4NPKA

Extended-synaptotagmin 2, c2a- and c2b-domains, calcium bound
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
280
structure length
269
Chain Sequence
b'FPVPKGVLRIHFIEAQDLQGKDTYLKGLVKGKSDPYGIIRVGNQIFQSRVIKENLSPKWNEVYEALVYEHPGQELEIELFDEDPDKDDFLGSLMIDLIEVEKERLLDEWFTLDEVPKGKLHLRLEWLTLMPNVSNLDKVLTDIKADGLSSALLILYLDSARNLPSSNPNPVVQMSVGHKAQESKIRYKTNEPVWEENFTFFIHNPKRQDLEVEVRDEQHQCSLGNLKVPLSQLLTSEDMTVSQRFQLSNSGPNSTIKMKIALRVLHLEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Extended synaptotagmin-2
publication title Structure and ca(2+)-binding properties of the tandem c2 domains of e-syt2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
total genus 53
structure length 269
sequence length 280
ec nomenclature
pdb deposition date 2013-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00168 C2 C2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4npkA01
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 4npkA02
4HLEA 3GPEA 1QATA 1E7UA 2ENJA 3B7YA 4TUUA 1DQVA 1DJHA 1E90A 4WWOA 4XZ4A 3CSTA 2WXRA 4ANWA 1UOWA 3APFA 4FJYA 3KWUA 3HN8A 4NP9A 1DJXA 4TS6A 1RH8A 4ICWA 1W16A 3QR0A 2WXJA 3IM1A 4QJ3B 3W57A 4F92B 1DJWA 4GB9A 3NSJA 3DBSA 3NZUA 4QJ5B 3NZSA 3PREA 2WXPA 3KWTA 4DK5A 2WXKA 1A25A 2K45A 2ZKMX 3L17A 4QAMB 2NSQA 4OVUA 4FHJA 4LCVA 2CHZA 3PS6A 4L2YA 3FDWA 3L4CA 4FJZA 4LDCA 2QZQA 4ANUA 4FADA 4Y1TA 2WXOA 2X38A 3ENEA 2K8MA 4KZ0A 2CM5A 3ML9A 1E8WA 4XE0A 5H4YA 3QAQA 3QK0A 1WFJA 2LHAA 4L1LA 2DMGA 5T8IA 1K5WA 3ZVVA 4TV3A 4LT7A 3RPBA 5JHAA 2JQZA 4WEEA 3L9BA 3T8MA 2R83A 2CJSA 4OVVA 4EZKA 3APDA 2V4LA 3FBKA 3R7QA 2WXIA 2CM6A 4QJ4B 3F01A 4PS7A 4KZCA 2YOAA 3PRZA 3P2BA 4G11A 4V11A 2A5UA 1DJYA 4AJWA 3CSFA 4PS8A 5G55A 3TWYA 2FJUB 3IBEA 3ZW3A 4KITB 4J6IA 4FLHA 4HVBA 1E8ZA 4FULA 1RSYA 2Y3AA 4NPKA 2Q0ZX 2Q3XA 4WAFA 4FHKA 3L08A 3L16A 1V27A 3DPDA 4L23A 3PFQA 4ANVA 3ZIMA 4ICXA 3N5AA 4DNLA 2Z0UA 3HHMA 3TL5A 1QASA 1TJXA 4FA6A 4MJJA 1GMIA 4GNKB 4IQHA 2K3HA 5KJ7E 2WXQA 1HE8A 4WWNA 1E7VA 5JHBA 5CCHE 3R7RA 4Y1SA 1E8XA 3PYCA 2RD0A 5G2NA 2FK9A 3F05A 1W15A 1UOVA 2ENQA 1DJZA 1E8YA 3HIZA 4A55A 2ISDA 1CJYA 1DSYA 2WXMA 1BCIA 2WXGA 3LJ3A 5CCJA 2WXNA 3F04A 2CHWA 2NCEA 4BGDA 3F00A 1BYNA 3W56A 1DJGA 4XX5A 2D8KA 3MJWA 4PS3A 5CCGE 2CHDA 3QJZA 1UGKA 3L54A 4JPSA 2YRBA 3OAWA 2ENPA 2WXHA 3JZYA 3S2AA 4NPJA 2CHXA 4F91B 5EDSA 2UZPA 3APCA 2N1TE 3SD5A 2EP6A 3QARA 4EZJA 3OHMB 2NQ3A 4WWPA 3TJPA 2BWQA 2A4ZA 4EZLA 4BFRA 4ANXA 3M7FB 4F93B 5H4ZA 2DMHA 4NS0A 1RLWA 3L13A 2WXLA 1WFMA 1YRKA 3QR1A 1DJIA 2K4AA 2CJTA 4IHBA 3RDJA 4L1BA 4URKA 1BDYA 2KI6A 2B3RA 2QZ5A 4AOFA 1TJMA 3ML8A 4F1SA 2WXFA
chains in the Genus database with same CATH superfamily
1T1YB 3QPXH 3VA2C 2YGNA 3E6HB 4ELMF 3RBGA 3DJRA 3HG1A 4U1MB 1JZDC 3GSXB 4IM8A 4UV7L 2BVYA 4ZQKB 3ILPA 2GY5A 4LDLB 1UG9A 2AMUA 3KPMB 4ICWA 3PV7A 4ZMPA 4JREB 3GEFA 2AJVL 2PW2B 1I9RL 3AMLA 1YPZA 4DVRH 4S1SL 4LIQH 4RGOH 3BHBA 4X7TA 1CQYA 2ZKMX 4I3RH 4AYDC 5EMYA 3V5HA 3TBVB 3N40F 1HYSC 1ZVYA 4Q9QL 5GRWA 2Y6SC 3G7TA 4CKQA 2ZAIA 4MNGB 4O2EB 1WAAA 3MRIB 2CDGB 2WZAA 3EOTH 2ZXAA 5K33A 2PTTB 5T3ZE 5ICZB 4Q9CA 3CHPA 3TCLA 4XP6H 5GS2H 4OY9A 4YDMA 3FN3A 1U8MA 2ADIB 2J88L 4JANA 1B0RA 3ASWA 3MX0A 4DAGL 1FNEA 2WKGA 3B8YA 2PWHA 1NOAA 4G7VH 3P54A 3WY4A 1A6ZA 3WO3B 3PWVB 1NLBH 4Z3EA 5G55A 1IKNA 3V4PH 2XWJB 5GZND 5BZZA 4NQEB 4J6IA 5IESH 3C6EA 4DQOL 4JNXA 5I1AB 4GRWE 4YSRA 4PRID 4ZRGA 4PJ7F 5BZDB 2XSKA 1H5BA 5CKAA 1E5ZA 4L5FH 2R8SL 3PDDA 3K6NA 3VO0A 2RACA 5DJZA 4K55A 4PEEA 4Z7QF 2X70A 5EU3B 5FA3B 1PZ5B 4UDTB 2VLRA 1MUJB 2BP0B 1NCCH 4JFFB 3B5HA 1KB3A 4GQ9H 3T1FB 3WOVA 3VXUD 4XBPA 2NY7H 3QQ4B 5FYJE 2YC1A 3D18B 4DZBA 4NAMA 1QLEB 4GG8A 3ZU8A 2H3NA 4XPGL 1TZGH 4HS6B 2V5RA 4Z7NE 3E2HB 2OK0L 4WV1B 1J5OL 1AR1D 1CE6A 5FHBL 3LPFA 4KJYA 5TK4A 2NTSP 2OV0A 2Y7QA 4XVTH 3G5VB 4Q9BA 1JV5A 1BIIA 4UIKH 1JPGB 1NCWH 1SXBA 2H26B 1U8LB 1VCBC 2CGYA 3HB3D 4M4RB 4PJBE 3M7OA 3D1MC 4WWKD 2Q2EB 2APTA 1OW0A 2I69A 5CILH 4F7TA 4JDZB 3R4DA 1Q9OB 2WUBH 5DS1A 3QXWA 3V0HA 2A73A 1JVKA 2YZ1A 4YDZA 2B7DT 4MMZB 5CEXA 4HU2A 4JGNA 5B22A 2VN7A 3L3KB 1K3ZA 4KK5C 5BMFL 1Z9OA 43C9A 5BRQA 4LDOB 2VDMB 4MJ5A 1ZWIA 2VMEA 2M8XA 4PJAE 4WU5B 2GTQA 4X98A 4XWOC 4A6YB 5KUMA 1QNZH 1NCUA 5M7QA 1QSED 3NIDE 2C8NA 1JMZA 1HHIB 1B4JL 1MIEL 5KSAB 3MNMA 2DI7A 1IFHH 1HSBA 4MNHA 1U93B 2CSPA 1OTUD 3G6JE 3LYRA 4JPVL 4L1LA 2EDBA 2WP3T 4QYAA 3LPPA 3MBWB 1WTLA 1EJOL 1MWAH 4ZFQA 1F18A 2FYYA 1TQCB 2QSTA 3IU3B 4YSQA 1BAGA 1NPJA 2EE2A 2VDQH 5DVKA 4DN3L 4MJHA 6CGTA 1P5UC 1IM9A 1MLCA 1QSEE 2DQHH 2VDKB 2XTJD 4ODSL 4X80L 5GGSY 4YXLH 1WSST 5DMKA 3IMRA 5GGSA 1JYNA 1AGCA 3N1MC 2ESVE 2R4RL 2C3WA 3HE6D 4G43A 3F84A 1IE4A 5KVDH 1W8EA 3KS0H 1DL7H 4HXBL 3H7LA 3MV9A 3ARGA 2C1PA 4XNAA 3QG6B 5FK9A 1G7JB 3V6OE 1Z0MA 2IFFL 3HUJA 4B3VA 2F68X 2MTPA 3QIWC 4TVPL 4NQTA 4XI5D 4ZUSB 3BUPA 1TSHA 3S35X 4QRPD 3LJ3A 4RQQA 1B6DA 4YC2B 2IQ9L 4ZUUA 3O6LH 2HT2C 2KQNA 3HE7B 4LQFL 2AXFA 5D5MF 5EN2B 1GZQA 2J55A 1FAIL 4FG6C 3SBWC 3CDGA 2QPFA 4RA3A 3O4LA 1CXIA 1ERNA 1HN1A 3L5HA 1TZOA 3N42B 3UTSE 3HG1B 4XPAH 3QJTB 1IVLA 5HYEA 4MVBC 1QTSA 3DMMD 25C8H 3ILPB 1MJ8H 3NIFB 4GPVA 1MH5B 4KH9A 1PZSA 1MJ7L 4P3DA 4QRPE 4YSDA 2PABA 3TYFA 3TZVC 4Y4HC 1EEQA 1UH3A 1JYWA 4PRBA 4NZ8A 3ULAB 1J48A 3E3QE 3OMAB 3T2NL 1EGJL 1OIOA 4H0LC 2QZ5A 1MDAA 3FSVA 3BHBB 3QYCA 2UVFA 4P2QD 1MELA 1XGRA 4X7TB 1S7SA 4EVNA 2IGFL 3V5HB 3GI8H 4PBDA 2EEDA 4P2YA 1CGSL 4FF9A 4ODHL 3SHSA 3W82A 5CD5D 4OFQA 2EDNA 4OR1A 1IAIH 2CRYA 4L3EA 3F7LA 5KOMC 1NUFA 4KKAD 3L1EA 1VZGA 4ZW6A 1THCA 3TCLB 5K1VA 4D9LL 2HUEA 2IBZX 3EYSL 4C56D 5KBDA 3QRBA 4XGZA 1U8MB 4A7GF 4JANB 5F7HA 1B0RB 3MX0B 4OGXL 1UM6L 2FT7A 5BV7B 1FNEB 5FLUA 3L48A 1YC7A 3CX2A 2X4NA 4P2QE 4Y1AA 1A6ZB 2VSKB 1HESA 2HX9A 3KWTA 3SBQA 1D7DA 3PHAA 1TTRA 1J1XH 3CDFA 3T2PA 1IFGA 5HHOA 1Z5HA 3CQQA 3K2IA 1J9SA 5EZIL 2F1BA 2JJVA 3KGTA 1AFVH 1WGVA 1QWNA 2OSXA 3AT9A 5D2NE 3LZNA 4B53A 1CFNB 5J11B 5A7BA 2QR0A 1H5BB 3BDYL 1DVUA 2HRHA 5EO0A 3AT8A 3L6FA 1FAKT 3U25A 4L0PB 1INEH 2XN9E 2YK1L 5DJZB 3R7QA 1WZLA 2X70B 2DAVA 4PJ9A 4LCCC 4XC3H 5JA8B 5EF2A 3GF8A 4GW5A 4N24A 4EKXA 4NZUH 1IMHC 1BBDL 1C5CH 2HRPH 2YGVA 4WNQA 3ZO9A 1MRDH 4XBPB 2YC1B 4DZBB 3ZTJG 1L6XA 4FTVD 4GG8B 3K5RA 2H3NB 1JNNH 4NJ9H 5I19L 3NA9L 2OTPA 1WISA 4JKWA 5K59F 1E0OB 4XP1L 4HK3J 2HXAA 5CLYA 1CE6B 3O45A 1CMOA 4LNRA 3NRPA 4KJYB 3WJLC 5KUKA 2BK8A 5C86A 4K4KA 5LBSA 2O5ZL 5EU6D 2OJEA 2JSFA 2Y7QB 2LFGA 4LOVA 4KXBA 1JTTA 1JV5B 5BO0D 1BIIB 2JKNA 2N3JA 4W9FC 4G7YL 3ZDZF 3GI9H 4NZTL 3QZBA 2OP4L 4H0IA 4ACTA 2GJJA 3KDPB 1HU8A 2BSRA 1UUNA 5TF1H 4F7TB 5HDQL 2PP8A 4IEFA 5HHMD 2A73B 3GUFA 3KR3L 1QWHA 2A4ZA 2DIBA 4IU3A 5EU6E 5CEXB 5B4MD 4FOMA 1YYLH 5ITBL 43C9B 2W60A 3EXLA 4X4XA 4MJ5B 4F33A 1ZWIB 3CXDL 1PZCA 4X98B 2YUWA 1OP3K 1WT5C 4ZJ9A 2F8VA 3V95A 5DEFA 3CFQA 4XXWC 1VCAA 3L2NA 1I8UA 2WAHA 4HJJH 3NZ8A 5L7XH 5GZNA 1HSBB 4DFHA 1XB3A 4IBSA 4MNHB 4N8CL 1B0GA 1HEHC 4N0YH 2MMXA 3P2TA 4AQOA 2UZYA 1KELL 1U9KA 2VOTA 5L4MA 5E7FA 3HI5L 3CIAA 2FYYB 2HN7A 1Q90A 1CI3M 1Q0YH 1YECH 3NZSA 4Q0XL 1CK0L 4PRIA 3B6SA 4I0PC 4P99A 1IM9B 1MLCB 3MLWL 5AG8A 2AV1A 4JHVA 1BW8A 5H37H 5GGSB 1AGCB 1GA2A 4FC3E 2DLFH 2OJ1A 1X6NA 4G43B 4OCWH 3VQMA 2D0GA 5JW4R 4FAAB 4F9PA 1EDQA 1FGVL 2PUQT 3FFOA 5DRZA 5EWIH 5I2IA 3H1ZA 4IIZA 2XCMC 3VXUA 2A6DA 3ARGB 3MV9B 4DO4A 2C1PB 2PWFA 4PJBA 4QRQA 5FK9B 2GITA 3CSYA 3HBGA 3HUJB 5HHXL 3QQ9D 1FLRL 2P49B 3T3PF 3LS4H 4H2AA 4J8QA 2EKSB 4FMFA 4HJTA 3MLSH 1GGYA 1PDKA 3NEXA 4ODTL 4YZWA 4ZUUB 4DTGL 5HVHC 2AXFB 5D7KE 4JQIH 1GZQB 3GQFA 3CDGB 2Z4TA 2D7PA 1HHKA 2H1PL 3O4LB 3VWKD 5SV3A 3VGAC 5DVNA 1WBZA 2NPLX 1SEQL 5JDSA 2VB5A 2F61A 4WWKA 1P9MC 1DQDL 2B16A 1FZKA 4H8HA 4GQZA 3GM0A 2JQAA 4L3FA 2APWA 4P3DB 5GS0H 4TNWF 3TYFB 4HSQA 1URIA 3WTVA 2CZNA 1QFOA 4PRBB 1T03H 3F00A 1Q0XH 3HAEG 4XPBH 4R7XA 4TNWK 3OQRA 2VR6A 4DCQB 1XGRB 4Y89A 1S7SB 4EVNB 4M6AA 2PCPA 4LGRB 5F7LB 3ABLB 1ACXA 4GG6F 2NZ9D 4L3EB 4KGJA 2CQVA 1ZT1A 1QSEA 4EUPA 2NXZD 3KEHA 3B7TA 3BAIA 5HVFB 4XGZB 3WFDL 1Q0EA 3C5ZD 1YQVH 3ZIYA 1JUFA 3ZN6A 5ES4B 3I84A 4HUUA 4Y1AB 2X4NB 3K71A 2ADFH 1A7NL 1QFHA 3LHPL 3QZMA 3RA7H 1V05A 2GQHA 3ARQA 5LDSA 2C4XA 2R56H 3V6OA 4DOHB 2A9CA 2ZAGA 5HHOB 5I6NA 2ZYHA 4XP5L 5AW2B 3VD3A 1CD8A 2EIJB 4NM4H 2DRUA 1A1MA 1NZRA 4HV8A 4KOCA 3SCMA 3HC3L 5L4JA 2DQTL 1CLZH 5GS0C 2QR0B 3HE6A 3PPSA 4B0MB 3N50A 4AE1A 5EO0B 2Z31C 4GYBA 1CD0A 3L6FB 2QTVA 4PJ9B 4OJEH 3AS2A 3AREB 1KGYE 1YJDH 4GW5B 3DIVA 1WEJH 1EBPA 3BQUC 5C0BE 3UC0H 4WNQB 4QRPA 5IGXL 2B9AA 1UENA 3H85A 2AJXL 1PLGL 3E80A 2J25A 5F1NA 4HCRA 1Y18A 3LNIA 1UCTA 5I0XA 1CGTA 3O45B 3RAJH 5J6HA 2G60L 3FULA 3GPSA 1C5BH 3FCUB 3B1TA 2DQGL 2OJEB 4BZ2A 1GPOH 2PPCA 5HDWA 4Y5VC 3TJEL 1LO2L 4LRIC 3DMMA 4F2FA 1FDLL 4OLEA 5PAZA 5KS9E 5GGQL 2I5YH 3TVMD 1F3RB 3IDNA 3WBDA 3RNKA 4LP8A 5IFAH 4TSAH 4POYA 2BSRB 1UH2A 2JLLA 4P2QA 2R4SH 4OCSL 4JZJC 1Q72H 4IEFB 4MFHA 3N6YA 3OG4B 3V7AG 4X5QA 4IU3B 4L4TD 4P3CL 1FJ1A 1ZV2A 2Y69B 3Q8AA 2QT6A 4PW9A 2X3AA 5CGYD 2QVIA 5KN5A 5FX3A 1YJDC 3OL2A 43CAA 5HDBE 2JB6A 1MCNA 2W60B 4X4XB 4BGDA 4C56A 4GRWB 4BFJA 4F33B 3EGDB 1T1WB 1X5XA 4XX5A 4WZ9A 3W5NA 1T7YA 4DP7X 1UM5L 1EANA 4FZEH 1ILSA 4LVNC 3MACL 5DEFB 4KRPC 1HXMA 3SDYH 4HUWA 3ZKQD 4NHCH 4ALAH 2QBWA 3NZ8B 4AV4A 1KBPA 2C7FA 2A6KA 3MSPA 4HZLA 3GXDA 4YUEL 3LSOA 3BUDA 2HG5A 1B0GB 4ZMYA 1WGOA 2DICA 3FRUA 4C83A 2UZYB 1TEFA 1ASPA 4ZNCD 1SVCP 3LKQA 2HN7B 1URLA 5EBMA 1TETL 4HK3N 4PRIB 3GDBA 3B6SB 1RIUH 1R5WA 4JVPA 5KSBA 1D6VL 2AV1B 1CT8B 2DWTA 4YHYC 4R90L 1T7XA 3ARBC 3RGVD 2F74A 4XRCA 3ILQD 4P2CG 2QQNL 5ALCL 1HINL 4GI9A 3CBJB 4JN1L 5DRZB 5B3NA 5I2IB 4X5XA 3VXUB 2A6DB 2ZSVA 2BDNL 1UTDA 1FHGA 4PJBB 4QJ3B 1ZVSA 4QRQB 4FTVA 2GITB 4CVXA 3CSYB 1MY7A 1AC0A 1Q9KA 4NO3A 5AWNH 3ZL4H 3ZZ1A 4AUYA 1JSYA 3G5XA 1AR1B 4U4BA 3VGGA 2A1WL 5ICYB 1PDKB 3MRDA 1NIAA 5EU6A 3UG5A 4L4VD 4ALAC 4PJIE 3BO8A 1OCCB 2BHZA 1N68A 3Q2VA 2XJLA 3QHZL 3DX7A 1XZWA 3BP7A 4M8VA 2P24A 5T3XH 2A4EA 4GKOA 5B39G 3H9SE 1HHKB 5HGGS 3HB3B 1WBZB 4NNYA 5JDSB 1MRFL 2AK4D 2M1KA 5T8IA 5LWYH 4A2LA 4WWKB 1G5AA 1FZKB 3F85A 5EC1A 2F58L 5CS7A 2EVIA 3NIDB 4LSSH 4PHZA 1BFVL 1F2QA 3B2UD 5ERWA 1O75A 4ZUWA 2GY7B 3I3BA 3LN9A 4AM0A 4C55A 2YLHA 5JDJA 1NJ9A 2ZX8A 1CE1H 2QQKL 3VGEA 2PCPB 1T6BX 3INUL 1YYCA 1MCWM 2AI0H 4OZHB 5E4OA 4MA3A 1S9KC 5CFAA 3LD8C 4JQVC 3C6LC 1ZT1B 4A7VA 1QSEB 4EUPB 3GXTA 3AG1B 3AXIA 4L9LA 4LO9A 2G75A 1R5IA 1W15A 5GS1A 1KYFA 1JUFB 3R8BB 4A7UA 4M8QA 1NCDH 2CBOA 1CXKA 4HUUB 4M7KL 3K71B 5JW5A 1EHLL 2VN4A 2CO6A 3FK3A 2GEQA 2D9CA 3DO3A 3UTTD 4PJHE 4AH2A 4W9ZA 1JGLH 3WO4B 1A1MB 1PCSA 1V7MH 4TSCL 3JYBA 2AK1H 4HV8B 4UDUA 3DHMA 2Z65C 3SCMB 2VH5L 4W4OC 4Y2DD 5DR5H 3HC4L 3VRLE 3HE6B 2WQSA 5JOPD 3HAEA 1M9WA 2K70A 5TE6H 1XDTT 4K71B 2DF3A 4TNFA 2OZ4A 4NP9A 1A7PL 5E5RB 5BOJA 3FCBA 4LEOA 4EN3C 1BM3L 1A7OL 1J86A 3H4HA 3G6DH 2J1YA 1SYSA 2G2RA 2RBLA 4QRPB 2YHGA 2C3VA 2WINA 3VWKA 2ZXGA 1ZGLA 5E1AA 5ID0A 2J3SA 1E4WH 1IC5H 4XNMA 3LN4A 1P4UA 5TDNA 4LKXA 2PMZA 1Y18B 5DA0B 5J13B 3HR6A 2FJFA 2P5WE 5CFHA 1YEHL 5J6HB 5JOFA 2W8CA 5L4IA 5BW7A 3CXFA 2XN2A 2VR4A 5DGQA 2O5XH 1P0SE 3WNMA 4Z77A 2R59A 1MCBA 1ACCA 2LVEA 5J4MA 4GAJL 4N2LA 3DMMB 1FO0A 4MYWB 5LBVA 1MFBH 4GW4A 3QNFA 5E8DH 2F15A 4OQTL 2FO1A 3DSFH 3IDNB 3RNKB 2CM5A 3NJNA 3QAQA 3U9PL 4ZMNA 4P2QB 2HFFA 2Q7AA 2PR9A 5EH1A 2ZPKH 3WIHA 2AITA 4JE0A 4P5KA 5AZEL 1FJ1B 4HBQA 5AVZB 5KN5B 4FQXC 4G11A 3U9UA 1ZSHA 2D3VA 43CAB 3TONA 1DBBH 2JB6B 1G1CA 1OPGH 4NRZA 1QR4A 4U0QB 2DWYA 5GS3A 2B9BA 4C56B 5DFTA 4DWHA 1Z9PA 3C5ZA 1CLOH 4F1ZA 2GUYA 5K69A 1PX4A 5D93B 2J5WA 5D4HA 1KJ2L 1HXMB 4LARH 2K3HA 4HUWB 4P23C 4HIXH 2GW5A 3DRTA 3TGXA 4ACPA 1SDYA 2A6KB 4HZLB 4N6RA 2BH0A 3LSOB 1KEGH 2HG5B 2IF7A 2J1XA 3F05A 1M05A 3FRUB 4IOSD 4C83B 2ZX6A 2P4AB 2IV8A 3LKQB 2FAUA 4K5NA 4I18A 1YEFL 3D51A 5EBMB 4P9HL 4FXGC 5INCA 5KSBB 1R5WB 3MZTA 4A7QA 4BCYA 1YN7A 3EJJX 4YHKL 3GS0A 4YHOL 3UJTH 1PNCA 1M53A 1AHWA 4CDHA 1T1ZA 5DHVA 1OTSC 2F74B 4XRCB 5DHXB 1P4IH 5FPIA 4TSBL 4FKHA 4Z7OB 1O0VA 1A4AA 3EOAA 4X5XB 2ZSVB 2BSTA 5TQ0H 1ZVSB 4HJ1A 1HYSD 1LM8V 4FTVB 4CVXB 4MLIA 4ODUA 5I1IH 2Y6SD 5KYNA 1Q9KB 2BNQE 3ECWA 2YGQA 4H2CA 5GRJH 2IADA 5I71C 4MBRA 3G5XB 5DDHA 2ZWLT 4PLKC 1JFQL 4J27A 2ENJA 3AY4C 3MRDB 5EU6B 4GP4B 3BO8B 1I31A 2ZOTA 3MJ8A 3DX7B 4OGYL 1RV6X 1JNLL 2P24B 3QJFA 3Q13A 2ICCA 3QQDA 4W6WB 4KNQA 2AGJL 1L9OA 1P1VA 3VW3H 4NNYB 3S8GB 5DHYA 2UZXA 1JZ2A 4I2XA 3TVMA 2APBA 3QFJD 5B21A 2VDRL 4X5RA 4JO4L 2BZCA 5EC1B 4OZIA 3RUGE 2J43A 4QJ5B 1H3PH 4KNUA 5EF1A 3NJXA 1S7RA 4CRPA 2L3BA 5ERWB 4ZUWB 5CU5A 1NBZA 2DLGA 5HHMB 5DZOA 5E99H 3FDWA 3HI1A 2N56A 4AM0B 3QUXC 4PWFA 2ZCKH 1DVFC 1OEZW 4UBDC 5BZWA 1SVZA 1GCFA 3MNVA 2GC7C 5FWRA 2YFOA 2E9IA 5GXBB 2MOQA 4MA3B 1J88A 2YQ3A 3GRGA 5IUSA 1SBSL 2CJSA 3CFKA 4BZ1H 3A6OA 1U36A 3F62A 3MOBH 3P3SA 4L9LB 2WNKA 1NGQH 1R5IB 2G75B 1ZEAL 4XVOA 5CM1A 1NWOA 2JXMA 3IU4L 1GW0A 4IW4C 1LP9E 2O93L 1QACA 1N5YH 5A40E 4PLJC 2YWZA 1T7WA 3MJ9A 5JW5B 2R2CA 2CO6B 5IQMA 2ODIA 2MPVA 4LIQE 4L3AA 3ZTNL 3UBHA 4Z0BL 5T5FA 4WUKL 4AH2B 4I89A 4UTAA 1AI1L 3IE4A 1MCQA 4UDUB 1AQ8A 2CRMA 4WI8A 2XU9A 1DBKH 4YSPA 4DN4H 4I5BA 3LKNA 1DZ0A 2F19L 3RGVA 2I7SA 4P46D 5AQ0A 2NY0D 2W9DH 5CEZL 4H25A 3HAEB 3WFEL 3CFDA 1SHSA 3STLA 5TFSH 1AIFA 2BHFA 1ROCA 3DARA 2CK0H 3QS2A 4LEOB 1T2JA 3CDCA 1IBGL 5CBAA 1CLCA 3JZYA 3SQOL 4J39A 4F9LA 2UZPA 1XF1A 5EO1A 3BYTA 5AVUB 3FJTA 2E4FA 2G2RB 4TM9A 2C3VB 2WINB 3I9GL 4LPUA 2D2OA 5E03A 3VWKB 1ZGLB 5E1AB 5T1DH 4XWOD 3U36A 2HX7A 4KAQL 4XNMB 5ID0B 4B5ZA 4S2SA 5TDNB 4LKXB 5EUOF 4R84A 2FJFB 2VRKA 3TXAA 5DGRA 5JOFB 2MQGA 3B7RL 4IKIA 4J3OD 1KB9K 4L5FE 4BDVA 2AK4A 3MGOA 1ZLSH 3HZYA 4KGLA 4Z77B 1ZPUA 4H88L 2V33A 3MCLL 4KKPA 1FO0B 4LU5L 1DJHA 1Q1JH 2Q7NA 4GW4B 4PJXB 4Z7WF 5JHMA 4W1TA 4DGIL 5FM5O 5J3HC 1D5IH 1NCIA 3HZKA 1IO4C 1OM9A 5EHFA 1G6RH 2HFFB 1OARL 5I1EL 1MHPH 4KU1A 5E2VL 1BSIA 2BOLA 4JGMA 1KFAH 4P5KB 3UGEA 4YHLL 5IQOA 4JKPL 2FWOA 2XWXA 2R29L 4PJHA 4W9EC 3VXSD 3WAJA 2J1WA 1JHTA 5I9QB 3U9UB 4QXTA 1WHOA 2NXZB 1JS4A 3MRHA 3QE5A 4NRZB 3FT9A 5GGTH 3SN6N 1QI3A 1P7HL 4K23H 2X44D 2HH0H 3C5ZB 5JOEA 4JFHD 4WNJA 3CUPA 2I60L 4J3OG 5I8KH 1F02I 4NBYB 5K1NA 1A66A 2BP8A 1X7TA 4LT7A 3F58L 4V33A 4G6MH 3DRTB 3UTTA 1Z9LA 4N6RB 5DJ2A 3EJPA 4JMXA 1AQKL 4X4ME 3VXSE 1A4BA 4PRPE 3WI9A 1M05B 7PCYA 4HS8H 4AK2A 3K8MA 5IJKA 2CA4A 3ZW3A 2NQDA 4HLZH 4I18B 2MQCA 3TEXA 5L2JA 4DGVH 4Y2DA 2W81C 2ZTBA 5INCB 2YXVA 1PNDA 4TVPD 3ATBA 2ZUUA 3UDWA 1YN7B 5GJTL 1CDGA 1T0OA 1AHWB 4GNKB 1T1ZB 4RH4A 3TZVD 4QRUA 4Y4HD 5DHVB 1V10A 2QQLL 3EJSA 4LP4A 3BJLA 3P0YH 4QXUL 3EOAB 4CJ0A 3CC5A 1WBXA 1PYWA 3NPSC 2BSTB 5AKTA 5DZLA 5HI5C 3DHUA 4X5LA 2AQ1A 1PKOA 2WOBA 1MPAH 3BLKA 2X1XR 4M61A 4LOUC 4ODUB 3WTYA 4MS8D 3D9AH 3WEBA 3PHOA 4HWNA 1P4BL 4XP9H 2IADB 2DMBA 5DDHB 3SZ6A 1NCBH 3T6XA 5EOCL 1FLTX 1DLFL 4U1IA 4KRNA 3VXOB 3K80A 3QFGA 3MJ8B 4OCYH 2ZOUA 2E6QA 1KBKA 3QJFB 3QQDB 4JO5A 3EYFA 5KVDE 2OMBA 4WTXA 2VSCA 1MOEA 1IC4H 1KV3A 1NANI 2UZXB 5DHYB 2IWFA 3FNKA 3GKWH 4I2XB 5LO7A 3TVMB 5I6MA 3D4GA 3LRMA 5HI4D 5J1TC 4OZIB 3QEUA 1AG6A 2E56A 2Y06H 4PH8A 1S7RB 2MEJB 3CCHA 3T4AA 1DQLL 1NBZB 2VDPB 5ADPH 3HI1B 1EO8L 5FAAA 4BQ6A 4Y88A 1UWXK 4YK4C 4MQSB 3RVTC 3ZE2F 2VJ8A 3LY6A 2VIRA 4B27A 1X6LA 2YQBA 1Z66A 4BK5A 4LCIH 3MNVB 2KHAA 3GS4A 1NBVH 3EDDA 5EU4A 4BXSV 4LLMA 5L8LB 3NOIA 4HJGA 3CFKB 2V7HA 3FQRA 4NKQB 5FO9A 4KK8C 4R4NC 4ZMXA 3PWJA 1E3FA 3FSWA 4OD1H 2JXMB 2NX5D 1H3GA 2AFNA 3QT2A 3QPQD 4PJCE 2QLVB 4XPHL 3D87B 2H45A 2SEBA 4JCLA 4IOSA 5ICUA 1CR9H 1SM3H 1XB6A 4KH2A 3LPWA 1RUMH 3QZPA 3V6ZA 4YDKH 3VJ6A 4YLQT 1VHPA 5JPMC 3BSHA 2YA1A 3D39D 2EE6A 5SX5H 3NYKA 3LIZL 3BFWA 3ZQWA 2PF6A 3M86A 3ZYJA 3U2IA 2ZJSH 4KKLC 4XVJH 1E6JL 4PV1C 1GKOA 4WEBL 1VRSA 3FMGH 3LVEA 4ZMAT 4I5BB 2VMJA 4X42A 3LKNB 3RGVB 2YOAA 2X4OA 4YNYA 1MVFA 2ZG3A 1FIGH 4FXKC 4H25B 3ZR6A 2HKFL 1G43A 4DEUA 2WNGA 3DX2A 3CFDB 4OT1L 4PW3A 4AJVA 1T83A 5B1BB 4KZEH 3STLB 2MPAL 1AIFB 1WZAA 3IJYA 3OB0K 5DJ0A 1ZHBA 1NMAL 3O6ML 5CBAB 4PJDF 3RUGA 1H8OA 5EO1B 3ILEA 5EIQA 5FGRA 2NY2D 2EDYA 2FECL 3KLKA 2BSDA 1J8SA 4R4FL 5D1XC 3DK0A 3EF7A 5L6YH 3U36B 4S2SB 3LQMA 4B3EA 1JERA 4EOWL 3T2LA 1WICA 3GO1L 4PCTA 5ABZA 4BDVB 1RUPH 5AOIA 2AK4B 3MGOB 3HZYB 4R8WH 2EUVA 4BK8A 1V7NH 3QFJA 4KNTA 3IMBA 2YRBA 5FYLH 1WCQA 5E9DD 1XB8A 1NGYA 5EIIG 1JGVH 3NESA 3MXVL 1S5IL 4AEFA 1LP9A 5BPPA 4NB7A 3ARZA 3HZKB 4H4NA 3FHAA 4XVSH 2FX7L 3GSVA 4I0PD 2DEXX 4OD3H 4IBQA 3Q6FA 4X6CA 4MSWA 3TFKC 2RQ8A 2PCXA 3JWDH 1DLHA 1KPRB 2FWOB 4PJHB 1YZZA 4FTDA 2ZYIA 5I1KH 1JHTB 1GGCL 4H20H 2DLHA 4QXTB 2MH4A 2K8QA 3MRHB 1ZVHA 1OOAA 1U8KA 3AC0A 1WLHA 2YAQA 2A9BA 1WF5A 2E3VA 4JCWA 4U7MA 1MQKL 3HI6H 3FZUC 3CN3A 3QW9A 2NXYC 3CUPB 2ZKHH 4GQQA 1OAZL 1A9BA 2VQUA 5FKPA 1ZLVH 5D8JH 2BP8B 3SO3C 4D3CL 3KPSD 2P46B 1W2KT 3UTTB 3OXSA 2J5LC 1BEYH 5DJ2B 3LZFL 3H3PH 1MF2H 3DBSA 4MKTA 4XMPL 3U6XS 1NOLA 3VB9A 4PRHD 4Z6AT 1MVUB 4L1DA 1F3DH 4U2YA 2FGWH 4XPTL 5F1IA 3OR7A 5L2JB 2QZQA 4Y2DB 4I1PA 3EGXA 1F90L 2BMKA 1OL0A 5LNGA 4QRSA 4TV3A 4QRUB 5HD8C 3JWDC 3LXBA 3TYGL 1OAYL 5HP5A 3RVWC 3H3BC 4PRHE 3RL1A 2ZCHH 3CC5B 1PZ2A 1WBXB 1JZEA 1PYWB 3U4BH 4OIIH 2ADGA 1KCVL 1RJCA 4M61B 4N85A 3IJHA 4PJGE 2BW5A 4JPKL 1IRAY 2Q3XA 2CKNA 3PHOB 3N41F 2AC0A 2BVEA 1MZYA 3L16A 1KC5L 1TZIA 4AQAB 2VYRE 1E4JA 3T0BA 4JFSA 4YHZL 1N6QL 2CLRA 2WIIA 4LLYA 4U1IB 1ZVNA 1BXUA 5D96C 5I1JH 1BF8A 2E8ZA 2IDCA 4XN2A 4YE4H 3O0RH 4AC2A 1NFKA 3FUHA 4UINL 2ZIDA 5G2NA 3EYFB 4PY8I 2Y2WA 3BZEA 2AHIA 5E1QA 3CFCH 1KCLA 2KT6A 3KWWA 4J3XA 4K3EL 4IBVA 3QEUB 2FT8A 1P5UA 3MJWA 3MU3A 2YPKA 2YRZA 1GCYA 3CCHB 1MCWW 3T4AB 1G0YR 5D7IA 3WFBL 2D7OA 3QBTB 3WD5H 1CVRA 4LEBA 3VXSA 5AVTB 3VQ1C 1T2QH 2AXJA 4GP5B 1YY8A 3G5YA 3B43A 3MUGA 4WWPA 3V52L 2VIRB 5DUMH 4KUCF 3M7FB 2X1PA 3QRGH 4NWUL 5LGYA 4LLMB 3W9EA 5C0GA 3WKPA 4HJGB 1J05A 3FQRB 2V7HB 3AB0B 5FO9B 2EC9T 2ZF8A 4KC3B 4TPRL 1A7RH 3PWJB 4R97C 3S35H 5L9DH 5E4IA 3H42L 4R2GC 2HFGL 3ZTEA 2XZAH 2SEBB 3FQ1A 4IJTA 5ACLA 2HUHA 2R0KH 4N90E 4P57A 3FPYA 3SBWA 1NCGA 3SDCC 5FF6A 2KZ1B 3OAUL 3EFOB 4PMFA 1LLAA 1VFOA 3V6ZB 3VJ6B 1AZUA 4KQ3H 4TNEA 3W39A 4CDGC 3QORC 1FBIL 1MCJA 5GIRB 3L9YA 4LPCA 4EI5D 2E5EA 3UJJL 2CRZA 3GZOA 3NSJA 1QWUA 1W6WA 2P5EE 3MXWL 2D0HA 1AXSA 2B14A 4Q6KA 3TZVA 5I0ZA 4Y4HA 2BVPA 3CHSA 4KK6C 2FBRA 2X4OB 4I0CC 4O2FA 4OVUA 4YNYB 4L2YA 2YBGA 1DQIA 3D2UD 2P80D 1ETJA 4O51A 2LE9A 3CQFA 3IMWA 2VISA 3OJVC 3KXFD 4KMTH 3IJYB 4XCFL 3MCKA 1ZHBB 2JCCA 5DJ0B 3DX3A 3KCPA 4XXDA 5HYJE 4WK2B 2ZYRA 4WHDA 1BOGA 3IDXH 3KVDD 4IRJD 5CJBA 3RUGB 1U41A 1M9SA 3EZJB 5IVXE 1OLLA 2BW4A 1CFVH 5EBGA 4PUBL 3WFCL 4ETQA 2V9UA 1EGJA 3QUMH 5INDA 5F93C 2HJFB 1U3HD 3A0OA 2VZ1A 4PRNA 3O6FC 4TQEL 4OB5L 3CFNA 3KXFE 2TRYA 1KCBA 3QFJB 2YGOA 2X0UA 2YAPA 1LYQA 1DQKA 1PD1A 3X1EA 4F7MA 5ICYA 1NGYB 5E2UL 3C5JA 2YAHA 3ESPA 3RZCC 4PLNC 2O72A 3T0XA 1FPTL 1LP9B 4PJCA 2LT9A 2OA9A 3GSVB 4GT7A 4O58L 3Q6FB 4X6CB 3GBNH 3OHXC 4MSWB 5GRXG 3UGXA 3DOHA 3S37H 3DHJA 3F04A 1DLHB 3ZT6A 1RZFL 4LCCA 4M48H 4YQXH 4XOBA 1BVNP 1FN4A 1IAMA 3RGBA 1RP9A 1H3VA 1HZHH 1NTDA 2X4UA 1YEIL 4KX8A 4JO3H 5CCJA 1U8KB 1GY1A 2XYBA 4KQ4H 2GJRA 1YYMH 2N1TE 2NX5A 4M7LH 1ZV9A 3L4ZA 3TJPA 2X4PA 2FYVA 2XPZA 4CVUA 2RHEA 1A9BB 5FKPB 2O6DA 1MIMH 3CVHH 2XIIA 3BKML 3OXSB 3WJLA 5DT1L 3D39A 4YSCA 3KL5A 2XV2A 3IFOA 4U1HA 1C8QA 4UILH 1UXLA 2I26N 2VLME 2BRRH 1OCWL 1U6AH 5EIIA 5F1IB 3OR7B 4PBWD 4F58H 3ZE0F 2DQIL 5JA9A 3EGXB 3INOA 3MTRA 1OD7A 2NY0B 4IRSD 3APFA 4HS3A 4A38A 2ROXA 3FB6A 2ITFA 2XA8L 1UEYA 3HFML 3HHRB 4GMTH 4PM1A 4BSVA 2HP4A 2OTWA 4WTWA 4JG1H 3BAYA 2JQMA 2XY2A 3RL1B 3WS6C 4DFIA 1C5DA 3DX4A 4B7IA 5LGJA 1N7MH 3Q8EA 5CJQL 1ZHKA 2ADGB 1IBYA 3T0DA 3NCCB 2LABA 4ODBD 2J8UF 3IJHB 4NX0A 4NZJA 1WIOA 5LCVL 3BWSA 1CGUA 2EACA 1Y6KR 3C6LD 2D03L 1TZIB 2D0FA 5HHQA 5CINL 3PIQA 4XXWA 3GRBA 2CLRB 2WIIB 4LLYB 2AJYH 2DYPD 4HF5H 1IQWL 1CBVH 2BXYA 1JPFA 2X53A 1QBLH 1KJ3H 2J1ZA 4F2EA 4TNGA 3FBKA 2NUPB 1LMKA 4U49A 5E9DA 1EHKB 2CRIA 3BZEB 1KCSL 2IDFA 5T3XD 1RURL 3BSZL 4NQCD 3QQXA 2ADYA 3KWWB 1U3ZA 4MWFA 3I3DA 4XOEA 4XN1A 3MO1A 2WZPD 2R1WA 4I0PA 4URTB 1BJMA 3LX9A 4QD2E 2YPKB 5KYXA 3M1CA 5DYFA 5IB4A 5D7IB 4ZX6A 4JMNA 1L9PA 3VXSB 1I7TA 2DI8A 4J4PC 1YY8B 3G5YB 4UWQB 1GYAA 3B56A 3MUGB 3ZUCA 1INQA 4X6DF 4X7EC 4BCZA 1IGTA 1E3XA 2AEPH 3GDCA 3GMPA 1COBA 5T3XE 4MMYA 1EJFA 4U6YA 2VXVH 3W9EB 2CCVA 5C0GB 1J05B 4Z18A 1QYGL 2MCAA 3WEAA 1ZGLM 1HIMH 1FFNA 2QMJA 1KF9B 15C8L 1F58H 1M2VA 1H3XA 1OXYA 4ERSH 2VC2L 3CMOL 4A2HA 2EE9A 4XCNA 3DVIA 4PRHA 4P57B 3VFGL 3L3JA 3ZKNC 1Z1WA 5FYKH 5FF6B 2ADJA 3O2DL 4OJCA 4XTRC 3W39B 5F44A 3NMEA 2UX6A 1P9MA 4HIEA 5AOLA 3WKMH 3BVTA 1NCJA 4GOSA 5I8OH 1OT1A 1E40A 1XMWA 2QHRH 1AXSB 1KJMA 3TZVB 1AGEA 4Y4HB 1HKLH 2BVPB 5EN3A 1JPSH 2GJ6E 5AYTA 4O2FB 3BUYA 5IY5B 3VXME 2JB5H 1TZHA 3P77A 5FIEA 3ZMRA 1G87A 3S88H 4JM4L 3V4VL 1XF2B 3S3DB 2DD8L 5CMAA 2X89A 4FFVC 4O51B 4WTZG 4DH2A 2J4WL 2VISB 2DMCA 1KOAA 3DOSA 2Y7NA 2JCCB 1FI8C 3MCKB 3OAYH 4N9GA 5F7DB 2QVKA 3KCPB 4XXDB 5KVFH 1BOGB 2FWUA 3KZ8A 3MLVL 4N26A 2NDGA 3KHQA 1K72A 1QAWA 3NZUA 5E2WH 2CO4A 5I1GH 1RZKL 4ETQB 3GBMH 5INDB 1R24A 5EU5A 5JHDD 1RZ8A 5D9SA 4AZUA 4OCXH 5JW4Q 3LXAA 4JQIA 4HPOL 3SDXB 3VD2A 1WIUA 1WITA 4O00A 2H6PA 2EIEA 3MOAH 1MFVA 1FGNL 2VN5A 4AVJA 5C6WH 3ML9A 3KS0J 4ZX5A 1A8JH 4F7MB 1MCLA 5BOZG 4U1SA 4LMQI 1NCAL 5DSCA 3C5JB 5IW6A 4Y0GA 3T8MA 2RCSH 4MQXC 5F21B 4AL8H 1RZKC 4PJCB 1IM3D 1A9EA 5F6IB 1XGTA 4AMKH 4JPWH 5GHWH 3E8UL 3MFFA 4IS6A 1TEYA 2KLTA 3S34H 1O9ZA 4MAYD 4C4KO 2J8UE 2RA1A 4AVKA 1IILE 4IU2B 4G8FA 4LCCB 4YLBA 1PZUB 1OTSD 2IEPA 1L9SA 1FFTB 4JHAL 4NSKA 4QHUB 1FN4B 2UZIH 2VLKE 3BQUA 2X4UB 1T89A 3GSWA 4NQXA 4I9XA 2P5EA 4NKIL 1C1EH 1NCTA 2NX5B 4P2RE 2EVGA 1P84J 5EFIA 2WWKO 2X4PB 2R69L 3FTUA 4DEWA 3L3HA 5JPNC 5D72L 4LZKA 4ABVA 1PL3A 4URKA 4WVRA 4NHUA 1ZLEA 3D39B 2ZNXA 2Y22A 3WGUB 3IFOB 4U1HB 4DUXA 3NH7L 4Y5VA 5HYJA 4LRIA 4B9PA 3ZT7A 1PBYA 1BVZA 5EIIB 5IVXA 3SD5A 2EINB 3QWOA 4EEEA 4AL8C 1XAUA 2W9EH 4HS3B 3D2UA 5EF3A 2P80A 3IE9A 5LGHL 4UQ2A 5IJBC 3FB6B 3HFFA 4JZJA 2D2CC 3S3JA 4NS0A 3KXFA 4BSVB 2DQUL 2TRHA 2OTWB 4L8DA 1DVSA 3QQ3A 4FNLH 4YWGL 1CF8L 4UBDD 3X3GL 2D7NA 1UA6H 4RGNE 1C5DB 4WI5A 4WI4A 4F8TA 4P5SA 4YVNA 2NY2B 4GEIA 3ZK0A 1ZHKB 1RIVL 2WGNB 2H47C 3BP5A 3NG5A 1TTCA 2PTUA 4G8EA 5D7LD 5CZRA 1HCVA 3MGAA 3QCUH 4WF7A 4PI2A 5HHQB 4XHJD 3PIQB 3ZKXC 2J44A 4RFNC 1ADQL 1HL4A 2IDSA 3A23A 4PLJD 1JPFB 2NY3C 4JHBA 4ELMA 2QQQA 4NZRL 1AS8A 4XB8A 5E9DB 1A14H 1INDL 1M2OA 2WK2A 4Z9KB 2AQSA 3ES6A 2PPEA 4MWFB 3MO1B 4Y2OA 4GFTB 1EZSA 2R1WB 4I0PB 2XZQL 1IGFH 1G9MH 3O3UN 3QEGH 4X7FC 1AE6L 5KYXB 2MTAA 5IB4B 3OWEA 4ODXA 2B1OA 4ONFH 5HPMA 1WD8A 3ARBA 2QVTA 2WQXA 2LHAA 3VXQA 4HT1L 1I7TB 2AEIT 2APXA 4UT9L 2WP3O 1TJGH 2FEJA 1INQB 1H3UA 1KPUA 3ESOA 3KYKL 1IGTB 5DJ6A 5C0AD 1LQSR 3GMPB 1ETA1 4MMYB 1BFOA 3T0WA 4U6YB 4JVUA 4Y9BA 3LNDA 5JW4N 5TE4L 1NMBL 5GRUL 1JI2A 3IBEA 4ZZKA 5SWSD 2NYKA 4HVBA 2P45B 3VD9A 1FFNB 1N8OE 1ODAA 2XYCA 5FS5A 1M2VB 1UB5A 3KPNB 4N2FA 4KDWA 4KJQC 4IHOA 4Y2LA 1WFNA 5F9OL 2AAVA 5HVHB 3BMWA 2FECI 4XCNB 4IQHA 2YQ2A 3EO1A 4PRHB 3PABA 5IB5A 3L3JB 1WP6A 3NDYE 3UCRA 2ED6A 2ADJB 2FZ3A 4N2DA 3VVWA 5FUOH 4UAOC 3NPZB 4Z76A 1PGRB 4HIEB 3C8KA 2WQVA 2LLLA 4IRSA 2Y25A 3TBTA 1MFDH 4GI6A 1XQ4A 1A6VL 1KJMB 2Q76A 4PJ7A 1AGEB 3OZ9H 4UT7L 2K7QA 3AROA 1SOXA 2FBJL 3BUYB 5J3HD 1TZHB 2IFGA 2LU5A 3P77B 4Z7VE 5DCCA 1O6VA 4JHUA 4NBXB 1J11A 5CMAB 4JZOA 1G1OA 1DANT 4MQ7A 4PJFF 2FX9H 1C08A 1U3JA 3DOSB 4ANXA 4N9GB 4M1DH 1TENA 2DTML 4JQVA 3AGVA 3C6LA 4FP8L 4ADIA 2Q8AL 4IIQC 2G3NA 3MV7D 2FNBA 3WL9A 4OKVA 2DYPA 3IFPA 3GSNL 1I8AA 3CFUA 4BFKA 2YQGA 1R24B 2B1AH 2ZWZA 4HGWA 4R0LC 1RZ8B 5D9SB 5EU5B 1I8LC 5FECA 1TXKA 2DJUA 2H6PB 4GSDH 4DPAX 3W5MA 3HNVL 4LRNL 3ARDC 3U0WH 4Z7UF 1T4WA 1KLUA 1WHPA 2H3KA 1B0IA 2J1KA 2N1KA 1R9FA 3K0YA 2WZPA 5FW8A 3EG9A 1XCXA 4TS6A 4OKDA 5AVQB 2YR3A 1IJ9A 4U1SB 4AYMC 5DZJA 3ARSA 5DSCB 3FC8A 3MV7E 2EUWA 5F7AA 5IW6B 4FS0A 1EJ8A 2EKJA 3F8UB 2G2NA 1A9EB 4HUMB 2EDOA 1XGTB 4DP1X 2XIBA 1A25A 3MFFB 4JY6A 4IS6B 4LCVA 2CIIA 2X9XA 4LL4A 4MQTB 3V5DA 4G8FB 2HG0A 1PKQA 3ZQXA 4WTZA 3TPUA 4ANUA 4EN3A 4NSKB 5EC2A 3VI4E 3BQUB 3GSWB 4YPJA 3FYEB 4NQXB 2P5EB 5HI5D 3TC9A 4HWBH 3WLWD 2ZSWB 4AEHH 1A6WL 1J0HA 5EFIB 5C3IA 1C7SA 2DM3A 3L3HB 1H3WM 1NSNL 2B77A 5MERA 3P2BA 1KTRL 2CGRL 2OMTA 4NHUB 4Z3GA 4UTCA 3CTTA 4IK6A 2LTQC 4Y5VB 5HYJB 1M56B 3EADA 3FUDA 2F53D 4J7RA 3EH3B 3SOBL 1E5CA 4DGWC 5IVXB 5DC9B 5FW7A 3H6JA 4OUUA 2DQDL 3QWOB 1DUZA 3UERA 2BP5M 2JI3A 5C08D 4AJYV 4ADJA 4EJ1C 3D2UB 4YHMH 3EBIA 2E7LC 1PLBA 4UQ2B 2BNRD 4R7DA 2V9RA 1KFGA 3KXFB 4LSVH 2BJML 4L8DB 4BQCA 1WWAX 3QQ3B 1JVLA 4K2UL 3SPVA 2Z35A 4FQXA 4XWGH 1NM9A 2F53E 4ZO8A 4BE5A 1KB5H 4GMSH 4OQTA 3BP5B 3ZSSA 2MIZA 1PSKL 4G8EB 1WFTA 2OM5A 3LQZA 4GIPD 4XNUH 2IAND 4Z3FA 3QARA 5JHDA 4LVNB 2V5MA 4L0YA 1W80A 4R4ND 4KTDH 1B0WA 1W0WA 3F7KA 5I5IA 1EHXA 5GISL 4BA8A 4ELMB 2E7MA 1QOKA 3RIAK 1BDYA 1L4IA 2F54E 2G5UA 2IAAC 5HJDA 4AUJA 4B7LA 4CU8A 3ES6B 4P2RA 1QLEH 5IUCA 1IM3A 5FYKU 3QR2A 2IXQA 4Y2OB 4NC1C 1G94A 3TIDA 3QIBC 4ZW5A 4MAYA 4YHYB 4ODXB 5FW6A 1I4FA 4K3JH 5HPMB 4QUOA 4A7TA 5C6PB 1DQJB 3ARBB 3ARXA 4BH8A 3WTSA 1E9PA 3S8FB 2BSSA 2F2HA 3EJZD 1A6UH 3BDBA 1FH5L 1KPUB 4K7PX 5DJ6B 1QKZL 2QPSA 1P5VA 1ASOA 1J8HD 1BFOB 1EZVX 3DXAD 4ZUTA 1RL1A 3HS8A 5JORA 3CHQA 3LXCA 4YZFE 1SNRA 3Q2CA 3P0VL 4Q6IC 3U46A 4EQ3A 3KPOA 1M6OA 3IPEA 5CEYA 2EVJA 5I1CL 1E5AA 2EO1A 3MLZH 1UB5B 5F70A 4NI3A 4GFXA 4IHOB 3AY4A 4UQBA 2F5AH 2DMGA 3EO1B 3BN9C 5DQ9A 3MMEA 1DVYA 2K4WA 3IEAA 3PABB 5IB5B 1MCHA 1IL1A 2B2XH 2FZ3B 8FABA 1H6EA 2VDMH 3ZZLA 2CDEA 2B5IB 4A6YH 4Z76B 5HYSG 5FFLA 3BVNA 3C8KB 5I28A 4IRSB 1S4IA 4HKZA 3TBTB 3TLRA 4JY4A 5KBLA 5I66A 3GC3A 1F13A 2GTZA 1CFQA 2Q76B 4PJ7B 5D1XE 4XMTA 3QUXA 4AQ8C 4Z7QB 3NBNA 3DI3B 3NP4A 1ONQA 1QLFA 4JZOB 3TH3T 2J20A 4MQ7B 1LL1A 4HUXA 1GAFL 4PB0H 3ARYA 4Y19E 3HN5A 3U83A 1C08B 2E0PA 5D7LA 5JW4M 1PZDA 5FFOA 4NAJA 3THML 2B08A 3C6LB 2VDKH 5LJYH 5A3IC 2AEWA 3FQNA 1CJYA 1IVTA 3WL9B 1CN4A 1UD6A 2XG5B 4OKVB 2DYPB 4QDGA 4IOFC 1KV7A 3ZRSA 3IFPB 3FZUD 3KBPA 3BD4A 4HGWB 4MMZC 4R6UA 3HCVA 3N44F 3O9WD 2HJKA 4WHYG 3ISYA 3S2AA 5FECB 5IF0A 1XX9C 4MA8L 1HCYA 4NQCB 1NC2D 2DDQH 4XC1H 1KLUB 2ZP8A 1NICA 4APXA 3C08L 1YEEH 3L5XL 3EG9B 1PZ3A 3V0DA 3QR1A 4NUPA 5IKCA 1SDAB 1BVKA 1PY0A 2DBLL 1KIQB 3H4FA 5FO8A 3ULVF 4JK0D 4XHQA 4B96A 4JG9A 4JY6B 1KTJA 3F7RA 3P3TA 4KVCH 5C0AA 4U1KB 2CIIB 4UNVA 2AJSL 2V8LA 3V5DB 4J12A 1PKQB 5CD3A 2YPLE 5KEZA 5DK0A 3RIKA 3TPUB 4D7BA 2HMIC 5HD8D 1UUSA 4EN3B 5EC2B 4K9JA 3ELQA 5SWSA 4FABL 2EYRA 1KNOA 5HHVH 2HLFC 5I74C 1UM4H 2NW2A 4BZ1A 4KY1L 2OMUA 4KTYA 2PYFA 4WY7L 5FYLE 5ICXA 3W57A 4LLWA 1NGPL 3RDTC 2JJUA 3B83A 2A4CA 2KDGA 2Y07L 3CZGA 5C1MB 5MERB 2X28A 1KTBA 2OMTB 3IT8D 1XV8A 1MW0A 4KK9C 2AXWA 2ALWA 1XTMA 2H1XA 2WYZA 5IP4A 1WZKA 3CFMA 12E8L 1QFWH 2YMOA 3UCQA 1FRGL 1UD3A 2X38A 5E0FA 4E5XG 1I8MA 2OYLA 1C8PA 3QCTL 3RVUC 3NFSL 4CW1B 1JWMA 3QXDA 4OGZA 2UUDK 1DVQA 3FU6A 3ORJA 4HOXA 4OUUB 1DUZB 4MDRA 5BV7H 4FLOA 4PGDA 4YXHH 1U8QA 4YN3A 1QHQA 2AJUL 1Q94A 1XCTA 1BZDA 1YG9A 4R7DB 1J8KA 1FUNA 3EHBC 3ZMEA 4X8CA 4XPFL 3APMA 1ZTXH 1HOCA 4NP4L 3SPVB 2IPUK 2VXSL 3B2DC 2Z35B 4UM8A 4FQXB 4P06A 2G30A 1QP1A 1OVZA 3CN2A 3MV7A 3O6KL 3JWOL 4Z95H 1EBAA 1TVBA 5JIIA 4LCYA 2MRYA 3KM2A 3LQZB 1BF5A 3B9AA 3FUNA 5JHDB 1F56A 1RKRA 1UB6A 2XFXA 4MAUL 1O9VA 1P7QD 3HHSA 1W0WB 3T8XA 4ZFGH 3WLBA 2HWZL 2BSBA 3CLFH 4JDTH 4FNSA 4TTDC 4HU8A 4P2RB 1KGCE 3WDHA 1A0QL 1IGYA 2X42A 3HG4A 1IM3B 2ZUTA 2WKOF 4E9TA 5C3LD 3IXAA 4P59H 2IXQB 1DO6A 3D06A 5DRNA 3TIDB 3CLEH 1Q9WA 4MAYB 5LXVA 1I4FB 4ZD3H 1E43A 4MJIE 5BUAA 4BH8B 2IPTH 3E0GA 2DMHA 3KDMA 2AQPA 2BSSB 3IWVA 2WJ5A 4NWTH 1J5HA 3HS9A 3MA9H 4KI5E 1JHKL 1PW3A 2ZOWA 1P5VB 2XX0A 4ZUTB 5JORB 2EICA 5GGTA 2H0FA 3R19A 1IEAA 1FQ9C 2YD9A 3U46B 3KPOB 1SEBA 1M6OB 4ONHA 2VLJD 2HVBA 5CEYB 1K6QL 1NIDA 1LDSA 4QOKE 5IVNA 4GUCA 5LQBL 1UOKA 1M7UA 4GAGH 3A67L 2E7DA 3T0VA 4FG0A 3B3IA 1VESA 1ZCRA 1B3JA 5DQ9B 1RAMA 3MMEB 1J1PH 4JG0H 2F53A 1IL1B 1A3RH 3AS0A 8FABB 1NAKL 5C71A 2CDEB 3EUUA 1HL5A 3EF4A 3BVNB 2H0EA 4QCIA 4HKZB 2VLJE 3ZQ9A 5EZLA 4JY4B 3WNJA 1EERB 5CR1A 5I66B 2BNRA 2ZCLL 1J0JA 2GTZB 3TFBA 1CFQB 3V6BR 1QSVA 1MFAH 2WZ5A 4UNUA 1JGDA 1ONQB 5FR3A 1QLFB 3IAQA 5BUPA 2F54A 3K6DA 4HUXB 3LVTA 3LB6C 2Q6WB 2W0LA 5D7LB 2VDRB 5IVZA 2X88A 2IANA 5CLWA 3FHQA 1EUUA 3HVNA 3FQNB 1FFPA 2FSEA 1X5ZA 1KWKA 2Y36L 1LHZA 4F80A 1SF5A 3BE1L 1DE4A 2WUCH 4KUZL 5AVYB 5C0ND 1GGIH 3HCVB 4HJIA 2HJKB 3QFDA 4KXAA 2BCMA 1JK9A 4TVSa 3QVAA 5BO1H 5IF0B 1AMXA 3BWUF 4JM2C 2FB4L 2X6CA 5JPMA 3FO0L 1UKQA 5CZVL 2BVOA 4TUKH 3GINA 4QRRD 3FQWA 2BY2A 3WUWG 2EZ0C 4P5RA 4ZAKD 2VT0A 1M7XA 5CKGA 3QUZD 3X3FL 1I53A 1A6AA 3Q7JA 1LK3H 1ND0A 1YNLH 2Q8BL 5MI0C 5IKCB 5E4AA 5A2LH 1BVKB 2HVJA 5FO8B 2AF2A 5CIPA 5AAWC 3S3BB 4FXKA 3CMGA 5C0AB 3RILA 1KTDA 1UYWH 1J8HA 3DXAA 5CZXC 1PQZA 5SWZE 1AGBA 5DK0B 5CD3B 5EZOH 1KCRL 3LIZA 3SE8L 4RBPH 4G3YL 3S3CB 4MZ3A 5SWSB 2EYRB 3DTUB 1KNOB 4W6XB 3NSXA 5H4ZA 2NW2B 3NCJH 3OM3B 1DQML 1QRKA 2DJSA 1FORL 2OMUB 2PYFB 3EFFA 5D1XA 5ICXB 5IFHL 1KYDA 3F6LA 1WZMA 4LLWB 5C07D 5I73C 3RU8L 2HJLA 1TNMA 4CL7A 1Y6MR 1K4CA 1M7DA 4NENA 1NLDH 5EEWA 4APQC 4ZS6D 4LAQL 3DOIA 1F8TL 2ATPA 1NWPA 3RGHA 3SODB 1I8MB 4G70B 5FA4A 2FD6L 1JWMB 3QXDB 1UOLA 3FOLA 3BGAA 4J3BA 1AD9A 4GB9A 1U8QB 4NGHL 4PGDB 4PP1D 5DWUL 2BWIA 4HOWA 3BEWA 1MRCH 1Q94B 3NTCL 1EXUA 3OKOA 4UQDA 2IOMA 3BKJL 4HZAA 1HOCB 3L4CA 3QWQB 1FNGA 3KYOA 4UM8B 4Z3IA 2XVGA 5KVGL 4OTXL 1AQMA 3U6RA 2MSPA 2ICWA 3KYNA 3MV7B 4YGVB 4O4YL 1TVBB 4LCYB 4DPRA 4KMQA 5E9NA 3SGDI 3TEYA 1K5WA 5IHZA 3T3PB 2BCKA 1U8OA 3I9PA 4LOFA 3MODH 4UB0H 3K0WA 4CBZA 5F0JB 1UB6B 2P8MA 2XFXB 3O9WA 4WUUE 5B1CA 4A7SA 1RK1A 1KIPA 1NPUA 3QEQD 3IGUA 4M62H 4OZ4A 3ZRFC 3HHSB 3DLQR 4QJ4B 4MA7L 3V4UH 1NC2A 1G0XA 3T8XB 3G9VA 5D4JA 2VW4A 3T9WA 3WLBB 1HFUA 5DRXA 3TCTA 1L3NA 3ZKND 4E5XA 4JPIA 4XTRD 4XNBA 5KVEL 5IT2H 5A2KH 1IGYB 2EDWA 1BXAA 3IXAB 3UG4A 2DWDA 6PAZA 5DRNB 3KPTA 4NAQA 4DERA 1Q9WB 3AGWA 3C12A 1AZZC 2CO3A 3QEQE 4E9YA 5E70A 3RFZA 1FA4A 5LBSH 3AG4B 3KDMB 1CD9B 1H0DA 3CFIC 3NFNA 3NIGE 1DEEA 1AOHA 3LH8A 5E4EC 3NPSB 4FFVD 4XOAA 1ZANH 2IDTA 3RBSA 4J28A 5DMIL 3ZDYF 1MAJA 1ZE3H 3SY6A 4MDIB 1IEAB 4XNYL 4NN5C 2WNXA 2JELH 1SEBB 1WQVT 4ONHB 1UZGA 2Q2LA 1D6EA 2VJ0A 3QNZA 2A7BA 3WKYA 4LSTH 4DETA 4MAZA 4DKAA 2XKUA 4XBGB 1EDYA 3B3IB 4KXZH 3AREC 3DUUA 1K2DA 4KX9A 3L13A 3QP3A 2NSXA 1XF5A 2F53B 4WFGE 3OLEA 3LEVL 3ZHFA 4KO6A 2C26A 3V0WH 2EO7A 2WXFA 4QCIB 5C08B 1I3GL 1LVEA 1QATA 2ZCZA 3X2QB 5EZLB 3VRJA 4ODWA 1JL8A 4AEIL 4BHUI 2BNRB 4ZX4A 9PCYA 3CSTA 5DD0H 5KTEH 4MQXD 3OB8A 1RULH 3OKNA 4YK4B 4X6FA 4NM8H 4NN6B 1JGDB 3QDJE 3VG0H 3BUQA 2F54B 2G9KA 4JW3A 4OM1H 2KH2B 5FUZH 3G5WA 4Z3JA 1KIUA 3N9GL 5FYKE 3L4YA 1JDDA 4EN2A 2XV3A 5IVZB 1BLNA 1ZE3C 2IANB 2I24N 5AFAA 4AW7A 5BS0E 2YA2A 2BS71 4Q58C 1FFPB 1P7QA 2FSEB 3VSUA 1VFAA 3ESUF 2VWEE 5M95B 1ZGLP 1UZ6E 2XWDA 3STBA 1DE4B 1QFPA 5KJRH 2CCWA 3LS5L 4M7JH 4ABQA 3QFDB 1JK9B 1K8DA 1LO4L 1XGYL 3E7JA 3V4LA 1CDJA 5JPMB 5C0CE 2RIKA 2BVOB 3NRQA 4Q9RL 3FQWB 3LKOA 3I2CH 5KVFE 5E08L 3Q1SH 4H26A 2DQ6A 4NQDE 3W0WD 4JEGB 1XF3A 1A6AB 4AIEA 1ND0B 3BRGC 4ZDHA 5E51A 4JY5H 1F86A 3GHEL 5CIPB 1U95A 3UZEC 1HWGB 1KTLA 4JO2H 5GZNC 4FXKB 2GI7A 2E6PA 3BZFA 4JR9L 4GIOA 1KTDB 1J8HB 3DXAB 3RY4A 1PQZB 1AGBB 2CCLA 4N5UA 1IC7L 4WWNA 3BW9A 4F2MA 1NIEA 4XBEL 2P8LA 3FTSA 2B0SL 4OLVL 4O9HL 2IOIA 1FZOA 2HSIA 2KERA 2OCFD 2VLJA 5FB8A 1MCPH 2BIHA 1EHAA 2GI0A 4LCWD 3D7PA 3SEPA 4L05A 4N87A 3EFFB 4Q4EA 2FTAA 5D1XB 3A6CH 4ZNEE 3DETD 2N01B 2PP7A 1EX0A 1GGBH 4N8UA 2HJLB 4F9PC 1K4CB 1PS3A 1GC1L 4M6MH 4KY2A 2R0LH 4GSRA 3EJUA 3O6FA 4NENB 4UM9A 1RU9H 2VDNL 3APCA 4KHXL 1M57B 2ATPB 2NY3D 4OJFH 4FRWA 5FA4B 5GGRY 3QS3A 1BX2A 5B1KA 5GGRA 1HNGA 1DFXA 3FOLB 3UMTA 2X0WA 3M17A 2XOTA 3GYRA 1AD9B 5DQDL 3BEWB 4X7SL 3MBXL 5CGMA 4U3SA 2B1HH 3MLUH 1GC1C 2CE6A 3OHXA 1EXUB 4FZ8H 4MCMA 3OKOB 4KDVA 4PJ8C 1AXTL 5EORL 1BA9A 2JKLA 3AW5A 3BI9X 1FNGB 3KYOB 4YHNA 4UMSA 1H8SA 2DQCH 3U6RB 1DVTA 2APFA 2ICWB 2KBGA 1N70A 4CADB 3KYNB 2F08A 1FYHB 3ZT5A 2XBTA 1WG3A 4PMEA 1W16A 2IOOA 5IHZB 1XBDA 1Z9SA 1U8OB 2BCKB 2NXYB 1B4TA 5L2KE 2JKTM 2P8MB 3O9WB 1WUZA 1RK1B 1KIPB 3QUMA 3SO3B 4OZ4B 1ROWA 2O1AA 4F3FA 5J9PA 5I15H 4KJQD 1NC2B 2J5LB 5C2BL 5DRXB 2WZ0A 4M3HA 4BIKA 5I30H 1QSFD 4GRLC 4ZAKA 1L9TA 5DXWA 4E5XB 3IDYC 4JPIB 4I3SH 2QV4A 1RUAH 3OD3A 2Y1ZA 4AIZA 3GJFK 2DWDB 4GSXA 2ICWJ 3EFDH 4WO4C 4RZCA 1F4YH 2EQDA 1HHHA 2OXGA 3ALXA 3RFZB 4YDIH 4ZTOL 3FO1A 5AL0A 3CSFA 3EGSA 3ZTCC 1H0DB 1LXMA 2H6OA 3BKYH 4P9ML 3NFNB 4WK4B 3Q8BA 3WO4C 4ZXBC 2XTJC 1JNJA 3T3MF 5FDYA 2MNJB 3ZIMA 4KRLB 1JF6A 1NKOA 2L8AA 1WZ1L 4NO2B 1D6EB 1VGKA 3IMSA 4N8PA 4WWID 3QNZB 1KEML 3LEYH 4FQ1H 3ULVL 2YMXL 5D96B 1OOWA 1M4KA 1O5PA 1W0VA 4D9QD 3DUUB 1K2DB 3RY5A 3K81A 4A55A 1XF5B 4XMKH 5C0DA 5I0WA 1FC1A 1R3JA 2WANA 5FM4A 5IHLB 5I6KA 3ZTJH 5LCVA 1CUOA 2V0AA 5J56B 2Q86A 4EXKA 2FO8A 1MCFA 3IN2A 3VRJB 3N91A 4ODWB 2WJ7A 3WU1A 1XWVA 3P9WB 2K6YA 1P6AB 2FIRT 3LNGA 3OLIA 1B2WH 2YSSA 4OZGF 1B4RA 3OKNB 3ATDA 4X6FB 1OAQL 2JTDA 4HH8A 2VZOA 2EIMB 3AT0A 4OFDA 3UYRL 5I0DA 2YEQA 3QG7H 3CSGA 1KIUB 4YXKH 1IKOP 2VGLM 2AJ3A 4AOFA 1BLNB 4U6XA 1KSRA 1TJMA 3O11A 4HEMA 4AITA 4DO5A 5G4MA 2VMFA 3GMRA 3QEQA 1P7QB 1F3DJ 3MVSA 1VFAB 2OJZH 4R97B 3WYRA 5CUSL 1I3UA 2CKBL 2MQ0A 2V3DA 2ATKA 5DEZA 5CD5C 2IC2A 3VX0A 4UQAA 3CK0L 3C8DA 5ESQA 2VO8A 4LSUH 5F7YC 2ZUVA 3GNMH 1K8DB 4IJ3B 4KKAC 4AUUA 5ACMA 4Q2ZA 2FBOJ 1FFRA 2VL5A 3D50A 3IPBA 1RUQL 3J8F7 4Z7WA 4RMRA 4UI2A 3LKOB 1GTNA 3VM7A 4DK5A 4H26B 5HYFA 4JS7A 4XO3A 5I18H 4WCYH 1XF3B 2VUYA 3Q0HA 2CBTA 4QKTA 1UACH 4DGYH 1BZQK 1U95B 2PR4H 1KTLB 1IBDA 1LDPH 4CILA 3CZLA 5I1HH 2YS4A 4KZ0A 1ZLUK 3O2DA 1PY9A 5J12B 1AH1A 1X5JA 3PUUA 3BW9B 4F2MB 2P8LB 3FFCD 4M29A 1BFSA 2AEOA 4KUCD 1FZOB 5FB8B 4C58B 2VLJB 2GBVA 2DKSA 3VQ2C 2MCG1 5HY9B 3FCSA 1Z3GL 1U30A 4YDJA 4JGJA 1E65A 6FABH 1XL4A 2CA3A 4CN4A 2VXUH 3OBAA 1U3YA 3LH2H 3QDJA 4OBSA 4JHWH 3IFNL 4FYRA 2G5BA 2CBQA 3EJYD 2Z1PA 2CXGA 3CZJA 3OKLA 5IHWA 1IEHA 3O6FB 4UM9B 5MP6L 3WXWH 4U0RC 4RISL 3GWJA 2E27L 2XKNA 2XVKA 2ZUQC 1T5KA 4ZPVA 1VDGA 2ZXQA 1BX2B 5GGRB 4FKEA 1RSFA 4KZDH 2CU9A 3CH1A 1NBYA 2ENQA 4HFUH 5GJSH 3M17B 3CN1A 2OI9B 3VI3F 4B9CA 5CLTA 4M43L 2ITEA 4U7SA 2WXNA 1BQLL 4ZO7A 4AVIA 3MLXL 3QIBD 4U3SB 3OHXB 4NQQA 1CFMA 3PWPE 3RB5A 4K5LA 3DA0A 2O4EA 3K5SA 2NCMA 1X5YA 5C0CA 1YN6A 3KPRE 4YHNB 4H0HB 3BP6A 4R4BA 4M5YL 4BFRA 5A2CA 2PWDA 2GJZA 1EEZA 2YN5A 1ACYH 2Z8SA 1Z9SB 5I6OA 4ZK8A 2X0VA 3DDGA 4NC1E 3KPQA 4NJAL 3HAEH 2ALAA 5CHNA 5JPNA 5B4MC 5E94A 3VNZA 1YMMD 3QUMB 3U2SA 2OZ4H 4F3FB 5J9PB 4OBRA 1KGIA 3N85H 4AV5A 4QRRB 5K9JH 2IAMC 5J1SC 4NQEE 5D7SL 3BN9D 4M6OH 4NZFA 4B6ZA 4ZAKB 4JFED 1VGEH 3W0WA 3BYYA 5C0RH 5DD5H 1L7TH 4O02L 5LHDA 4L9LC 4TF4A 4PWKA 1PCXA 4AIZB 4OIAA 2R69A 3MRPA 4WJKB 3TTYA 3GKZA 3QHFH 4N8VG 4RZCB 2QSCH 3N42F 1HHHB 2OXGB 3OSKA 3VMOA 5H2BA 5MHSE 1G5GA 4FFZL 5D71L 3ZUNC 2EEBA 5EU7C 3FO1B 3GJEA 1LEIB 3ECBA 1O6TA 3ZGIA 3EGSB 4M1GL 2Y5TA 1I9JL 1S3KH 4OCMC 4LCWA 5IQ9A 1CLYH 2A74C 3KJ4B 2BHYA 2EH8H 1OAKH 3NABH 4BKLA 1YPZF 1KN4L 2VZTA 1VGKB 5DU7A 2XZCL 4S1RL 5E9AA 4D8PA 5A3ID 3WIHH 5DQJA 4X8GA 1WAAF 4K3DL 5DC2A 4IOFD 1W0VB 2AABH 4GO6B 3WIIH 3GSOA 5C0DB 3HRPA 1R3JB 1O7VA 1TZ8A 4JHZA 2A3TA 3KH4A 2A38A 3QQ9C 3T71A 4N25A 2EDHA 4AYID 2FL5A 1UCBL 3VWKC 1JDCA 4TLTA 2Q86B 5PCYA 1JFHA 4HJ0C 2J56A 2PO6D 1SQMA 3NAAL 2YSSB 4IBWA 1ADQA 2WVUA 1N10A 5BW7C 3VVVA 3HG2A 4K94H 3VMPA 1A7BA 3US9A 3KMDA 3JV6A 1S7WA 3TV8A 3A47A 2AJ3B 3RX8A 4BWTA 4U6XB 3O11B 3I6SA 5A2BA 1NUGA 2HLFD 3DTDA 3GMRB 2BVQA 3QEQB 3V0VA 4YFDB 4G9FE 5F7EH 4HKJA 4IDLA 3NEOA 5DHVH 4RX4A 3V8CA 5C09D 4LSPL 3ATAA 4FCHA 4P48A 4DK3A 2C9QA 3PV6A 2NZ9C 3R0MA 1QSFA 4I7ZC 4UT9A 5ESQB 4MMXC 4Q2ZB 1Q38A 1UJ3A 4FXTA 4KK9D 2VL5B 2WWOA 5G4NA 4HXAL 3C5ZC 4UQ3A 1LEGA 4Z7WB 2B4CL 4YSUA 3M1BA 5IQNA 1OANA 2X2UA 5ILTH 4DUWA 4KVNH 4FFYH 4G6KH 4UV4L 2KUTA 4C8XA 4M56A 1C16A 1TR7A 2DM4A 4K94C 1TQTA 2FLMA 1KB9J 3DJSA 1NUDA 5KYUA 5JIPA 3T4YA 5JQ6H 1KN2L 4ES8A 1U91A 3EHBD 5K9KA 4F15B 1F97A 1MWOA 1DJWA 2VQ4A 4I18C 2CDFA 4JAMA 4W9LC 3UEQA 2A99A 4XAKD 5TE7L 3KBHE 3FCSB 3L17A 1CGYA 4IIQA 4YDJB 5AZ2H 1KYAA 4CNIA 1SYVA 4U1LA 5DHEA 1TU2A 1YEKH 1W72L 2HT3C 3I6LE 4E41E 4DPBX 4DEPB 3MLYH 5FHAH 1IGCH 3IDUA 4R0LA 4ZOAA 1JK8A 3QDJB 3V4VB 1HC1A 1E30A 2G5BB 1BZ9A 3AWEA 4LSRL 1JXFA 2VJXA 1U8HA 3H54A 3OKLB 1R3IH 5L0QC 2ZUXA 2H41A 3ARDA 3ZE1F 4LL9A 4ORZC 2V17H 2XKNB 3HG1E 3ZDXE 4ZPVB 1CYGA 2D3LA 3U1SL 4X8XA 3QDAA 4TTDD 5EA0L 1MFEL 3CH1B 1NBYB 1RPUA 3WENA 1ZS2A 3NIFE 1YSOA 2DL2A 4JJOA 4WW1A 3GSNA 5F7BA 2Z34A 3BT0A 3SE6A 3GTNA 1ID5I 2AXHA 3MJ9H 2WB1A 4QNPF 1SLWA 3QRFM 2B3IA 3FQTA 4WK0B 4Y9FA 1JGEA 1N4XL 5T5FH 2X4TA 5C6TL 2QTEA 5C0CB 1YN6B 4H44C 3IRCA 1CXEA 3TVMC 1XSJA 5KW9L 3BP6B 4WFFD 4HKBA 5JHBA 4R4BB 1Y07A 2UY6A 5E2TH 1PJ9A 5ANME 1J87A 4J2QA 1DFBL 4M6NH 1J1OH 5FOBA 2GJZB 1EEZB 4GEJA 5F7NC 3ZHDA 4KFMA 1YQ2A 1DSYA 3PY9A 3KPQB 5CGYC 5D7HA 5CHNB 3SPIA 3DROA 4EBQH 5E94B 4B95C 5JPNB 3T09A 3U2SB 1BJ8A 3PNWA 4NN7C 4HQQH 4Y8AA 5F9JB 3HUJF 2FATH 3OXRA 1N6UA 3Q43A 1ZTXE 1SXCA 4W9CC 4WFFE 1G9NL 3WIFB 1D7FA 3W0WB 1UWEL 4BINA 1BZ7A 3C09C 1GIGL 1CZ8H 1OAXH 4U2ZA 1F4WH 3MRPB 4LCUA 1CBJA 1RLWA 3KGSA 1A3LH 3OKEA 5C0EA 2E7LA 3ULUL 3EH4B 3S98A 1NFDF 2K4AA 3ZY7A 5H2BB 1JHLL 3EO9L 1MCKA 4QF1A 1NH6A 3GJEB 3ECBB 4K8RL 3FFCA 4YFEA 1L7IH 2Y5TB 3U48A 4AMWA 3MFGB 1G9NC 4OJYA 5DLLA 2AVFA 4GKSA 4LCWB 5IQ9B 3Q48A 3FT1A 3GSXA 3WSQH 1ZRUA 4BKLB 4CJ1A 3NUKA 2X2YA 1DBAL 3UL4A 3RGVC 4F7PA 2YN3A 3ILQC 3VFSA 2QFRA 3ULUC 2HA1A 1CDIA 4NQVA 4D8PB 3JT0A 3ZKXB 3PWPA 4OLUH 3BUTA 5SX4H 3BVDB 5DQJB 4Z5RA 4K8RC 4KX7A 4GO8A 4M5ZH 4X7CC 1T0MA 1UJTA 3KPRA 3MV11 2NY3B 1KBGL 5ADOL 3GSOB 1EMTH 3MPCA 4PAZA 5L88H 4HMDA 5IQ7H 4HUCA 3L9EA 2FL5B 1L6PA 3K8LA 4JJHA 4KTEL 1GHFL 1RVFL 3VSVA 3L5IA 4W9HC 3VD0A 1XTLA 3QIBA 2EZ0D 2Y23A 5KYWA 4DUVA 2WCPA 3MCG1 4N2IA 1CC3A 3LQAH 3ABGA 4JRWA 3UBXG 3DGCR 3ATEA 5ABDE 2BY0A 1F0LA 1TJHL 4N3UA 3NACH 1DBML 1IE5A 3BFQG 3ESNA 4MDJA 3JV6B 1S7WB 1WWCA 3AQZA 4IMLA 4AYBA 5CZXD 5IROD 1KB5A 3IB4A 4C4UA 2I27N 4KRMB 2JI1A 3KVPA 1U8PA 2A9NH 4Q6IA 2XN1A 1MFCH 1TMCB 1U2HA 4NUGH 4DKEL 1YMMA 2BVQB 5JUEL 3V0VB 4FA6A 4HKJB 3IAPA 2K9FB 1CXHA 4FG2A 2WM0A 4TQPA 3PV6B 5A7EA 1QSFB 4NCC2 2ARJQ 3QDGD 4NXSA 3WTUA 5E5UB 4S0TD 4JB9L 3MV8D 4JFEA 2RQEA 5IFJA 1RZGA 2X3BA 3BT2L 1UJ3B 4J8RA 1A5FH 4UAOB 2H5UA 3QQ4A 4APQD 2XQBH 1R3LA 2DWXA 4HUNB 4XBMA 1NCHA 4UQ3B 1LEGB 5C7XL 2W5PA 1OAUL 3M1BB 3UH8A 2TAAA 4DP0X 2VZVA 3K74B 3EBAA 5DZAA 3LQAC 5CJOH 4AQ8A 1C16B 2L7QA 1RZ7H 1K3IA 2V3EA 1O7SA 1JXJA 4LHUD 5JXAL 1HK6A 5KYUB 1CU4L 3PP4H 5TQ2L 4KKQA 1U91B 4M7ZC 3K6FA 1SJEA 5K9KB 1YEJL 1FIEA 2CDFB 4JAMB 2AEQH 4QXGL 4TRPL 1A4JA 1MFMA 3A24A 2DJMA 1DSFH 3HUJE 4G6JL 4WHTA 4CNIB 3B5TA 3IKKA 4IIQB 3QZWG 2C3HA 1SYVB 2VZ3A 2X9WA 4U1LB 1TU2B 4YPGA 4JRYD 5DURD 1Q9OA 3U0TA 2XV6B 1JP5A 4TUJA 3S3PA 2GABA 4R0LB 5DHDA 5D55A 1JK8B 3UZQA 4GRWF 3TV3L 1BZ9B 2CK2A 5DD3H 1U8HB 2QPEB 1P1ZA 2ZAHA 3O4LE 3HW7A 4I9WD 5DD1H 3K2MC 1FSKC 3M8OH 3UJIL 1DN0A 2WO2B 4MXWH 4WHCA 5L4FA 3TO4D 2YJLA 4JL1A 2IO5A 4H8WH 4KO7A 1U42A 2PO6A 4RWYH 3WMSA 2WCSA 4G9FA 3OJDB 4HP5A 4JRYE 1WS8A 4WW1B 1LILA 2NR6C 3D5OF 3GSNB 3GXFA 4LHUG 3K7UA 3HN3A 2CUIA 3MNZA 3FQTB 3BIKB 4G6AC 2J6EL 1JGEB 3KPLA 2X4TB 2BERA 5TH2B 2FWSA 3HPJA 4P5MA 4CMHB 2QGDA 4LVHC 1EZUA 4HKBB 4HWEH 3TF4A 1UD4A 2UY6B 5FC9A 4AQZA 4R26H 4XP4H 4V11A 5TF0A 1BZEA 2CO1A 5FOBB 1AY1L 3P11H 3RDTA 2DLTA 5C09A 3TWYA 4GS7C 1BJ1J 4RWHA 1PAZA 3DROB 4PJBF 5AOZA 5ENWA 3DX6A 5I75C 2BFVL 4WI6A 4Y1AE 1YAZA 1SY6L 3LEXA 2PETA 3OXRB 2AQTA 4MJJA 3VDBA 1SOQA 4UV7H 3KD4A 3QUYC 2XQYA 1BZ7B 3AB0C 3IJ8A 4W81A 1G7HA 1XXFC 2AJVH 2UXVA 4E41A 1I9RH 4UOJA 2E86A 1KENL 1R33A 1MNUL 4LCUB 5ALBL 4S1SH 4U3CA 3OKEB 3AY2A 2CMRL 5A6LA 4A37A 4HOZA 2VXQL 1TUPA 3R1GL 4QF1B 4Q9QH 4MBOA 3FFCB 2FJSA 4BZYA 1UGKA 3NIDF 1FNSL 2PPDA 3OAWA 1EXGA 4GKSB 4U7KA 5ECGA 5IR1A 4Q4IA 3L95A 2J88H 2NNAA 5AOMA 3G6JF 1MH5A 4DAGH 3PNRB 4XO9A 4F7PB 1R1CA 2FX8L 2X6MA 2XX1A 2ZXWB 3VFSB 3V0EA 4NQVB 3OTTA 2UWEE 1UURA 2BIPA 2D4FA 2YKLL 3PWPB 5DRWA 2ETWA 5I5RA 1X5LA 2A77L 4P8QA 1HE7A 4Z5RB 1T83C 4N20A 4R3SA 5GRVK 1JI1A 4W68A 1T0MB 3KPRB 4DQOH 5AZUA 5ANMA 5F96L 1EWHA 4NFDA 2OTUA 2EIKB 3CX5K 3C8HA 3QIBB 2R8SH 4D94A 1JVOA 5KYWB 4I1NB 5BUGA 5JIKA 1LE5A 1MJJA 3IJEA 2WYHA 4C4KT 2DQMA 2ZYSA 1EV2E 3HNSL 4N1CA 3BZDA 2VDLL 2CHZA 4MDJB 4IMLB 4PFEA 1MKFA 3HMWL 3S4SG 4F20A 1KB5B 2DKMA 1CFNA 4XPGH 1CB4A 4Q6IB 1U8PB 2OK0H 2WWKT 3D08A 3EZ8A 1J5OH 1YMMB 5FHBH 1HEZA 3TURA 1ZA3A 2FEEL 1NPNA 4YR6A 3ZHKA 1KYOJ 5E8OA 1KZYA 1JZGA 1JZHA 5E56A 5K1JA 4JFEB 3SQBA 4ENED 3MQIA 1RZGB 5IFJB 2DY2A 4J8RB 2DIJA 2QLYA 3U7YL 4FLHA 3ERXA 3I50L 1P6FA 1Z3RA 1R3LB 1VSCA 2C9SA 2EXTA 2Q0ZX 3EIFA 4AGQA 4WFED 4GKZB 1J0IA 1B9ZA 4PRIE 3UTQA 3U0PA 4J3OH 4CAGA 2R0WL 2YPVL 4YDNA 3H9ZA 4JPQA 3RVVC 4YS4A 5BMFH 2P3YA 5D7EA 1OGPA 2DOCA 4ZMLA 1SJEB 3HIZA 2DQJL 4PJ8D 1YNKL 5GGVL 3VXUE 4HX1A 3RLSA 2WTOA 3P4LA 3BGFB 1OZUA 1OV8A 3D69B 1A4JB 4P46C 4OI7A 2WLNA 2NY0C 1XGQA 4WHTB 1SZNA 1B4JH 1MIEH 2WLKA 1IGML 4D0CA 4YPGB 2ZP0T 3P02A 4WO0A 2DQEL 3U0TB 4S1QL 2WQRA 2HT4D 2O6PA 4I8DA 4OFKA 4JPVH 4TUJB 3OHMB 1Z7JA 2NQ3A 3BLBA 3UZQB 1W8NA 3WY3A 3PQYD 3HZVA 1UWFA 1CICC 1P1ZB 3EYUL 1EJOH 1D2OA 3B7UX 3ME0A 4JM2A 4Q56A 1KGWA 1BIHA 1DN0B 4DN3H 5FO7A 2N0MA 2A6JA 3X1BA 4ODSH 4GRLD 4X80H 2K0RA 4LEXL 1JDAA 2CBMA 3OLGA 2PO6B 2XKSA 3ZE0B 5B3JE 4G9FB 1QEXA 5CWSA 1U92A 2R4RH 4J3OC 3FFDA 3IKCA 4IDJL 1ZDQA 4LXFA 3MAWA 3L3DA 1MNNA 5AAWA 2OMWA 1QI4A 4ZUVA 4HXBH 3UYPB 3MNZB 4MB1A 4WO4D 2WCGA 3PWUA 5IROA 3ZBMA 3KPLB 2IFFH 4GP8B 1I8IA 3B9EA 1ULVA 3HPJB 4P5MB 3WJJC 5CCKL 3BH4A 4OZHE 4Y5XC 1JZIA 2KZWA 4TVPH 1R0AL 5I74B 1ADWA 4NO5A 3TEZA 3K1DA 4ZXBD 3QZWA 2IQ9H 4Z7OF 1ETB1 3RDTB 1AJ7L 4LQFH 5E8EA 5C09B 3PS6A 4BFOA 4L8SA 3TT1L 1FAIH 4X83A 3VWJD 5ENWB 3DX6B 4U3HA 5HVGB