4NPKA

Extended-synaptotagmin 2, c2a- and c2b-domains, calcium bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
280
structure length
269
Chain Sequence
FPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSRVIKENLSPKWNEVYEALVYEHPGQELEIELFDEDPDKDDFLGSLMIDLIEVEKERLLDEWFTLDEVPKGKLHLRLEWLTLMPNVSNLDKVLTDIKADGLSSALLILYLDSARNLPSSNPNPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Extended synaptotagmin-2
publication title Structure and ca(2+)-binding properties of the tandem c2 domains of e-syt2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 53
structure length 269
sequence length 280
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4npkA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4npkA02
4FHKA 2YOAA 4WEEA 4TUUA 4FULA 3L9BA 1E8YA 3W56A 4FLHA 5EDSA 1GMIA 2Y3AA 1QASA 3DBSA 2CM5A 1RSYA 3IBEA 3ML8A 1E7UA 2NSQA 2YRBA 1DQVA 4FJYA 4Y1TA 2BWQA 1E8XA 3OAWA 4XZ4A 3PYCA 3TJPA 4BGDA 1V27A 4QJ3B 3L4CA 3T8MA 2FJUB 4FJZA 4TS6A 5CCGE 3R7RA 3ZIMA 2K3HA 3FBKA 5KJ7E 3IM1A 3LJ3A 4L23A 3TWYA 2CJSA 4ICWA 4DK5A 4GNKB 2NCEA 2K45A 3FDWA 4KITB 2CJTA 1RH8A 4XX5A 1HE8A 3JZYA 4EZKA 4XE0A 4MJJA 4F91B 3M7FB 4NPKA 4IHBA 4LT7A 1K5WA 4WWOA 2QZ5A 1E8WA 1DJYA 4LCVA 4NS0A 4HVBA 1DJZA 3W57A 3QJZA 4PS7A 3NZSA 4NP9A 2ZKMX 4EZJA 4FADA 4BFRA 2WXQA 2UZPA 4URKA 4G11A 4L1LA 4AJWA 4HLEA 2ENPA 2NQ3A 5H4ZA 3F04A 3APCA 4DNLA 3ML9A 4QAMB 2D8KA 4WWPA 3PREA 3ZVVA 1DJIA 1RLWA 3TL5A 4QJ4B 2CHDA 3CSTA 2WXOA 2DMGA 5JHBA 1TJXA 3HIZA 4ANXA 3QR1A 4AOFA 1A25A 1BCIA 1E8ZA 2K4AA 4JPSA 2RD0A 3N5AA 4WWNA 2FK9A 1W16A 5CCHE 3RPBA 3R7QA 4PS8A 4EZLA 1QATA 3L16A 4F93B 2JQZA 2A5UA 5T8IA 2DMHA 3P2BA 4KZ0A 2WXPA 3APFA 1TJMA 3PRZA 2K8MA 3F05A 2WXJA 3S2AA 4ICXA 2WXGA 5JHAA 1DJGA 1WFMA 3RDJA 2V4LA 2WXMA 1BDYA 4F1SA 4A55A 4FHJA 2WXRA 2LHAA 3F01A 4IQHA 3B7YA 2KI6A 4PS3A 5G2NA 3KWUA 2Z0UA 3ENEA 3QK0A 5H4YA 2QZQA 3NZUA 4J6IA 1UOWA 2CHWA 2EP6A 1E90A 4KZCA 4ANUA 2WXHA 2N1TE 3OHMB 1UGKA 1DJXA 4FA6A 2ENQA 3PS6A 1YRKA 4F92B 3HHMA 3F00A 1DJWA 2WXLA 3SD5A 4QJ5B 2A4ZA 1E7VA 1BYNA 3PFQA 1DSYA 2WXFA 3QAQA 4L2YA 4ANVA 3KWTA 4OVVA 5CCJA 3L08A 2Q3XA 3L54A 1CJYA 1W15A 1WFJA 2WXKA 2WXNA 2X38A 3CSFA 3APDA 2CHZA 3HN8A 4WAFA 3L17A 3NSJA 3DPDA 3QR0A 4GB9A 4Y1SA 5G55A 1DJHA 2B3RA 1UOVA 2ENJA 2ISDA 3L13A 4V11A 4NPJA 4LDCA 2R83A 2CHXA 4ANWA 2Q0ZX 3MJWA 4TV3A 3ZW3A 4L1BA 3QARA 3GPEA 2WXIA 4OVUA 2CM6A
chains in the Genus database with same CATH superfamily
1H3VA 4BH7B 3VXTA 1YMMD 1HINL 1KEGL 3D52A 2GW5A 3V5KB 2DKUA 3WHE1 4KTYA 3IU4H 4OCMC 4PJGE 2IG2L 3TXAA 3MMEA 1CICB 4MMXA 3BKJL 4TPRL 3GK8L 1FFNA 1KXQE 1GJUA 4LEXH 1IEAA 4J3OG 3CG8A 3QIBB 3HRZA 3KR3L 1PAZA 3WUWB 5C7XH 2VDLL 2VC2B 4UANA 2WVUA 2A7BA 3K1DA 2H0PA 4BGLA 1ZJAA 4GRWH 4NN6B 4M43H 4H8PA 3UZVB 4FYTA 5DD5L 3U6RA 2YPLB 4KDWA 3TA3A 1Y18B 4ODHH 2FYVA 3HE7B 1CXFA 1HEZA 4P5RA 4Z7UF 4DCQB 3FUMA 2E0PA 4XPTH 1IGML 3QDHA 1PLCA 3FQUA 5GGTH 4MDJB 2BIHA 4U7MA 4DKAA 1B4JH 1CT8B 3AUVA 4QAMB 5MEQB 1P4BH 2ADGA 5GGTA 3PL6D 2R23B 4GXUN 2X10A 4HJEA 4AOFA 3QZWB 2JKRM 1PZ2A 2XWJA 3SCMC 1BZ9B 3DA0A 3LKPA 1S7SA 1SOQA 3HZKB 3G3LA 1NGWA 2W60A 4W6XB 5JORA 2OR7A 4ZFZA 3BLBA 1KPRA 1CTNA 2H3KA 2FE0A 4NZUL 4Q58C 2WXJA 3SE3A 1A02N 1TITA 3EFFB 4JDTL 1E65A 5CZXC 2WXGA 1HNGA 1NGZA 2BP3A 3S96B 3EF7A 4GYBA 3GNML 1EDQA 1HI6A 2IF7A 2ZX5A 4O5LH 4S1QH 1FZOA 5CU5A 2HTLC 3SGDH 4UNVA 3ZYIA 2WUBH 3PWUB 3BQUC 3UTTD 2GTWB 5JYMA 5INDB 3RNKA 4HK0A 3HUJB 4I3RH 1SM3L 3HI6L 2WKOA 3FCSB 5E5LA 3PS6A 2GHZA 1UENA 5AWNH 4HPYL 3GSUA 3MUGA 4LCWA 3ZL4H 4OM1H 8FABA 1J9SA 2IMMA 3Q43A 4WUUE 5DFTA 2R56H 3DJRA 2CCVA 2FX7L 3F7VB 3RWJA 4HCGA 2ESVA 1SN5A 2YD1A 6PCYA 2WGXA 4QTIH 2GTZA 1H3TA 4P57A 2UY7A 3V6OC 2WLKA 4OV5B 1P7BA 1U8CB 4WJ5B 3T5WA 1JPTH 4G8GB 3DBXB 4NP4L 1P7HL 3U0PB 2GK0A 3FUEA 5B1BB 3WDJA 4FNLH 3O8XA 3QUZB 3ZHDA 2PXYC 2AJSH 4UZGA 1WAAE 1MI5A 3MV8D 1RZKC 4JDZA 4XXDB 4PG9B 4ZX4A 4H13C 3T2NL 2KC0A 4K94L 4G3YL 3O6FA 2NW2B 2JJTA 2UZYB 2G3NA 4HXBH 3P30L 4WUKH 4LVHB 3C60A 5FV1L 2FATH 2OMZA 4BE6A 2ZKYA 2AJVL 2EKJA 3BP4A 3K7UA 4JM2A 4V1DA 2O26U 3L3HB 1GY1A 2XDHA 1IC4H 1G4MA 3A0OA 3GI8L 2APVA 3D85A 1Z0NA 2YIHA 1FN4A 4NKOA 3M7FB 4FAAB 4YO0A 4KRNA 3MLVH 1LO2L 2X1PA 1PTZA 4GRLC 4KQ0A 15C8L 3LH2H 3NMEA 3QH3A 4LLQB 5FUCE 5GJSH 4Q74A 2WY3B 3CUPB 5A2FA 2YN5A 1UH4A 2QGDA 4NKMB 2JJVA 5GS2D 5AOIA 3HE6B 1FAIH 3JV6B 3VWKA 3GMMA 4OM0H 4C56D 1KGUA 1LLAA 5HDBB 3IXTB 4WKZB 2MTPA 2AQPA 3QW9A 5HHXL 1BF5A 1SY6H 1B0RA 1WFIA 2ATKA 2Q7NA 1HSAB 3PNWB 3HVDA 5BVPL 3M07A 5CEXB 5DYOA 1VGKB 5JHDE 1I3GH 3MJ9H 1UXMA 2VDRB 1SY6A 1E2ZA 3QIWD 1G9NL 1IGCH 1PY4A 1OWRM 4LARH 2BIOA 4NO0A 4G7RB 4EKXA 3MJ9A 5EF3A 3OAUL 4J5VA 3I3BA 2E75C 2IWFA 3HPJA 4JK0D 4B97A 3RGHA 3ARQA 2LLNA 3EXLA 3QXWA 4NB7A 3Q7JA 2CH8A 2WZ0A 4FZ8H 4U1GC 5IB4A 1JYNA 5F3FA 2BDNL 4OLEA 4RFEB 4MZRA 2CWRA 3VNYA 3WLWD 2V2WA 4YSCA 4LKXB 4FQHA 4FA6A 1R46A 3BAYA 4LLYB 4PRPD 4ZMPA 4N2DA 4IK7A 3P4NB 3AREC 1BJMA 2EECA 1RURH 5A43C 5I71B 3ARZA 5E9DD 4P5TD 1AYOA 2DBLH 3BZFA 2WWMD 3IETA 1DJSA 5TF1L 43C9B 3UG5A 2BNQA 3DHMA 1XL4A 3L54A 3VQMA 3K4AA 5HI5C 4AIXA 3OMAB 4FQ1H 1A7OL 2VAAB 4A2HA 4LDOB 5GGRY 3GSNB 5DMKB 2DQCL 4E9XA 2MCPL 5J6HB 5HPMA 3F64A 1UJTA 4DHLA 5IHBA 2UUDK 3MZGB 4O4YH 1TG8A 1CD0A 2VDNB 2V9QA 4UNUA 3VG9B 4GBXD 2YFNA 4EI6A 3NRQA 1TEFA 4FQXA 2CU9A 4GW4A 3IXAB 4ETYA 4J4PD 2ODHA 2UYLB 3BEWB 1DE4A 5FYKD 4FJYA 2C9QA 4OKVA 5EZJB 5JIHA 3KPQA 1E8XA 1FH5L 1E0OB 3E3QE 4HK3J 4K7PY 4K7FB 3X1BA 1HHJB 4JO4L 3AXLA 1PS3A 4LOFA 4N5UA 3VFWA 3EO1B 3C8DA 4XOBA 5KBMA 5JIDA 2X4RB 43CAA 5B4MD 1NCCL 2QPDB 1WBXB 5LG1A 1B0WA 3E8VA 4X5PA 2FSEA 1EHXA 4IU3B 2AK1H 1JZ4A 1WS7A 5D2NB 1OM9A 4J3OF 1NLDL 3ZE2E 4OJYA 5ETUA 4TTGA 1CGUA 1IO4C 1NCIA 3L7FB 2XIIA 4HU2A 1KTBA 4KXZH 4TSBL 1OD7A 3ZHFA 4R0LB 2JJWA 5FCUH 4I0PA 2OW7A 1H8LA 4F1ZA 5JZ7C 2EKSB 2J8UE 1FVDB 3MBEC 1E6JL 4JFFA 4O58L 1DEDA 2ZWYA 3JWNE 3E2HB 4YH6A 1QSED 1PYWB 5KWYC 1RUKH 4PP1D 1OAJA 4AGOA 4UM8B 3I75A 3DGDA 1QLEL 3W2DL 3WJMB 3SJVE 2J43A 4FYQA 4L3ED 2IFFH 3PQYE 4M48L 4DPCX 3MRFB 3CFMA 3MCYA 3FT9A 4MQSB 4KKCD 4PIBA 1UM6H 2H1PH 3BCFA 4PBWD 3NCJH 3DECA 1U91B 4ODUB 2ZOKB 1WRFA 2ZYHA 1C12B 4R96A 1LE5A 3GIZH 3K2IA 4KZEL 1IQDB 5HGHB 2EINB 3S48A 2R1YA 2EIKB 2RGSA 3U4KA 5E5RB 4N3TA 4OD3H 5ABZA 1W9XA 3NCMA 4F92B 2I26N 1TQBB 5HYFA 3G7TA 2N3JA 2FT7A 3LKNA 5A6LA 5J11B 2JKLA 1WHPA 4XO3A 1UM5L 1HHKA 1FWXA 1E43A 5DEFA 1F4HA 4KKLD 1CICD 4X99B 4Z7WA 4DKTA 1F45A 4FXTA 4CDHA 3S8GB 1FRGH 3QIBD 3GMQB 3IFPA 4ODSL 4ZYKB 2R83A 4EQ3A 3TBTA 2XWEA 4XCNB 2PP7A 3N0PB 1N67A 2IAMC 2YPLD 4PJ8C 4POUB 4DZBA 1J8HE 4A38A 3HE7D 3TU6A 1U8MA 4D3CL 4E5XG 4RZKA 1CMOA 3W56A 1RP9A 4NN7C 4NQEA 4FLQA 1GW6A 1CDIA 3DO4A 4UNIA 1I9RL 3MRJA 3UJIH 1KLFA 2BZDA 4JGUA 3TZVA 1OAXL 3QDME 4Y5VA 3RI5K 5DGQA 3M6DA 3V8CA 3QSKB 3EH1A 4L1TA 4F7PB 3DPBA 5KSBA 4RGMC 3LPOA 3UBGA 2XKNB 3H7LA 1SBSH 3QYCA 3M46A 2ZXQA 1A1NA 3VFPB 4YSSA 1NCJA 2OMUA 3B3BA 3INOA 4L1DA 1AG0A 5C0JB 1U8LA 4H8QA 3CVBA 4U1SA 3EYVA 1F4YH 5BRZB 1L9PA 5D7IF 1UB5B 3QFGA 1QSFA 3S37X 1AQDA 1R19A 2ZWLT 4F8QA 1Z3GL 1NFDF 5I23A 4TVUA 5CJOL 2V2XA 2HMIC 2W9EH 2FWSA 1PZ3A 4NWUH 3SYOA 1SOXA 5TF0A 1D7FA 1KIRB 3D39E 1IAMA 4C83A 2NPLX 1UZ6F 5G5DA 1TJIL 2A6DB 3S37H 1LO4H 4MDRA 5C92A 1LTXA 4OLYH 3R1GL 1Q90A 2OJEA 2VDKH 1KACB 1WTLA 2I9LA 5C6TH 3N2JA 5I74C 1SFHA 1OSEA 4GT0A 1WJ3A 2DM3A 3AM8A 5E2UL 3NA9L 1F3RB 2NY5L 1IMHC 5DUBA 1KIUA 1ORSA 2PF6A 2FQDA 3T4AC 1TZIB 3HR5A 4Y4KB 1HOEA 1QHQA 1BQKA 2AEQH 5BVJB 4NO2B 3IDYC 2LGNA 3B7YA 3IPFA 2QSCH 2DH2A 2A1WL 3VXSA 4AL8H 1YN7B 2EP6A 4CSZA 3TBBA 5IW1A 3BE1H 2DWSA 4LL9A 5F0PB 3SKJL 4WY7L 1GYAA 4F7EB 3LHPL 1YJDC 1YYLH 5KYXB 3QPXH 3LV3B 4AENA 1C5DB 1F6LL 4BUHA 3MTRA 3BUIA 5JHMA 5DHDA 1MCSA 3QUZD 2XN2A 3TH2T 1IJ9A 3KJ6H 3NTCH 4LCCA 1T5WB 1SYSB 4IKNA 2K9UA 2FYYA 1Z3RA 5FM5O 1IFRA 5HVGB 2CBOA 2HP4A 4WAFA 3D69A 3PHOA 4MZ3A 4GO8A 4LOUD 4S1DD 2FWOB 1ZOXA 5HGAB 1JJUA 4MNHB 4PJDA 1L5GB 4F58L 2C3VB 1JCKA 3F7KA 4G7SB 1SJEB 3S36H 4DP5X 2JTYA 4WHYG 1M1XB 2R4SH 3IFOA 5DDHB 4Y2NA 5I6OA 2IOMA 1RU9L 1L9TA 5IM7B 1H19A 3ARDC 4LHUA 3BPNB 2V9UA 3QAZC 1Z9MA 3VI4F 1NCHA 9PCYA 3CDZA 1T21B 4YBLB 1AHMA 1LO5A 4GRWE 1QASA 3HG5A 1CCZA 1KYOJ 2NX5E 4IRSB 4ADGA 5HBBA 1NINA 4R2GB 3Q48A 2WWOA 5DZPA 2VZOA 5KW9L 1I1FB 2XWCA 1GSMA 4DGIH 4Z7NB 2Z8SA 2ALAA 1V7MH 1T22A 3V10A 3HE6D 4HJGA 2BCKB 4S0TD 4KGLA 3K8LA 4JHBA 1G1KA 3PY9A 3QEHB 1DN2A 1QR1A 5J1AB 4UDUB 4GINA 4PJHA 3FO2A 1PVHA 3ZL1A 4A2MA 4B7LA 4DP1X 4AVHA 1CL7L 3VXME 3ZN6A 1NJ9B 3QEQE 3RIKA 1CK0H 2JCCA 1RLBA 4RRPA 4NNXA 4KJPC 3SDDC 1A2YA 2E9WA 5AD0A 2GIMA 2PKDA 4KJWD 4KJQD 4HLEA 5J5EA 4KHXH 3KM2A 2P8PA 1RV6X 3OD3A 4IMLA 4KOCA 1ES0A 2A9ML 3CFDB 1HDMA 2DQMA 2ZWKA 3FB7B 4GQPH 2WLMA 2IBZY 2QDVA 4DN3H 2FIKB 4UWQB 3UPRB 5DJXB 4ZW5A 2Y7LA 3R06B 3HMXL 3G08B 1K4CB 3ECWA 3WTVA 4TUJA 4PJCE 3SBQA 3D0LA 1OO2A 2J5WA 2PYFB 3H85A 1S7RB 2Z93B 1FNGA 5D70L 3CZUB 5KYYB 3SOBH 4KUZL 3ATDA 4NZJA 1E5BA 1HILA 2WWKO 3CVHL 3FUDA 4LCWE 3HBZA 2IPTL 3EGDA 5BUAA 1CGVA 4APXB 3GLZA 4IKKA 4NLAA 5E08H 2EE9A 1R24A 2YJQA 5H94B 3T6VA 2EYSB 4JL2A 4EEEA 1J0HA 2Q8BL 2V4LA 5IROC 4YX2H 2R8SL 3W9EB 4PGZA 4BA8A 3F12A 4IU2B 3FH7A 5EF2A 1P4LB 4OCRL 3HNTH 3HJ0A 4QRTA 3AS0A 5DZJA 3N40P 1ZHNB 4OIAA 3SZ6A 4JGNA 3FSVA 3K4DA 2GEQA 25C8L 3MODL 3H54A 2WQWA 1H3GA 1TCRA 3VD7A 3IU3B 2HFGL 3WEOA 4UQDA 5HY9B 2HFTA 4W1TA 2ZAIA 1T7YA 1IT9H 5EOQL 4ZAKC 4RCAA 3CHPA 4UV4H 4X6CF 2XA8H 1SDDB 4BKLA 5IMOB 3I9AA 2MQGA 3S8FB 2A0LD 3LEXA 3NFPA 5B39G 3FQYA 4H1LG 3FT3B 1FVEB 2BOBA 4IOIA 2IWEA 2PR9A 5I5RA 4GB9A 3S35X 1R9FA 3FU6A 1XMEB 2UZXA 4L5FL 2YMOA 1L9SA 1KSRA 4UB0H 1ZV5A 5DJDA 2OPCA 1CLOH 1F0LA 4WI3A 1CZ8H 1QW9A 1XGTB 3UO8B 4XTRC 4WFED 1R3LA 1AQHA 1IB5A 2XFGB 1C08A 4PJ7B 2L8AA 5LLIC 3MNVB 5HPOA 3IDJA 5DEJA 1DZ0A 4DGVH 4DPBX 1KZQA 2Q7AA 5D4IA 4PLOB 4WI4A 4BYHA 4XOAA 3X13B 32C2B 5T5FH 1Q9WB 3A4AA 1ZD6A 3MV9A 4X5XA 3T3PE 3GBEA 3TF4A 1U3HC 1GCFA 2PXYB 3HG1B 5JPNA 2X9XA 1DFBH 5FGRA 5E6ZA 5T5FA 5BNXD 1ZRUA 4CN4A 5IIEA 1AG6A 4M1DL 5IBUB 1KCVH 1SUHA 3O41A 4KBPA 3JV0A 2Z0BA 4OJFH 1TJHL 1QO3B 1MQKH 5GISL 3SQBB 3LXCA 4EOWH 1JXGA 2FEDD 2O5ZH 1Q94A 2X6MA 1BXXA 5ITFA 3QUMH 1VFUA 5JXAH 4LPTA 2ENPA 5IR1A 1Z7JA 5MEOA 4G1MA 2XICA 4M7LH 3QUMA 3MLTA 3BW9A 1XH3B 4OB5H 2AXFB 4LGRB 3NOIA 1O75A 3QZPA 4M7ZC 3BVXA 1UXSB 3ZKXB 3QI9C 4GRLB 2W0FB 4ES8A 3WHXA 3AS3A 4HS6B 5INCB 2WYTA 4ZBJA 3OLGA 4L37A 2P28B 3LN9A 4F93B 3B9KC 2C7UA 3H7BA 4JZJA 1T20B 1Q0XH 3Q1SH 3M1BB 3B56A 1QQDB 1NDGA 4CU8A 3T77A 1VRSA 3FN9A 4MA3B 4LNVA 1JK8B 1AD9A 3UBHA 2NW3B 3PWLA 3NN8B 1PF3A 1KENL 4ZX6A 1HXMB 4L4TD 3IDGA 5FC9A 2YEVB 3U2SA 1ZSHA 5IJBC 3BKCH 4NUMA 4HWUA 4XNUH 4BEIA 3UTSB 3NPSB 5CLXA 3BGFC 3SBPA 4XGZA 1ZCRA 1NGQH 3QQDA 2EUZA 3SDAC 3GZPA 3IYLW 3FQRB 2FR4A 1S8DA 5D1ZC 1VZGA 3TJEL 3DVFA 4N1EA 4WJKB 5D5MF 5AVXB 2XI9A 1GZQA 3ZZSA 4UOQA 1R33A 2XVKA 4U1GB 4K23L 4ZFGL 3PWNB 4XNAA 3DXAB 5KANG 1IGYB 2R0LH 4C47A 5J3HC 2XQBH 5F7HA 1U3JA 4FG6D 2Z4QB 3HUJF 2XG5A 2CK0L 1KGIA 3AREB 1SNRA 4QRPB 4A04A 3R19A 5JIQA 3JWOC 3CZKA 5F7AA 4YNYA 4LBEB 4FHKA 1KELL 4FFWD 4HFWA 4LFHD 3QXUA 4LLMA 1BXUA 3LB6C 1IU1A 1YY9C 4P5KA 4F57H 1NTDA 5BRZD 4WQOA 4LGPB 2VYRE 5GRUH 5AW6B 4BFOA 1K3IA 3SGKA 4NRXA 4EDWH 2Q86A 2R0ZL 5EBLB 5TK2A 5DVMA 3MRHA 2HRLA 1XBDA 4M6MH 5I66B 2XZCH 3ZTCC 4X6BB 4N25A 2J7LA 3DUUB 5DJYA 3OF6A 3IDXH 3Q5OA 4N9OB 4EN3C 4YOKA 3HAEB 2VM4A 1K85A 3PWPA 3EBHA 3K72A 4ZPVA 4HSCX 3LKSB 2AHIA 4K9EH 4I9WD 4UQ2B 1FLTX 4Y4KD 4N6RB 3WJLA 4Z0XA 2GT9A 1KCSH 2QFRA 3ISWA 1VA9A 3X1EA 3X14A 1WEJL 1NFIB 4PVLA 4Z3FA 5TDPB 3GBMH 1PX8A 3HMWL 3U82B 4JS7A 4GAJH 4A6YH 4MA7H 3TT3H 3MXVL 1CYWA 1JN6A 4ETQA 5CJ8A 2C4XA 4K9JA 4Y1AB 1PSKH 5AVUB 3S34H 3VXQB 5KSAA 4Y9FA 2I9TA 1L7IH 1MCHA 4A6YA 5BS0E 3MLUL 3KDMB 4YR6A 1KYUA 2F9BT 4MD0A 5MI0C 4N5EC 2GC7C 4N20A 5HDBF 5TQ2L 3VD3A 3FYIB 3OX8B 5B8CC 1HHGB 2GCYA 2WN2A 3FT0A 4JFVA 1N26A 4QNPE 3NSXA 1JDAA 4JFQA 4YBQC 1L3NA 2GJRA 2EIZB 1M7DA 5G4OA 1FCGA 1V10A 3HBPA 3MYZA 2J56A 2WVTA 3FQ1A 1X5GA 1JYWA 2ZUTA 2JFCA 1M7UA 1NDTA 3HC3H 4ELMB 1OGAE 1QMUA 1AFVL 3DX6B 3CQPA 1O9VA 3DHPA 3QRBA 1GYWA 2OSYA 4HQQH 1JGVH 1IAOA 4IRSD 4M7KH 5FB8A 4R2GD 1KCUL 5CEZD 2XN0A 4NQEE 4MQXC 4NZTL 4A68A 4WU5A 5CBAB 4XC3L 1J8SA 1XGPB 2NYYD 3H3PH 4WNSA 1OF2B 4U7KA 3VXPA 2H6PA 1SN2A 4QKTA 4ZUSA 1WWCA 3B2VL 5BXFA 1QHPA 5KSBE 4MDIB 4U6HB 4KITB 5D72H 1O6SA 2YUZA 2B1HH 3CZSA 4LESA 3S4SG 2A73B 2R69H 4JDVA 2DIBA 5FUCC 3WE6B 1KB9J 2V2TB 4AVIA 2Z64C 3VQ2C 4TUOA 3QXDA 2R69A 3TV3L 4LASL 3UZEC 2H41A 2E7MA 1OE1A 1JGLH 2JB6A 4YDVA 5AAMC 4IGBA 4Q0XH 2IAMB 3BO8A 3GO1H 5E8DH 4P46B 4DN4H 2WQAA 4AUYA 4PJ8B 2N4IA 4XB3A 3IDMA 2C34A 2IH3B 3LQZA 3TEZA 5DR5H 4MWFB 4XBGA 4XP1H 4J28A 2DLGA 3ME0B 2YEZB 2BC4B 2WTOA 1H0DB 2CO3A 1DVTA 5ANHA 3WDIA 3QQ4B 2IH9A 5JXEA 3VI3B 4LAJH 2FJFA 5J06A 4NP9A 4AQ1C 2C7FA 3GZQA 4QHNB 4K3JH 4HBCL 1GOGA 2EDBA 4AM0Q 1KYOK 3OXRB 4AZ8B 5JW5B 1NC2B 2OMXA 3H53A 5E23A 1T7XA 4ACTA 1XAUA 4H26A 3ZVVA 4PJ5E 5IJVA 4KQ4L 1BX2A 1IEBA 3JT0A 3T2LA 1ACZA 3VRIA 4FEIA 4LU5L 4KKAC 5ICYB 1UT9A 4JO3L 3ZKMC 4NRYB 1F3DJ 2VLKB 1YPZA 4ZW6A 1B90A 3BFQG 1TNMA 4APQA 4CADB 1HL5A 4KPHL 4DEPB 3SBWA 4R26L 1PFCA 1A6TA 4GO6B 2B7DT 3WNNA 2AMUA 3BQUD 5FYJL 2MMXA 1KN2H 4QKXB 1T6VN 3IDNB 1HHIB 3QK0A 5K69A 3EF4A 4KVNH 1FORL 3KLQA 3ZYZA 4R7XA 2CNYA 1PNCA 2IDUA 2DQUH 1UT1A 1P9MA 5C0BB 3VGEA 3FYEB 3STZA 2BINA 1HCYA 1KGCD 3RL2A 3WL9B 1G1YA 3T8XB 1OF0A 1YJDL 3A6CH 2ZKHH 2Q7YB 4XP5L 3IDYB 2ITDA 1WIPA 4UIMA 3E3QC 4N3UA 3BH9B 3DWTA 3QCTH 1MHPL 3I6LD 4XPAH 4O02B 1UURA 4B50A 1RJCA 3V7AG 4WHTA 1ZIAA 3KXFA 3VTTA 1MCWM 5GSRA 3L9RB 3DOIA 2J73A 1B2WH 2G30A 5FM5M 2PXYD 4FG0A 4JG0L 3HG1D 4JAMA 2DLFH 2J25A 2ORBH 2BP5M 3FB8B 1CGXA 3VRLF 3D30A 3VGGA 5H37G 3PV6A 1U58B 4DT2A 4NZDA 3N42B 2W9DH 2JCCE 1LDPH 2AQ3A 1XMWA 2BSEA 1XCTB 1HYRC 2ZG2A 1Q72H 3BJ91 3DV4A 3T0AA 2VQ4A 3UJJL 2O61B 4HOXA 2CJUH 1RULH 4GXVH 2MOQA 3VFGH 4BFNA 4NKDA 2WNWA 1VPOL 2CE6A 1V3KA 4Z7UA 4UCFA 3H1ZA 1IAIM 2W88A 1VFAA 3H55A 4L29A 2VN5A 2YA0A 3STLB 2VH5L 2WCPA 3HCVB 4PRHB 1KGXA 4M6NH 5I9QB 3JWNC 4OLXL 1THAA 2LU3A 1GAFH 2VDOB 1QFWM 4N2EA 2VXQH 2P1YA 4GRLD 3FCGA 4KX9A 5F7UA 2X6CA 4LF3B 2AI0L 3R4RA 2E6PA 2GEEA 4OD1H 5L8KB 3A4DA 3U0TB 4HV8B 3LZFH 2J12B 1G84A 5CHNB 1F02I 1RQ5A 2PW1A 2VXQA 3VXOB 3FO1B 5IWLA 5HP5A 4BFRA 5C0DA 1NEUA 1KJ2L 5A6MA 3KCWA 5C86A 4YMPA 3MROB 4GI6A 3GXFA 3EYOA 4YL9A 3ZGIA 3PIQA 3GB7B 1T2QL 1X9QA 3HW7A 1WDAA 3GI9H 4I48A 4JFZL 4CJ0A 4Z76A 4Z7OB 1GZHC 4YXKL 1IGJB 1PY0A 4NXKA 4PBVC 3SDDB 4OFYA 1K8IA 5ENWB 3SKNA 1R5VA 3QUXC 4N9GB 3UTSD 5E00B 1QATA 3BP7A 5T3XE 3U0WL 5E2VH 2P5EE 3C5ZC 3EW3B 4G6JH 1C16B 3BUYA 5PCYA 1U8PB 4K8RL 4U6XB 2MHAB 3RFRA 5CLWA 1YZZA 4UQEA 5I16A 4UT9H 3RI5F 4DQAA 2FD6L 1XF4B 3FO0L 4DVRL 5ACZB 3NQIA 5SWZA 4LEOA 3BQVA 2O5NA 4GH7B 4N2AA 4UT9A 2HTKC 5IW6A 2AJYL 3BPOC 2BHZA 3WN5A 3P77B 2VITB 1HKFA 4GAGL 3TYFA 4UM9B 1FSKB 3GXTA 2IH1A 1T04A 5DJZB 3ARED 4QRPD 5IB1A 4WTZG 3SE4A 1NUGA 3KYKH 1CPUA 5EO1A 5D1XC 5HI5D 5AZEL 4AQOA 2CDEB 5I8KL 3IMUA 5H2BA 1JHLL 1U9KA 4W81A 4NRZB 3J7HA 3KHQA 4UTBL 5DHVH 4D0BB 1N6QL 4BK5A 1EAPB 4RA3A 3GDBA 2PCPB 3FBQA 2NT1A 5E5MA 3SKOA 5CBEA 1LK2B 5DHVA 4LOEA 3V0HA 2X6AA 1H6TA 5EU6A 1UA3A 4IJTA 4X5WA 1BMZA 1SXAA 4ZOCA 1Q9LB 1TVHA 4P4RB 1ZS8A 4HGMA 4QIRA 2OTWB 2D7QA 1IKFH 4TQEH 5E8EA 4RMWA 4ZPTB 2EUXA 3GHBL 3K4ZA 1YEFL 2LQRA 4F8PA 4O51B 3IGAA 3DX9A 4G8IA 3PE9A 4IIQA 4PJEB 3RNQB 2HB0A 3HZYB 2VOTA 1KEMH 4ZUWB 5T3ZL 4K3DL 4WI6A 3BSZL 1J0KA 1E4WH 2OJZH 4A7QA 5CZKA 3B2UC 5CD3B 4S1SH 3L1OH 3WEAA 3DHJA 1Z9PA 3O4OB 3TO4C 3UBXB 4D2NA 5ID0B 4FQIL 1BAFH 2L7UA 3ZX1A 3QRGL 1KNOA 3RWFA 3NYKA 4JRYB 4M5YH 4G83A 4MTMA 4KVCL 1HFUA 3WFCH 1X5MA 2V9RA 1UWEH 1U8NA 4WDIB 4PR5A 4PVMA 4U1HB 4X5LA 1OEZW 3HI5L 5FHAH 4Y1AD 4KXCA 3CZLA 2L7QA 1AXSA 2QKIC 2OYPA 1E27A 4Z7NF 1N3NA 1QKZL 4A7SA 2CO6B 3KEDA 3SGDI 5JZ7D 5KBLA 1U3HB 4UDTB 3MBED 1QBML 2PETA 4FFVD 1FL6B 2BIIA 4AEHL 3ULAB 5D7JC 4M6OL 1M57B 3CXHJ 4GAYA 2C1OA 1AHWC 1GHFL 3HIZA 3PGFL 1DCEA 3O3AB 4PVBA 3FNKA 5I75B 1MQ8A 4M03A 3FOMA 3VVWA 1U8KB 3RY6C 2FJGA 3RZWA 3BZEB 5D71H 1XZ0B 4LSDA 3VWJC 4IMKA 4Z77B 4DKFH 1WFUA 4ODXB 4XO9A 3UJTL 5C0AB 5AVTB 5F0LB 2AK4B 3NEOA 5IJKA 4RQQA 3BEVA 2X88A 4JZNB 1VF5C 3BD5A 4NQCB 4JFYA 1B0GB 5TK4A 1S7XB 3QI9B 4DTGH 5CIPH 2VDPH 4QRUA 4CC0A 4FHJA 1FNEA 1P4IH 3BKMH 4PRAB 5GRJH 1TQTA 3FCTA 2GQHA 5ITBH 1XX9C 3ABLB 3SY0B 3PXLA 5CIPA 3NAAL 3TN0C 5KVFE 4NSKB 4HJJL 1A8ZA 4HHWA 4UTAL 5GRXG 5I1LA 4J1UB 1YEIL 4P2OC 5JUEL 4YIQA 3G5WA 3LEYH 1S7TA 2GUOB 4YDZA 2HKAA 3O2DL 1N8ZA 2SODB 1YEKL 2A4ZA 4NQXA 4F8LA 1NBYA 2C9PA 1UWXH 1WS8A 3I6KB 5EU4B 2L7JA 1TJGL 5A6IA 1RUMH 3EGXB 3JT2A 1MHEB 4RAUA 2W1NA 3OKMA 1USZA 4YDKH 1T89C 5HYSG 3K6DA 4GQ9H 5E6RB 5I1AA 1UD5A 3BGFB 4D7PA 3SN6N 2QGEA 1OT4A 2FO4B 2VDQB 3P9MA 2PCYA 1KPUB 2EE6A 2IAMD 2RFXA 4FGMA 3BWAA 5CAYB 4P46D 5D1ZB 5AKSA 3WSQH 4PJ8D 1RHHA 4HIXH 5KVMC 4NPJA 1T03H 3F7LA 4L1BA 2WSDA 1XSIA 1AD0A 1TSHA 3B43A 2EILB 1T5XA 1TNNA 4MJIB 2QVIA 3JWOL 4PWFA 4G70B 2EAEA 1I3VA 4ZO7A 2AJZB 1OCWH 1KDIA 3GUFA 3S3JA 2Y7OA 5F89A 5SX5K 3X3FH 2ZOUA 4J3OH 1GY2A 4LSSL 4XZ4A 2PWHA 4QRRB 1NC2D 1T1YA 2EVJA 4F37K 3GRGA 1IGTA 1L7TH 3FDWA 1JGEB 2UXVA 5JO5B 3GGWA 1F4AA 3CX5K 3QFJA 4J3SA 4ALAL 3I6GA 4MBRA 1DQDH 4GIAA 4PJ7F 2DQFA 3F7YB 1YNKH 4YFEA 2HMID 3ARRA 3JTSB 2N7SA 2P9RA 4PM1A 4WV1C 3OG6B 2V3DA 2QHRL 1HJBC 4AT6A 4XNYL 3DGGA 3U79A 4BH8A 4O2FA 3T09A 3UYRL 3QWNA 2EC8A 2DM2A 2O5XH 4Q2ZA 2ZTBA 3CN4A 3WI9A 4B27A 1SEBA 2DMGA 2EIDA 5DJ2A 4EN3B 3PU7A 5IGXH 4MYWB 1RZJC 4N8VG 3C6LA 2V17H 1I8KA 4HYTB 4X4KA 1MLCA 3KWXA 4PJAF 4ZS7L 5C0BD 1CWVA 3II3A 1EXGA 4XHQA 3MVSA 4FF9A 3A67L 1KB5B 2GIXA 1U8HB 4E5XB 3MKGA 3ALWA 3WIHL 1G7PA 1QRNA 2F2HA 3O3UN 2J6WA 2NY0C 2WLIB 1J18A 1IJNA 3F5WA 3ZT7A 3X11B 3ARSA 5E94B 4U6YB 1FZJA 4Z3GA 5C07A 3Q9PA 4AYSA 2AEPL 5SWQA 1FZMA 2N01B 2VR3A 3RWIA 2G2RB 2ZWZA 3MFFA 4NPYB 1SUJA 2HKHH 2Y06L 3D0VB 2QMJA 1TF4A 4P9HC 2C9AA 5EEWA 5KYWA 1P5VB 1Z2KA 5B8CB 2H45A 4FL4C 1LMIA 2EDKA 3FUFA 1YY8B 3OXSA 2PTVA 4KY1L 5FGSA 2ICEC 2KZKA 3NRPA 2GJ6E 1N7ML 5F9OH 1GXEA 4WNQB 2R0KH 2XWXA 3CSFA 4G9FB 1ONQB 4NZRH 3FTUA 4FC3E 2OMTA 4Z95H 3GJFH 1Y0LB 2L3BA 1I1CA 1HYSD 3ARDD 4X9YA 4PRHD 3CMOH 4KO5A 3SDXB 4ATWA 1BIIA 4ZQKB 5DVNA 3VGAC 4GG6F 5J12B 5EA0L 1HIMH 3GJFA 3QJZA 4O9HL 1U6AH 4J12A 4OGXL 4OW6A 3I2CL 4HKBB 4TVPD 1LM8V 1P84K 3O6KH 2EXSA 3BAJA 4YDJB 4KXZI 4W9ZA 1YNTB 5L2KA 4QHKI 1BAGA 5J4MA 1O6VA 2QTVA 3RTQB 3FH8A 4JPWL 3I9GH 4N2BA 1V27A 3B7RL 4LPWA 1MG3C 2UZIH 4Y5YC 4DQOH 3CD4A 3MJ8A 1S2EA 3VD5A 4OV6F 2E7CA 4U1NB 3SDDD 3EH3B 2Y2WA 2F53B 3AB0B 4UZUA 2Y9RT 3IJ8A 2ILLA 1T1WB 1OM3L 1RK1B 1FBIL 1I8IB 2EYTB 1B4LA 3COOA 3TYGL 1T6WA 3BVNA 3FQWA 1ZXKA 3QYMA 5JNYA 2EEFA 5AW5B 3E7JA 4HK3N 4FQQB 3X3GH 4RMRA 4A7VA 2KERA 3CSGA 5CSZA 4X98B 3K5RA 5MEPB 4E36A 1FF5A 3L3OA 5D7HA 1MH5A 4PJFB 5FEBA 4UM9D 1L3WA 5TE4L 3D34A 1GA2A 4I5BA 4AQ1B 4AMXA 4J3VA 2DL9A 3CFJA 2X9ZA 3GTVA 3OAZH 4K15A 4R97B 1TOXA 4U7SA 4B9FA 4E42A 3L5WA 3CLEH 2ED9A 3BWSA 3CH8A 4M7JL 4PRNB 4QRFA 3T4YA 4F8OA 1JZ6A 5J89A 1S9XB 1F1GA 4KHTL 2VDML 2XV0A 5DMJB 5IROD 2A77H 1KIPA 3N1GC 3VXUB 1NPNA 3U7YH 1HH9B 5GS2H 1O7DE 4NO3B 2V8LA 4CILA 3OKDB 3TLRA 1UWGH 4KV5E 3BDXA 1QW8A 5KVGH 2CLVB 4M3HA 4Z7AA 2WVVB 3U30C 1BVLA 2EEDA 2NNCA 4GKLA 3MACH 5FKPA 2YUVA 5LN4A 1DLFL 1E90A 1YDPB 3U83A 3WJMA 4A2DA 3THMH 2F54B 3KXFE 3PHSA 3V0VA 3MBXL 2W59A 1IC5L 2CMRH 2YXWA 5ALCH 1G6RL 3MRCA 4XMPL 5FWRA 2COQA 4RH4A 5HD8C 3OTTA 1CFVH 2Y2TA 3EYQC 4CRPA 1T7VA 4B95C 1KYAA 3PJSB 1K4DB 3KCPB 4XXWA 3HS0A 4HDIB 4WZ9A 4WTXA 5EUKB 5KUKA 1CS6A 5CZRA 2ZOLA 3G5YB 5J1SC 4I4WB 2D7TL 3VI4A 2P47B 12E8L 3EBGA 3IWUA 2PPEA 3HZ3A 3QWRD 1BF8A 4WO4C 1NIFA 2RCSH 3MJWA 4Y9CA 4ELMF 3QPKA 4Q6IA 4JRYD 4XTRD 3U25A 3NIDE 5I15L 3QO1B 1S3KL 1LNUB 1S5HA 3T8VA 4HPHA 1TFPA 1M53A 1JUFB 4QPEA 1EEZA 2HWZL 2QVMA 5TH2A 4KQ3L 1MUJB 2G3MA 3T65A 4LIQE 1HT6A 3PAZA 4RAVA 4H8VA 3OAWA 4PSRA 1U3HD 3UAJC 3KYAA 1P5UC 4X7CC 4DO5A 4G71B 4Y4HC 2CJSA 2HKFH 5K9OA 1W72L 2R1WA 3KL5A 2Z91A 1H3XA 1OARH 4M4RB 5EORL 4CGUB 4YLQT 5TGBB 2LAGB 1HSBB 1MCOH 2RMNA 3FXIC 1RZIA 4ECNA 5FYKH 5FDWB 2ADFL 2ICWJ 5C0AD 5ADOL 4BQCA 2DLIA 4LK4A 2AK4D 3HKZA 3J2PA 2GAZA 1M2VA 2J8HA 1GOHA 2DY2A 4NQCD 4EI0A 5AENA 3QI9D 2VZ3A 3PUUA 3PREA 4U6VL 1DVYA 5SWZE 4XO5A 4LEEA 3QNFA 5IEHB 4PJBE 4TQPA 3RHWK 3O6MH 1WIUA 2IADA 1S9WA 2MIZA 3E9TA 3EJCA 4TMPA 3VI3F 1U2CA 2FVNA 3B3IA 2B20A 3GXIA 3P3RA 1MJ7H 2WNGA 1RVFH 1J1XL 4YUEH 5D7KD 5DTFA 1S9VA 2GI0A 3CFEA 4W9DC 2KLTA 4QOKA 2ARWA 3ARVA 3GIVA 1BBJB 35C8L 3LKRA 4KH9A 2FH6A 1CU4H 4YHIB 5DJAB 1TYEB 2A6IB 4QHKJ 2X4QA 2AS5M 5ICZA 4JFUA 1MJUL 2OJ1A 5L6YL 2R4RL 1KCWA 5ACMA 2J4WH 4X6CA 3CXHK 2X0WA 3V4PB 1NCNA 4HH9A 5D1ZD 4QHMA 2F6AA 4J3TA 1KCLA 5IQMA 1ULVA 1IIIA 2ZXBA 3FTYA 3PAYA 4JO1H 5C0GA 1J88A 4L4VB 1MHHA 2UVFA 3K71A 4MJID 4DP4X 4N68A 1TTGA 2GJPA 3BGMB 4AM0B 5J3HD 1NBVH 2Z7WA 3PXJA 2UXTA 1C9SA 4LO9A 3VMNA 1JMZA 1A5FH 2NY1C 2VZVA 4WI8A 3Q06A 2Y5TA 5KJRH 2B9AA 2D0GA 5DZ9A 3DMMC 1DL7H 3VSTA 3B7SA 3NSJA 3QR0A 2OP4H 4QRRD 1D9KA 4M4PA 4D9RD 5IHZB 5EF0A 1UOVA 3AAZB 5K59F 1E30A 1OT1A 3NJJA 4E41E 1FUNA 4XP6H 1CD8A 2CHXA 5D1XB 5C0EA 1ZVYA 1L9NA 3N91A 2HN7A 3KPTA 2ZYRA 3LB6D 5F7WC 1XH1A 1YAZA 3WO3B 4NJAL 3HZMA 5IESL 3VXNA 1ZEAL 4J3UA 5H35B 3QG7L 4XH2B 3NFSL 4XP9H 1DQMH 4AEIH 4QWWC 1H5BA 4K07A 2CA4A 4ENZA 1AO7E 4MX7B 4F2FA 1IM9B 4WFFD 1QWNA 5DHYB 1HINH 1KEGH 1JS4A 2E7HA 1K2DA 2NRDA 3MV01 4EN3D 2IG2H 2IANA 2WB1A 3NPZB 3QIBA 4O2CB 1NMAL 3C5SB 3GK8H 3Q6FA 4KK8D 4MAYA 3KR3H 5GZND 4L3CA 2OXHA 2VDLH 3ZDZB 1Y18A 1JYVA 2H32B 2WXQA 3JTBA 2ZCLL 1MWAL 4XBEL 5DD5H 3TO4B 4LSUL 1ACYL 4DCQA 2VIRB 3GRWL 2B4CL 4WENB 2PO6C 1XR9B 2BXZA 1ZIBA 4MDJA 3D2TA 4F2MA 1IGMH 4J27A 3DURB 1ML0A 3BDBA 3LS5L 5K9KA 3WGUB 4EIGB 3BH4A 1MZYA 3IWVA 4HAGA 2QKIB 1ZWIB 4K5MA 1IFHL 2DEWX 3OHXA 2Y7QA 4XI5C 4QO1B 4NWTL 3ELQA 5LB1A 4NKIH 1BZ9A 3I6SA 4N5ED 3ISRA 1MAJA 4IRJA 2BY3A 5FHBL 2OYLA 3A24A 3ILPB 3MN8A 3QPQC 4YZFF 1AHWB 1QEXA 3AXIA 5MENB 3FRUB 4YBQD 4MNGB 3DV6A 3RDTC 4Z7OF 1IKNA 5C08A 3QORA 4NZUH 4G9FD 4Y2DC 4NO5A 2KPNA 5CKGA 5D5MA 4JDTH 1EXHA 5EDXA 5EBMA 1MFBL 3F2LA 2QFPA 3LZOA 3CJJA 3X12B 2J3SA 3D3VA 3GNMH 3PJNA 1TPXB 3PWUA 4OCSH 1HQ4A 5INDA 3WS3A 1U8JB 4MZ2A 5C7XL 5JPMB 2EVGA 4G6AC 4J2XA 2A6KB 1MVUA 1FYTA 4PV8A 3RGVA 3JUZA 2ZUQB 1CYXA 5AZ2L 1ND0B 1AGBB 1JV2B 2V8MA 3TN0B 4JHUA 2PWGA 4HPYH 4ODHL 3RTQD 2QSTA 3IMWA 3PHAA 4JFOB 2MPAL 2Y23A 4KDTC 2VXVL 4M8QA 1AKJA 1KTDA 2JKNA 1YSOA 2FX7H 3MJ6A 3VFRB 3ZDYB 1BZEA 1P4BL 2F53D 1T4KB 4HIEB 4BM7A 3P4MA 4OV5A 2K7PA 2JELH 5JIPA 1X9RA 4AWJC 4G72B 3UEZA 5FOBA 4LSQH 3W11C 3B8YA 1KZYA 1SDAB 3QUZA 4UOW1 5AUMB 3DARA 3D09A 4FNRA 4JKWA 1YMME 4PG9A 3CHQA 3AWGA 4U4BA 3FSOA 5I19L 1N5AB 3A4FA 3MBWB 3ULVC 5F1SA 3FTZA 4K94H 4G3YH 2GC4C 4Y9GA 2DYSB 2DQJL 5KS9A 4KMTL 3RYMA 2VLJA 2KS0A 2AJVH 2ADIB 4O5LL 4PJEF 5D2LB 3US0A 2HVJA 2X9YA 2VLRB 4EZJA 4RZCB 2BNRB 3GI8H 2JKTM 3O11B 3OJ2C 5IMKA 3VXUD 4OCYL 1KC5H 4Z5RA 1EV2E 3KVQA 2ZCZA 4UQ9A 1A6AA 4WWPA 2EDMA 5DQ9B 3DIFB 3MRGB 5AWNL 5F71A 5ABDE 2CQVA 4PP2B 3D08A 3ZL4L 1R3HA 4XWOC 5B1JC 2NLJB 2LVCA 3HE6A 4FCAA 5GRVK 1MZZA 3O9WA 3I3EA 4WV1B 3UGEA 1OOAA 2F54D 1IC1A 3DJ9A 4LNRB 5HHMB 1CLVA 4OJCA 1VDGA 3H9SA 1HSAA 2FHCA 4QTIL 1W0WB 3F05A 2MNJB 3S4SB 5HHXH 5IMLA 4P23B 1XGZA 4WJG3 1S5IL 5FM8A 1SLXA 1WICA 4P07A 4ZD3L 4CVZB 2LOEA 5I0DA 2ZF9A 3QIUC 2NNXA 4JCMA 4N0UA 1VEMA 2LHAA 4FNLL 1XF2B 1YQ2A 3ENEA 2FQEA 1CG9A 2CKBB 5HJGA 4OJAA 3OAUH 2IVFC 2D3NA 2O30A 3OL2A 4HCRL 5HYJB 2QMKA 1H3WM 1HCFX 3U4BL 5JIKA 1EZVX 2YD2A 1LP9B 2R9HC 3CDFA 4ISVB 4NM8H 3SO5A 3UTTE 4HMDA 4WK0B 4P9HL 2VMDA 2WKLA 3KWTA 4YDIH 4XHJD 4PW9A 5C0NC 3DUSA 1DO5A 1ETZA 4H1LH 3UCQA 2A4EA 5T1MB 5DJCA 2VERN 2E6QA 4CSPA 1MF2H 1FFPA 4NC1C 3GSNH 4XODA 1WT5C 4H1LA 2ZXEB 1JWMB 5TF1H 5F3BA 1DQQB 3BP6A 4XCFH 4FL4B 1T7ZA 4GQZA 2VAAA 1GZPA 3L7EB 5D7IE 1XB8A 1EUTA 3QULA 4JKMA 3AC0A 3GUTB 1A7OH 2Z92A 2ICEB 4XCYA 1NFDE 5CD5C 3FU9A 1FAIL 2FLBT 4BSVA 2JJSC 3FUJA 2DQCH 1TO4A 2MCPH 4OM0L 1KPVA 3ZLQC 3VRJA 2WTPA 2JB5H 4A7GF 4BCZA 1WP6A 1SY6L 2NSQA 1UZ6E 3AT9A 1IBBA 4LAQH 2X4OA 3IXAA 4I2XB 4PUBL 2BVPB 4W6YB 2C8NA 3MV8E 3VGAB 1QI4A 2HX8A 1I3GL 3D9AL 3MNWB 4XCEB 3AU1B 4PJGF 4TS6A 2NZ9D 4F8NA 4XNQB 4RX4D 4ZMVA 4JMNA 2UUDH 4Z7QE 1QFUH 4K7FA 5LN8A 4A1RA 3KMDA 2BWDA 4WW1A 4Y2OB 1BQHA 3BUBA 1FH5H 1NGXA 3MLPA 5LBGA 4JE4B 4I18B 2X1WL 3L3IA 4JO4H 2VLMD 5D6CB 1MFEH 1GVIA 1YQVL 4Y7OC 1PZDA 4KKPA 2EUVA 4F9PA 3ZIYA 1J5HA 3CFKA 4G11A 4Y5YB 2BVUA 1J0IA 3B9DA 8CGTA 1NCCH 4AIZB 1NM9A 2ZP0T 3JWNG 5D2NA 1BF2A 3ZY7A 5EN2B 2Z1KA 1OQOA 1KXTB 2YAMA 3UO1L 4YHYC 1NLDH 1RURL 4R0LA 5GS1C 2JTDA 2P4AB 4TN9A 1VACB 4AIEA 2Q6WB 4TSBH 2WIIB 4Z8FH 2FK9A 3IGFA 1I9JL 4X4ME 1DVUA 5FOJA 1FVDA 3O0RL 5ALBL 3EG9B 4FQ1L 2UXGA 1BEXA 1EHKB 3MRRB 3QNZB 1A14H 2BX5A 3MCKA 1GYVA 4G8EB 4L4VD 1E6JH 1F13A 4B41A 3ETSA 1G7JA 1WF5A 3RZCA 3T0WA 4F37F 1SEQH 2B2XH 5JDJA 1X5FA 1WAEA 2V0AA 2WO4A 2JK5A 4ZUVB 1J86A 4OZIB 3W2DH 3HFMH 2GK2A 3KGRA 1DFXA 3CU1A 5IT2L 1QBLL 3IDIA 2CO7A 3WBDA 2X42A 1HH6A 1UXWA 3VI4E 4QY8B 1Z5LB 3L4XA 5D1XD 2YC1B 2ZOKA 4ZSOA 5DEGB 3ZDWA 1S4IA 3P4OA 3V6BR 4P2QB 1X9LA 1IQDA 1DQJB 4J8QA 4N8CH 2ZSVB 3U30B 2ICWB 4KZEH 1OCZB 1UD3A 4PRPE 5E6IA 4ODWB 3BPCA 3W38A 1PIFA 2UX6A 3OKKA 5FA4B 4N90D 1SQ2N 5E9DE 4KK6C 5E5UB 1IM9D 2VTFA 4Y1SA 5AAWC 2K0RA 3H4HA 2AK1L 2HRPH 5DI8B 1FFQA 3AZUA 1UM5H 4DETA 2Z7YA 1NAMB 4L4TA 3PAVA 3ULUD 4NQTA 2CIIA 4GW1A 3WEBA 3EOBB 4WU7A 4B6ZA 2WWNA 5FCUL 3F85A 4BCXA 1S6NA 4K5PA 4G59C 3ZT6A 3PP4H 3NJNA 1H6UA 4FERA 1RZQA 3TO4D 4HS3A 2HZHA 2IGLA 5HYEA 3CN3A 1NKRA 4D3CH 1Q9KB 4TULL 4HCFA 3EH5B 5FYKE 1O7SA 2IGTA 3R7RA 4FG2A 3G5XA 2D31B 2XWTA 2IFFL 5DLLA 1WGOA 1HE8A 2Z8RA 3KPSA 5DD6B 3AQDA 1E9QA 1YNTF 2H1PL 4XMKH 3NCJL 3TX4A 4K3GA 3B37A 4W4NA 5EN3A 4QRQB 5T1LA 1I1RA 3P4LA 3DDFA 1OTUC 5MERB 4EBQL 3GIZL 1WBYA 5MEND 3FCUB 1DSFH 4LLWA 5BRZA 2D8KA 4MXQC 1HL9A 1J12A 1YA5A 2DWDA 4JO8A 3QUYB 1Z3GH 4X6CE 1KIRA 2G2PA 4PJXB 3GSWB 1X6NA 5CJOH 5ESQB 5HJ3A 2X12A 4W68A 4BHUI 3FULA 2A6DA 3AWEA 2WTRB 2A9CA 1V55B 1SYVB 5EFIB 1TJIH 1ADQL 3PWJB 1QSEE 4BSJA 3MC0A 5E8PA 3T0DA 4PCKA 1HS6A 4RNRA 2D73A 4ZUTB 1UZ8A 3TN0D 4PJFF 5FGCB 5AG9A 1U8QB 3UZQB 1JZ8A 2GSGB 1ZTXH 4L3EE 2KI6A 1TZIA 2F18A 3NA9H 4P2OD 5E2UH 2NY5H 4Y4KA 1FVCB 2L0DA 3E9UA 4NO2A 1T0NB 3JTTB 1PZBA 1X7QB 1E4HA 4ZS6C 3UJIL 3VD0A 3DIDA 2A1WH 4AITA 1F3JA 2V3EA 2E5EA 3FRPB 3TURA 2OXGB 2QBWA 2G60L 2F19H 2N7AA 2BIMA 3AG3B 4WY7H 3SKJH 2D03L 3WFHB 2ROXA 5FK9B 3UYPB 1FGVH 3N0AA 1AGEB 4YVNA 1T5WA 4H40A 1AZBA 3FFOA 3MRDB 5F7MC 5HYQA 3NEEA 1RJYB 3CPUA 1I8MA 5GIRB 4MB5A 2IPKB 4HUWB 3OWEA 5LAXB 4BZ2H 3NZ8A 3MUJA 2FWOA 3WXVL 1F6AB 5HGAA 2UWEB 4NWUL 3QBTB 1I7TA 1OTTC 4FG4A 4PY8I 2DQHL 4FXLA 4BQ6A 3WMQA 5GGRA 4QRSB 5IM7A 2VLRD 5JLZA 2YPLE 1LO4L 1JWUB 2WBJA 1Q1PA 2X70B 2BNRD 3DOHA 3OR6A 2TRHA 4OLYL 5D6DC 3REWB 2G3XA 1XGRB 4OKDA 1P53A 4MJ2A 2CNZA 5IJDC 4IRSA 3C08H 4B9PA 4EI5C 5C6TL 3MV7B 3LN5B 1UB6A 1NANH 3G6JB 4XN8A 2D4DA 3O0LA 3SDCC 2GUYA 4F2ME 1HEHC 1G43A 4HBQA 4K7PH 2G75A 3BZ5A 1E9OA 4WI2A 5LGYA 3RP1A 4GEJA 1CDHA 2GHWB 3LNEA 1IAKA 2ITEA 2QZ5A 2OL3B 5AW8B 4XAKD 5HHMD 5I2IB 3EDEA 4XT1C 3TVMC 2Q20A 1XZWA 2F1AA 5FS5A 5M94B 4P23D 5J9PB 1ZT7A 2ZP9A 4OF7A 2VW4A 1CL7H 3HG3A 1CQYA 5HYSB 4DNLA 2I07A 1YYLL 4LB8A 3QPXL 3BSHA 3ZE2F 4S0SD 1TTFA 2D9QB 4HWZB 5L7XL 1CF8L 2HAZA 3V6FA 3U36B 2YHGA 4L9LC 3DSNB 4N22A 5AB1A 3B9VA 1XXFC 4GW5A 3NTCL 3KJ6L 3FFCA 5KYUA 5D5ME 4EDXB 3OPUA 2CA3A 5DURB 2A9MH 2FIKA 5HYJD 3DRTB 2YUXA 2ARJB 3BVTA 2BFVL 3GMOA 2PO6B 3R06A 4FQJH 2GBUA 4CVXA 2X3BA 3CZFA 3APFA 2LAAA 3HMXH 1INQB 3HUJE 4HKJA 4Z6AT 3TIEB 2AGJL 1RL1A 4FNSA 3S36L 5DHMC 5D70H 2R4SL 5A16B 3SE9H 4J6RH 3HMXA 5IQ7L 1FG2A 4XVTL 1EK3A 4K5LA 4APXA 1E9PA 4KO6A 4LVNC 2NR6A 3SCMA 2EYSA 2EYRB 3P73B 2IPTH 3K0WA 4R4BB 2D7MA 1P4LA 2C9SA 4X9IA 1DDTA 4PLJD 3VGFA 2R8SH 1CFTA 4EUPH 3W5MA 4WW2B 3STBA 4DGIL 4OCRH 1YEHL 4YLCA 4HAFA 2WLLA 2CXGA 2H2PC 3G5ZB 1VZHA 3B7UX 5GS0C 2NT0A 4EUPA 3QO0B 3KBHE 4U1JA 4P48A 3O2WL 3Q8AA 1SDDA 5IMOA 3RHWF 5EOQH 2PCFB 5EUOA 3APDA 1Y7VA 5E9NA 3L6FB 3BQUA 2ENJA 2ZUWA 1FVEA 1JV5A 3EOAB 5DQJA 5D7EA 5ESVB 2VN6A 4KHXL 5FO7B 4U3HA 1HCVA 1LL1A 3AU0A 4QTHB 1T83C 2BVOA 2VL5B 3K5SA 3RVWC 1ZLDA 2OCFD 2EDLA 4KWUA 4L5FH 3TIDB 4DN3L 4PGBA 2NYZA 1BVKB 5FDYA 5I8OH 2O93L 2NXZC 4TQIA 1DUYB 3LS4L 1PZ5B 1O9WA 2YMXL 2B59B 4HIQA 3RILA 3SQRA 3V6OA 5HHVH 1RZKH 3JXAA 5E08L 1XR8B 4MMZC 2E56A 2ZSWB 4DH2A 3OKNA 5T3XL 4B96A 2YMTA 4JLRB 5HDBE 1UVQB 2WYIA 1NSNH 3OWRA 2YD3A 5DFVC 2GI7A 1QSZA 4MBOA 3SPGA 5F1NB 2KLRA 4JFXB 5F96H 4M1DH 2LLLA 5DVOA 3SQBA 4S10A 4PJAA 4GUPB 3RWCA 3ULUF 1BQUA 1TJHH 5J6GB 1IT9L 5C2BH 3ZDXB 1MJ8H 4UV4L 2DI9A 2XA8L 3MU3A 2VKXA 4N0UE 4H4NA 2GBAA 2OKMA 4YSPA 4EN2A 5LCVL 3LZRA 1JZIA 4ORGB 2IGFH 3RWHA 5EC2A 1M7IA 5ANMA 4R5XA 1D7DA 2VQ1A 3EDDA 2YZ8A 3R4DA 4P2QD 1LGVA 4L8CA 1A6ZA 3UGXA 4FKEA 3MNDA 4YE4L 5TDNB 3BP5B 4RA0C 2QR0A 1J9TA 4TL5A 3U4EA 1PD6A 4K2UL 4OCLC 2R7EA 3Q2WA 4N28A 3IFLL 2NY3B 1CGYA 5D96C 2YRPA 3LEVH 2QZQA 1XTLA 1SOKA 2OR8A 3ARFC 4PGDB 4JFSA 1HXMA 1KENH 1U2YA 2A9NL 2WVSA 4BSWA 5HD8D 4DGVL 4X6EB 5T1KB 4S2SA 2W5PA 1BP3B 1L6ZA 2CUIA 2HG5B 3C6SA 5T5FL 3QIUB 4HCIA 5ECGA 5HGBA 3VFVB 4N87A 5IQ9B 2DYRB 1G7IA 3FQRA 5DO8A 1EJFA 4ZMWA 2WV3A 3APMA 2DKMA 4POZC 4GG6A 5FYLD 4CL7A 3QQXA 4WO4D 2AXGA 3TJEH 2XU9A 4OJFL 5IBTL 1LO3L 4ZRGA 3WKNA 1A21A 1EBAA 3GMNA 3S8WA 3K2UL 1FIGH 1JIBA 1ZA6B 3S6CA 1MFVA 3I3DA 4PB9H 4ZFFA 3LH8A 1CE6B 5I28A 2FWLB 1GRWA 5ES4B 4H0LC 1R5IA 2YD9A 5DVPA 2NYKA 2V6HA 3QDAA 4QRPA 4M7LL 2ID5A 1CFSB 4U3SA 3AT0A 3WIFA 4OB5L 4HGKC 1FC1A 1SXBA 3NJKA 3UAJD 1A4BA 1DQVA 1EANA 4ZXBB 4Y4HD 2X7LA 5I76A 4WFEE 4JHWH 4GG8A 5D2NE 3OLDA 1TYJA 3AGWA 1ZHLB 1S7QA 4DWHA 1Q0XL 3K80A 3Q1SL 3ZDYF 1MEXH 2VO5A 1A6PA 2UV3A 3IJHA 3ROOA 3B83A 1H6EA 1RH8A 3QUYD 2C9UA 3TP4A 3I02B 4QGYA 1HHHB 4FFZH 2R0ZH 4XB8A 3X1GA 3N06B 4QDGA 3DGCR 3KPLB 3HAEH 3VU2A 3MGTA 1DVFB 3FH5A 4WHDA 3OJDB 4FFZA 1LE9B 4XNUL 3HAEA 2WLJA 4OTXH 4X0KA 3FB5A 3BUPA 4BELD 3WIIL 3SHSA 2CHDA 2NMSA 3LKSA 3D87B 4MMYB 1ROCA 2AABL 4U2ZA 4WWKC 4DZ8A 5A2CA 1BHGA 5KVFL 1TTCA 1OB0A 2HT3C 3SYPA 3GJEB 1I3RA 1S46A 2JLLA 1WEJH 3EHBC 3MRQA 4PJCF 1MCNA 1NUNB 4JCWA 4OLWH 3IS0X 3GSRB 3MXVH 5GS1B 4J39A 2OBGA 2P5WA 4BQ9A 1SOSA 3O3DB 3B4NA 1MCEA 4OUOA 2E76C 1AR1C 1AGDA 1E3ZA 3MBEA 1RMFL 3KWUA 3MLUH 4NYLB 3VE0A 1WK0A 2DYPA 3OX8A 3CMGA 4AMKL 4F57L 2VJXA 5TQ2H 1KV3A 1EPFA 2BERA 3MNZA 5GRUL 4KRPC 4L4TE 4A2LA 2ZAHA 4MNQA 2X5PA 5F8RC 2FECI 3FB6B 3DRQA 4MCMA 1ZHBA 4RBPK 2BS8A 5D9SB 4M6ML 1P2CB 1ILUA 1A6VL 3SKMB 1BBDH 1T6BX 2AV1B 4D9QD 4ELMA 4QHPA 2XY2A 3LSOA 1U33A 3DX6A 1JGDA 1YAIA 1MRDL 1AFVH 4NQVB 4MCYB 5G55A 4HAKA 3MV7D 3RWGA 3KPRA 2LE9A 3MRKA 2FL5A 1GH7A 1F6FB 3BSGA 3WEXA 4K9EL 4YAQB 4ZFOL 1RKRA 1Z9OA 2V5TA 1UA6H 2X4PA 1RK0A 4MJ5B 5BZDB 5F21B 2VLLB 3BHBB 2H0JA 4EIZC 3B2DC 3B6SA 5E6YA 3K6IA 1I8UA 4R4ND 2A73A 2BY0A 1X5LA 3FSWA 2X2IA 4N2FA 1SJVA 4NQDB 2V2TA 2ZOTA 5BRZE 6FABH 4WFGD 1G7LB 1P1ZB 1A0QH 1HL4A 1P7KA 2IAMA 1LILA 3PL6C 2P48B 4Y16B 3MLRL 5JQHC 1ID5I 4Q97A 1UQSB 5DURD 3L2NA 2PO6D 3TA3C 1TIUA 4NENA 1EHAA 1I1AB 2BC4A 4PWEA 1NIEA 2GBTA 2CO2A 5HTSA 3I84A 3MXWL 3IKCB 1SGKA 1ZMYA 4QHNA 1USQA 2PYEB 3VFOB 4L18A 1LK3L 1EXUB 3I50L 3ARBB 4GOSA 1V3MA 4I9WE 3ZMRA 4HBCH 2NDGA 5C97A 1JGVL 2J5LB 4G7QB 2AVFA 3QPQD 3WKPA 4KKZA 4N8VA 1PBYA 1ZTXE 4KQ4H 4R3SB 3CFBB 1F11B 4LMQE 4X80L 5ICYA 3OGCB 4DUVA 3CLWA 3BX7C 1CB4A 4NRYA 2CPCA 5A40E 2NY7L 4FEMA 3TNNA 4HIJA 1XL6A 2CR0A 4EQ2A 1IIKA 4CADA 5CGYC 2G5BA 4MJ6B 2XZZA 2B1HL 4KPHH 1J9RA 1QSVA 4A7TA 3TFKC 3Q8EA 1CDJA 4R26H 1JMXA 4Y4FB 3KWVA 4LHUG 5F97E 4X4YA 5KSVB 4UI2A 4UOJA 5FYJH 4PSPA 3TPUB 1CGWA 4NGHH 3MJ7B 1UYWL 3GO1L 5CZVL 2VAJA 2I25N 1BOGB 1G87A 2OTUB 4R7DB 1DSYA 1FORH 4OZGB 3T4AA 4OZIF 3D4YA 4ZMLA 1KG0B 4XP1L 1G7QB 2G9HA 2J44A 4F15C 2HFEB 1E67A 1CF1A 1WFJA 4GKNA 2H26B 1J8RA 3PGCB 3CH1B 4X9GA 1YJDH 4XPFH 3CHXA 3S88H 5IHUH 5C9KA 4XP5H 4ZMXA 5EEZA 1A7RL 4HJIA 1N5YL 5A2KH 5CEZE 2VMFA 2BNUB 5F8QC 4RRPG 4Z7NE 4YSDA 2YPVH 3UERA 1MHPH 5K39A 2ALWA 1JK9A 3L9RA 4OF8A 1WV7T 5ESAA 5C6WH 3WJJC 1MW2A 2VUYA 3L9BA 1OGTA 3ETTA 4GKOA 4ZO8A 2YPVA 2LU5A 3FB8A 5D1QC 4JR9L 5E1AB 2WM0A 3ULVD 3ROLA 1P1VA 1CFBA 2NUPA 4JRXA 2HVKB 1OW0C 4FTVB 5F7NC 5D8JL 4ONHB 4JVWA 4UTCA 3T8MA 3VUAA 4PLNC 1GGIH 3F6LA 3P40A 2BMKB 2H2SC 4DPAX 1ZGLA 2VE6A 3UJJH 4YQXL 5DC2A 4IHOA 2XFXB 1KJ3L 5F7YC 3ARDA 1RJZA 1QLFA 4PRHA 5SX4I 5TD4A 2CLZA 5I82A 3KWWB 2W0KA 4HC1L 2HRGA 4DGUA 4X8JB 4KVNL 3CVIH 3FSZA 4HV8A 2X28A 1OK0A 4XWOD 2AI0H 4DJMA 1H9DA 3BT0A 3A6BL 2Z35B 3KPNB 5KTEL 1OAUL 5BZWB 1OVZA 2NTFA 2Y25A 1G9HA 3D25A 3GB7A 2V5YA 1IVLA 3O2VH 4L48A 4LPVA 2R1XB 2YK1H 3HC4L 1LD9B 1IQWH 4X4XB 3WNOA 4N8UA 1V05A 4MD4A 1T2QH 4V2BA 2JQZA 4BV1A 2BK8A 3E8UH 3S5YA 5T1KD 3ZQWA 3SDDA 4DW2H 3MRMA 2YAPA 4M93C 1JZFA 3LVTA 3QIUD 4YXKH 1A1MA 5DRZA 1CD1A 3LRSA 2EZ0C 1QUNB 2KQMA 2X4UB 3PP3K 4L9LB 2AJXH 2ZJSL 4U6XA 4NC0B 3OLIA 1I3UA 4P5TC 2DLFL 3JSSA 4D0DB 5FUZL 1KV7A 2WWMC 4K8RH 1XF4A 4R8WH 4HKZA 3OB0H 1RUQL 4PJXF 5ACZA 2ZF8A 3D4ZA 3UIYA 5BMFH 2W9DL 4QCIA 2J1YA 4JY4B 1Q72L 4BDVA 1J9CT 3TCLB 4QNPF 3INUL 5EZPA 1RULL 4GXVL 5C0CA 1LWRA 1YUHA 3P0GB 2JIXB 2AJYH 3C87A 5C0ND 2YPKA 1XGQB 2PP9A 3TBYB 3W0WB 1AQ8A 4GBXC 4IBVA 1NDMA 1KGCE 2VQUA 3FF7A 3JWDC 4G6FB 3P9WB 4LVNB 5C0IA 3Q8CA 4U1IB 5CCJA 5FFLA 3QS3A 2YD8A 3KH3A 4JDEA 4LIQL 2J2ZB 1LQBC 4J4PC 3IFNH 4AV4A 4ZXBD 3VFUB 1FNFA 3QJRB 3HLAA 3LZFL 2X4SB 5I8KH 4PV9B 1IE4A 4HKXA 1JHLH 4PJ7E 1F00I 5CD5D 2IWGA 4UTBH 3BRDA 3I6LE 4MAUL 1LK2A 1T5KA 4ZAKA 2YKLH 3QUKB 4K71B 5C0FB 4UTBA 5TE7H 1DVFD 1RZFH 2EDWA 1W8OA 4ZOAA 4OZHF 2IDCA 3HG1E 4PY7A 5HHNA 4R90L 3K6SB 3MR9B 2AJUL 3P02A 3O3EA 2X44D 3V6ZA 4GRMA 1S9KC 4Y19B 5DU7A 5I5IA 5TQ0H 1DUZB 2WQSA 3DUHA 4QHUB 5E2VL 1YEFH 4G6JL 4PJEA 3HZYA 5EEVA 2WPGA 3N1PC 4ZUWA 4OFVA 4L8SB 5LNGA 1HZHH 5CD3A 2VERA 2GFBA 3BSZH 3UBXA 3QWRA 4X6DA 1NUFA 4MQ7A 1KXHA 4H20H 2G9KA 1CR9L 2FNWA 4FQIH 4H8HA 2XXCB 2OMWB 3BSZA 5ANME 4PP1C 4U1MB 3MREA 4WDIA 3S2CA 1U3NA 4XE5B 3NZHL 1AOHA 1OPOA 3OKLB 3G6JF 3KPOB 3OPZH 5F1IB 3HI5H 2IBGA 3UOAB 4B53A 2CO6A 3U1QA 3RGBA 1JPFB 4UDTA 5D7LA 4KKCC 1G6RB 3QR1A 2ITFA 1FL6A 3CK0H 5DJ6B 4LSVL 5KVEE 5C8JA 4AEHH 4N86A 2YQ3A 1AOZA 4KZ0A 4RMBA 1GS6X 1GHFH 3PGFH 1YN6A 1PQZA 5EG6C 3UTSE 2VM3A 1XZ0A 2XTSA 4WTQA 5ISZA 1MJJB 3ABZA 2O6DA 3LXUX 5GSVB 1KN4L 4PWHA 4Z77A 5C0AA 4BQBA 5TDOA 4J23A 1IKFL 4TQEL 4UYQA 1F1DA 3EZ8A 4GG6E 1I9EA 5BV7B 1B0GA 4DVBA 3QI9A 4LSTL 3CC1A 4KKLC 4CBPA 1EHNA 1N6UA 3B9KA 1LEGB 3BXNB 1T7WA 1IL1B 5AYUL 1E4WL 2OJZL 5GGUA 3P0YL 4WF7A 2F8IA 1QWUA 1W2KT 3BC9A 3WNIA 4NN6C 2PPAA 4S1SL 3EFOB 1NC4D 4UT7H 2WNKA 3NAAH 4NI6A 4QRPE 5D96B 1GYCA 2GUOA 3MGOB 3HE7C 4G1EB 2J8UB 1JP5A 5KAQG 1W72B 3FU7B 2APSA 4HHAA 5EU4A 3EGXA 3B8SA 3O2DH 4HMEA 2BSDA 1YEKH 4KXDA 2BSTB 5EIIG 5I6XB 5FHAL 4NQDD 5EO9B 2E27H 1FIEA 4NHUB 4W9HC 1N59B 3O2DA 3SDAA 4RIRB 1U8OA 3CFIC 5D1ZA 4X8XA 4Y16D 1OT2A 2OMNA 4JFED 3GS7A 4PJGA 3VG0L 3CFNA 5HGDA 1XF3B 3GSVB 2H47C 2BP8B 1I1AD 1KXQA 2AFNA 5EOTB 1PZAA 1TKWA 4ZZFA 3VM5A 5SV3A 1BFOA 3B9AA 3H3BC 5D71L 3JWOH 1RJLB 2PYED 3L48A 3FJTA 3Q3GB 3DO7A 3ARBD 3C8KB 4PRIA 4XPHL 1I4FA 4JQVC 3RG1C 4LSSH 2R39A 3RUGB 2VDPL 3ATAA 5B7MA 4M6AA 1MXDA 4IHBA 2QQKL 1PAMA 5K9JL 1E8WA 1SLVA 1D5MB 1GIGL 1P4IL 1OLLA 1PDKA 2XOTA 4MXQD 3VFMB 5JW4Q 4BUGA 3N44B 4URKA 4FXKA 1XF5B 3CSPA 2YRZA 2Z34A 3DVNA 3QJVB 3V55A 1P7QA 4Y1AE 5AOKA 4XPBH 2E7LC 2QT6A 1DJIA 3LEYL 5FKAB 2WJ5A 1TVBB 1UCBL 1M05A 5IVZB 2AZUA 5K9QI 1E5AA 1UCTA 1NGYA 2QHRH 5TTRA 1UOKA 4JFPA 4YDNA 4YDKL 1FL5A 3UYRH 3ARXA 1CFQB 4EN3A 1FZKA 1U3YA 4G80A 4ESKA 4ZJ9A 4MNQE 3ULVF 1B4TA 1I31A 2WD0A 1YEDB 4PGCB 3FQNA 1T4WA 3WSQL 2DEYX 5DCCA 2OQJB 4ZS7H 3F62A 3ZDXF 4N4YB 1ZLSL 4U31A 4IKJA 4WWKB 1FFOA 3A67H 4E9LA 1JPSL 1INEH 2OULB 4ELME 2JH2A 1BG9A 2A74B 1T1ZB 2WLIA 1S7UA 3MA7B 4G5ZH 5CINL 5IFHL 4PJIF 4ZS6D 3EHBB 3HZVA 4LVHC 4S1DC 5CKAA 5IG7B 2P7TB 1DVXA 1OPGL 2BRRH 3D2UB 4OGAD 4WUUA 1YRKA 2BSSB 2Q5BA 1DJWA 1WZLA 2WXLA 3HA0A 4FQ2H 4K0OA 3HBGA 4NPYA 2PWEA 1AR1B 3E6HA 3QAQA 1TSRA 3KYNA 4WI0B 2X1QA 2EDYA 3DX0A 4D7BA 3FFDB 2WO3B 2IBBA 4MRCA 3CNKA 5FX3A 1UD4A 3U1PA 4KRPB 2ZNXA 1KLUA 3OV6A 4YHPB 1YNKL 4FTVD 1ZPUA 1EDHA 5IB3B 1OTTD 3GMLB 4KY1H 4M1CD 1DBMH 1MWAB 2WBXA 3CTTA 4ZUUA 1Y0LA 1WAAA 2AEOA 2H9GA 1F3DH 5IP4A 4NIYE 2O5XL 5FW6A 5H8DA 2CCWA 2AQTA 3B34A 3AWFA 2CCLA 3QCVH 2ENYA 4HJUA 1WFTA 2Q2LA 5DZVA 3ZPDA 5EA0H 5DC9B 2O6PA 1MOEA 4O9HH 1D6EB 1RIHH 1YNTA 2HFFB 3ECUA 4JO5A 4KJWC 3UABA 3VI3E 1LEIB 2Z31B 4RRPM 5IOPA 4NNPH 1HCZA 3L3DA 4ZDHB 5J6SA 4JPWH 1NFAA 1ITBB 1BW8A 3N04A 3TVMD 4LVOC 1RERA 2ROYA 2WWKT 2X6VA 5TPWL 4MMXB 5I5JA 1AY1L 4NUGL 1FFNB 1IEAB 3CZJA 5LVEA 1W80A 3ZTDC 5JQIB 3HRZB 5AAMA 2KMWA 3AVEA 5I71C 5DA0B 1D5ZA 1YEEL 1R75A 1EJOL 3HJEA 1FBIH 5KBKA 3QXTA 4HIPA 3Q05A 3LKOA 1IM3A 3U46B 4P3DA 4FQQA 2VXTL 3RBGA 3TA3B 4ABQA 3VA2C 4AEFA 4PW3A 3EYFA 4GI9A 4PB0H 5C3LD 3FO9B 2WCGA 2R0KL 1M71A 1SJXA 4E9SA 3FQUB 4MD5B 2JIXD 1NCDL 4AQ1A 4TSCL 1CXIA 4N0CC 4Z95L 4Z0BL 2L7EA 5TE4H 2NTSP 4HFUH 4JN2B 3W0WD 5C0BE 2ADGB 3CMOL 5LNDA 4XP4L 4X7TB 3T3MB 5K1NA 5K59E 3FMGL 4G6FD 4J8RB 3RX9A 5B22A 1HIML 2XY1A 5EU3A 1RI8A 5JOEA 2A0LC 5EZIL 2XWJB 4KHTH 2DJMA 4NO3A 4AKOA 2FECL 3O6KL 1S7SB 1MFDL 1NGWB 2W60B 5JORB 2ZX8A 4ZFZB 2P80A 3U48A 2WVVA 2H2PD 1SF3A 3KS0H 5GS0D 4N1HB 1E4KC 1ECYA 3I9GL 1Q8MA 1QUPA 3K6FA 1NGZB 4DQOL 1UGNA 1HI6B 2Q3XA 3FT2A 4Y19D 3M17A 1B3IA 5JOPD 4XMPH 3OKEA 4UQAA 3L5XH 3FPXA 1WQVT 3PJSA 4KXBA 4HDIA 3RNKB 4HK0B 3HHSA 1FJ1A 3IK2A 2CDGA 3NBNA 3G5YA 1PGRB 3RVWD 2OI9C 3MLZL 3QJQB 2J20A 4I4WA 3RVTC 4AUUA 3GSUB 4YXLL 2XKSA 3ZZ1A 4LRIC 8FABB 5AW9B 3X3GL 3I9IA 2D7TH 3KBPA 2CXKA 4OIFA 4PRHE 3AW5A 4MA8L 12E8H 2DLHA 4QTFA 4JHAL 4X7FC 2MCAA 2AQNA 3MRBA 1GMIA 4KAQH 4BQ8A 3QO1A 5I24A 1LNUA 3O4LB 1OHZA 4AKQA 3RWJB 3PAUA 2EEAA 2ESVB 4FABH 1JUFA 1S3KH 2KZ1B 4IBTA 4TVPE 2FEDC 5GZOA 2GTZB 2Z8WC 3QZMA 3SPIA 4P57B 2JKSA 2ERJB 2UY7B 2ZX9A 3NCEB 2B14A 2KYIA 4PG2C 3V5DA 4KQ3H 5E1QA 2A77L 2GK0B 3MOAH 3WNMA 2OR9L 3O8XB 3R0NA 4YZFE 5DFVD 5D1QB 1EHLL 3DYOA 1UWGL 5JPNC 1MI5B 4JDZB 4PTUA 1F41A 2XUWA 4Z7OE 2BM3A 4M4RA 4PVNA 1RK7A 4UIKL 3CGTA 5TGBA 5A3IC 3JWNH 4W9EC 4P05A 5EORH 2NY4C 2OMZB 3BP4B 1OP9A 4V1DB 3MPCA 1QEWB 3OGOE 2ADFH 2CMRL 2ZG1A 3KYMA 3S5LG 5AB2A 3D85B 1GC1C 4F7TA 2B1AH 3GBNH 4NKOB 2R2BA 3E0GA 1QVOB 4YO0B 4NAJA 1OAQL 4XMVA 4U6VH 1E4XH 4GT7A 4BFIA 4FOMA 3LVEA 2LFEA 2NCMA 1QFWH 3PQYA 4XMXA 4GS7B 3JBG7 4C54A 5C71A 3RWDA 1VKXA 4TLKA 5E7BA 4JZJC 3KLSA 2FQGA 5DZNA 2H0FA 1UH2A 2EH8L 2XWBB 3GMMB 3VWKB 3V4VL 3L4TA 3QJFA 4OFQA 1J1XH 1B0RB 1JF6A 1JF1A 3IDUA 1TLMA 4HEME 1GZHA 4OGZA 1OCCB 3V4PH 3V95A 5C0RL 3GBLA 4IEFA 4B3EA 4H44C 3QUXA 4ZMZA 35C8H 5DYOB 4HWNA 2J8OA 4FG6C 2QADB 2N1TE 3C5ZA 4W4OC 1MJUH 4PGEB 1UEMA 2R4RH 4OIIL 3V4PA 1JAEA 2YSSA 4B9YA 4NO0B 4POZD 2MQ0A 3SO3C 3LNIA 1AKPA 2R2EA 2XJLA 3HPJB 4W9KC 2P26A 5F7LB 2B9BA 1TZHA 1BSIA 1KTKE 3BGMA 1NANI 3QZBA 1KCBA 5EOCJ 1AS6A 5IB4B 1MCOL 4Y5XC 5FYKL 2V2WB 4PJEE 4I7ZC 1QPPA 1JD7A 3NH7H 4FQHB 1ZDQA 3CBJB 5DEZA 1HZKA 3KBFA 4U2YA 5IHZA 4WSJA 4MCZB 3PABA 4OZGF 1UATA 3BZFB 3IETB 4KNQA 3DOSA 3T0EC 2BNQB 1E8YA 4TF4A 4JRYE 3ESUF 3P2DA 2QQLL 5ICXA 5H35A 1A3ZA 3O6ML 5IESH 3QDMA 2YGVA 1MIEL 4M62L 4AGLA 1L0PA 3BUTA 3IGLA 1MJ7L 3ZL2A 4XB7A 3SGKC 4TNFA 5HPMB 3BGAA 5CCGE 1IZKA 4MX7A 4FFYH 4AKPA 1F97A 1NMCB 3U7AA 1N6VA 4EI6B 1ZVSA 1CU4L 1FG9C 3AADB 3AJ7A 1XGUA 3FW6A 1ZE3C 4GW4B 4FFYA 4OLUH 4O2CA 1DE4B 1H8OA 4PCSA 1TQSA 5A2JH 3IJYA 2H32H 5DD1L 7CGTA 3KPQB 3DX7A 2XA3A 4BFBD 3GLAA 3QDJB 3AXLB 2HJFA 1KJMA 1N10A 3U4AA 3VFWB 2H32A 4WWKD 3TO4A 3CFTA 5C0AE 1R6VA 2VIRA 2AK4E 2Z6FA 5DO2D 2HT3D 2ZCLH 3RPKA 1NGPL 43CAB 4LSUH 1ACYH 5IEKB 3L3JA 3GRWH 4NQCE 4X9FA 1NBVL 4PRDA 3EHBD 3RTLA 1A4JA 2APXA 1OCOB 1KBBA 4FI8A 1DL7L 3GRWA 5ETUB 5IZ7A 2F74A 2OP4L 2YD0A 3LS5H 4YHLL 1E5YA 4QO1A 3CDGA 3S2AA 1RFDL 1AR1D 1UM4L 3O6LL 1NZRA 4JUSA 1N64H 1SJHA 2DWEA 3BPNC 3NJXA 3BMVA 5D7JA 2Q10A 3BH8B 3QCUL 3ILPA 4JJOA 5D7KE 4YBLC 3V5HA 1AHWA 2ZWSA 5CSBA 3NIGB 4JFFB 2DQTL 3LN4B 4KRPD 4R2GC 4XP9L 2PPFA 1PFOA 2KDGA 3RY6A 2BLFA 1A8JH 2W91A 3VWJA 3TO2A 2Z65C 3ATBA 3OJMB 2N0KA 3X12A 1Q1JH 1HESA 2VC2L 2WXFA 1U93A 1MFBH 4KI5D 1Z9SA 3M8OL 3NCYS 1PEWA 4Z3JA 2ZXAA 4MJIE 3JYCA 3WY4A 3V2AR 1ND0A 1AGBA 4R96B 1LE5B 2WNXA 5BJTA 4OZFB 2BSRA 2EVFA 5AZ2H 2R1YB 4HP5A 4A2FA 4P2OA 3ZYOA 3RQ3A 5FW8A 1A3QA 4PRIE 3GPEA 4QRRE 4D9RE 2MPAH 3LKNB 4RWYL 3Q8BA 1MCIA 2C1PA 2NX5A 2VXVH 5FXCH 1HHKB 5CCKL 3BLKA 4AIOA 1A65A 1T89A 5DEFB 3QNXA 3NIDF 3LPGA 1NUDA 4HIEA 1AZZC 4Z7WB 2WKGA 3JV4A 2AF2A 5IOKA 3MUHL 1HVXA 5JHLH 1BQ5A 2E8ZA 3IFPB 4QJ3B 4NKIL 1FV1A 4KY2A 4FE9A 3B2XA 5FPIA 3AABA 5EPMA 5JQ6L 3VXMA 4FNQA 5JHLA 3QEQA 3TA3D 4WFFE 4DZBB 4XN2A 1N5AA 5KSUA 1U8MB 3OQ3B 1L9RA 2AC0A 4OF5A 2DW5A 3P54A 2H1XA 4NCDA 5I19H 1V8HA 2P8LA 3FT1A 4NQEB 4D8OA 3RFZC 3IVKA 4EVNA 1A6WL 5JXEC 3NJGA 2FEJA 1MAKA 2ADIA 3WCYA 1KLFB 2DQJH 2GYSA 4KMTH 1L0QA 3TZVB 1OSZA 4Y5VB 3OR7A 4P3WA 2VLRA 4RZCA 2Y36L 3O11A 3DPBB 4OCSL 1M9SA 3TBWA 4NQUA 5IHHA 4PJCA 1A1NB 2XIDA 3OAYH 4JL1A 2OMUB 4G42A 4OCYH 5DVLA 2CUMA 5EBWA 1U8LB 3N1FC 4MXWL 4PP2A 4EZLA 1OE3A 4KC3B 1RIVL 5LKNA 4U1SB 3EYVB 4PJBF 1Y07A 1QSFB 1WLHA 3ULSA 3D07A 4WV1A 3SIKA 1DEEA 4N26A 3IJEB 2V2XB 2PW2A 5JW3H 4UQCA 5CGYD 1YVLA 1RZJH 2GKIA 2PPCA 4C83B 1QA9A 1W0WA 3IS1X 4QUOA 1H9VA 2EDQA 5G5DB 3TFKD 2WXMA 4X7EC 2UVEA 2M83A 4LVEA 5AZUA 2CD0A 4MGXA 2OJEB 2JELL 2R2HA 1S5IH 5IQLA 4YHZL 3AITA 1GJWA 2I9LB 2QLVB 4LSQL 1CVRA 4ZD3H 4JKNA 2EVIA 5DC4B 2BOCA 4HOZA 2B3IA 4G9FE 4AXWA