F2QA 3R7RA 4KHTH 5LJYH 3WTXA 4QUOA 1WUZA 4GKZB 3C5XA 3DSFL 4FP8H 2DIAA 1RHHB 1YNTA 5I0DA 4WTWA 3CLWA 4DGIH 1FL5B 2ATPA 1QLEB 4JG9A 2FSEB 3VWJB 5FM8A 1KT2A 3FCBA 5DEZA 2EIKB 3VACA 4FQJL 3W37A 2Z3FA 4ZG1A 1EZVX 1D9KD 4G43B 3TO4B 3L2LA 5KYWB 5I76A 4CMMB 5B7FA 3LN5A 2X4TB 1I1AB 1M57B 2CO3A 2HKFL 3FSOA 4M1CC 1BX2A 4NN6C 4I0PD 5HDBB 3SKNB 3NZHL 4I3SL 4FQHA 4KTYA 5ESQB 1WWBX 4KX7A 4Z7OF 1N59B 3C6SB 2WLZA 5IQOA 4XE5B 2V2WB 3HMXA 1CS6A 2X10A 1H19A 1IC5H 3VD2A 1JFQL 1DR9A 1HCVA 4LP8A 1R3HB 4XN9A 3GK8L 3OKOA 4HH9B 1MHPL 2IDFA 2NZ9D 3EJJX 1WA0X 4P5SA 3PABB 3ETBF 3UEQA 4ODBD 2Y4SA 3H0TA 1CLVA 5GZOD 4JY6A 3W57A 4BZ2A 4UQ2A 1I8KB 4HK3J 4GFTB 1KB5B 2GHWB 4FQPA 2EDEA 3HS0B 4I0PC 4OFQA 1AZZC 2Z8RA 1WC7A 3OTTA 4H8WH 3Q2WA 3GJEB 2E6PA 5BO1L 3QE5A 4L8SC 3DETD 3L3DB 3SDAD 1HE8A 4M7ZB 3DX8A 4BDVA 3MRFB 2A9NH 2A4ZA 3KPRB 2UWEE 1IGCH 5HDQL 3Q3GA 1QR4A 4EN3D 4HULB 3F6LA 4PMFA 2OTUA 3LKSA 4JZNB 1ZV2A 5EUOF 4TTDC 4P59L 5KJRH 3IJHA 4NM8L 3EOAB 1ASPA 2YOAA 1OPOA 4GXFA 4HZAA 4OTXL 2X5PA 1S4IA 5KYUA 5F9WB 3ULVD 2AK4E 3RWIB 1PIGA 2R83A 4FZEL 1IGJA 1DLHB 1PU0A 2Y36L 3N6YA 3KPSE 2R15A 4HWEH 1BQUA 3GDCA 4TS6A 2AC0A 3GTVA 2YPKB 4NKOB 5KJ4A 4AM0Q 1ZJAA 4KJPC 1XV8A 2EYTA 3K8LA 4IOFD 4S1SL 2WY3B 1W72H 1E9OA 3FBQA 5GGUB 1OAZH 3BZEB 4XWGL 2ITDB 1E9QA 1M2VB 3H9HB 2HT3D 5CP3A 4HJUA 4MD5B 2FJHB 4FLQA 1GC1H 2VLRD 3VH8B 2B1HL 2PYFA 2CLRA 4IBQA 1NGWA 3QHZL 4GT0A 4MNHB 4PJEF 3A67L 1CFTA 1CICD 4JDEA 1S5HB 2FJUB 1DBAL 3DX9B 2YRLA 3K8KA 3JV4B 1Q1JL 4MFHA 1JG9A 1J8HD 4FNLL 3TURA 3G5VA 4HAKA 1JWMB 4KK9C 5IJDC 2WVVB 2GFBA 1JFHA 3IDYB 2CHWA 2BIIA 4NBZB 2WLYA 4JDTL 3X1EA 2ICWJ 3E9UA 4PQXA 5DRWA 5GGVY 1N2RB 4NSKB 4KPHL 3RIKA 4P23B 1EFQA 3FT2A 4NUJB 4IBZA 2B2XH 4XPHL 1SNRA 1XF5B 1UWGH 2XZCL 4Y5XA 3VD0A 4MD4A 3ULAB 3FO1A 4MQSB 1AIFA 3IJYA 1U93A 3D39E 3POCA 3N50A 4TUOB 3CSFA 4JKWA 4IBWA 3IK2A 3CVHL 3RAJH 3OXRB 3MRMB 4ZX5A 1Z6JT 1J8SA 4OIFA 3S2AA 1OF2B 2NXZB 3GSUB 3ILQC 5C9JB 3BMWA 5E8OB 4HSAC 4JO5A 2XWRA 3LKPA 2NPLX 4DQOH 5IESH 3TEWA 1JZHA 5IVXA 4Y1TA 4G9DA 3WFEL 4MJHA 1U8OB 2F1BA 1MIMH 1JP5A 1I8IB 3MN8A 1YMMA 4E9WA 1P7QB 3SKJL 4BQ6A 1KGCE 5I8OL 5BW7A 1KZYA 2QZ5A 3V0FA 2YIHA 4UILL 1M71A 4GRWB 1KCKA 3IS0X 2KDYA 1YN7B 2WB7A 3O4LB 4GUQA 1D5ZA 5IT2H 2YWZA 2GY7B 1T21B 1YN6A 4OI7A 1SY6A 4JL2A 1BD2D 3VFPB 2KZKA 4XZ4A 5JHDE 1OE2A 3Q8CA 1M9WA 2CO1A 1X7QB 3GRGA 4J8RB 4OGYH 5CD5C 4L8BA 1IB5A 3HC3H 3GRWA 1TMQA 1JF1B 35C8H 1BAWA 3FULA 3OLEA 5DF0A 2PN5A 2NY6D 2L04A 1HNGA 2Z0UA 4NGHH 1FLRH 1KJ2B 5ISZA 2ADFL 1U3JA 2BSDA 2Z92A 4HEPG 3WKMH 4DT2A 1K4DA 2YAFA 2DMHA 2QFPA 3FN0L 4U6YA 4ZQKB 5E4IA 1FNEA 5ICUA 3SY0B 3QH3B 4Y7OC 3T08A 5BW7C 2OMNA 4HJIA 1G7LA 1U3HD 2R0ZL 4QXVA 4HJEA 4HOMA 5AW8B 3HG0A 3RWJA 3EF4A 1M56B 3MNVA 3N9GL 2EP6A 5GIRA 3P11L 4J6RL 5GRVK 3Q05A 3NABL 2QVKA 4HKBA 4HUUA 1EJ6A 3ISRA 4W1TA 4X6CA 5CKGA 4OAWB 5J56B 3CFDB 3WHXB 1HDMB 3WAJA 2CIIA 4PWGA 5K69A 3PRZA 1TZHA 1T1YA 2GJ6B 4R97B 3S3DB 3F65A 3RP1A 2D73A 4ZZKA 4HG4K 1I1FA 1U36A 4Y2OA 2EKSA 3ZK0A 1WJ3A 4P5MB 2PP9A 1KBPA 2HSIA 1DVUA 1X5ZA 2V9QA 4GBXA 4ATTA 3QFDB 1XCQB 5L2KA 3VXPA 1KXVA 3L4ZA 3LXCA 4NKMA 1SGKA 5IR1A 4RRPG 1SEQH 4NX0A 3V6ZA 1II4E 4HUMB 4FLHA 3T3MB 2YPLE 3BP6B 3C6LD 3ZL1A 5GSVB 2DH3A 2Z7UA 2VRQA 2XY2A 3T04D 1KC5L 4TRPL 2BCKB 4RGMC 5IW3A 4XNYH 2IMNA 5D6DC 1YQ2A 4O4YL 1NBYA 1DUZB 2OXGB 4S2SA 1LE9A 3MRKA 1DO5A 2I24N 2VXUH 4WI4A 1NEZG 3FONA 3RHWF 2NY1B 3V0WL 2VN7A 1NDTA 2HMIC 4NZ8A 2OSLB 4NCDA 2WXPA 5H35A 1ZV9A 1I8UA 1JVOA 3CD4A 4M62L 4OZGE 5IHZB 3Q6FA 1N5AA 1UT9A 2Y36H 3P3YA 3FPYA 4HPYL 5F21B 1PG7X 3QI9D 1XGRA 3LOWA 4JY5L 4ODSH 2EIZA 3OR7A 3ZDYB 3O3DA 3DOSB 2MWCA 2FX8H 2X4NA 1NIAA 3MJ8B 2XETA 3U9WA 1N6QL 1C5DA 3O0RL 4YPGA 4YEFA 3CCHA 3QAZB 5E00B 3V5HA 5BRZE 3VD9A 3ES6A 3ZL2A 1MWAH 1QP1A 3MZTA 4U1JA 2XPGB 3MREA 2IWKA 5GS0H 4XCCH 1G9HA 1XD0A 3LRLA 4HDIA 2WO3B 1WITA 1T7WA 1EHKB 3DTXB 1QRND 4NQXB 5LN4A 1DSFL 1TTFA 1KG0A 1CLZL 3ZSSA 3D07A 3FHAA 2X1XR 1SDDB 4LK4A 5G4OA 4E9LA 2JVUA 1FSKC 2W9EH 4GG6E 1FO0H 1P0SE 2NNAB 3UAJA 4NN7B 1H0DB 3IEAA 4XXDB 5DZJA 4K7FA 5IROD 5C3TA 1CLOL 2MPAL 5C0BA 5JMRA 2CJTA 4XNQA 1QSED 5D8JH 1N4XL 1XSJA 4KQ0A 3EBGA 1AR1C 3DUUA 3FCSA 3F85A 1DJYA 5I1CL 4TNVF 4GW5A 3G6DH 4Y5VA 5KVDE 3RHWK 2E3VA 3E38A 4UYQA 4X99B 1HVXA 2EH8L 5JW4R 1OP3H 4U6XB 4WO0A 2BC4B 4LGSB 4WTQA 4NBXB 1BQ5A 3LZFL 3NZHH 4JHBA 1KENH 1LEKA 4K5NA 3CDZB 4FFYL 4XGZA 3L9RA 2PPDA 4XMKL 2VQTA 5J3HC 3H3PL 3LXUX 4O02L 2X6AA 3MRNB 4IIQC 5K59F 1IILE 3DRQB 1UD4A 1HZLA 4C83A 4N2HA 3KPMA 1WZMA 1HQRB 3KLAB 1VAHA 4HU2A 4JAMA 3BAIA 2X89A 4TM9A 4LCUA 5CIPH 3LIZH 4ZNEA 2XBZA 3IDNA 3WNJA 4FFYH 3QNXB 4DESA 3TTYA 2BIQA 1A4CA 4NQED 2JQAA 2EABA 3POHA 4YVUA 1U4EA 2XWTB 4YHYB 4XT1C 1RUKL 4MZIA 2WKLA 4A7TA 3ZVVA 1BVLA 2HLAB 3OAUL 2YRZA 4HU8A 4KMQA 4P5KB 4B0MM 4P2QB 2WLIB 1EUTA 3S3PA 3SPCA 1ZK5A 2WNKA 4JFDA 5IIEA 3CFEB 2GB2A 1SYSA 4G1EB 1BEYH 5BOPA 1QMUA 4DGVH 1BCIA 3KXFA 4YUEH 4CBPA 1E28A 1FBIL 2OMTA 3QUZD 3EYOB 4KH2A 4UZGA 1A1NB 5L2JB 4G6ML 4KROC 2A6DB 1RLWA 4HIJB 4L5FL 2YMXL 1MREH 1PAMA 2YD1A 1JK9B 5MEOA 2OZNA 1E6JH 3AAZB 2W9EL 2NW3A 5GS1B 4KC3B 4KJQD 1HL9A 3NIFE 3QORC 4P2RB 1RUQL 3UGXA 4IOIA 1ES0B 1DSFH 4Y1AE 4QRPD 4UT9L 2VMFA 1T2XA 4AJVA 4AX3A 1TNMA 1M7IB 1EDHA 3FO0L 4KRLB 3DX7B 4NZFA 5JXED 2Q86B 3PYCA 1FQ9C 1DFXA 4MQ7B 1AXTH 3NFSH 3R06A 3W0WB 4YDZA 4CC1A 3V5KB 1FZKA 4H25A 3MRQB 4WV1C 4RFOH 2A74B 2IBZY 4W4OC 1ILSA 2OJZL 3FHQA 1ZLWH 3V4LA 5BUGA 3GMMA 1S46A 2VQUA 3QDMD 3S96B 3THML 2B3IA 2LU3A 4XRCA 1OK8A 5JDSB 2Q2LA 1O6SB 4JM4H 3FH7A 5C0GB 2EZ0D 1KJVB 4L4VA 4MGXA 4P04A 5EU4B 2C3HA 3WDIA 4JFED 3H2WA 2ALWA 4ZXBD 3DROA 3BKYH 4P46D 3RBSA 4BKSC 5LNGA 3UPRB 3BSHA 1CMOA 3BH9B 2EUWA 1CDIA 2XG5A 3UBGA 5KS9E 4IJ3B 1P5VB 3E6HB 5KSUA 4XODA 5BMFH 2N4IA 5BS0D 4ZOBA 3W3BA 4UU9B 3B3IA 3GIZL 3RGVD 1DVXA 4WV1B 3SHSA 5EU6B 1MFNA 4F9LC 2OM5A 3BD3A 3QUYB 4YFLF 3CN3A 4K23L 2WXIA 5DURD 4J5VA 4MASA 2Y6SD 4ES8A 4XXCA 2JIXB 1LK2A 4JZJC 3ULVC 1LO0L 3RY4A 2R4SL 5FFGA 2Z4TA 3VDCA 5FO7A 2XWJB 3FS9A 3IJEA 3S36L 5K93A 4A2EA 2MHAB 4G9FA 1QTSA 3LSOB 1IGIH 4WU7B 4YO0B 5BVPL 3OKEB 3TV8A 2ICWA 1K8DB 3AROA 1OCZB 4GKZA 5HGDA 5D5MF 1IC4L 1NKGA 4TLTA 4NZDA 3T8VA 3F58H 4UT6L 3DI2B 4X4ZA 2RH0A 4XHQA 4DEPB 3MROA 4G8FA 2FJGB 2P9RA 4XNUL 4PJDF 4M7LT 2Y6SC 3IKKA 3SPVA 2YKKA 3BVNB 2CO6A 4EUPG 1KBWA 4GRWH 1P4IL 1JERA 1E4JA 1G7JB 2D7MA 1BHGA 1XH1A 5F1NB 1O9VA 3IS1X 1INDL 3BSZL 1J0JA 4FG6D 2XXFA 4YHZH 3SBPA 4H26B 1D6EB 2I69A 4LSRH 4JFOA 3FN0H 4QF1B 4YZFF 3QCUH 5EOTA 4ZT1A 3TYFA 3FRPG 3RFZB 3QQ9C 4G6FD 3ZMNA 4CVZA 3GSQA 2J8UF 3MKGA 5LNEA 1I3RB 2VJXA 3B7RL 4Q0XL 4EQ2A 1SJEA 4JM2D 3IDYC 4E41E 2CDFA 3UMNA 1OM3H 2IDUA 1NEZB 2YAEA 5DJ2B 1MFCH 1NDGB 1UXWB 5HJ3B 3S35H 2WPGA 3ROLA 2ZUUA 1OW0A 4H13C 4NP9A 5D4IA 3VMNA 1BBDH 4DVBA 4R7NA 4Z7NF 1GCYA 3E6FA 3DHJA 1VPOL 3V0HA 4JFFA 4MZRA 4L9DA 4PJ6A 2FEDD 3RIAK 3GLAA 1D5BB 3ZE0E 1EHXA 1FVCA 1JD9A 2IH3B 4ZQTA 4F5CE 1B2YA 3QHTC 3JUYA 3LNHA 4GBXD 4YSQA 5B1JA 3BO8B 4PAZA 43C9B 5KBLA 1MWAB 1MIML 2XZZA 5HI5C 1JI2A 5JMOC 2VDLH 3T2PA 1SBBA 4ODWA 5G55A 5DUPH 1NL0H 5HPMA 2IFGA 3SKJH 2GSGA 3FB7A 4JFQB 1MCEA 3SEPA 1K6QL 5SWZE 1GSKA 5GJSH 4PJAE 4ZOAA 5JR1H 4U0RB 4AW4A 3C6LC 1UACH 5G4NA 3WXWH 2BHUA 3EDJA 4MXVF 3BPOC 3QIBD 2BSRA 4J1UA 4G70B 4LKCB 1RP8A 3NEOA 5B38G 1J05A 3MACL 1NGQL 4WU5B 1RK0B 1AR2A 4YHMH 2GEQA 3U4AA 1CD1B 1Z9PA 4LIQL 1D2PA 3JWDC 1F4YL 2MKLC 3WY4A 3MGOB 5FYLD 4LAJH 4S1RH 1U8JB 1HE7A 1SN0A 2VQ1A 3O8XD 1Z66A 1O0VA 1G7IB 4OVUA 5G4MA 4XVTL 3U7AA 5GZND 2F53B 2BY3A 5IHUH 3GSXA 4FNLH 1B4RA 4ALAL 2Y22A 4PN6A 2WKOA 3ATBA 1DBAH 2VAJA 3FMGH 1Y1DA 1YVLA 4OCMC 4HS8H 2NY0C 1EJOH 4UWQB 5D1XA 3L5XH 4KZEL 1JWUA 5F0PB 3LS5L 1UOVA 2CO7B 1QBBA 2B1AL 3AT9A 2IPKA 1LO0H 1J5OL 4FI6A 1E2ZA 2RCSH 4XMLL 1IQDA 2A9BA 2NUTB 2JKJA 1KXHA 4JN2A 2DICA 3D5OF 5H8DA 3OKLA 2DEXX 4TN9A 4KXCA 4DCQA 5D7EA 1I1AC 3EDKA 1YZZA 1W72L 4WK2B 3K72A 1I7TA 5C9JA 3ARQA 2HTLD 5TDPB 5A6IA 1GZQA 4ZX4A 2W0KA 3CMOL 3RZCD 3BT2H 4FULA 1BZ9B 2VH5H 3BAXA 4WUUD 4XB8A 3KYMB 1KBBA 1ZS8A 3VQLA 2OZ4A 4PPTA 4U1NA 1U8OA 2VDRL 2WLHA 4KNSA 2YN5A 1U30A 1NFDA 2DJSA 2HJFA 3ML8A 4NQSB 3T4AB 3MRDA 2VMJA 4PTUA 4XP5L 4G6FB 5EBLA 4MKTA 3P0GB 4XH2A 3RUGB 4XB7A 2A9NL 4NM8H 4ZJ9A 4PWIA 2EYSB 4J4PC 4D3CL 3T0WA 2R1XA 4QDGA 2A0LD 1GYWA 4DVRH 2Y2TA 3W11D 2O5ZH 4PJCE 3VUAA 3T6ZA 2VR5A 2GK0B 1KWGA 1JVKA 2PR4L 5L9DH 5T8IA 3ULUL 2ZCZA 4MA1C 3NRQA 4HETA 5E08L 1PIFA 5EF1A 3H42H 4WWKC 5I28A 2I9LB 1EDYA 3LRHA 1A4KB 3VFPA 5E03A 3ESMA 3TN0D 4ZFZB 1NCTA 1JCKA 1C5BL 4J8RA 3A24A 5HHOA 2Y06L 2VDMB 1UYWH 2QGDA 3L3GB 1EFXA 3MNWB 4AMKH 3ARWA 5JO5B 1NCAL 4Y9EA 4P9HH 3F7LA 3KWWB 3QWRD 3K0WA 1FIEA 1P4UA 3E0GA 2D03L 3S5LB 2EJ1A 25C8L 3ZYIA 5DK2A 4U6YB 1BM3L 1KCUH 4MAYB 5F71A 1ZGLA 5EN3A 2XHNA 3H9YA 4PV8A 5IBUG 2CM5A 1MCOH 2OULB 2VLRB 4CGTA 2MCPH 2WIMA 3HE7D 3NK3A 2ISDA 1CVSC 1RFDH 1TZGH 3CFJB 3EBIA 3BH8A 3A6BL 2A38A 3IU4L 3OR6B 4KKQA 5A2IH 2KH2B 1W9XA 2IQAB 3D2TA 5IP4A 3DO7B 3QRBA 2FL5A 1FSKB 2Z7WA 5JTWA 4X6CB 3O4OB 4WAFA 5F2FA 3QDGD 1S7SA 1W72B 1KNOA 4KVCH 3S3JA 1T1YB 2GJ6A 1CBVL 3B2VL 3CFUA 2H1LM 4YSUA 2GSMB 2GUYA 2HX7A 4FQIH 5JUEL 1ONQA 3C08H 2V7NB 5DRZA 1NC4B 4R8WH 4TQHA 3MV7A 3S6CA 4IIZA 1URLA 1SJHA 3HBPA 1PQZA 3Q2NA 4QHUA 4ICWA 1AHWC 1EK3A 3F7VA 4TKWA 1H3PL 3SKUD 5DD1H 4GFXA 1ACYL 2JF1A 3KNBA 4CC4A 2R56H 4NZTL 4FTVD 1G9EA 2E4TA 1EERB 2PW2A 1I8MA 2C7FA 3QR2A 1J11A 3HKZA 2MCPL 1NFAA 1INQA 2EH8H 5GGVH 3G7TA 3MOQA 4FGMA 4UM8B 1G9ML 3ZYZA 3QDJE 4HJJH 1BM3H 1KCUL 4JLRB 2NNRA 2ZYSA 1AP2B 1RZJL 2Z31C 4BUHA 1HHJB 3VNZA 2D03H 1T6VN 2OSLA 2OSYA 1NSNH 1JD7A 2BSBA 4PRNB 4P9HL 3N40F 4CILA 5C1MB 3RNKA 1PEWA 2NY2B 1C7TA 4FG4A 2VDPH 3LX9A 4L48A 1RPQA 2JFCA 3BZ4A 4IGBD 4HAFA 3KPOA 4NQQA 4RGNC 4U1GC 4WHTA 3WD5H 1VACA 2ITFA 4K3EL 3D51A 3MRPB 2D3LA 3T65A 1W0WB 3U9UB 2FBJL 1OAUL 4X7TB 5F1IA 5CZXC 3UAJD 1TPXB 3PWPA 5FGSA 1CXEA 3K2UL 4N2LA 4JHUA 4XCCL 5K9OA 3V4PH 1B6DA 2CR6A 2W60A 3L5WA 3PAUA 1S5IL 4U2YA 3DTXA 2EC9T 1RURL 2NY0D 4R0LB 4Y5XC 1T04A 3FBKA 2LV4A 3RFRA 4BH8A 5KSAB 3GHBH 1EXGA 3N1GC 1H0DA 3GT6A 4L4VD 1XO8A 2D8KA 3WCYA 1FL6A 4PJ7A 4RMTA 4HOZA 1TTBA 1U8NA 1AOZA 4UOW0 2J1KA 3C9NA 4EBQL 4ONHB 1A6AB 2RMNA 5INDA 1N6UA 2J71A 3DGDA 1JZDC 4B9YA 4ZUVB 2WZPA 2D2CC 5FUOH 1SQ2N 4Y5VB 3QG6B 5AVZB 4ZTPH 1FC1A 3EIFA 2YAMA 1IEAA 3KDPB 3FH8A 1C5CH 5HYSG 4U6XA 4TSBL 4DTGL 5MHSE 2F15A 3C09C 1S7VB 2WW8A 3QQ4A 4L1LA 2E76C 4OLWL 3O9WC 3F00A 2R69L 3EKCA 3LRSA 4NO5A 1JN6A 1C8PA 3F6IA 4LF3B 4FFZH 4QTIL 1MUJA 5HDLA 4KXBA 1G1OA 4BUGA 3GJFK 4K2UH 4OF8A 4Z7WA 1RUMH 4AUJA 1IC7H 3Q5OA 1NEPA 3GBLA 2OW7A 3QYCA 4YHPB 3TN0C 3I75B 3LPGA 3VMOA 5KYYB 1RHHA 1YNTB 3KLAA 3RGVC 4G83A 1U41A 2SEBA 1R4XA 3ZIMA 4G6KH 5FDWB 5FYLL 5ACZA 4ZFOL 3T0AA 1TZOA 5EOCJ 1F4YH 2DS4A 4DKEH 1QFWM 1YQVL 4G43A 3TO4A 5EA0H 4HYTB 2CCLA 1CPUA 1DSYA 3EFDL 1I1AA 1NQBA 4GS7B 2L8AA 2EIBA 1XCXA 3VFUA 3RWCB 1I9JL 4OIIL 1MJ8H 4U6TA 3ZQWA 2QPDB 3WTYA 1C9SA 1RQ5A 2FH6A 4JR9L 1KJMA 4WI0A 3BAKA 4J3OF 4XCNB 5DLML 2UZIH 4W9EC 4GUCA 5T3XL 3WKML 2P5EE 4OFIA 2VLKB 3AREC 4GKLA 1DVTA 5DK0A 3WFCH 2H1PH 5JHDD 1KN2L 3FFCB 3M8OL 2BS71 1X4YA 3H0TB 3H2QA 2ZTBA 4GMTH 3AXIA 4E5XB 4QHLB 4QRUA 4JFYB 5DA4A 1KCWA 4KVNH 3A22A 1AGFA 5JW3L 1YHPA 1QLRB 4K5PA 3SJVA 2EDWA 4ADIA 1MI5B 1B4JL 2BXYA 1T0MB 3FOLA 3VTTA 4JFWA 5BOZG 4MA1B 4Z7UB 4BFNA 2ZKXA 1QSEB 3CJJA 2C26A 5I30H 1W6WA 2XBDA 1QASA 1R5VB 1O6SA 1HHIB 2YK1H 3MV11 2BDNH 3BKML 1KULA 3DURA 3D08A 2Q1EA 3G6JE 3MRHB 4J6IA 1Q9KA 1DEEA 1VGEL 5IQLA 4GP5B 1BZDA 4OJFL 1MLCB 4N2GA 2OV0A 5A2BA 4AYID 1DBML 4WUUB 4NEHB 2B20A 5ANMA 3QQNA 1KIRA 1E9QB 3L1EA 4OCWH 4PTTA 4DFIA 5B8CC 4OZ4A 1EH9A 2C3WA 4FG0A 1LDPH 1SDAB 1XVSA 3MLVL 4PJHA 1CFTB 2HT2D 4NJ9H 5J13B 5EULV 3V5DB 2DLTA 5HI5D 2DKMA 3TJEH 1Q9LB 4GQRA 1UB5A 1NLBH 5JNYA 1Y07A 1CD0A 3L45A 2JJUA 2IXQA 3NCEB 4NFDA 2YJQA 2QGEA 1CFSB 1A6VL 2DY2A 3M1CA 4NSKA 3EAKA 5JW4N 1VZIA 4NUJA 4EN3C 1GXEA 1RUPL 4FNPA 1NC2A 1YEDB 3ROOB 4X6DE 1H6EA 12E8L 1CDGA 3IDGA 3OMZA 3VA6A 4M8RA 4L05A 2AJXH 4IBSA 3GBNL 4LCYA 4PJIF 3S37H 1AAJA 2P8PB 4BK8A 3TOPA 3IDJB 4HUKB 1ZLVK 1I8AA 3CH1A 4H26A 3HG4A 1XZ0A 3VWKC 3IWVA 4LO9A 4FHJA 2M2DA 2HT2C 1OZTG 4PRHD 1VLXA 4N85A 4B97A 5ANME 3U1SL 2NMSA 1IBGH 1I3RA 5FHAL 2N59A 3MAWA 5F9DC 4N26A 4NENA 2WWKO 1I7UA 3KEDA 2CGZA 1A6UH 1E67A 1N9PA 4U0RC 1IBDA 3HRZC 5CGTA 2BVQA 3P40A 2ZWKA 5C0RL 4LOFA 3ALXA 3SKMB 4KO6A 2N7BA 1JRHI 5CP7A 1F4WH 4G80A 4MAYD 2FHFA 3S3CB 1YN7A 5T5FA 1YCSA 3O4LA 4Y4FA 5SX4I 4J3UA 1NLBL 1UT1A 1CXFA 4OCYL 3EOTL 4HGWB 5FUCE 4FLSA 1CE6B 1R5WB 4PJXE 4M93B 5IQ9A 4PRBB 2AK4A 5TJWK 4UQIM 4NJ9L 1GC1C 3KYOA 1SPDA 3RX7A 5J1TC 3QIUA 4K7PH 1BFVH 4L1SA 4MMZA 2V17H 4PJBA 5CGYC 5DC2A 4FXKC 1X5IA 3QXDB 4MQXC 4JEGB 3P4OA 1MWAA 3Q1SH 5AVVB 1JF1A 3FSZA 1MCIA 5HHVH 1S7TA 4YBQD 4UIMA 2GSGB 3GHBL 5KSBA 5CWSA 2FAUA 3KG5A 4ZQKA 1S9VA 4PLNC 2BVTA 4NQCD 5D55A 2D0FA 3COOA 4W9GC 1QI3A 3TCLA 1ZSDA 4RMWA 2QR0B 3MYJA 3MRRA 1YUHA 1C08B 3V4PB 2HKFH 3KL3A 3DI3B 5ADPL 2YK1L 2HKHL 3FT9A 4N8UA 1JGUH 4X4MA 4QYOA 1C16B 1Q4NX 4MQTB 5ISZD 2XN1A 4HLZH 4NQEE 3FQTB 4PJIA 1KTLA 5I30L 2NW2B 3HG1A 2D7TL 4ZAKC 2R69A 4Y4KC 2GJZA 5CLWA 5LAXB 3ESPA 2BNRA 4HBCL 4NZUH 4WTXA 5JPNA 1BVZA 1XB3A 3NIGF 1T0OA 3QUKA 4PB0H 4C56D 5KYWA 5I76B 2VDML 5D1XB 2X4TA 3BSGA 3X3GL 3Q8FA 4WFHE 3ARBB 4QIRA 5CZXD 1CC3A 3UAJC 3RWDA 1QVOB 1CGTA 4M7LH 4L37B 4H1LG 1QYGH 1QUNA 1KN2H 1UH3A 5FYKU 2ZUVA 4J3BA 4HKZA 5CFHA 2KI6A 3T6WA 1YEIH 3PS6A 3CHOA 3INUL 3PWLB 4ZYKA 4HXAH 4HEPA 1TF4A 1S7RA 2HRPL 1O75A 3CLFH 3R18A 4JPWH 4R90L 1MAKA 5JOEA 2H7WA 5FGBA 1BLNB 3L3KB 4ZAKD 3TVMD 5GGQL 2P43B 2W38A 4OJEH 5EDXA 4N2FA 3P2BA 4GKNA 4AITA 3Q6FB 1AE6H 5F0JB 4QRPA 5FYJU 5DJZB 3BLBA 5IK3B 3L4TA 2WP3O 1QLEL 5EA0L 4ANWA 5D71H 1RIVL 1XGYL 4L0ZA 5EBLB 3NT0A 5D6DA 1GR7A 1LLAA 5EU3B 4K9EH 1C5DB 2J44A 1MVUA 3ARFD 1OTSD 4NWUH 4Z0BH 4ZXBB 2HPTA 1WIOA 3ES6B 5DYFA 2CUIA 3MMEB 3NQIA 5ADPH 2F1EA 2FWOA 2J1XA 1NUFA 1A7NH 1QPPA 5DJDA 1UD5A 1CGSH 1H3UA 4L1TA 3D52A 4K2UL 4QRRD 4X5XB 3ZLQC 5E9DB 1LO5B 4Y9FA 1KG0B 3HB3C 1EUUA 3P3UA 4N2MA 4Z7QB 4NNPH 4GLRI 1EZSA 5EH1A 1F41A 3F5WB 5EU7E 1MJJA 1OARH 1V3KA 1U58B 4J3SA 2CK0H 1NGXB 4HCRA 5C0CD 1CI3M 1E4XL 5HHOB 3MKKA 3BPLC 1TJHL 3KE0A 6PCYA 5LAPA 2EDJA 4HIHB 2IADA 4M1CD 4CVUA 3RTQB 2ZCKH 3JBG7 4YE4L 3ECVA 3DUUB 4YXKH 2IPUK 5KSBF 2ITDA 5DZNA 3TC9A 3UABA 2EIDA 1Q0XH 3OJDB 4M9OA 1A4BA 1AGBB 4DF9A 5AAMA 1M05B 2BSCA 2HTLC 4Z3GA 4X99A 5E6ID 1NGWB 3E8UL 4ZUUB 1PBYA 1Q9OA 2AVGA 3DX9A 4OZIB 1F3RB 2C9PA 3VAEA 4PREA 5J12C 4WI3A 5JXEC 4DUXA 4NNYA 4W9JC 5EFIA 3S34H 2QSTA 3APFA 2HFFA 4TULL 2VZOA 2C9UA 2CO4A 3T0ED 2FL5B 4PJ8A 1TKWA 4UV7H 1RD6A 4WW1B 4Z7QF 3DETC 2NY7H 1G7PB 3C2AH 3SDAC 3UZVB 1ROCA 1VFBA 2LFGA 3RWFA 1I85C 1N2RA 1S7SB 3EF7A 1BSIA 1MLBB 2DIBA 2H4EA 3ZJAA 1HQRA 4OLZL 1CZ8L 5DZOA 4X9GA 2CXKA 1A8JH 4KITB 4GRLC 4L8CB 1IM9B 4KTEL 2VH5L 4N86A 3RA7H 5C7XH 1XHHA 3OG4B 4S10A 3W11C 1KB9J 3B6SA 4OFPA 1UA7A 1BLIA 3KD4A 3GSUA 5I6NA 3MR9B 5E8OA 2X4PA 5L0QC 2QL1A 3B7SA 4LLUA 1KTRL 2VDKL 2WZAA 4MXWH 1AE6L 4PJXA 1KTBA 2O61B 3D9AH 3ZDWA 5I82A 4Q9RL 2KDGA 1GZHA 1GY2A 3CE1A 3GSWB 2APVA 2DQIH 1TFPA 5JXEA 1YMMB 5AOIA 1ML0A 1B4LA 2F18A 1J5OH 4XAWH 2OMTB 3EYOA 4G6AC 3W56A 5L2JA 5BRZB 1SXCA 4OFYA 4PH8A 3CXDL 5GGVL 1KIQA 2EDMA 4ODXA 3HR5B 1JV2B 4UDTA 2ED7A 4AYDC 1K3ZA 3NH7L 1V7MH 5D4HA 3RNKB 3WNIA 1T6BX 3UTPE 2ZUSA 3CMGA 3WIHL 5B3NA 2WINA 3DMMD 1HYRC 1IAIH 1PLCA 3SJVD 4YHNA 1B0GA 1PSKL 3PWPB 1R0AL 1LWHA 2J2ZA 3MRQA 3RY6C 4RFEA 5HHPB 1TJGH 2QTVA 4GIAA 3TLRA 4NO3A 1SF3A 5SV4A 3T8XB 3N1QC 1IEBA 2NYKA 2D9CA 4GAGL 4EMZA 1XL6A 2PWDA 3FKUS 5GGTA 4BFGA 5I8OH 4YHKL 1FNEB 3H56A 4RISH 2E75C 2ZNWA 3WMSA 1TZAA 3DXAA 2UZYB 1QTYT 1A3LL 1XT5A 3D18A 3DVGB 3QZPA 5EUOE 7PAZA 2VLLA 5DHEA 2D7NA 2XN2A 3VH8G 3WFEH 2NXZC 1D5IH 3NP3A 3HNVH 2V7HA 3KLLA 5C0FA 1UH4A 2JI2A 3CDGA 1FFNA 1WA2X 2EILB 2XOTA 1DBBH 2W88A 4ZUWB 1IIIA 3MO1B 2ZWZA 4IMLA 4EE2A 4NQUA 4HKBB 1WG3A 1WO2A 5DHYA 2WYIA 4ZUVA 3W9DB 1BGXL 1U95B 3BAEL 3NZ8B 2DL9A 3FQRB 4ZD3H 5JW3H 5EU6A 3UBXG 2EUVA 1LEGA 4IBUA 4W6YB 5ELIA 4HJ0D 3EHBC 1AGEA 4PFEA 3RJDA 5CJOL 5E8EA 3SGJA 4GI9A 4B6ZA 4HXBL 2B5IC 3ZE2F 2X3CA 4GBXB 2F5AH 1V7ML 4AC4A 4LP5A 2RACA 3OC5A 4D0CA 2AABH 5CO1A 1BEXA 5EMYA 2Q0ZX 4OCSL 4L4TE 1SXZA 3WIIL 3BHBA 5KYYA 3HN3A 1PZCA 3D30A 2G5BB 4LLYA 2BCKA 2IPUG 4WJKB 4N6RB 5CJXC 2DD8H 1J8KA 3K71B 3DRTB 2DTML 4HIXL 2H9GA 5DWUL 3GRBA 4N68A 1CU4L 3VI3F 1LO4L 2UXGA 2BVEA 5GS2D 1I9JH 4OIIH 3SPVB 2CBTA 4S1DC 5J6GB 1OAZL 2JCCF 4PWKA 5H37A 3T0EB 3MTXA 5IG7A 1GKOA 4K9EC 3RURA 1ZANH 3MA7A 1M4KA 1OCRB 1H9VA 3KJ6H 4BZ1H 1N5AB 2DMKA 4MVBC 4OBRA 3TIDB 2N56A 5I6XB 4W70A 1CG9A 5JYMA 1T3FA 1UQSB 4PWEA 3EYVA 1OP4A 3OXSA 3H4FA 1CDUA 1KV3A 4OIBA 1TMCB 2G3XA 5C09A 3DO3A 2VE6B 1UJ3A 5K1JA 5CSBA 4TUJB 3MREB 1SM3L 2HH0L 2NY2C 4YHOL 5AW5B 1A21A 1ACCA 1MW2A 4PLKD 3SDDB 1MOEA 2X38A 3J2PA 3QCTH 2YPVH 2HG5A 5E2TL 1UH2A 3RVUC 3MXVH 2XTLA 1SQMA 3AM8A 1ZGLP 4YDNA 3MV9D 2UX7A 3VYOA 4JFYA 2DQFB 2UV3A 5FYKL 3U48A 2BY2A 3SJVB 1MRFL 2RQEA 4K8RH 1DQDL 1KXQA 1QFHA 4HXBH 4BQCA 4F57H 2IH3A 3V6OA 3RVWC 4KGJA 3ARBD 1QSEA 1ZA6B 1QLFB 3S8WA 1T1XB 2BHZA 3GMPA 4L3FA 3RPIB 1OV8A 1L7IH 1MCLA 2NLJB 3V8OA 4K3JL 4Z78A 4JBSA 2E56A 2W0PA 1IC5L 4LBAA 5DHVB 1RLBA 3VE0A 1DBBL 2MQGA 3D2UA 5D1QC 3IBEA 1LEKB 1I7ZB 3GQFA 1XTLA 3O2WL 3OB0H 4W9IC 3D4GA 1K6QH 4KKLD 4PR5B 3FFDB 1IGTB 4Z0XA 3TVMB 2CD0A 3MODL 2VN6A 4Q4EA 5AZEL 4WU5A 4W6XB 2MSPA 1UKQA 1U9KA 3MX0A 4GSRA 3ESUF 3DRQA 1T4WA 4HC1H 2YBRA 1BFTA 1UCBL 5BZDB 1Q0EA 3E2HB 2FNBA 4RX4A 3CDCA 2WOYA 4OI9A 1XR9A 3BAWA 3DIVA 3ZKMD 1EEYA 3L3OB 5IOPB 2R0KH 3TH4T 2VXSL 5JNYB 4AOFA 1JPTL 3NIGE 4X5QA 5D7JD 2VMCA 3P4MA 4MMYA 5IHHA 4OD1L 2YKLL 3HB3B 4AYFA 4CGUB 1JXGA 4YWGL 1Z3GL 2H1PL 1ZHNA 2R27A 3EO1A 1X3DA 3U82B 3MCG1 1FNFA 4WRLA 5FV1L 5HD8D 5HGGS 5KVDL 1OM3L 5KVGL 3ULUF 3WTWA 3WFHA 3GSVB 3CH8A 4NAJA 4PJGB 3SGDH 1JZ7A 1HHKA 2IG2L 3SOBH 3CH1B 5IGXL 3A4DA 3O45A 4XZUB 3O2VH 3BOVA 4PJHF 3Q0HA 4DETA 3LIZL 1I8KA 1PY9A 4BYHA 2NYYC 2ZSVB 5HHOD 4A39A 2AV1B 2CA3A 3IU3B 3BC9A 1I7UB 2X0WA 2L7JA 3RI5K 4ODUA 3MXWH 2NR6C 2A74A 2ETWA 3DX8B 2QPUA 2ZUYA 2YOCA 5F7MC 1AG6A 5HGBB 4BUQA 4F33B 4RMQA 1Q8MA 2C1PA 1LO2L 1LGVA 3RIFK 2HJLB 5ETUB 2BY0A 5HBBA 3RL2A 4NN7C 1CGUA 5F6IC 3U4EA 1J87A 2AJUH 1KCSH 1UA6H 3I9IA 1CFQA 4P9ML 1PD1A 1W91A 3BP4B 4MMXA 4XC1L 4LL1A 1CE6A 4XOBA 5LBSH 2XVLA 2J8HA 3PAYA 1R9FA 5B1AB 1J0KA 2AERT 1M42A 3RWHA 4IDJH 2QADD 4ZMWA 3I9GH 2Y2YA 3U7WH 2XZQH 2VLMD 1CLOH 5B4MC 4IKKA 3UX9B 2BO0A 1BFVL 4UU9A 5DZVA 5GGUA 4HOXA 5AWNL 5IMKA 4APXB 1UASA 3M86A 2FATL 4HT1L 4TVPL 4X0KA 5CWSB 3FU7B 2HFGH 3SGEI 1MHHB 5I18H 2YXFA 2VLRA 2BP3A 2XACC 4UTBA 5A3IC 4ABVA 3GB7A 1IGFH 3TCLB 1S5HA 3PP4H 1BFSA 4ZS6C 1FFQA 2BNQA 3HTLX 2AQNA 5IQMA 1WVZA 2CH8A 5DVLA 2G2PA 1JPGB 4Z7OB 1J18A 1K85A 4MVBD 3MLXH 1JDAA 2F7OA 3VSTA 4QYOB 4L1HA 1HHHA 2CDGB 2G9HB 3FU9A 1KXTA 4R5XA 5D7JA 3R8BB 3ZHFA 1HILA 3GBDA 1MCFA 2GTZB 3EGDB 2E6QA 1W72A 1F3DJ 2GJZB 3WS6C 1F58H 2F0CA 2EE9A 1JGVH 5E8NA 3FT2B 4FYQA 4OCRH 4EIUA 1I1CA 3QXVA 1CF8L 1LM8V 3KL5A 3DMMA 2TRHA 5F9AC 1CXHA 2TAAA 1EGJL 4LLQB 5F1NA 3ILPA 5FDYA 4NQCE 3VDAA 4MB4A 4NI6A 4GQ9H 4FHKA 4WLCA 1OF2A 2WAHA 5K9QI 1D6EA 4QXWA 5DD6A 3B2UD 4Y2DD 3BE1H 4L37A 3SN6N 3PWNA 2P5WD 3FHEA 4PJ9B 1DN0B 2EYRA 3HN5A 4R97C 5JHMA 3DLQR 5CLZA 2KL6A 3DX1A 1E5ZA 1SJEB 1TQSA 4TVPE 5FKAB 3QUYC 1NEZA 5DJ2A 2BFVL 2DWSA 2YFOA 4YNYA 3EW3B 4OD2A 2O5XL 1N8OE 1JMXA 5HJ3A 2VW6A 1OGTB 1TQCC 4NZTH 5DMIL 5JHAA 1F3DH 2QEJA 2VABA 4QRPB 2P48B 5DJZA 4LHUD 1DZ0A 4HCIA 4BZYA 2ZOLA 5C07D 1GYVA 3P2TA 5BXFB 1QQDA 1UWYA 4E0RB 4LEOB 1ZJBA 3UBXI 3V0VB 3BI9X 4ELMA 4H7VA 4B3VA 1T5KA 2I25N 1X7QA 1AQHA 1YEJL 2IOIA 4PVNA 3NA4A 3BAEH 3K6OA 4Z7VB 1NLDH 3IVKB 4M7JL 1NGQH 4WJG3 3HAEG 3KWTA 5TK4A 4N87A 1OTTD 5E9DD 5HHQA 3BIAX 3BP7A 3VG0H 1F3JB 1ZTXL 2WTOA 4TOYH 1HXYA 5ABAA 4LPTA 4YXLH 1U58A 4OZGF 3GM0A 1HT6A 4Y16A 1CLCA 2X42A 1NBQA 4ANUA 5C6WH 5EZJB 3FO2A 3VGGA 3KBPA 1L4IA 5C08E 3JQOB 4J2XA 3HS8A 3L48A 1Y18A 4KJYB 5ESAB 5F7LB 1HDMA 3ZGHA 5LKNA 2EUZA 1CWVA 2O5YL 2LVCA 4GEIA 1JHKH 4ONOA 5EWIH 1RI8A 5DUBB 3BH4A 1QFPA 4N9GA 2A1WL 4M4PA 3QS2A 4YDLC 3I74A 5FF6B 5GPRA 1FAKT 5HYSA 2XV3A 3RDTA 4NNYB 5EFIB 3D06A 3FU5A 3QRFM 4JFVA 4C4KO 5F3BB 5K5YA 4NT6B 3US1A 4HWBL 3OKYA 4BSVA 4XPTL 4GUPA 1V54B 4FNQA 4LOEA 2Z8WC 5I8KL 1VFBB 1WHPA 2GHZA 4ZDHB 3QWOB 3ZUNC 1V55B 4Y16C 5AG8A 2HH0H 4LPWA 4EDXA 1HL8A 1DBJH 2A6KB 4WJ5A 1A6UL 3X14A 3O6LH 3T1FB 4RWYH 2GUOB 2F19L 3P4LA 4JK0D 1S7UA 2X1PA 4Q74A 5H37G 4F20A 2ALAA 1YG9A 1WFTA 2ZF9A 2HG0A 1BZ9A 3Q9QA 5IHZA 1A2YB 3H3KA 4FXTA 4QHMB 2CE6A 1KELH 4X6CE 3LDBB 1FO0B 1KLUA 3E3QE 3GSOB 1DLFL 3MRCA 2FRGP 5FM5M 1ACZA 3U6RA 2FIKA 3O3AB 4ZFOB 4JDTH 5E70A 3RG1C 2AS5M 3MJ8A 1LVEA 3O6FD 4FCHA 1ZA3A 12E8H 3TO4C 1Y7VA 4HIXH 3VSUA 4Z95L 2Y7QB 3ZE1B 2DTSA 2A74C 3QJFB 4XMLH 2RCSL 4XNMA 1QHOA 1XGQB 4AQOA 3CHQA 3WFDH 5KBDA 1NBVL 3BVWA 3LEVH 1A6VH 3VB8A 4JFUA 4KFMA 3QUZC 2LTQB 3GPSA 3DC0A 5D1ZC 3X12B 2JB5L 5MEQA 1T0PB 2F9BT 4P2AA 1WCQA 4LCIH 4I13B 1D7BA 2WN3A 4QD2E 2DQGH 4J3OD 2ORBH 1DL7L 2NSXA 1D7CA 3CFCL 5ES4B 2RALA 2J12B 3PXHA 3WLWC 4XVTH 2X4QB 2E59A 1UGKA 3WFBL 4YXKL 3FOLB 5C0BB 4GRLD 2F54A 4F7MA 4AQEA 2X2JA 3FFCD 5EIQA 1WWAX 4XMTA 3VD3A 1WP6A 3QQXA 4PRID 3MLTB 2RQ8A 5CXPA 1OTSC 1BGXH 3HE6D 4GQZA 4XP4H 5ALCL 3LIUA 4GAYB 3L4UA 2ZKHL 1TENA 2BC4A 3CFJA 3ECBA 5DFAA 3DURB 2UUDK 2V7HB 5AW2B 3Q13A 2H3NA 5PCYA 1ZV5A 2CJSA 2H5UA 3HNSL 2EVIA 1FLRL 4Z8FL 1E5AA 4LVOC 3GM8A 4KK5D 3ESNA 4C56E 2CGRL 4HQQH 3T0BA 1MZZA 4AVIA 3RBGA 4K9EL 5E4OA 2AJ3B 5FKPA 4QHKJ 1SEBA 1HK6A 2FBJH 2GBAA 3RVUD 4HUNB 1JNNL 2JIXD 3G3LA 4HLJA 3VI3A 2J4WL 2XIIA 3DYMA 2OSXA 3LXAA 2IDSA 1ONQB 5E6ZA 5I1GH 3QIBB 2OTWB 1TXKA 1MCCA 4HHAB 4I1RA 4OJDH 3MV7D 1PX3A 4XPAH 2X9WA 4UANA 4XE0A 3P0VL 2IPTL 1JNHA 1UZ8A 4PCSA 2QVTA 5D9SA 3VQMA 2CO2A 2G5BA 1FBIH 3OX8B 4LLYB 2XQYK 3SCMB 3L9BA 5I19H 3DRTA 2AF2A 3OHMB 2N7AA 2LT9A 3A5VA 2WANA 3MUZ1 4OF3A 3ROOA 3JT0A 3SGKA 3IDGB 2GKIA 4K94H 3C60A 1A47A 4EIGB 1OTUD 1YNKL 3HG5A 5IF0A 2HTKC 5HVGB 2H0FA 1FG2B 5T3XH 3R8QA 3L3HA 3N5AA 1ET5A 3A21A 2NW3B 3EADA 5LUMA 2VDMH 4DQAA 4WI8A 4ZOEA 3GSNA 4UM9B 3MUY1 4NUQA 4FQIL 5JUEH 3VRLF 3OZ9L 4GAJL 1LP9E 3GUFA 3ZHDA 4B9KC 5J6HB 3GJFH 2QQKL 5L6YH 2F08A 5HI3C 3C5ZD 2GI0A 4NQTA 2VE6A 4XPHH 3U7YH 1FAIH 1RULL 1FHNA 2WXJA 1EFXD 2HFEB 3H3PH 5IB1A 3RZCB 3WGVB 3ZMEA 2W60B 1T1WB 3QAZC 1J5CA 1KPRB 4HV8A 4RAUA 3M46A 4AG4H 1N5YL 4YDKH 1NCUA 3GTTA 5HY9A 4LCWA 2NY1C 5E23A 1T04B 1TZGL 1AD9A 4AGPA 3B9KB 4EZJA 3EYSL 3ZDXF 1KJVA 5EU4A 1I82A 3U9PL 1JUFB 1RSYA 1P6AB 3C5SB 4LHJB 2P80A 2JJTC 1FL6B 4P06A 2WVSA 3HG2A 2VM3A 1H6FA 2ICEC 3T4YA 3AREB 3OG6B 1UKSA 4FLRA 4UOJA 1EJFA 2K0RA 5D8JL 3NFPB 1GC1L 1SDYA 2Y0SA 2VC2B 4XR8C 3OHXA 2VMEA 5I9QB 3P4OB 1CURA 2NY5H 1DFBL 2JB6A 2KZWA 1OSEA 3L3OC 3B3IB 1S7TB 2E5EA 1BREA 3MCLL 4QCIA 1YEHH 4H8HA 4UT9A 2FYYB 2WLKA 3C8KA 4NDMA 4JPKL 4MCZA 3FB8B 3UG5A 5DR5L 5CEXA 3D0LA 1KIUA 2VDQH 1G7MB 4HIIA 4IK7A 1I7ZA 3UG4A 3VXTA 4N2IA 1PLBA 4QMEA 4HCRH 3LNGA 3PV7A 2HRHA 2VDOH 5FM5O 4PR5A 2GBTA 3VWKD 4PG2C 2BVOB 4MSWA 4OZHB 2ZICA 1R46A 1R3KA 4TXVB 4PJIB 1I9RL 1XXFC 1C8QA 2DF3A 3K5RA 5B38A 2GTWA 2OX5A 1PJ9A 2KHAA 5KSVB 4M7KH 5FHBL 4O58L 4RMBA 2LQRA 3G5YB 4UV4L 5T1DL 3QZBA 4LPUA 4HCRL 2X4SA 2YMOA 4U7MA 4HPYH 2MQCA 3ATEA 4OF0A 2VL4A 1LDSA 1MQ8A 3F2LA 1AXTL 3L13A 4U31A 5E1HB 2KT6A 4S0HA 4LCWE 5JA8B 4HT1H 4HHGA 4QNPE 1WZKA 3S3BB 2VXUL 3GSRB 3RLSA 3RWCA 2AJYH 4FTVB 3VFTA 3TF4A 1ASQA 1B2WL 4ORGA 2VXQH 2Z7ZA 3ARVA 1HS6A 1JXKA 3BYTA 4HMDA 4N0UE 1MSPA 1VHPA 3VXSB 3ULUC 4GJTB 4PV1C 4TTGA 4PWFA 4OFYD 3ZMRA 1J0ZA 4C56B 3KAAA 5GGRY 3INUH 4GOSA 4JKLA 1UVQA 1JV5A 3H8NA 4YX2H 1J7VR 4GIOA 1ET7A 4FE9A 4Y1SA 4R2GB 1X5FA 1NCHA 4TNWF 1VADA 2BVPA 5GS3A 3HAEA 1NWPA 3U7YL 4S1RL 3SDXB 1D5BA 3QCVL 3WMPA 4N90D 2EVFA 1GGIL 1O9WA 4G71B 5HGBA 3NUKA 3H9SD 4RESB 2MCG1 3ABZA 4OJFH 4GAJH 4YQXH 5LG6A 4L9LC 1MCKA 5JOPD 2F1AA 2XWDA 3I6KA 1F00I 5EZOL 3T6VA 4X98B 2WD0A 5H94A 4KAQL 1GJWA 1CGYA 3LPOA 4W4OA 3T3PB 1IFHH 1L3WA 3RGVA 5D4QA 4AV0A 4XMKH 3WTSA 4W6WB 3NSFA 32C2A 1FGVL 3IU4H 2KS0A 1NGXA 4HKJB 1NDMB 1MCOL 5E6RB 1RK0A 4H8QA 5HHNB 2E7MA 2FECI 4APXA 5IMKB 1JPTH 3GEWB 2OMVA 1E30A 2PO6B 5A2JH 3AS0A 2J8UE 4PRPE 5C0NC 4G8GB 1U6AH 3OJVC 3L3IB 1NCWH 2HX9A 3Q2LA 4FL4B 2X09A 1BFOA 1D7FA 2PP7A 3EH1A 3N42F 3O6FB 4GMTL 4X6FA 3UTTA 2X6VA 2BM3A 2F5BH 1Q9LA 3F8UB 1JPGA 3OMIB 4XCEB 3EH2A 3H9SE 3EFFB 1TKWB 4B9ZA 4EIBA 3WFCL 2G2RA 2NYZA 5EPMA 2IXQB 5E08H 4MJ4A 3HE7C 4H0LC 4U6VL 2YD0A 1MLBA 4M3JA 5CBAB 3PGDB 5KVEE 4OZIE 1MHCA 4JW3A 4Z3EA 3R19A 1RK1A 2JXMA 3HVDA 4IKNA 2MQ0A 1EDQA 5D7LE 2OCFD 4CKVX 4N1CA 1NCNA 4ODSL 3TT3H 2F54D 3IFLL 3GUTA 2OQJA 2XTJD 3D69B 4PJ9A 3RVVD 3ELQA 2PWFA 2XZCH 4TYUA 5FYLH 3QJOA 3ARUA 4ELMF 4LLVB 1YECL 4ZTEA 3MJGX 3QO0B 1P9MC 2PMZA 1MRFH 2AHIA 4AYSA 4K3DL 2EYSA 1IC4H 5JHLA 2QFRA 1UFGA 5C0DA 4XO3A 4LCIL 3KLHD 1I9IL 1BVOA 1P6FA 3BUPA 5JHDB 1KC5H 4TRPH 1EEZA 1NCDL 3N1MC 1E6OL 4YL9A 4KI5C 3UO1H 3EH5B 3MUUA 1C12A 2CUMA 4HFUL 2I07A 1QRNE 1XAKA 1H3WM 2NY5C 4RNRB 1TU2A 1VEOA 3EJSA 3PLYA 4B5ZA 1NCDH 4OW6A 4TSBH 4OUUB 2K7PA 1E0OB 1HTYA 2XYBA 3MLUH 1IAOB 2DLFL 4DTGH 4HFUH 3IF1A 1SJXA 1G5AA 4LVOB 4C4KT 1N19A 2V5RA 4X4XB 2XV6B 4I77H 1PCXA 2LABA 2W65B 5IMMB 1AMYA 3ZDYE 5ECGA 1AY1H 1Z7JA 3L6FB 3M1BB 4IRJD 4LLMA 5I6PA 1MFVA 1LQSR 4GRWF 3VXMB 4BHUA 1TETH 3LH2L 3QULA 2J57A 2BMKA 3CSBA 2OJEB 2CBMA 2XX0A 4OLUL 4WWOA 3T77B 1JNJA 3EZJB 2I7OA 3DXAB 4DEPC 1N7ML 1ZSDB 5F0MB 4KI5D 2VXVL 1LILA 1XQ4A 1NPJA 3TT3L 5C0FB 2K3HA 4OUOA 2NX5B 3QFJD 3EO9H 4NPYB 5GQBA 2AXGA 5TGBA 2NY6B 1SXSA 3FQTA 1MF2L 4AEHH 2XIDA 1KTLB 3F04A 2D3NA 5C08A 3FQRA 3I6LE 4X8GA 1PL3A 1KNOB 1JRHH 5JIQA 1F8TL 2CR0A 4N9GB 4X42A 3DX0A 3HI6L 4AEIL 3LJ3A 3TGXA 4JN1H 4IW4C 3BPNC 1WFUA 3HHMA 5IEHB 4GINA 2ZG1A 4UAOC 3VXUB 5I8EB 4M29A 4D0CB 1ETA1 3ARBA 2XXMB 4RRPA 4ZD3L 4A7SA 3GI8L 5E5MB 1EO8L 1CI5A 4O02B 4AVHA 3F7VB 1ICTA 4WO4C 3WNOA 2APWA 3C12A 4PRIA 1NGZB 2J1ZA 2UXTA 4G7VL 2YEZA 2WXNA 3AT0A 3MRBA 2XQBL 3ZIYA 1A1OA 5B1CA 1I8LC 4ZYKB 3PQYB 1INQB 1OEZW 1S7RB 1Q94A 4OI8A 4RFNB 3SQBB 2BHYA 3WEMA 2IAND 3H55A 3TESA 4JLRA 3B7UX 2X7LB 3QXAB 4FXKA 3C87A 4R7DA 4JDZA 4QXTB 1UOWA 5MERB 4M56A 1FJ1B 3IGAB 5ADOH 1EV2E 2EE3A 4KDVA 3J7HA 4G7SB 4KKCC 1RZ8A 2H41A 4XPGH 3BPOB 3TIDA 1FO0A 1KLUB 3IRPX 4LASL 4UAOB 3GXPA 4YPJA 4KAQH 4IU2B 1L6PA 2G4EA 2WHVA 2A7BA 5EZOH 2PTUA 3LKQB 2VLKD 3BYYA 1IM3D 3OKMB 4M5ZL 3I50H 1UWGL 2CG9X 3MMEA 3BGMA 4PB9H 2V2XB 2IBZX 1IE4A 2VERN 3MI6A 3L3JA 5DJ8B 1F45A 4F9LA 4KROB 1HL4A 1U8IA 4U1SA 3OAZK 4K7PX 4BE6A 1CBJA 2DQFA 2CKNA 1JF5A 3FN3A 3QJVB 3S36H 4LKXB 1VSCA 5FYJE 4UYPA 4YSRA 1O6VA 2ADIA 5IBLC 3CSYB 2OL3L 2P80D 4Q58C 4PJ5B 4JHAL 3RTQA 4I0PB 2HJKB 1AHKA 2MEJB 1XGUB 3UJIH 1EAPA 2DM7A 3OJDA 3MLTA 4U1IB 2VDNL 1HQ4A 3HEIB 3VDBA 5MENB 1KGIA 2OCCB 5D7IA 3FFOA 1XD1A 2YXMA 5IM7A 3C5JB 1BIIA 4PREB 1R3JB 3MUHL 3C5ZA 1OGAD 1WZAA 3NAAH 3T6XA 4PRPB 1F18A 4X80H 2YD3A 4FQXD 4FXGC 4UV4H 5T1DH 1KJ3H 5BUPA 4PJ8B 1VGKB 1HEHC 3IFPA 5GS0L 5KW9L 4L4TB 5GGTH 2LE9A 1L7TH 1BG9A 3MX0B 1J9CT 1FPTL 2X44D 4NUMA 5MP6H 4YHPA 4JB9H 4KKNA 2SEBB 4PLKC 4UTAH 3SDAB 3IMVA 4WY7H 2AEIT 3WS3B 1UXSB 2ZX9A 2X41A 4AMWA 1TQCB 2W0FA 4E36A 1IJNA 1TJIH 3MJ9L 4GP8B 4CVXB 1OAUH 3R4RA 5H4YA 1X5KA 2DEWX 2O72A 4ETYA 4I89A 4PJXB 2GCYA 3EHBD 2H26A 4PJBF 1UM4L 5DYOA 4FKEA 3OX8A 1MDAA 3FRUB 3FT4B 2BNRD 2VDNB 5FOBA 5KBMA 4MAUL 4X9IA 2QPSA 1ZHNB 2NNXA 3RWEA 4TUUA 2FQEA 4A2LA 1E3FA 1INEL 4EIZC 2VDNH 4E42A 5T3ZL 3IAGC 5T1MB 5I1EH 1KEMH 3EJZD 4ODXB 2BW4A 1NAKH 5GXBB 1KJ2L 3AGWA 3CC5B 3J8F7 1YYMH 2VM4A 3O45B 3MNZA 4BK5C 4R96B 2JKWA 3VRLE 4E5XA 3P02A 4QHLA 1O9ZA 2GIMA 4MRBA 4D9LH 5FLUA 2XC8A 5JW4M 4BGDA 2I9TB 4M6MH 4MX7A 3CUPA 5CIPA 1DHKA 2CJUH 3FAXA 4FABL 4QOKA 4L0PB 4LARL 4YMPA 3KH3A 5KUKA 2W07A 2WLLA 3WJJC 4LSQH 4HV8B 5C9KA 2DJUA 5FPIA 4QXGH 2HLEB 1CN4A 3SPJA 2XLLA 1A65A 2YBGA 3P77B 4YIQB 4Y8DC 1NAMB 4MMXB 2EXWD 2EXSA 5IFHH 2NXYB 2OLDA 3KCWA 5DMGD 1EVTC 3JTSA 4I4WB 1HAWA 4MXQC 3AREA 3SE4A 5T5NG 4KZDH 1YEIL 4BKLB 1RFDL 4Y2DC 1KCRL 3HNTH 4CNIB 1XBRA 2WMPA 2WNWA 3W9DA 3NCXA 1MVFA 4M7LL 3UJJH 4BM7A 1YEEL 1SUHA 3TM6A 3HA0A 1KIRB 5GZOC 1N6VA 3B2XA 2ZYRA 1LTXA 1W15A 3LQMA 3TA3B 4D0BA 2H6OA 4ZX3A 4G7VH 1BD2B 4KGLA 1X7SA 4WUKH 5GRVL 2PCPA 3PFQA 2IDTA 2RD0A 2G9KA 4FNUA 4B7IA 3H9SA 2QVFB 5GISL 1Z1WA 4BGLA 2KLRA 1RU9L 4TNFA 2AFNA 5KN5A 2AEPL 3GDBA 4JZOA 3D6GA 4MNQB 4MNGB 3LNIA 4ZMAT 1F02I 1JGUL 5EBMA 2L3BA 5FECB 4Z8FH 2ZCLH 5ILTH 3K71A 2QDWA 3KBEA 3PU7A 4XMXA 2X4SB 4FFWD 1MF2H 1I3VA 4MJJA 5DS8A 2E9IA 2COQA 3ZYJA 1P4LA 4U1MB 5BV7L 1KFGA 2ZOKB 2GJPA 5AKRA 4OB5H 5EEXA 1OAXL 4XP4L 3LZOA 1BX2B 3H6AA 5H37H 2MFNA 3ZL4H 4YHZL 1KV7A 5DD6B 4N24A 2HVJA 3ABLB 2CRZA 5L0QB 2VW4A 3Q1SL 2QADC 2J73A 4OLUH 3HZYB 2IFFL 2DH2A 1E5BA 1NMCB 4P48A 3B9KD 3RKPA 3LNDA 3OKOB 4HH9A 1CB4A 3BT0A 4F8LA 3APDA 2HAZA 1UJ3B 4YNYB 4IYKA 3LIZA 5SX5H 4EDWL 2BVQB 1JV5B 3WKNA 3V7AE 3KPRE 4QLWA 3ZR5A 4X6BA 4Y2DB 4JO4H 1JZJA 1VA9A 3FT1A 3HZVB 3V6BR 4F3FA 4ZSOE 2BK8A 3DXAD 3GJEA 2H47C 4H8PA 3FW6A 4HGWA 4I18A 3HAEB 4DGYL 3CHRA 5BXFA 4DERA 3HE6B 4QAWA 4HS8L 3PHQB 1BAFL 2AK4B 4ELMB 2EVGA 1ZHKA 1F90L 4WEUD 3QB7C 5IHUL 4JFHE 4Y16D 4MMZB 4BFIA 1TNNA 1ZGLM 3HLAB 5I24A 1NC4D 3UC2A 3VD7A 3H2PA 3IMTA 4EUPH 2R2BB 5B3JE 2CIKA 4ZFQA 3ARGD 1RSFA 2XXGA 3B9KC 3IMRA 4X98A 5TD4A 3RTQC 4ISVA 2P5EA 1DLFH 1G1KA 2AXWA 3BUDA 2W8CA 1XTMA 2OA9A 3C75A 3D2UB 3D85D 3P2DA 1ZHLB 3GHPA 4O5LH 1I3GL 3FT3B 2QR0A 5DVOA 5DWUH 2O6DA 1RUPH 3MCYA 1YUHB 2AMUA 4KQ3H 3FFDA 4LSVH 3V4PA 1M6OA 1LP9B 1E5UI 3MRLB 3QDJD 5ICYB 3TU6A 3JWOH 2PO6D 3WY2A 3BZEA 1Y18B 3MJ9A 1YY9C 1FHGA 1U3HA 3TEZA 2AK1L 3M07A 1AO7D 2AABL 3G5XA 4M3HA 5SWSD 5DUBA 5HTSA 3DJZA 2AGJH 4R5TA 4DAGL 3ZTNL 3H7LA 1KGYE 4L23A 2XVKA 4ABWA 1OANA 1M1XB 1S7XA 1XIWB 2Q6WB 3MBWB 1UZ6E 3SO3B 5F3BA 5IOPA 1PVHA 5JPMB 2HUHA 3BISA 3BGFB 2WWNA 1UB6B 3FC8A 4L5FH 3NJGA 1GHFH 4AGNA 1TVBB 1U91A 2OMUB 4PWHA 3U36B 2ODHA 5DZAA 1IQWL 1MHCB 3RI5F 4YFLI 4KK6D 4R0LC 4UI2A 3FRPA 4Y5XB 4YUEL 1KUMA 4JCWA 4MA7L 3P3TA 4MD4B 1RIUL 2AAVA 1U93B 1RERA 1AS7A 5AL8A 3HUJF 4TQPA 3GMNB 1EXUA 1F0LA 4Q9CA 1RUAL 4PGBA 4MJIE 2DYPA 3UTSB 4LQFH 4L3CB 2DQUL 1HL5A 4OZFH 4G8IB 2V3EA 1FCCA 2VSCA 4PJ7E 2Z0BA 3KGUA 4WGKA 1U3YA 4MJ5A 3QW9A 1C1EH 5HYJE 5D7IE 5EO1B 5LWYH 4FHBD 4XXCC 4Y1AA 2HZHA 4PLJD 5I1HL 1YEJH 1J1OL 4ZS7L 1WD8A 4F33A 4KVNL 4WHCA 3EH4B 4XWOD 1HEZB 1SFHA 2V37A 4TPRL 1I9EA 4F8QA 4XMPL 2VOTA 5AOLA 4HVBA 4F9PA 3UAEA 1LNUA 2P5WE 3QCVH 4NI3A 1D5ZB 4Y4KD 3NH7H 1CF1A 3O2DL 3OPZH 4NO2A 1T21A 1DDTA 2ZPKH 4WCYH 4LSUH 4GIPD 3F5WA 3QIWD 5F7DA 5I23A 4JUSA 4NO0D 5TE7H 5HDOA 1N12A 1SLVA 2UWEA 1B4TA 2MOVA 2DQJL 5F6HI 1FNGB 4D0DA 3OB0K 5DMYA 3ILQD 4JPQA 5HDRA 1AS8A 3SE4C 2YGPA 4AQEB 4YSSA 4B27A 1HWHB 4FG6C 5CP3H 1NZRA 3VXMA 4EI6B 2M8XA 4ELKB 1GW6A 1TVDA 5JZ7D 3IAQA 4RAHA 5D2NC 3TVMC 1XF4B 4AYMC 1KEGL 3T0EE 5ID0A 5CEZH 1F56A 2QKIC 4J3VA 4ZUUA 2X88A 3VM5A 1E42A 4WDIA 4XP1H 5JORB 1EGJH 3KLQA 1ZVNA 3D85B 5DSCA 1U8CA 4GO8A 2QMJA 4AE1A 1O7DC 4NAQA 1OT1A 2APXA 4MA8H 5HI3D 2HVBA 2WTRA 2ZOTA 4OAWA 5SV3A 1T0NB 1DQJA 3K91A 5L88L 2EDHA 4H0HB 4NJAL 3HLKA 3SPHA 2F53E 3ATDA 1HEJC 1X44A 3VXRA 4YGAB 5DT1L 4NNXA 5IROC 4DHLA 1S9YA 2C4FT 5AALA 1J48A 3AW5A 3CQQA 1E40A 4Q8BA 2Z91A 4YSTA 3T3PE 3B2MA 4AQZA 4KJPD 4NKMB 4YFDB 5TPWH 2VDOL 4LLUB 3IMWA 4FRWA 2V0AA 5EUKB 5LCVH 1DVFA 3PWNB 1JNHB 1ZPLA 3FK3A 7CGTA 1S9WA 1ITBB 2ZUTA 4GG6A 5TF0A 1B3IA 5A16A 4YLBA 2ZKWA 4QT5A 2HFGL 2FO4B 4AVKA 4PD4J 1OGPA 1A6PA 3RYMA 1Q94B 2HRLA 4AK1A 3D7PA 5AWNH 2JJWA 1CD9B 1LE9B 1T2JA 3MBXL 4G5AA 4V11A 3NJMA 3AQDA 1FRGH 3CWGA 1FZOA 3FB5A 1CGVA 4PRHA 4S0SD 1T20A 1HYSD 5EEZA 1TQUA 3FUDA 1DJXA 1J9SA 3OAZH 2H0PA 4G6JH 3WMQA 4AEEA 4UM9A 2EDXA 3NGBC 4I8DA 3PWVB 4OH2A 3VFRB 2ZUWA 1RULH 4JO1L 3LRMA 4DN4L 5ID1A 4MCMA 5D2NB 4Z0BL 4AZ8B 2LGNA 4OLEA 2QLYA 1S6NA 4Z7VA 3CLEL 5HYIA 3IVKA 3QEHA 4IKLA 4LCCC 1GS7A 5HHPA 4K3EH 5BQ7B 5GZOA 1OSPH 1QRNA 4B9GA 1TTAA 4NO3B 2VDOB 2WUBL 2XN0A 2YLKA 4RAUB 4H20L 1WF5A 2FZ3A 2NUPB 5DCCA 1YMHB 5IHLB 5ESVB 3B34A 2GITB 3N44B 3QDAA 1QAWA 5J89A 5GGQH 1OPGH 5F1OB 1YJDL 3GZQA 2NNAA 2UZYA 3D18B 3DVGA 4AGLA 4FCAA 4X6EA 3S98A 2XDHA 5EBWA 7FABH 2I60H 3T4YB 2NX5D 1JHLH 1HU8A 1E9PA 1Z5LA 2AJSL 2Z31D 3CSYA 4HPHA 5I6OA 3QO1A 3W9EA 1N64H 1NINA 1XH0A 4U3HA 3S48A 1RZKC 4I0PA 1T6WA 4WI7A 5ALBL 4NM4L 4I48B 1P5UC 4JY4B 2P52A 1YC8A 4X6DA 2DIEA 1QSFB 4ZMYA 1QHPA 1HIML 3GKWL 3QARA 4OFVA 1IT9L 3ZW3A 5MENA 4N0RA 4Q14A 4QCIB 3QA3B 1KLFB 3RIFF 4CN1A 4FA7B 4R8WL 3KPPA 2DZEA 4QO1B 2K45A 3VFOB 1T4KA 4LVEA 4P46A 2VXSH 4UTCA 3EBHA 4XMWA 5IWLA 1LE5B 1KTJA 2BS9A 3VWJC 3NA9H 4L4TA 5GRWA 5MI0B 2FR4B 2BVOA 3RWGA 4P4KA 2FEEL 5I1GL 3WEBA 2VXTL 4EVNA 3TO2A 5HDBE 1PZDA 4JAMB 1T66C 4HC1L 3SDAA 2JWYA 4EDXB 3Q5YA 3DNKA 1YYLL 2VGLM 3BESR 4P05A 4YDIH 5D72L 2YQBA 3LPWA 2NY1D 3TFBA 3O0RH 1S78D 1JYWA 1URIA 1N6QH 1BV8A 4QRFA 1NBCA 1BVLB 1KCVH 2F68X 3EJTA 2VAAA 3MA7B 25C8H 3MLSL 4TSCH 3SKNA 1U8MA 5JIIA 5L8KB 4K3GA 3CIQA 1J1PL 3K6IA 2LR4A 1ORSB 2CLZB 2ZKHH 4KKBD 4PJAA 1YPZB 5SWZA 4AQ1A 2BW5A 5C07A 4ZFOA 3DYPA 3LH2H 3AACA 4R7XA 4KRPC 3NCYS 4PGCB 5DUMH 4F2EA 4JQIL 2WNGA 1PY0A 2FIRT 5LLIC 3EOTH 2QVIA 1HKLH 5IHWA 1TQBB 4KK9D 3SJVE 3IE9A 1DQDH 4HZLB 2PR4H 2HG5B 1G7HA 1JDDA 4ZMLA 1GJUA 1GPOL 4BQ9A 2EDYA 3WDHA 2P44B 3F7KA 3VQ2C 3NJNA 4PJGE 4QJ3B 3II1A 4UOQA 3UYRH 2OP4L 5MEQB 1Q9WB 1D6VL 2I9TA 1TZ8A 2B1HH 5EU5B 2RBLA 1FL3B 4H25B 2VDQB 2JCCE 4F8TA 3G5WA 4WEBL 2F74B 3CX5K 4JKPH 1DJGA 4BDVB 3WNMA 4DZBB 1FH5L 5LNDA 3GMMB 2J88H 2KUTA 3Q3GB 4PCYA 4RRPM 2EH7L 1I9IH 3WNLA 1FFPA 2C3XA 1P4BL 2UVFA 3BT2L 3T5WA 3ENEA 2IC2A 3OZKA 2F7IA 1YECH 4FZEH 5DJXB 2C7UA 4K3HA 2DM2A 2AANA 32C2B 4ZSOB 4I4WA 3CDFA 1DLHA 1NIBA 1XSIA 2Y07L 2CK2A 3TFKD 2R0ZH 3M1OA 2F19H 2V9UA 1M7DA 1ZWIB 3GRWL 4DP7X 5IZ7A 1PX4A 3NGBB 4ONGL 2YAPA 2XA8H 2PPCA 3PE9A 5DS1A 3VH8A 5SWQB 3LQAH 2ZXQA 5BZDA 1TYRA 3W2DH 4Z1PA 5CZVL 1A7OL 2ADYA 1EAQA 2JIXA 3RJOA 3T9WA 3ETTA 1IUZA 2NY3B 3BWZA 3SBQA 3LSOA 4YO0A 4CBZA 1J12A 2QGBA 1A02N 5KVFE 1F11B 2VN5A 2JKNA 4PGDA 2GFBB 2QSCH 1I4FA 2F8VA 1ETZB 5C8JA 5DO2D 4NKDA 2X28A 3RIAF 3M7FB 3GHEL 9PCYA 2IALA 2DDQH 1OSZA 5FYLE 1KDJA 3VXOA 2XJKA 3MACH 5I15H 3MOBH 1HH9B 3BFOA 3BVDB 2J72A 4P23A 5E2UL 3ZTDC 3PGDA 4ZXBC 4WEMB 2VJ8A 2MNWA 3C60B 4PJEA 2EZ0C 1S2EA 4OV5B 2WUCH 4U1LA 2X4OB 4F37K 1XEUA 4UCFA 2XPZA 4EI0A 3OD3A 3TF7C 4QTFA 3I84A 5C0CE 4LPYA 2DQCH 1A7QH 2DQEH 4JRYE 1F2XK 4JFOB 2PCFA 2WQ8A 3UROR 2XTSA 3PV6A 3MV9A 5IW1A 2PABA 5KWYC 1HINH 2EEBA 4WNQB 1UUSA 2F7QA 4ANKA 5I73B 1BD2E 1EHAA 5EC2A 3LVEA 3WTVA 2BSSA 2ZSVA 5GRYA 5HI4D 3OKNB 4J23A 1JSYA 2CDFB 3B5HA 4AIXA 4APQA 2ENYA 3L4WA 3FQNA 2LW3A 5BZXA 3ZE0B 1JXJA 3OF6D 5C0DB 3RZCA 1IAIL 2DLHA 4UTBL 5BZWA 1WDAA 4IDLA 1EEZB 2BJML 1KPRA 2C1PB 5D7HA 1KFAH 3TJHD 3TNNB 2Q8AL 5K1VA 3W0WE 1MQKL 4IOFC 4AYBA 2XFXA 4D8OA 1UATA 1TU2B 1DVFC 5DJYB 1YN6B 3UBFA 4U05A 1WHOA 3U6XA 2HVKB 5TE6L 3ECUA 3PP3H 1GAFH 3ULVF 2P8LB 4U3XA 4NN5C 1RJLB 4YHYC 1G6RB 3O41A 3ELAT 4IEFB 4MJ6B 2ODIA 3ZQXA 2C4FU 3L6FA 4LLMB 4Q2ZA 4ODWB 4Z3FA 1USZA 1J9QA 2NQCA