4NQDD

Crystal structure of tcr-mr1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-d-ribitylaminouracil
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
200
structure length
200
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVKDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title T-cell activation by transitory neo-antigens derived from distinct microbial pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdD02
3LN5B 4QRTA 4XTRC 3DXAE 4E41E 4V1DE 3CDGA 4QRPB 4CNIB 4WEBH 5J56B 4HIHA 5ID0B 3VW3H 4WUKH 1E4XH 1H8NA 1M7IB 2Y06L 4JGMA 3S98A 1GJIA 5I18H 1U8IB 5KVFL 1F5WA 3DV6A 2X6MA 1G7IB 1MAJA 5DJ6A 6CGTA 1RUKH 1T7VA 1IM3A 3SGDH 3P77A 5C09E 3IU3A 2VXQH 4PB9L 2HVJA 4MA3A 5ILTL 3S35L 4N9OB 3L95A 4Q9BA 3SE8H 3E8UL 5C9KA 1M7XA 3CDYA 2QSQA 4HF5L 4U7SA 4NQCE 3AM8C 3SO3C 3LY6A 2XTJD 4O9HH 4JPWL 4PJIF 4XVTL 4CKVX 1FFQA 5D9SB 3VRJA 2D03H 1N5YL 35C8H 2N1KA 3T0EB 5DQ9A 1ONQB 2YEZB 3ESUF 4PJ7A 3SGEH 3E3QC 2R29L 4PJDF 2OL3A 3QEQE 2OTWB 4PJFF 5EWIL 3TFKD 1T0PB 2HMIC 1BWWA 4Y4HD 4LKXB 5IW6B 3EO1A 3N9GL 4G6JH 4LPXA 4OCRL 2XG4A 3QG7L 4YDJA 2V5TA 1WBYB 2OR9H 3VWKB 4Q9RH 5GZNC 3N85H 2XG5A 4PJEA 1WEJH 3UTZB 1JUFB 5L2JA 1HHHA 4Z78A 3I84A 4X9IA 2QLVB 4APQD 4LSTL 4ZFFB 1RZGB 4K3GA 2CQVA 3GSUA 3FAWA 3BWAB 3STZB 3QHFH 1AY1L 4NHCL 4X7SH 5CILH 4TRPH 2DTMH 5FV2A 3FFCD 4WFGD 4BFEA 4UZGA 2L4OA 3O6FA 2CO6B 4K94H 1TNMA 5IW1B 1A3LH 2VLME 4G6AD 1IAKB 4RGMB 2IADA 4XXCA 4F3FB 1IGCH 1G84A 5C0IA 1U8JB 1H8OA 4YE4L 1RFDL 1U2CA 4DGVL 3L6FA 1ACYL 4JHWH 3QDMA 1R6VA 1QHPA 4TSBL 2HFGH 2PXYB 3D85B 3RNQA 3WFHA 2DKSA 3KPOB 2YPVL 1FORL 2IH3A 1CFTB 1KTDB 1X7QB 4FTVB 1Q72L 3ARBD 4GKNA 2XA8L 3QUZD 5J3HC 2WSKA 3WS6C 4NN5B 5HJ3B 4NNYA 5KSVA 1RMFL 3V52L 4JM2C 2HG5A 4U1SB 3MOQA 1BP3B 1N6QH 3SE9L 3TBVB 3MJ6A 3LQZB 1CDJA 4RGND 4MX7B 4DKDC 1PX3A 5C71A 2Y07H 3FFDA 1CLOH 5GGVL 3D2UB 3WKML 4L4TA 4WW2C 5GHWL 4U1NA 3NIFF 4G8EA 4WO4B 1LK2B 2CR3A 4XWGL 3PUCA 3DGGA 4MNQA 1XF2B 3QO1B 2AJUL 4FQXC 1K2DA 4HLZH 3KPRA 3N1GC 1D5BB 1S7VA 5FOBB 1O0VA 1UEYA 2DYPB 4P2RD 1CXLA 2P48B 4L8SA 5I1LA 3QG6B 4GAGH 5FYLL 4JANB 3VH8B 3EDDA 5SWZE 1ZLWK 5AWNL 3IXTB 4HUKB 1UWEL 5DJ8A 4BM7A 1C1EL 3T3PE 4O2CB 1BQLH 1I7UA 4HKZB 1A3QA 2GK0A 4K7FB 3WHE1 2HJKB 2XWTA 5KZCB 1JN6B 5EU6B 4JAMA 4EIZC 2OK0H 4XAWH 4HW6A 3SDAA 5HHNB 3P0GB 3H0TB 2DQFA 3KAAA 3MOAH 4UAOC 4DK3A 1QBBA 2C3VA 3FO1A 3RZCD 5HGAA 3S96A 3IKCA 2DS4A 2B8OT 1E4WL 5C08D 4X9GA 1D6VH 1J8HE 3B6SB 4R96B 4CVWA 1FO0H 1CD1B 5J6HB 4P3DB 4XPFL 5IG7B 3VXRB 1QTYT 3VXQA 2DWDA 3O3DB 5CHNA 5MERA 5IB3B 4PRNB 5T33L 5D7SL 1OVZA 2PYEA 2A74B 2BJMH 2DQEL 1NC2A 3B5GA 5DD3H 1HYSD 1R0AL 4PBXA 5CCKL 4JRYE 3O6ML 3BP6A 4M1CD 4YLQT 4MXVF 3L7FB 3NCJH 4XRCB 1DEDA 2GEEA 5LGHH 5KSAA 4LCIL 5FK9B 2WWKO 4QRRD 3DGCR 4M8QA 4M61B 3U7YL 3OMZA 4WCYL 2YD8A 2W1NA 3U9PH 3AROA 4YO0B 3X12A 1J05A 4GG8B 5E1AA 4Y19B 3U46A 3H9HB 4D0DB 3MRDA 4X8XA 2EDDA 1XCTA 5JO5B 5ACLA 5H94B 2B1HL 3B5HA 5I66B 5K9OB 1A6AB 4N9GA 3DXAA 3UO1L 4V1DA 3V7MA 4MCZA 4Q2ZB 5IFJB 3TJEH 3PIQA 4K7PY 1T1ZB 4WV1A 3OF6A 3AS1A 3O9WB 4ZFOA 3UPRB 2FSEA 2AEWA 2N7BA 4OAWB 4QF1B 5DVNA 4BZ2L 4OZ4B 5D7IB 1FO0A 4FQJH 2AKRB 2ICWJ 3MBEC 4UIMB 3EYFB 2V2TA 4JJHA 2UWEB 3BH9B 3SDYH 2F53E 4BSWA 1V3LA 1QEWB 1NGZA 5GS3A 2AJSH 3S5LG 2IPKA 2ZCHH 1QSFE 3A6CL 3L5JA 5IB2B 3HG1E 3DUUB 4QGYA 4IRZL 1Q9LA 3MFFB 3CUPA 2UZXB 4NFCA 5EN2B 1T89A 4NC0B 5C0BD 2ZSWA 3QEQA 5FDYA 5L2KB 5IVOA 1WCBB 3PGDB 4HLJA 4LLMA 4XCYA 5ICXB 3MFGB 4NO2B 1QFPA 3QWOA 4AENA 5EUKA 3O4OB 3PP4H 4HJJH 3BOVA 1G9MH 4DGIH 1JWMB 4JY4B 4OI7A 2OTPA 4BKLA 4PJIB 4I18C 4OJFH 3QAZB 1SMOA 4OFPA 1BQSA 4I1NB 1OCWL 2EC9T 3HTLX 4PRHA 4L8BA 5AD0A 5CAYB 4MQ7B 4N0FB 3RTQD 5E94B 1YNKL 5SWSB 1HKLL 4JCLA 1OW0A 4H88H 2ZG3A 4PJDB 5IMOA 4GKZB 4PJFB 2AV7A 3QIBB 2W38A 1A6PA 1U58A 5EOQH 1M6OA 3CFEB 4KHTH 2Q8AH 4YDLB 3UTSD 1KCSL 1CLYH 4ZAKC 1R5WA 3EW3B 1CQKA 4PRIE 3VXUE 3MRCA 3QDGD 2HJLA 4M8VA 1DQQB 3RGVB 3F7VB 4P5MA 3RWJB 1EAJA 4HJGA 3ULUD 1OAQL 2WM0A 3UDWC 4YGVB 1LDPL 5I15H 1NJ9B 2ZCKH 1IEBA 4HG4J 5F89B 2J3SA 4OZFH 2W65B 3BD5A 3D9AH 1JPSH 3NCFB 2BVTA 5FYLE 2LU3A 5EIIA 1A2YA 5KSBF 1BECA 3W2DL 5C0AB 4TUKL 5KSUB 3FJTA 5LQBL 4YHYB 3ES6B 4QRPE 3V5HA 1MJ7L 4R8WH 4RISH 1HH6A 3SO5A 3QJHB 5BV7C 1MEXH 4F9PA 4I2XE 1UM5H 1IC5L 5KVDL 1GGIL 1V3MA 1A7QH 4H8WL 2P24B 3SKOB 4FQ2L 5HGBA 3IETA 4U6XA 5ESQA 4MD5A 1DUZA 4PPTA 3DX8B 3QXDB 2UYLA 1G9NH 1AXSB 2E6JA 5LCVL 4I4WB 2ZUYA 25C8H 1GVIA 4WHYG 5SWZA 1XMWA 1YQVL 1QVOA 3N1FC 4X6CF 3W82A 2NPLX 2VUYA 3GSXA 3MMEB 3JXAA 5C6WH 2BNQB 5L8JB 2CGRL 3UBXG 2FJFB 1YYLH 3DX9A 4KMLB 3DURB 3WIHL 4ETQB 3C2AL 3RKDD 3KPSB 1FL3B 2P1YA 2FLRT 4UOJA 4ZUVB 4EN3B 5DMYA 3MNVB 4JY5L 4C54A 4OZFA 2VLKB 3ZDYF 3EOBB 1FFOA 3I6LD 1T22A 1KG0A 4R97B 2R8SH 4OGAD 1NDMA 4ALAH 5H2BA 3O6FC 3MROA 3W9DA 5FM4A 1J8HA 4LARL 1ETZA 4GRWE 3PNWA 5C0CA 5FHAH 1YEHL 4XXCC 5FO7A 4IDJL 2FL5B 1EEZB 2VQTA 5GRUH 5DMJB 5GS2D 2LU7A 1JCKA 2D7OA 3RL1B 3LIZH 1OF2A 4ZXBB 1EH9A 4X4MA 1XF5B 2HT4C 4F7PB 1AH1A 2W92A 2VKXA 4JRYA 4JFDA 5DD6B 1MQ8A 2XN9E 4LCCB 2KPNA 3VFUA 2R4RH 3MUGB 2P5EB 1RQ5A 4HIXH 3V0WH 3ZKXC 1INEH 2I26N 2NYYC 1Q9OA 2VDLH 1X5HA 4GW5A 2NY6D 4QHNA 1KENH 4PLKC 1VGKA 2R9HC 1ZOXA 4UILL 4DVBA 4OLZH 5FGBA 1TVHB 1SEBB 1BFVH 3FTGA 2C1PA 3K2UL 5J11C 3IFLL 4FTVE 4U1MA 1IAIH 1QFWM 4KU1A 1J11A 4YJZL 4K8RH 5J6GB 4GSDL 3DBXB 1ZLSH 1GC1L 1EJOL 4OFIA 5CBAA 4LLAA 5A40E 3PWJB 4DAGL 2OI9C 3I50H 4KK6D 2ZUQB 4GUPB 2Z31D 4IRJA 3UAJC 5DMIH 4HMEA 2OQJA 4G8FB 4QRUB 3IAPA 5F72S 3TT1H 4C57C 5FYJU 4A6YH 4FFYH 2EYTB 4FMKA 5HHQA 3REWA 4R4NC 2VDOH 2Z91B 4R3SA 3DRQB 1I4FA 3I6GB 2EEDA 2F53A 1L6ZA 2D7TH 4FG6C 4NIKB 4P5KA 1VGEH 5IB1B 5JTWA 3BSZH 3GJFK 2O5YH 1FNFA 1QSFA 1SEQL 2OMBA 2VITB 2Q86A 5TPWH 2GJ6A 4KUZH 2ITCA 2VN7A 1KLGB 1S7SB 3QPQC 1KIQA 3SDAC 2NY1C 5FXCH 1PY9A 3OGCA 1ZLWH 1YEEL 1QO3B 1ZSDB 3QXTA 4G43B 5FHBL 3BHBB 4HDIA 3V8OA 1ZA3A 1II4E 3K7UA 2VXVH 3EO9L 5HHPA 1NBQA 5EU6E 1IEAB 4XB7A 2XYCA 5ICZA 2NX5B 3HI5L 3D25B 2AQ2A 1MHEA 1S5HA 1KCVL 1MI5D 4RFOL 4GLRH 4KI5E 3MLSL 2R1WA 3RA7H 1EHLH 4X7TA 2Y7QB 3VXSA 5TQ0L 3H7BB 3OB0K 5AUMB 4JDVB 1HDMB 1ZMYA 4PJCF 1Y0LA 3ARGA 3CXDH 2HAZA 4ZUUA 4OCWL 4K07A 5DC0A 4P2QA 4YHIB 4FFVD 4FOMA 1R3KB 4HWZA 3G9AB 5DJ0B 2FX7L 4Q0XL 2Q87A 4POYA 2HH0L 2F58H 4HS3B 4PRIA 5ELIA 5KSAC 4A6YA 1KB9J 2ENSA 3B3IA 4FNLH 1RIHH 2IPTL 4NFBA 1JK8B 3QNXA 4PY7B 1NGXA 2J6EL 5EOTB 5CGTA 3ARYA 3SJVD 3O11B 3L7EB 5FUZL 4OSUL 4U1HA 4YAQB 5EU5A 5F1IA 4LKCA 15C8L 2C4FU 3LHPL 5D1XB 1RJLB 3PWVB 2V6HA 1QSEA 4AL8H 5DD0L 2XPGB 1BD2D 4QHLB 4ZPTA 4YXKL 3TBSB 1CF8H 4WV1C 1KEGH 5ADPL 5HYFA 2ADJB 4LCUA 1EZVX 1JF1A 3T8XA 4ODHH 1ACZA 1VHPA 1JNHB 3B9KB 3P9LA 4MAYA 5D5MF 4JEGB 5IK3B 3LN5A 4QRPA 4HFWB 4CNIA 4AIZB 5ID0A 1R3JA 2CXGA 2FD6L 1M7IA 3LZFL 2OJZH 3K1DA 4TPRH 1HXMB 1KB5B 2DQUL 1G7IA 2XA3A 1MELA 3EJZC 5TFSH 1XFPA 3WFEH 5IBTH 5D7IE 3P2TA 5KSBB 4JQVA 4QWWD 1T89C 3IB4A 2M26A 1M71B 5K9QG 1X4YA 2UWEE 1CXIA 4PRBB 3U4BL 3VG9C 3RBGA 1XF1A 5DJAB 4OCXH 1HINH 4EBQL 1NCAH 1LEKB 5D9SA 4NJ9H 5KN5B 3T0EA 1JRHI 4Z8FH 2FO1A 3GUTB 1ONQA 2B2XH 4U49A 1I7ZA 1GOGA 4HD9A 4OV6F 3LH2H 4MA1C 1GHFL 3HNSL 5CIPA 1WC7B 2OTWA 5L2KE 2I27N 2XT1B 3TJHC 4LKXA 5IW6A 1CE1L 1DQMH 4PLOB 1OW0C 1P7QD 5IHZB 1WBYA 1OY3B 3VWKA 1GIGH 3MV7E 4YHKH 1BGXL 2ED8A 4J8RB 1IGML 2NNAB 4X6CB 3UTZA 1JUFA 1UM6H 3L3HB 5IESL 3OAZH 5BS0D 5JOPD 1EMTH 2BVOB 4ZFFA 4P59H 1RZGA 1JGUH 4MXQD 5SWSE 3BWAA 1F4XL 3BRFA 2FB4H 3GMOA 4XPHH 3GMPA 3OPZL 4Y1AD 2VE6B 2X41A 2VUOA 1MH5B 3EBAA 5C2UB 3HAEG 1MRFL 4UQ2B 1CXFA 5D7KD 5A2FA 1IAKA 2EH8H 4BFBD 5C0EB 3QDAA 4F3FA 5FA4A 5GJSL 1U8JA 4JPKL 3OKOB 2Z8VC 2A6IA 3LS5H 4MDJB 2BVEA 4LPCA 2MKLC 3MRGB 4WTWA 1V7NH 4MNGE 1I8IB 3K8LA 3A0OA 2C26A 1A7RL 2PXYA 4XTRD 3CSPA 1G9MC 5IHBA 2KH2B 1A4JA 4KK8C 4FTVA 5GZOD 4P2YA 5HYJE 4OCMC 4F9PC 1YEJH 2BVPB 3M8OL 5C0GB 3IFNH 5HJ3A 3DUSB 5CFHA 5C0AE 4UB0H 2VXTH 3PQYE 4U1SA 5J13B 3O2DA 2NY5C 5CJQH 3TBVA 1BJ8A 3ARDB 3LQZA 4MX7A 4KQ3H 4PYHA 5FCSH 1IARB 1CIUA 3D2UA 4HKJB 1VKXB 3JTTA 3VE0B 2NY4C 4D9LL 2FX8L 1NMCC 2YSSB 1X5KA 4WO4A 1LK2A 2XQBH 1K9TA 1XF2A 4LDEB 1U0QA 3UDWA 4NM8L 4KTEH 3BE1L 5C2BH 2IANB 2DYPA 2WLYA 1BX2B 1D9KB 5IFAL 1FE8H 3MV8D 5ENWB 3QG6A 3TIDB 3VXME 2HTLD 2HMID 4JANA 3VH8A 3F7PC 2MPAH 3IXTA 3OJDB 5DT1L 4O2CA 3V95A 3STLA 4OGXH 4HFUH 3AUVA 3HMWL 2J12B 4HKZA 4KRPC 1Z0MA 4K7FA 1HSBB 2HJKA 2PR4L 2BNRB 1JN6A 5EU6A 5GS1B 1X5LA 4Q97A 4YR6B 4KROB 4RRPG 1SM3H 3TC9A 3H0TA 1DVFD 3VFRB 4QHKJ 2VLKE 1YMME 1MCEA 5E2UH 2XKNB 2APWA 1L4IA 5IROA 1FFPB 4Z7VE 1EAPB 3KYAA 3B6SA 3ZDXF 4RMSA 1CD1A 1AI1H 3EFFB 4P3DA 3DRTA 4G6ML 2EEBA 2FIRT 5IG7A 4LEXH 1JGEB 1G9NC 5HPOA 3LMJH 3VMNA 5KANI 2GCYA 3O3DA 4AQ1B 4M9PA 2DQJL 3FOLB 3KGRA 4PRNA 5IB3A 2H6PB 2AW2A 3G5YB 1PG7H 2A74A 5I19L 3HNTL 4YBLB 1T04B 2GTZB 4IMLB 5ALBL 5IEKB 1U8MB 5FGBC 4YHPA 1U95A 3BKCH 4R26L 3BJLA 3S9DB 4XRCA 3L7FA 1EHXA 1Q94B 1DCLA 4PJCB 3HMXL 3PV7A 1KCKA 3V5KA 5FK9A 1QFHA 4DKAA 5EO1B 5SX5K 1FGVH 4M61A 4NZRL 5EORH 2X1XR 5AYUH 4YO0A 4JM2D 4GG8A 4Y19A 2L7JA 4XBPA 3H9HA 1CCZA 4D0DA 3LB6C 4IRJC 1R24A 1DLHB 2OLDA 4JM4L 2DMKA 5JO5A 5H94A 5TDPB 5I66A 5K9OA 3FRPA 1A6AA 1RJCA 3TN0B 5IFJA 5DVLA 1EA9C 4MXVE 5DA0B 3EYSH 2GSGB 5FUOL 2GSIB 1T1ZA 3QFJB 1AO7B 1TPXB 4JKKA 4ZOEA 3O9WA 1J1XH 3UPRA 5I71B 4IOFC 4OAWA 3LDBC 4QF1A 1HI6A 2DI8A 3N1QC 1FCGA 4OZ4A 5D7IA 5JMOC 2AKRA 2N7AA 2VLRB 3ARWA 3EYFA 4YIQB 5I1DA 3T1WA 3LOWA 3V0VA 1TJHL 2UWEA 4H5SA 1G0XA 4OM0L 5D5MB 3B9VA 3BXNB 4POZC 1K4DB 5F7LB 2QSCH 4KDTC 1QEWA 5J9PB 4EQ3A 2RBLA 4KH2A 1LO0H 2VDKL 3CVHL 3R4DA 4LSSL 5IB2A 3DUUA 1KFAL 3B5TA 4D9RE 5E0QA 3RIAF 5DEFB 5DS8B 5DLML 5EN2A 5GJTH 1UQSB 1MSPA 2KZWA 3PJSB 2P47B 5L2KA 1WCBA 3VGAB 5ICXA 2QQQA 4NO2A 3NTCL 1TTGA 4H1LG 1B0GA 2FBJL 3ARGC 2YRPA 3NA9L 3AREB 2CDFB 5IQ7H 1A6UL 1JWMA 3L5XL 5CZVH 4GG6E 2IPUK 4JFEE 4PJIA 3T04D 1RIUL 1WIUA 2EEAA 4JQIH 2QR0B 4N5EC 4MJ5B 2R2EB 3CFCL 2CRMA 5F6IB 1CFVH 3VG0H 4TOYL 3HHRB 3S37L 1T2JA 4MQ7A 1UADC 3KXFD 4N0FA 5E94A 4HWBH 5SWSA 5E4EB 5HBBA 3OB0H 2HFEB 1F90H 4PJDA 3PL6B 2F5BL 4M4PA 5JOFA 2AXJA 4GKZA 4LHJB 4BYHA 2A83B 4LCWB 3CFEA 3OKYA 2LU4A 4OLUL 2XRAH 1VACA 2Q8BH 1KJ3L 1MPAL 1N64L 2VXSL 3HLAB 1CU4H 3QUYB 2B20A 4LRIA 3WFCL 4UQ3B 1JZ2A 3GBNL 3RGVA 2KUTA 5E2TL 3F7VA 2DOCA 4HK3J 1FBIL 3RWJA 5E7BA 1SYSB 5FO9B 2QHLA 1FC1A 2IBZX 1PEZA 4MAYC 2WINB 3G5VB 4YGVA 2FH8A 1R3LA 1NJ9A 4P2OD 5I30L 4YZFF 5TDNB 5F89A 1DBJL 1EK3A 2W65A 5C6PB 4HGWA 1U2HA 3Q2CA 2DLGA 1L7TH 3RDTB 4F57H 2AJ3A 4JHAH 1NFIB 3TA3D 5C0AA 1N0LA 5E8PB 2X42A 1JZ4A 3F12B 1OSPL 3IFPB 1JE6A 5D70L 5KSUA 1GZQB 3BWUC 3JV6B 3ES6A 4Y7MA 1IQDB 4RMUA 4JQVC 2XACC 3OQ3B 4G3YL 3T0DA 1BEYH 3QJHA 1B88A 3PP3K 2ADFH 2P42B 1ZTXL 4HWBA 5I1AA 1LO3H 2PW2B 2DBLH 4MSWB 5I1EH 2P24A 1PQZB 3SKOA 4PJ5D 5DZNA 1WSST 3T0EC 3KJ6L 5KSBE 3DX8A 3QXDA 1E27B 1AXSA 2UZIH 4DKFH 2A9NH 4I4WA 2DN7A 3VFGL 3THMH 1B6DA 5I8KH 1ADQL 5EOCH 4F58L 3TGXA 3MMEA 1UH2A 1PD6A 2BNQA 3TH4T 3N0PB 2AQ1A 3VWKC 1ZT1B 1I8LA 3DURA 4ETQA 5F9JB 2X2YA 2ADGB 3SKJL 4NNPL 3KPSA 4QY8B 1DUYB 2J5LC 1FL3A 4ZUVA 4M1GH 1QFWH 1EGJH 3QNZB 4EN3A 2R2HB 1HN1A 4C56D 3X14B 3T4AB 1YEGH 2VLKA 1FLRL 3EOBA 5LWYL 1U8OB 4M00A 3L3KB 3BQUD 1U6AL 4PBWD 4PGZA 1CDYA 1JIBA 1WFTA 3QISA 1T5XB 3L3IB 4F7CB 3QIWD 4ZAKD 3ZTNL 5F7UA 4RGMC 3JV4B 1MFDH 4G5ZH 1UENA 2FL5A 1EEZA 4XMPH 1BFSA 3SKNB 3VFTB 4ZPVB 5DDHB 3MRHB 4XP9L 3NBNA 4K2UH 5JIHA 4RAUB 3RL1A 5DWUL 4ZXBA 3QRFM 2WP3O 1XF5A 4F7PA 2ICEB 1V3KA 1RZJH 2PXYC 1S8DB 4JFXB 5IUSA 4KZEL 5DD6A 2DQGL 1RZIB 2AK4E 4LCCA 5GSRA 2BSRA 5F7EL 3BAEH 3GJEB 3MUGA 2FBOJ 1N59B 4G6KH 4NO0B 5K9KB 4XI5C 4NN5C 1G7HB 3ECBA 4JB9H 1J1OL 2VC2H 4KC3B 5C3LD 3C6LD 3IXAA 4TULL 3RI5F 1HCVA 1TVHA 1SEBA 1T7YA 5JZ7C 3DI3B 1FYTE 1YYMH 2DKUA 3MBXL 5I6XB 2J8UF 2IF7A 1EGJA 5J6GA 4WO4C 3DBXA 1NMBL 4HEPG 4YDIL 1MCCA 4J3SA 3WV0A 4PGDB 3IDXH 3IYLW 4GUPA 4Z95H 2FECL 4M03A 1D5MB 2VB5A 2AJXL 4G8FA 4QRUA 4NBXB 1G0DA 3EO0B 4OF6A 1F8TH 2EYTA 4G8GB 2EDJA 1TZGH 2Z91A 1GL4B 3DRQA 1HIML 4QOKE 5D96B 5B4MD 1INDH 3NFPB 2AI0H 5IEHA 1Y6KR 3FO0L 4J4PD 2IAMA 5IB1A 2ADIA 5ACZB 5KAQG 3TIEA 2VITA 3EOTH 4OQTL 3QWRD 1OAKH 5CLWA 1KLGA 1S7SA 1DBML 4ZMAT 5FECB 4ISVB 2FATH 2YMXL 1FLTX 1ZSDA 3QEGL 4G43A 4YC2B 3BHBA 3CSGA 4S1SL 5IROC 8CGTA 3KJ4B 1RZKL 3O6FD 5B8CB 3BKJH 4HHAB 5JXAH 4XBEL 1KN4H 2MNUA 3VFVB 3D25A 1TQBB 5TQ2L 1KTRL 2PO6D 4IJ3B 4HUUB 1T7XA 4U1LB 4N0YL 3QDMD 3UXFA 1KB5H 2IWGA 3MR9A 2KDGA 3SN6N 1ZVYA 2QADB 5AUMA 2JB6B 4KJYA 4OTXL 4AIXA 3FMGH 1VEOA 2VDMH 4WW1B 1SJHB 3O41B 4XP1L 3GNMH 5DJ0A 4WWID 3GKZA 4HS3A 4KVNL 3I3BA 2NYYD 4MQTB 3PWPB 1JK8A 1AKJD 4PV9B 4LSDA 1PKQB 3T4YB 4PY7A 5HVWA 1C7SA 5HHMB 4KKLD 5I1GH 3Q5YA 1FPTL 4YAQA 3LRHA 1IAMA 4L4TD 1WICA 5DJZB 1CFQB 4GMTL 1FNHA 4WNQB 5D1XA 1YNTB 5KS9F 1RJLA 3PWVA 5JUEH 1KPRA 1FNGB 3CAFA 1EEYB 5SX5H 1JI2A 2XPGA 4ODBD 4QHLA 3TBSA 3CCHB 3O9WC 4LAQH 2ADJA 3KPRD 3KYOB 2FGZA 1IZKA 5DR5L 4E0RB 2FEDC 3UAJD 4YFLI 4JR9H 1JNHA 4KQ4H 4OCSH 3B9KA 1A5FH 4D0BB 3TYFA 4LRNL 3S4SB 1JBJA 1K8IB 3RY6A 1U8QA 2F19H 5F6HI 5KW9L 2EECA 3CC5B 1YECH 4FZEL 4NT6B 4R4ND 5MP6H 1HXMA 2VQ1A 4FZ8H 1KB5A 3QDJB 4FG6D 2X05A 1MCPH 4ZFGH 4G9FE 4J3UA 1AJ7L 3D39D 4HLZG 2MMXA 4LLQA 3QPQD 3B8YA 5KSBA 1CDIA 1CGWA 3SDAD 3QA3B 2W59A 5LBSL 1KV3A 4PTTA 1M71A 5E2WL 3D0VB 3W0WE 5BVPL 3GI9H 4TSCL 4PRBA 1FFNB 4LSUH 4MVBC 2BSTB 4DWHA 1HWGB 5DJAA 4FQIH 1UYWL 4LLWA 3O4OC 1LEKA 4DUWA 4U1KB 5KN5A 1DQLH 3GUTA 2KZ1B 4RWYH 5EBGA 3BN3B 3HUJE 3QAZC 5A16B 4B41A 2NTSP 2P46B 5ID1B 5DJYB 3I2CL 3LN4B 2D7MA 3QHZL 4CUCA 3RRQA 3HZKB 3Q1SH 3OXRB 4XWOC 5IHZA 4JLRA 1J0YA 3B2VL 4KV5F 4J8RA 4YDLC 2BY2A 2NNAA 4X6CA 3DROB 3L3HA 5KSAD 1D5XB 1MHCB 4FFZH 3R0MA 3P40A 2ARJB 4L5FL 4LRIC 5T1MA 1QPXA 5C92A 3GHEL 5T3ZL 3F8UB 5IT2H 3RGVC 1IGFL 4D9QE 3CZFB 5ICYB 3MUHL 1P84J 4UIKL 5ISZB 2NQCA 4I9WE 4ELMF 4UQ2A 1JV5B 3MLZH 4ODTH 4OLXL 3DXAD 5D2LF 5C0EA 4E41D 4V1DD 2BDNL 3UBXB 1HZHH 1K6QH 3A67H 4DOHE 1PJ9A 1LP9E 3OKOA 3RVXC 4MDJA 3PG2A 3MRJB 3NCEB 3OF6D 3WFBH 5MHSE 3EJYC 2D4DA 3MRGA 2WIIB 1S78C 4WEUD 2G75B 1I8IA 3HB3D 2E7BA 2PNDA 1EUUA 4L3EB 3BO8B 3INUH 3MLWL 4YHYC 1OOAA 4Z0XB 4DZBB 1LE9A 2ZUTA 4NOFA 4NQCD 3RIAK 3CFBB 2BVPA 3HI6H 5C0GA 3DUSA 2VXUL 5AAWA 1BQHG 3NPZB 2VYRE 2Y23A 4HUVA 5BJTA 4YXLH 5T5NF 3HS0B 2Q6WB 5E8EB 5TE6H 2LTQB 1JWUB 1NC4D 5GS0L 1C12A 2QEJA 4PJ8B 5B21A 4HKJA 1VKXA 3QEQD 1NGQH 3VE0A 2X1QA 2YUWA 1BM3H 1KPVB 1C5DB 1NBVH 4YX2L 2ZNXA 4YBHA 4XP4L 3U1SL 3PP3H 2FO4B 1UA6L 4X6EA 4QOKA 1JTOA 2J8UB 3BKML 1I8LC 3NA4A 3ULUL 1BX2A 1D9KA 5ENWA 3TIDA 4NQVA 5E8DL 4EN3C 2C3XA 3PHQB 4PRHD 4JZNB 4P2RE 4DK6A 2YD4A 1H3PL 3M1BB 1H0DB 3OJDA 4F37K 3LKPB 3WO3B 3KLHC 4K3DL 1RULL 1MAML 1T03H 1HSBA 2VLMD 4PB9H 5GS1A 3WIIL 4EQ2A 4YR6A 3QRGH 2JLLA 3RWGB 4K3JH 1ROWA 1DBAH 3G6JE 1YEFL 3VFRA 3E8UH 1F2XK 2XTLA 4M5YH 4BK4A 5ECJE 5EZOL 5GGRB 2GITB 1AC0A 1WQVT 2N4IA 3A6BL 3MOBH 1W72L 3HPLB 3MRIA 2EO1A 4JPWH 4ZXBC 1EAPA 1E0OB 1WWBX 3TCLB 3EFFA 5I0ZA 1B4JL 4TUJB 2V2WB 4V2CB 4LCCC 3U2SA 2R29H 2ZCLH 2R0ZL 3LPGA 1NUGA 3EDJA 3FOLA 1S7XB 2H6PA 2X89D 4LVEA 3G5YA 1OAXH 1T04A 2GTZA 2NXYB 3IU4L 4IMLA 1P4BL 4N8CH 4WY7H 5EC2A 3UYOD 4KK8D 1Q94A 4PJCA 4FABH 1MLCB 4UDUB 2YZ1A 2DDQH 4OZFG 3LKSA 2IMNA 1N8ZA 2XFXA 4HKXB 1JZ6A 3B43A 2V7HB 2Z35B 2ZUQC 4NOBA 4WFFE 3JTSA 1I8KB 2OSLB 2VN4A 5TDPA 32C2B 3TN0A 4KKCC 1P5VA 3MJ8B 5E1HB 5IVNA 2EDHA 1CZ8L 1CWVA 2I9LB 1RFDH 5SWZD 4GO6B 2ITDB 2O93L 1M05B 2GSGA 4DN3H 2GSIA 3B2UD 3QFJA 1NSNL 5KS9B 5E5UB 1NLDH 5J8OA 2IAMC 1HK6A 4G9FA 4I0PD 1B3JA 4LEOB 2Q76B 2AJYL 2A6KB 2ZKHH 3P0VL 1RZJC 4QO1A 3ILQC 4YIQA 3MYJA 2R69H 1OM3H 1GAFL 2AABH 3W0WA 1NGWB 4UUJB 5D5MA 3RPIB 5CGYC 2XKUA 3BXNA 3NMEA 1T2QH 1K4DA 1SYVA 1JHLH 5HHXL 5CUSL 5J9PA 1MCOH 1OP9A 4OFDA 5GRWA 4KRPD 3V52H 5ALCH 5T3ZE 2VH5L 1VPOH 1J8HD 3T3MF 5ITBH 4FS0A 4NZUL 4KFZC 2CUMA 4XC1L 4PJXF 2CRIA 5DEFA 4XPAL 4M62H 3RAJL 4XP6H 3OKMB 5DS8A 4OZHE 2Z4QB 1UQSA 2V2XB 3QUML 4UBDC 3PJSA 1OPGL 1P7KB 5ESAB 3HPJB 3BESR 4M9OA 5GHWH 2VERN 1G6VK 5MEQA 1G7MB 4FA8A 2G2RB 4Z7OE 2FHCA 2ORBL 3K80A 1OD9A 3AREA 4JRYD 5LGJB 3TNMB 2A6JB 2D9QB 4N90E 3SOBH 4Z9KB 2EC8A 2QR0A 4MNHB 3RI5K 2R2EA 5FO8B 1JGVL 1W0VA 2VRAA 4HWEH 4WHTA 4P4KD 4LP5A 3TBYB 4TUOA 2X4NB 2HFEA 3PL6A 2ESVB 2CDGB 2A83A 5FEBA 4K23H 4LCWA 4WHDA 1OAYH 5F96H 4JN1H 4WTXA 2BHUA 5F1NA 3ZL4L 3GSOB 4HS8H 3HLAA 4MA8H 5D1XC 1ZEAL 2A77H 4UDTB 5HXMA 4TVPE 1LP9A 5IF0A 4PB0H 5TE4L 4UQ3A 5DO2C 3UJTL 5INCB 3PWPE 1Q0YL 2XY2A 4CU6A 5J0BA 4RWHA 1S9VB 2WK2A 4PRPB 4TNVK 5FO9A 5CEZE 1MRCH 4GMSL 4IRJD 3EYOB 1E4WH 3B9KC 2WINA 3G5VA 3C9NA 1LO2L 4HC1A 4PRDA 5DGQA 4N0UB 1DBKH 5TDNA 3RY6C 2Y4SA 3DVNB 3FO2B 1FL5A 4ELMB 2APBA 3UEZA 4U3CA 3BGAA 5D2LB 1S7QA 4GKSB 2F53D 3RDTA 1U9KA 5MEOB 1FN4B 1N5AB 1NFIA 4JG0L 3T0BA 1RI8A 4IOFD 3UZEA 2DQEH 1MIML 4HK0B 3F12A 1QSFD 3S97C 5IGXL 1FAIL 3HG1D 5F7HA 2GJ6D 3EGSA 1GZQA 3JV6A 2EXYC 3JBG7 2CUHA 3PF2A 4X80H 3VGEA 4E5XB 1IQDA 4WWKB 1H3UA 3MNWB 4EJ1C 1MWAL 3HAEB 4POZD 1C5BL 3D48R 4LCIH 4UT7H 3HRZA 3QDJE 5CP7B 4JDZB 3NACL 1YY9C 2NXZD 1O7VA 2VDRL 1J0JA 1CICB 4MSWA 2ZJSL 1PQZA 1JI1A 3IAGC 2HTKC 4P9MH 2V17L 1IGIH 1WZKA 3TV3H 1E27A 3WD5H 3O6LL 1A21A 3KPPB 3IJSB 1RY7B 2HKHH 3FQXA 4MCYB 5C0FB 1U8PB 1TXKA 3QCVL 3ARGD 4P48A 3C09C 1Q8MA 3FT2B 4CVXB 3CLFH 2YK1H 1ZT1A 1ZLVK 2UVFA 5FYKH 3LRGA 2X70B 2ADGA 4FQ1L 4LASL 4N5ED 1DUYA 4ONHB 5C86A 4L1DA 4PRID 2AXHA 3QNZA 3K74B 3VXUD 4GRLD 4L9DA 2R2HA 2N56A 4ACPA 2R2CA 1W2KT 3D3VB 3T4AA 3GI8H 5BCAA 2DQDL 5HGDB 3FQWB 5A2LH 4CW1A 1T5XA 2P5WE 3L3IA 3F7RA 4HPYL 3V9FA 4P99A 5C0DA 2DJUA 1IC7L 3JV4A 1CDBA 3BGFB 4JO3H 2F5AH 4O5LH 2RR3A 1V5JA 3SKNA 3VFTA 4ZPVA 5DDHA 3MRHA 3FONB 5FYLD 4RAUA 2MTPA 1UWXH 5ISZE 3BPOB 4KK5C 4MAYD 2ICEA 1S8DA 4JFXA 3ZE0F 4NRYB 1SBBA 4QRPD 3C87A 4B7IA 1RZIA 8FABB 2AK1L 4NJAL 1F4AA 3QIUB 5F3BB 1N59A 4NO0A 4UOW0 1OCWH 4OD3H 1DDHB 1OARH 4PS4L 4EDWL 1F3DH 4Z5RB 1NCDH 4M7KH 1YNKH 2AS5M 1RZFL 1HKLH 2CK2A 5IB5B 4BFIB 5J13C 5HHOB 4L3EE 3TLRA 4M1DH 3FB8B 4LU5L 5K9QI 2H26A 3BEWB 2W91A 3WIFB 2EDTA 3E6FB 1JYNA 1MQKH 2BOCB 6FABH 4QTIL 3KPNA 5EBMB 5BO1L 1LQSR 5FF6B 5CINL 4UINL 3U0WL 1OAQH 3AMLA 2D0HA 1G7JB 1C5CH 1HSAB 1AGDB 1D9KC 1LDPH 5DFWH 1D5MA 5D6CB 3V79C 3G6DL 1LWRA 4NKMB 1BJMA 1LVEA 3EO0A 4NUGH 1J7VR 3G9VA 1QR4A 1JPFB 1UB5A 3LSOB 3SE4A 1EVTC 3IS1X 5ITFB 3WDJA 1WJ3A 1XCQB 3ZSTA 3NCCB 4U4BA 1XGYL 3W2DH 1CT8B 5ACZA 4Z7NF 4JJ5A 4KK9D 4YHOL 4R7DB 1JMZA 1SQ2N 5GS1C 4F15B 5EU7E 2DM4A 4KROC 3IKKA 5FECA 4ZNCD 5DMGC 2P8MA 3LD8B 4JRXE 2WAHA 4ISVA 1UACH 2YBRB 4QXGH 3IDYB 4UV4L 3TWCL 3BRDA 4OD1H 1G6RL 5KAQF 3R1GL 3K8KA 5B8CA 1CR9L 1A0QH 4U0QB 1ZGLB 4HHAA 3C60B 3VFVA 5DQDH 5GGTL 4LQFL 5I9QB 2XN9D 1QD0A 3H42H 3HA0A 4HUUA 4HG4K 5DD1L 1F45A 4U1LA 4PJXB 1PG7X 4YEFA 3VGHA 1ZLUK 2Q3AA 4WI5A 3X3FL 1WF5A 1YQVH 2W9EH 4NUJA 2JB6A 4YBLC 2D9CA 4Y2DB 4X4YA 2PXYD 4BQ9A 2EDBA 4WW1A 1SJHA 3BT2H 3O41A 3C2AH 5EPMA 4FTVD 5F9AC 2BC4B 3S5LA 4Z7WF 1HHKB 3K8MA 1J5OH 1GOHA 1GYAA 3TT3H 1UEMA 1KCLA 1KN2H 1EFXD 3SDXE 3RWCB 3VH8G 5I1CL 4NNXB 4XI5D 1V05A 3NH7H 2Z0BA 3TO4D 2YD3A 3PWPA 4QCIB 3UYRH 4PV9A 1LE5B 3T4YA 5I2IB 3O6KH 5GIRB 4H1LB 2AEIT 1KIRA 3T0WA 1KOAA 3TN0C 3NZHH 2WV3A 4HXBL 1CFQA 4WNQA 4XH2B 1YNTA 1YEHH 1CQYA 1OWWA 3ARSA 5B3JF 3MLYL 4DQOH 2H2PC 3ZT6A 1FNGA 1N4XH 3MREB 3CCHA 1TPXC 2J7LA 3Q5TA 2X4UB 4E0RA 2DD8H 2W07A 4JREB 3F7QA 3S34L 4D0BA 2E9JA 1RUPH 2BRRL 2JJVA 3GSNL 1I3GL 3HN3A 1K8IA 2VR5A 3CC5A 4NT6A 1MREL 4M43L 1NFKA 2XZCL 3EFDL 3GRWL 3FOMB 1F13A 3T08A 3QDJA 3O45A 2EH7H 2DLFL 4FXKB 4X4ZA 5KS9E 3IVKB 2FRGP 4WHYH 3PHSA 5HHVH 4M48L 4M6NH 2ERJB 1NCCL 3FQTB 3ZT5A 1W72A 5KZCD 5EU6D 4FQHA 5HD8C 2H1PH 3QA3A 3CSYB 3BYYA 5H37G 3D0VA 1QRNE 4Y5YB 1KEMH 3L3GA 4KI5D 1FAKT 1FFNA 2BSTA 3VGAC 2EYSB 1GC1H 1S7TA 4BZYA 1B4RA 1L7IH 4M93B 5GSVB 3AREC 1ZWIB 4U1KA 1AGEB 1U42A 5IWLA 3FRPG 4MS8C 5A16A 1H15B 2R0WL 2VWEE 1MOEA 1P1ZB 5F6IC 3T2QA 5ID1A 2G5BB 2L0DA 1E6JH 4S1RL 2WWMD 2DQCL 4U3XA 1NAKH 5DJYA 4GXVH 1RUQH 3LN4A 1FFRA 5E4EC 4CN6A 5I1KL 3BPCB 3HZKA 2XZZA 3OXRA 3PL6C 2XTJB 1AQDA 4CDGC 1BFOB 4Z0BH 4R2GD 3MPCA 5IW3A 2DB8A 1E6OL 3DROA 1X6LA 3U4AA 4M6OL 3QUYC 4UU9A 1KULA 3ZKSD 3HC4H 3CZFA 5ICYA 5FHBH 5ISZA 5DJ2B 4JFZH 4YPGA 2AJVL 4Y4HB 1XEDA 4LHUG 4CDHA 5IFHH 4NGHL 4M5ZH 3UBXA 1CGYA 2CK0H 4PLJC 1JPTH 5LJYH 2YPKB 4KV5E 4AH2B 3MLSH 3MRJA 3QCUL 3QI9A 3RDTC 3ULUF 5TQ0H 2G75A 3W5MA 4OBSA 5FKPA 3SY0B 1NCWL 4L3EA 3BO8A 1TJGL 4EXPX 3FFCB 4Z0XA 4DZBA 1B2WL 4Q0XH 5D71L 4I48B 4HXAH 3BMVA 5MEPB 3CFBA 3DX6B 5GISH 4URTB 2EDKA 4ONOA 3KR3H 5JW3L 3CMGA 2BK8A 1JWUA 1INQB 4HQQL 3C8KB 4PJ8A 3C6SB 5L2KD 1KPVA 2GYSA 1C5DA 3CXHJ 4HS6A 5DD0H 2FO4A 3MQIA 3EAKA 1T1XA 2XXCB 3ARBB 1KIUA 2EDNA 4KKNA 2J8UA 5D7LB 3MGOA 4PJBF 1JF6A 3QUZB 4DEPB 2AEQL 3REVB 1CD9B 4LIQL 2OP4H 4Y4KA 1TETH 3WFZA 3RU8H 5C07B 5DVOA 3EDEA 2P8PB 3PHQA 4RGNB 2Q1EA 1FNEB 4JZNA 5FCUL 3CK0L 5SWSD 3M1BA 1H0DA 4HJ0C 3AVEA 3ULSB 1KB9K 3LCYA 3LKPA 5FGCB 3DSFL 2VSCA 4YWGL 2DI7A 1CI5A 4JFFB 4YBQC 2OJEB 4MHHG 4F7TB 4H20H 3S88L 5DUPL 4JDTH 3CMOH 5DRWB 3RWGA 3F6LA 3ULVF 1KJMB 1TVBA 1G0YR 1NMAL 3FKUS 4LSVH 3RPKA 3NVQA 2YXFA 2FZ3A 2I5YH 5GGRA 1CXKA 2GITA 2FDBP 3HPLA 5KVEH 3MCLL 1A22B 5MENE 4U7MA 3BGMA 4KVCH 3SBWC 3QSKB 4YGAB 3TCLA 5IMKB 3OB8A 4I13B 2D7PA 2V2WA 1VA9A 4Y4FB 2AGJH 1WFNA 3RVXD 12E8H 2AQ3A 4NWTH 5HYJD 1QBLL 2BP3A 1S7XA 4RGOL 3MCKB 1S78D 4IDLA 2ZOKB 5C0AD 3PQYD 4NQUA 1CE1H 5F7YC 5DJDB 1UXWB 2CKBL 2QQKL 4L8CB 3F62A 5AG8A 1QA9B 4AMKH 1IGMH 2RIKA 5C08B 1MLCA 3U0PB 2OXGA 4UDUA 4OM1L 1XIWB 5I6XC 5C0ND 1RZ7L 5IESH 3L1OL 1F58L 3OR6B 5IVXF 2Y9RT 4V2BA 5T3XE 4CVZA 3GBMH 1U93B 4HKXA 1F4XH 4ORGB 3BKYL 4Z7WB 1KC5L 3BEVA 2V7HA 3E1F1 1BIIB 1FZJB 1I8KA 32C2A 3RY4A 2FIKB 3VXMD 2I9LA 4HCRA 1S3KL 4TNWF 1PAMA 3SE4C 5D96C 1I7RA 5KS9A 2ATKB 4QRRB 3UMTA 3FN0H 4KZDL 1J0KA 3U7WL 2Q76A 3HNVH 3VRLF 2A6KA 2ZSVA 4FHBD 3B9EA 2Q20A 5EIVA 2CLVA 3S36H 4U1JB 4KKAC 1F6AB 4ZO8A 1NKOA 4KPHL 3DVFA 1NGWA 4UUJA 2VLKD 3RPIA 3ZTJH 1YMMD 4XCCL 1XT5A 3Q6GH 4YC2C 1AFVH 3MLVL 3KLHD 3KJ4C 4ODVH 5F7NC 2VDNL 3CJJA 1EO8L 5B8CC 3T1FB 4EKXA 5ADOH 2LFGA 2B4CC 1JZ5A 5BRZE 3OKMA 1TQBC 2Z4QA 4IJ3C 2V2XA 1P7KA 5ESAA 3HPJA 2JCCF 4WGWB 3RWIB 3P30L 5BV7L 4YQXH 1BQUA 1GSMA 5AZEH 1G7MA 4DW2L 3T77B 2DQHH 1WT5A 5DVKA 5DUML 2G2RA 1HXYB 3EUUA 3QXVA 1FL6B 3CH8A 2ICES 4J1UA 5LGJA 1MFEL 3BE1H 5CEYB 2RFXB 5LKNA 1UWGH 5JR1L 2VR4A 1X5JA 3HAEH 4MNHA 3L3DB 5D7JB 5FO8A 4WI2A 4LLYA 2OL3L 4NDMB 4PJXE 4C55A 1BFTA 5EA0L 3V4PL 1ZLUH 3TBYA 4QEGA 2X4NA 3H3PH 5C0BB 5DT1H 1IC1A 1IC4H 4ODXB 1YY8B 3UTPE 1WTLA 3MRMB 3OZ9L 3QH3B 1BIHA 3ETBF 4UDTA 1E4XI 5INCA 4WUKL 1E4XL 4MLIA 4ZSOB 3OKLB 4DZ8B 4BQ6A 1CE6B 3SGDI 4WIQA 3RTQB 1RUKL 3EYOA 3V8CA 1GH7A 3NAAH 2IGFL 3WLBB 3AS0A 3QO0A 3GMRB 4N0UA 2VXQL 1P2CB 3DVNA 4LIQE 4RQQB 4ZOBA 4ELMA 3TYGL 1LO4H 3SE8L 3UTSB 5D2LA 4GKSA 1KXVC 3G6AB 2YWYA 4UTAL 5MEOA 2R4SH 3SQBA 1FN4A 3QDGB 2IAMD 4Q7DA 1TQCB 2NZIA 3HNTH 4O9HL 4EI6B 4HK0A 4GAYA 3ZSSA 5ALBH 4ELKB 4D9RD 1QZ1A 4ETYA 4QHUB 3ILQD 4LF3B 1A64A 2EDXA 35C8L 2YD7A 3SGEI 4WWKA 4DCQA 3MNWA 3HAEA 3HMXH 4PGEB 1U41A 5DRNB 5CP7A 4FQPA 1CICA 1FVDB 4G6JL 3U82B 3AM8A 3DUHA 1YDPB 5I17A 1VEMA 2BX5A 2OR9L 1Z9MA 4KTDL 5IWLC 2A73B 4K7PX 4JFED 3RWDB 4HZAA 1L0YA 5GXBB 2JJUA 3N85L 4UBDD 4RX4D 5CSZA 1QLFA 3C5ZB 4OKVA 3IJSA 3ZT7A 3X17A 4XXDB 4MCYA 4O02H 1KXTB 1YZZA 2VLLB 4PGCB 1T6WA 1UKTA 2QBWA 4OFVA 1WFUA 4X7SL 1AE6L 5CILL 2X1WL 4Z7UE 3VRIB 1IKFH 4TRPL 2DTML 2B0SH 2DKMA 1BWMA 2X70A 1MCHA 2I07B 5EZIH 4ONHA 1LK3H 2CLRB 4S1QH 4NQXB 1A3LL 1FGNH 1MNUH 2XWJB 1IGCL 3VFMA 4CU7A 1MY5A 3S37X 3VCLB 5HGDA 4JHWL 2VZ3A 1OGAB 3QFDA 2CMRH 5TE7H 4NQDE 5L0QB 2HFGL 4F8QA 4JO2H 5D1XD 5CJOL 3QXUA 5KTEH 3L9RB 5DLMH 5CWSB 2D31B 2DL2A 5D72L 3V4VH 1MJUL 5TDOB 3FONA 1A6ZB 1GZPA 3CU7A 3OAUH 3CNKA 1GC1C 4J3TA 3K46A 3QQ9C 1CBVH 4MZ2A 3NA9H 1UM4H 3QXWA 3LKRB 4XNYL 4NRZB 1IAOB 4NRYA 3RKPA 1N6QL 2B5IB 2H32B 2VDPL 2Y07L 8FABA 3QIUA 3WHXB 1PBYA 2HWZH 5J12B 4KUCD 5IKCB 4W70A 1CLOL 5FB8A 2YA2A 1DDHA 4RRPA 4Z5RA 4B5EA 3G5ZA 3HE7B 4NO5B 5IB5A 2CH8A 2F5BH 1NPUA 3QDHA 2B1AH 2HLFC 3O8XD 3FB8A 5I8OH 1TIUA 2LTQC 4L3CB 5JHLH 4PJ8C 4NCDA 1N64H 3WIFA 3E6FA 1F4WH 2BOCA 3P0YL 5HI5C 1PG7W 1FRGH 5EBMA 5FF6A 5HYIA 5HDBF 3C8HA 2HTKD 4M7JH 2UY7A 5IVXB 3NIGF 1BQLL 1G7JA 2WUBH 2NY6B 1AGDA 4Y4KC 5EIQA 4FQXA 4W6YB 2NTFB 5D6CA 4NKMA 4QHMB 4M6MH 1DBJH 4XAWL 5DSCB 4P9HH 1JPFA 1J88A 3LSOA 5ITFA 2EIEA 4LFHG 3MOAL 4LPWA 3DMMD 2R0LH 2XZQH 4LOUD 3RWEA 1XCQA 3HZVB 5D7LE 4ZFOL 1CT8A 4MJ6B 4H1LH 3EHBC 1OSPH 2IALA 2JB5H 4AEHH 2Y36H 1D6VL 1I1AD 5D70H 4KI1A 5C07E 1FO0L 1F42A 3LN9A 5I8CA 1WV7T 3FQNB 2Y6SC 2DTSA 4JKPH 4PJEE 2F74B 5KG9B 4RAHA 3U4EB 1J1PH 1OGTB 4JFFE 3OKKB 1I9JL 5DD3L 1ZGLA 3C60A 4MWFA 3CFDB 3OHXA 1ZXQA 2AK4D 2IPUG 1RJYA 2FJGA 3NCJL 3VFNA 5DQJB 5EUOE 3VFOB 1M1SA 5LGHL 4PJXA 4OI8A 4HGMA 1MCQA 4PJHE 4UV7L 1DFBL 4U0RB 3U9PL 1EERB 1ED3B 4Y2DA 2JCCB 2NXYC 1NBYB 4Q9CA 2UUDK 4UMGA 3WSQH 2EDWA 2PW1B 3WN5B 3BP4B 4P5TB 3NFSH 5EU4A 1IGJA 2BC4A 4PD4J 5CMAB 1FYTD 3ARVA 1D5ZB 3RVUD 3ZE2E 3RWCA 4NNXA 2I24N 2XKSA 5KVMC 2BSED 3KLAB 1QKZH 2FX9L 3TJEL 1AXTH 1BOGB 1MI5B 3IDIB 4QCIA 2HT3C 2XWBB 1MHPH 1LE5A 5KJRH 4AJ0A 5I2IA 1K8DB 4FQLH 2DQIH 4H1LA 5GIRA 5TF0A 4XT1C 4L4JA 4FQJL 4OCYL 2QKIB 4G80B 2W9DL 4EUPG 2R2BB 4MDIB 4Z7WE 2X1PA 4QOKD 2X4UA 3SDYL 2HKFL 4PREB 4Y16B 5HPMA 3MRQB 3BDXA 3ZE1F 2AJSL 4MNQE 2X10A 1D9KD 5FUCC 5LVEA 3BI9X 4KZEH 1NUDA 2DQGH 2AERT 3MXWH 3TNNB 4PJAF 4YXHL 4JFYA 4GXUM 2ARJQ 4ZOAA 4OFYA 3LV3B 1NCNA 3FOMA 3P4OB 4FXKA 3IVKA 2MFNA 2A9ML 3PE9A 5INDB 3FQTA 1BBJA 3PP4L 4HJJL 4MQSB 1F4YH 1G9ML 2QQNH 4WI6A 2XOTA 3WNPA 3CSYA 3GIZL 5E5MB 5EB9A 2K7PA 4OJFL 3FQRB 4MD0A 4Y5YA 3ZDZF 1AGBA 1A1MA 4GQ9H 3P73B 2EYSA 2GHWB 5GSVA 5K59F 1ZWIA 4H88L 5AEAA 4QNPE 3MODH 1FYHB 5D1QD 2NY5L 5HI3C 3VDCA 1TNNA 4CJ1A 5EOQL 4KHTL 2Q8AL 2UV3A 3RJDA 1P1ZA 3FT3B 3V6ZB 4D2NA 4MQXD 1P69B 4IRSA 1FVCB 3UTTB 4D8PA 5KOVC 1XGQA 3BPCA 4LDLB 4AIOA 1G7LB 4LVHB 1WAAF 1BFOA 2PYEE 1J8KA 1NDGB 4XCNB 5J1TC 4OQTH 1KJVB 5JW4R 3MV01 4RFEB 5I15L 4CADB 2ZCKL 5B38G 4LVNB 3LQAL 4R90H 3KLSA 4W4OA 3H9ZA 4FFWC 3D9AL 3IDGA 3QEGH 4XVUC 2JTDA 5F9OH 5DJ2A 3SGJC 2QSVA 1CTNA 3NABH 3VDAA 2YC1B 4X6DF 1J18A 1P7QB 4XVSL 3H8NA 2H2PD 4UI2A 3VD7A 4R8WL 4RISL 2YPKA 4ZTOH 5ESVB 1QOKA 2DICA 4ZSOE 1KLUA 1MEXL 1C7TA 5BS0B 2CDEB 4G9FD 3OX8A 3SY0A 4X4XA 5CJ8A 4Y1AB 4H0HB 1CGXA 4POUB 4LDOB 5M95B 1C16B 4RCAA 4WWKC 3QCTH 5DJXB 2IEPA 3W0WD 1G9NL 2OXHA 4I48A 5MEPA 4JVWA 3JWNC 3DX6A 3HFMH 2X4QB 25C8L 1ZVSB 1A4KA 1JP5A 1CICC 4EVNA 1NAMB 5HD8D 1JGDB 1CGTA 1OTUC 3LEVH 2CO7B 3C8KA 3D1MC 3C6SA 1KJ2B 4OV5B 4XNMB 3KPQB 5E2VL 2MKWA 4HZLB 3MO1B 5GPRA 3ARED 3ARBA 5I1JH 4UNVA 3ME0A 5DFVD 5D7LA 5AZ2H 3QUZA 5DR5H 2R8SL 4U6YB 2V9RA 3X3GH 4ALAL 4U3HA 4OUUA 1IM9D 1BAFL 2QHRL 4LRNH 4RAVA 5I1HH 5C07A 2YD1A 2RAMA 2P8PA 5DI8B 5KW9H 1FNEA 2GJJA 2DI9A 4RBPK 2P7TA 4RIRA 2FWOB 3ULSA 3QZWB 5E9DB 4BUHA 5BQ7A 1I7TB 3MRPA 5GRUL 4D9QD 2ZWLT 3ALWA 3OTTA 1M7DA 4PG9B 1U8HB 3CGTA 4X8JA 3SO3B 3FT4B 4PRHE 1GGBH 3VI3E 2PCPB 1ORSB 4I9WD 3LIZL 4JFFA 1S7RB 4ODSH 4X9BA 2OJEA 3GBLA 4F7TA 5J7CC 3QHTC 1RJZB 1OP3K 1JHTB 1AQKL 3BGFC 2XNAB 2XXMB 1H3VA 5BVPH 3CVIL 4ZUSB 4TYUA 3ZKMD 5EUOA 5E99H 4XCFH 4TSCH 4GBXA 2R4RL 5L8KB 3MV8B 5MHSD 1OGAE 4K9EH 5FM5M 2EDOA 1IBGH 1FNSH 2DF3A 4HIXL 4PJHA 3V0WL 1INEL 3BPOC 2VDLL 1ND0B 2G60L 4F8TA 2X4SB 1KENL 3KWWB 5IMKA 4OLZL 3BVNB 4C83B 3OJMB 2GUOB 4KY1L 1IAII 3IFOB 3QYCA 4Y4FA 3QIUC 1IAIL 5AG9A 2WUCL 3V6BR 3ULVE 2ZOKA 1ZLSL 1KTKE 1DVFB 4MYWB 1F2QA 5I73B 3N06B 5IMMB 1DQDH 1TZIB 3TP4A 3I50L 4L8CA 3ROOA 1RUML 1QA9A 4HMCA 1JZ7A 5C08A 2GJZA 3U0PA 1G1YA 1XIWA 2DMBA 1R3IH 3IF1B 3OR6A 3TT1L 5EO9B 4A6YL 4O2EA 4FFYL 2CIIA 5DC4B 1U93A 3MCG1 4Z7WA 1F00I 2VDOL 2LABA 2WMPA 1YQ2A 2DIBA 3WUWB 5FFLA 2D7TL 2OX5A 1BIIA 1VGEL 5EULV 4WU5B 1OAZH 1X44A 3WS3B 3X11A 4OLYH 2FIKA 3OG4B 1RUAL 2V9TA 5D1ZB 1CG9B 4KUZL 2BDNH 4L4VB 4O51B 2GIYA 2IBGA 3FL7A 1XGPB 3P9WB 5TF1H 2GK2A 2OZ4H 2ATKA 4MMZC 1MF2H 3RGHA 1I8MB 4PJ7F 2VXVL 5CZXD 1T3FB 1NANH 4UNUA 3VWJB 4NQTA 4F15C 3MLWH 4J23A 4U1JA 1F6AA 3TCXA 1T83A 1UZ8B 4M7LH 2APXA 4GLRI 3LD8C 1WWWX 1U8NB 1I3RB 2C3WA 1S7WB 3CLEH 3IDYC 3RA7L 1EHLL 3UTOA 5MI0B 1TITA 2W0FB 4PJAB 1MUJB 2R15A 1P84K 3T1FA 2QV2A 3C60C 3CXDL 5K9JH 1IQWH 3GGWB 3CH1B 5C7XH 5JQ6H 5I9QC 3LEXB 4UT9H 4LNRB 1I9RH 2YA0A 3HKFA 4UNTA 5C0CE 2WBJD 3T77A 4OKDA 5E6YA 4XP4H 3U1SH 1UA6H 3MUZ1 4DUXA 1EO5A 1QBMH 4FNLL 4Y2DC 1T20B 1JNJA 5EU3B 1RIHL 5CEYA 2RFXA 1F6FB 1MRDH 1DSFH 5T1KB 3ULUH 5C0RH 4WFHE 3I85A 3GB7B 3C08H 4X4ME 3L3DA 5D7JA 4PGBB 4D94A 4NDMA 4JFDE 4P9HC 4AL8L 4OB5H 1CL7H 5EOCJ 1CF8L 2OZ4A 5IJVB 1KEGL 4WFFD 1YY8A 4XPGH 4KMQA 1DR9A 1RVFH 4ODHL 5DRXA 5E08H 3MRMA 4KGLA 1YC7A 1JWSB 3WIIH 2X4PA 2J8OA 1FIGH 3QH3A 3VFWB 1UT9A 1YEFH 3FZUC 4GT7A 3X13B 5BMFH 4GH7B 4WHCA 4ZSOA 3DARA 3A6BH 4TPRL 5E6IA 3OKLA 4DZ8A 1U3JA 4HIJB 1DANU 3RTQA 3KXFB 2YPLB 3WLBA 3GSWB 4JREC 5TFSL 3EYUH 3GMRA 5IBTL 3WFEL 4E42B 1KELH 3GFUA 4RQQA 3TBWB 5I1IH 1DLFH 2BHYA 3UTSA 4X6DB 4LLDB 3G6AA 3VI4F 5HYEA 4Z7QE 3MJGX 3P9MB 3QDGA 3H9SB 3SDCB 4U2ZA 4EI6A 5I76A 5T3ZD 4OCXL 2ERJC 1JJUA 4P2CG 1NCAL 4ELKA 3QQNA 1OLZA 4PJ9D 2E7MA 2P8LA 4KKAD 4LF3A 4CMMA 1RPQA 3GMLA 4MD4B 4Z8FL 3ROLB 1EPFA 3B8SA 1NLBH 2B2XL 4LHUB 5EZLB 1IZJA 2NLJB 4Y5YC 3LH2L 2GJ6E 1OTTD 2HJFB 4PGEA 4P2OB 5DRNA 4JCMA 3ULVH 3HC0B 2CSPA 4J7RA 4KKBD 4EI5B 3QQ4B 4I5BB 1GRWA 4M93C 1FVDA 4MB3A 1A6VH 3Q0HA 1DQML 1YDPA 3O2DL 4N90D 4F9LA 2H32H 2A73A 3RWDA 1SY6H 3BW9B 3TA3B 4YHKL 3Q6FB 5TH2B 4O2FB 3C5ZA 1UM6L 3BDYH 4Z76B 1PVHA 3AU1B 4XXDA 1YEIH 4H0GA 1OP5K 1EMTL 4IRSC 5IMLB 3GO1L 2VLLA 4P59L 1JGUL 1ITCA 1NSNH 5GS2H 4XPHL 1IGYA 3CSBA 2GI7A 2XTJC 3PABB 3HCVB 3HC3H 3VXSE 2W9LA 2R39A 2I07A 1BQHA 1IT9H 3BUYA 2CLRA 3S4SG 4NQXA 4PJ5B 3LKNB 2XWJA 1SBSL 4TVPD 4P2QE 1GAFH 2ZOLB 5GS0D 5IBLC 5DK2A 3MJ9H 3BP5B 4W4OC 3UTTE 1QPPA 3PWPD 3LS5L 2VNCA 4TTDC 3U36B 1DTUA 3VCLA 4YDKL 1OGAA 5CUSH 4Q9QH 4YHZL 3TFKC 2IFGA 5CEZD 2LQRA 5D93B 2RJMA 4LSRH 4Y4HC 1YJDH 1CGSH 1I1FB 5B39B 3QP3A 5ABDE 2R1YB 4XC1H 3BP7B 1FC2D 2VZTA 5F3HB 1Z3GH 1QYGH 3QPXL 1DE4B 1RSFA 2D31A 3GJFB 1U91B 1JHKH 5TDOA 1X5AA 1YEJL 4FQQA 4C56B 1QSEE 3IFNL 4YDVA 1FH5L 4PFEA 4XNQA 3CPLB 4NSKA 2VXTL 3PDGA 5FM5O 3LKRA 1PFCA 4AM0B 3BQUB 1IAOA 4OIBA 5CJQL 4AK1A 2UVEA 2YR3A 2H32A 5CEXB 1MIEH 1P4LB 1SY6A 3TVMD 1BZ9B 1FSKB 3K3QA 4N0CD 5IKCA 1AD9B 3QIWB 4G6AC 1ZHNB 4X6BB 4ZQKB 2CIKB 3QDJD 3O2VH 1BJ1J 3PWUB 4U1IB 3OAYK 4DN4H 4NO5A 3HE7A 2BCKA 3UYPA 1BZ7B 3WXWL 1H3XA 4KTEL 1RIVH 5SX4H 1JYWA 3VDBA 4RMRA 5C2BL 4L3CA 4QT5B 1EEUA 4QRTB 1FE8L 4QYOB 2DM2A 3PWLA 3MJ9A 2MPAL 1Q0YH 3ARBC 2AV1A 1K4CB 3DV6B 3QUZC 4DEPC 4GMSH 1FZOB 4OGXL 3MLXH 2HRPH 4G9DB 2NTFA 3C6LB 3S3SA 4QHMA 2JKXA 3T0EE 1J86A 5DSCA 4RGNC 1A3RL 2QQLH 1SM3L 1WVZA 4Q6YA 5F93C 5E2UL 3HZVA 4MJ6A 1P6AB 1CFSB 2P5WD 5IV2A 4HT1H 2NR6D 1V7MH 5B3NA 5ANMB 5EBWB 1AI1L 3D18B 2FYYB 3FQNA 3NIGE 4Z18A 1H3WM 4PJ7B 5DD5H 1FG2B 2QSTA 4RBPH 5E9DE 4GBXC 5KG9A 5BOPA 5A3ID 5ISZD 1OGTA 1PG7L 2CRZA 3OKKA 3UJIL 4MJ4A 3CFDA 2MJWA 4X5WB 3BKCL 2DAVA 4Y4FC 1Z6JT 4XHJC 5DQJA 3BPNB 4O58H 3VFOA 5JOEA 3QI9D 43CAB 1Q9WB 1HHHB 4DKEH 1KACB 5DJCA 1PSKH 3QQ9D 2X5PA 4MB5A 2JCCA 4L3ED 1X5GA 3O3UN 5JPNB 3DWTA 1JNLH 4KDVA 1T66D 2PW1A 3WN5A 3MA9H 3BP4A 4P5TA 1T5WB 1XGRA 5CMAA 3QBTB 3O6FB 1NH6A 1D5ZA 4YHLL 1XIWC 2IADB 2ILLA 3PGCB 5M94B 2PO6B 1WZLA 4X98A 1EV2E 5BZDB 1WGOA 5I8EB 1BOGA 3EYSL 1MI5A 1IFHH 3IDIA 2XWBA 1JPGB 2HLFD 4IBLT 1J1XL 2O5XH 1UKQA 2GT9B 4PJ8D 5CSGA 1HYSC 5GGVY 4P57B 3SDDA 5HI5D 2VISB 3BISA 2VIRB 2QKIA 4G80A 2ZG1A 4K94C 2R2BA 4WUUB 4B53A 3RX5A 4J12A 4K9EC 1B9ZA 2QSCL 4PREA 2Q7YB 4Y16A 3C5SB 3MRQA 9CGTA 1LO0L 4EOWL 4Y4KD 3S36X 2O5ZH 4JPVH 1AKJB 2EYRA 1RU9H 4L4VE 5EFIA 1T83C 5J11B 5E03A 5JPMB 3RZWA 3TNNA 3HR5B 4JRXD 3LV3A 4L4TB 3P11H 5FV1L 3T3PF 3P4OA 1AXIB 1QP1A 2FH6A 1RZFH 3EHBD 3DGGB 4MHHI 1U92A 2MWCA 3U48A 4KDTA 5JA8B 3KPRB 1QLEL 1EEQA 4LU5H 4DTGH 5CZVL 2Y6SD 5E5MA 4JO4H 4L8SB 3D0LB 4JQIL 4DFHA 3UCRA 5FYJE 5T5FL 3CFJB 1CFVL 4LP4A 3VG0L 3P73A 5TGBA 3FCTB 3RHWK 4HWBL 3MLUL 5CINH 1DL7H 4FXLA 4UINH 1F90L 3N1PC 3U0WH 2EKJA 1I7UB 3BDBA 1W0YT 4CN1A 3P3YA 5D7JC 3D39B 4RMVA 4RA0C 2XRAL 2XWTB 3FT3A 2Q8BL 3V6ZA 1AC6A 5J89A 3RNKB 1CU4L 3QUXD 4LSPH 1MJJA 4ZG1A 1FVCA 3VXRE 1Q0XL 3UTTA 3LS4H 1G7LA 1NAMH 1TLKA 2AVGA 3S96B 4O4YH 1D3CA 5C3TA 3QXAB 1NDGA 3NPSC 4XCNA 1KJVA 1JNNL 4M7LT 1I75A 4NN6B 3MLRL 1KJ2H 4OF7A 1W8OA 4HBCH 5HVGB 1BVZA 3VXQB 3IDMA 4R7NB 1AGFB 4PY8J 2Z93B 2DBJA 5CHNB 5E6IC 1KBGL 1L7TL 3TWCH 4JHAL 3RTQC 2JJTA 3R1GH 1CR9H 2YC1A 4NHUB 2I60L 4PRAB 4Y19E 3KYKL 1BBDH 1WAAE 4JDVA 4WEMB 5ESVA 3BZ4B 1HE7A 1BEYL 2NMSA 5KSAB 1MCSA 5BS0A 2X44D 2CDEA 2ADFL 1TQCC 2YPLE 4G6FD 2VL4A 2MSPA 3WNKA 1LO3L 3D87B 1U8IA 2DBLL 5I1EL 4Y1AA 1F97A 3ULUC 2DM3A 2AEPH 5DJXA 4G7VH 3LKQB 4ZS7H 3O81A 3DETD 5DHVB 1QRND 1JZ3A 2UZIL 4KRMB 4DKFL 5CP3H 2A9NL 3V4UL 4V1DB 4E41B 1NEUA 5I1CH 3THML 2X4QA 2ED9A 1X6NA 1ZVSA 5I8KL 4JY6B 3BD3A 3H9SE 4X99B 5EOCL 3RVTC 5EZJB 1KCRH 3PIQB 1FV1B 4KAQL 1NAMA 4F9LC 1JGDA 2FSEB 4XMLH 4I3SH 4K71B 2D7QA 2V5SA 2YUXA 5C09B 1QFWI 3W5NA 1CDGA 3C5ZC 1KJ2A 1EGJL 4OV5A 3KPQA 2YEZA 3BFOA 1JRHL 3ZTJG 2FHBA 3MO1A 4U6VL 1VFUA 2OR7A 4NQCB 4HX1B 1HH9B 2H45A 1T6VN 4L1HA 4U6YA 3F58L 4ZFZB 2F8XC 3MZTA 1L9MA 4Y5XB 4X9FA 4RMWA 3O2WH 1I3GH 5DI8A 4KXZH 1MFDL 4G5ZL 4PJIE 2FWOA 5HYSG 1CVRA 4XMPL 1NC4B 5E9DA 4NRXB 4U7KA 5JW4M 2ZSWB 3EFDH 4ZYKB 4PG9A 4N1HB 3FT4A 4K2UL 3VG9B 4XCYB 4XNXH 2FGWH 1ORSA 2PCPA 3K2MC 3DHJA 4AENB 3DV4B 5L0QC 4PTUB 3STZA 1RZJL 4ONFH 4PJDE 1RJZA 2EC9U 4PJFE 3CD4A 4P3CL 1JHTA 1YC8A 2YKLL 2XNAA 1WWAX 3VXNB 4ZUSA 1MCIA 3RKDC 3UC0H 1YN7B 4NKOB 5IW1A 3MV8A 5LG1A 2HN7B 3ULVC 5AD0B 4NC1E 3RP1A 1NFDF 4JB9L 1ND0A 4XNUH 5JXED 4KTYA 3KWWA 4WDIB 2B5IC 3BVNA 4OGAC 1U58B 2GUOA 3RWFB 3IFOA 5GGQH 4L3AA 1S9WB 4XVJH 5FYJH 5J12C 3D85A 5T5NG 3KPOA 4S1RH 1WIOA 1CFTA 1KTDA 1X7QA 4WI8A 1DVFA 2HJLB 3HE7C 4WU7B 3VMOA 1LGVA 5IMMA 1A9BB 4K3EL 5IHUH 1TZIA 1HKFA 3IDXL 1U8LB 4WWKD 1T1YB 4Z95L 4JO1H 4QXUL 1GGCH 2X9WA 1F8TL 1YUHB 1TZGL 4GW1B 3FO9B 1INDL 2AI0L 3WUWA 4ZODA 3WS3A 1WISA 4HK3N 1YJDC 2NY6C 3QO1A 3ZO0A 1GCFA 3UJJH 2C9AA 4NGHH 1FCCA 1OAKL 5D1ZA 3QWQB 4L4VA 1D5BA 5FOBA 4O51A 1XGPA 2JIXD 3UPAA 3V5HB 3HZYB 5H37H 4XP5H 4ZUWB 2FATL 2BNUB 3T09A 1JPST 2ICCA 2OR8A 1I8MA 2WANA 1JGLH 5F1SA 1T3FA 2BNQE 3VWJA 4BQ8A 3BKJL 4W6XB 5JXAL 1TJGH 4KK6C 3NIFE 4U6XB 1UZ8A 1MCFA 5IJKC 4S2SB 1O5DT 5GZND 1S5IH 3KPSE 5DGRA 1U8NA 3SKUD 1I3RA 1YPZF 1S7WA 1N26A 1KB5L 1H9VA 5HHNA 1TJIH 4BUGA 5MEND 4NKDB 1MJ8L 4EUPB 1MUJA 3GMMB 3RL2B 1QVOB 5F7KC 4GRWF 3FMGL 2ZUVA 1U3ZA 4U05A 1KTLB 3LEXA 4I0PB 4LNRA 1ZANH 4QLRA 4R96A 5J6HA 5HTSA 1ZA6B 5CKGA 2NY0B 3PDOB 3VXRA 4U0RC 1T20A 4W81A 5F6HJ 1CD0A 5EU3A 1CS6A 3JWOH 5T1KA 3S3PA 3WN5C 4P5TC 1CXEA 4KRPB 4N8PA 3H6JA 1KPUB 5H2BB 4F33B 3WUZA 5I1GL 3MLPA 3MROB 1J8HB 1F3JB 1ETZB 1MCJA 2X7LB 1DEEB 5JHDB 4G7YH 5T3XD 3WHE0 5JUEL 1OWRM 1JYVA 5DMKB 4TN9A 5F8QC 2YD2A 5DZLA 2P5EE 2DLEA 5IJVA 3K81A 4LAQL 5J3HD 3DSFH 4YWGH 1Z0NA 4EXKA 3WMSA 1IL1B 2A2QT 4JR9L 2HFFB 4KQ4L 1WZ1H 4JVUA 4OCSL 1A5FL 3S88H 4XAKE 1JWSA 4KJWC 3JWDH 4HKBB 4HWUA 3VFWA 3SDDC 3VU2A 1WAAA 1NMAH 2F19L 4FFVC 4Q58C 3X13A 2O26U 4RNRB 2GTWB 3CXHK 1OT2A 1YECL 3HI1B 4ZS6C 5LAXB 3SQOH 5MP6L 3ELAT 4Q2ZA 2IQ9L 1KYOJ 4FZ8L 5IR1B 4HIJA 4Y16C 4YFDB 1EBPA 2YPLA 4YHMH 1MCPL 2A6DB 4P4KB 4ZFGL 3GSWA 4FQXD 4KMTH 1OAUH 1ZV5A 3QEUB 4E42A 3SCMB 3GKWL 4Y2OA 3TBWA 4U31A 3CFIC 4WUUE 1QBLH 4LLDA 2XQYG 4NWUH 4LSUL 4UIMA 1ODAA 1KCUH 3P9MA 1Q1JH 5HDQL 5B38B 3H9SA 2IFFH 3SDCA 1IE5A 3BH9A 2BOBB 1ZAGA 2YUVA 3NZ8B 3ARFB 3C8DA 5BRZD 5I74B 1CGUA 1DQLL 3ROLA 4RWYL 3GJFH 4LHUA 4K7PL 2EDQA 3RVWC 1RZ7H 4C58B 2HJFA 3MFFA 4P2OA 2LVEA 2Q3ZA 3HC0A 1KUMA 2M2DA 4MA7H 5T1DL 4EI5A 3QQ4A 1F3DJ 1ZK9A 4MGXA 3R0NA 1KC5H 2F53B 3PGDA 4K8RC 2VDQH 2Q7NA 4LHQB 3CIQA 3BW9A 3TA3A 3Q6FA 3ZYIA 3IDUA 3HG1B 2DLTA 1E4JA 4KI5F 4JY4A 4XMKH 1Y18B 5L8LB 2NX5E 4Z76A 4FFZL 4ZD3L 5LGKA 3DIFB 3AU1A 4JN2B 5IMLA 5LXGH 4HPOH 1A7NH 4UTBH 5IT2L 4BFGA 4LVHC 3PABA 3UTPD 1HCFX 4KZDH 1X5IA 1A1OB 4HDIB 2NXZB 1ZA3B 5GGRY 4PJFA 4PJ5A 1MVUB 1VENA 3QIBA 3LKNA 5ICZB 5T1LD 1HZHL 2EDEA 2ZOLA 4LVNC 1K6QL 3A67L 2CJUH 1HEZB 3RFZC 1IAIM 4S1DC 3U36A 4F37F 5L7XL 4X7TB 1U36A 3WFBL 3PXJA 1I85A 3MLVH 2VDNH 2JJTC 4F7MB 1EO8H 2NY3C 5B39A 1MY7A 1DQQA 5B22A 1Y0LB 2R1YA 1EHAA 5F3HA 3WNLA 1VERA 1DE4A 4J3XA 5H8DA 3GJFA 1U91A 1KT2B 3TM6A 4PRIB 4P49A 4E9LA 4WFEE 1MFCL 1HNFA 3VXUB 4GRLB 4MXQC 3CPLA 2I9TB 2E7CA 3DO7B 4YHNB 1BHGA 3BQUA 4J6RH 3UZVB 5CEXA 2EDRA 1NFDB 4MMXC 4ZDHB 1BZ9A 4NP4L 5TE6L 4X9HA 4OFYD 3QIWA 4X6BA 1NGQL 4OZGF 4ZQKA 4AG4L 1BM3L 2CIKA 3MBED 1NBVL 4ZO7A 3V4PH 4U1IA 3O0RH 5DVMA 3ILPB 1BZ7A 2RHEA 4MXWH 1VADB 4OGYH 2OCFD 2YXMA 1ZHLB 1Z2KA 4BZ1H 4P4RB 4QT5A 3P9LB 3OZ9H 4OIIL 4QYOA 4PY8I 1AHWB 5GZOC 1R3JB 3MXVH 4GXUN 4LAJH 5C0JB 4HUMB 2VL5B 4MZ3A 1K4CA 4I2XB 2EE6A 4WENB 1UZ6F 3VJ6B 1FZOA 2NY7H 2IGFH 5DURB 1T03L 1A6WH 3KS0J 4G9DA 3C6LA 2FJFA 4Z6AT 2VR9A 3QRGL 2J88L 4K3JL 3K4DA 1DBAL 3TYGH 2DWEB 1FDLH 4IRSD 4NZTL 1GOFA 2E6PA 3BYTA 4M5YL 4JG1H 4UTAH 3MOBL 1JVKA 3MNVA 2MOVA 4Z77B 4NQDD 1CFSA 1D5IH 4N8VG 1X4ZA 5IQ9B 3MGAA 5ANMA 2R0KH 5EBWA 2LAGB 3D18A 2ZZUT 4OLVH 2FYYA 5EH1A 5IBLD 1FG2A 1I7ZB 2R56H 4L9LB 4XZUB 4X6CE 4TTDD 2ZCLL 5EDXA 1NUNB 5CIPB 1P4IL 4AEIH 2HTLC 5E7FA 1OAXL 3BZFB 3U0TB 2CPCA 1S9XB 1RK1B 1YPZB 3I9GL 1VB9A 2ZUWA 4N8CL 4KTDH 4J4PA 4WY7L 4X5WA 4LSQH 4JFPB 1A7OH 1FP5A 2VZOA 3ZDYE 1I9IH 2J5LB 3H3KA 4GRWB 3QWRA 3R8QA 4FABL 3MYZA 5JNYB 1CLZH 1T4KB 3D6GA 43CAA 1Q9WA 2DDQL 4YUEH 1DVFC 4NM4H 5I73C 4XPBH 2P5EA 3GMOB 3GMPB 1AE6H 1A8JH 5JPNA 2PKDA 1T5WA 4RMTA 4ZTPH 5IP4A 4OZIF 4QTHB 4XNZB 4DGYH 3PGCA 5FA4B 2BVUA 3PWNB 2PO6A 2XN9B 5BZDA 2A6IB 5I8EA 4DN3L 3UTQB 3VMPA 1JPGA 2JELH 4U33A 3S3JA 4HGKC 1NLDL 4HWNA 4NCC2 2GT9A 3VA2C 2ZKHL 3PWJA 1L9NA 5CJOH 5D1ZC 1MCKA 4P57A 1IILE 2VISA 2VIRA 4R4BB 4TSAH 3BMWA 4AYFA 1A4JB 2R69L 1OM3L 2AABL 4WUUA 5D72H 1MJUH 2KKQA 3QUKB 1T2QL 1EFXB 5D7LD 1BVLB 1JHLL 2Q7YA 2W0KA 3C5SA 4HIIB 4TNVF 1MCOL 3TO4B 5ALCL 3I6GA 4XNYH 1VPOL 4AQOA 3W9EB 2R1XB 5ITBL 5JLZB 4X7FC 5FA3B 4HC1L 5C07D 1AKJA 1AIFB 3VWJC 2DL9A 2KBGA 2OMNA 1CDCA 2IANE 5JPMA 2VDPH 4M62L 4XP6L 3HR5A 2ARWA 2X9XA 4NFDA 3JTTB 5E6ZA 3OKEB 2DQTL 5MI0C 4JFFD 4JGJA 1EIBA 1ZHKB 3OSKA 1QO3A 2VSDA 3WXVL 2ZPKL 3SOBL 3TF7C 4MB4A 3D0LA 4GBXD 2BNRE 5I16B 1IEAA 3P0YH 4NQEB 3O4LB 3CFJA 2NX5A 2D0FA 4HWEL 1MCWW 4Z7VF 1KIPB 3Q5OA 3FCTA 3M07A 2Y7QA 4ERSH 5GRJH 2RCSL 3H7BA 4M3KB 3HRPA 4TQEH 3STLB 4XX1G 1X9QA 4K23L 4PJGF 1HDMA 1OAYL 2HT4D 4Y4FD 4XHJD 5DHVH 5F96L 3D39A 4JN1L 1RURH 4HS8L 1A02N 4MA8L 4S0SD 3RNKA 4YHIA 2A77L 3EOYG 1R3KA 4Y5VB 2VAAB 4PB0L 4PUBL 1TCRB 3RY5A 4XGZB 1QBAA 3QXAA 1MRCL 4OGZA 2D4FA 1NEZG 4PLKD 2R9HD 1XIWD 4TTGA 2D3VA 2WBKA 5EOTA 1DBKL 3DRTB 5JHDE 3O11A 3L7EA 4N68A 3L3OB 4RFNB 3V2AR 3ORJA 4PJCE 4R7NA 2J4WH 1AGFA 2GCYB 2Z93A 4FQCH 5F9WB 3LEYH 1R5IB 2OTUB 4C4KT 2COQA 4U6TA 2BFVH 4MNQD 1I9JH 4NHUA 4PRAA 4ZNEE 1BVKB 2C4FT 3AY4A 4P23B 1A9EB 1PLGH 2D7NA 4X80L 4YHPB 1U95B 4R2GB 5IB4B 5IK3A 4GFTB 4XPTH 3BZ4A 3WLWC 1QR1B 3GSRB 3V5KB 4HFWA 3DVGB 4UT7L 4B50A 5KVGH 1PX4A 4AIZA 4UV7H 1DFBH 1BPVA 3SDCC 3ARRA 5JA9A 3QFJE 4I8DA 1AO7E 3TZVB 4XBPB 5F71A 1NCBH 3JWOC 4P9ML 1N0XH 2G5RA 1IGIL 1R24B 3LKQA 3TV3L 5L9DH 1AGCB 5DHVA 3WD5L 4I3RL 3ET9F 3AB0B 4E41A 4P2OC 2QL1A 2VLRE 4PP1C 2NY1D 4JY6A 3NN8B 2HKHL 2V5MA 2FX9H 3NOIA 4X99A 2VQUA 1A14H 5EZJA 4EI5C 5D5ME 1FV1A 4WVRA 4OZGB 3CLFL 2YK1L 3BPLB 4WJ5B 3TA3C 5FYKL 1HI6B 5C09A 3O3AB 1V8HA 1BLNB 1YA5A 3C5JB 3JWDC 4OCYH 3E0GA 4D0CB 4NN7B 2W9DH 2KQMA 5I1DB 3V0VB 3GI8L 1DBBL 4H5SB 1SJXA 1WC7A 1LEIB 4NQCA 5I75B 4HX1A 1QNZH 1IEHA 1HH9A 2HKFH 4EEEA 4GG6F 1QLRB 2PYED 2B7DT 4ZFZA 1NC2D 2NY2B 4Y5XA 5D7JD 5FIEA 4PD4K 3QIBC 1AR2A 3RVVC 2E7LA 1P6FA 4JO3L 4YXHH 2F5AL 4O5LL 3D5OF 1NC4A 4NRXA 3VXPB 4F80A 4ZYKA 5ERWB 1I85C 4NC1C 2BVOA 5D93C 5HYQB 3HR6A 1ITBB 3DV4A 3OKDB 2A9MH 3J7HA 4PTUA 5DC9B 1B0GB 5JW5B 1QG3A 4DVRH 1QSZA 2VE6A 1WZMA 1MH5A 3MV7B 4LCWE 2E27H 3GIZH 2JE8A 1MCDA 4LGPB 3VXNA 2P4AB 1YN7A 4NKOA 3EOAB 3OAZK 2HN7A 3GHBH 2C1OB 5E6ID 4OD3L 1VCAA 1OARL 4D3CH 1NCDL 2VZSA 4M7KL 1DQJB 4NKIH 3BQUC 4WDIA 5BZWB 2O61B 2NY5H 5JOFB 2B4CL 4M1DL 1C08B 1F11B 3GK8H 3RWFA 1FSKC 1X5YA 4GW4B 1QHOA 1S9WA 1YNLH 1VACB 1CIDA 3O3BB 3QIWC 5CJXC 1MQKL 3U83A 6FABL 5L88H 1NL0H 2K3TA 4EUPH 2YS4A 4WU7A 4EDXB 5C6TH 1A9BA 2APTA 1NGYB 3KPTA 1N3NB 1U8LA 3EJZD 4MNGB 5A2JH 1T1YA 3QNYB 1NFDE 3AFLA 1C5CL 2JF1A 4KUCF 1R3LB 2GAZB 3ARDA 4ONGL 4NUGL 3PGFL 1FZKB 4TVPL 3LQAH 1YUHA 2PTVA 4OQ1A 2VABB 3RVTD 4HGWB 4GW1A 3WO4B 1XR8B 5HYJB 4OZIB 5JIPA 3FO9A 2YSSA 2YN5A 2AJ3B 2X89A 4BQBA 5CEZL 1VSCA 5D2NB 3PQYB 3EDFA 3C6LC 4XVSH 3C5ZD 1A7PL 2DRUA 2IANA 1UCBH 1TMCB 3HZYA 4IOIB 4ZUWA 1UACL 2BNUA 3TJHD 4QXGL 1X5ZA 5F7WC 5I1AB 2Y06H 4OD1L 4JQXA 3ZYZA 4R97C 1MCRA 5KVFH 1A0QL 1Z9SA 5DQDL 4S2SA 4W68A 4GQPH 4RDQG 2E9BA 1LO5B 3H42L 4NBYB 4ODWB 2BNRA 2JJWA 1OGAD 5ILTH 3S35H 3VXMB 3QQ3B 4NKDA 4EUPA 3GMMA 4HF5H 3RL2A 2W9EL 3UROR 1YEKL 2XKNA 5B4MC 3QEHB 1KTLA 1I9EA 4J4PC 3MRBB 4X6FB 1FFPA 4I0PA 3BT2L 4XVTH 2YUZA 3BPNC 2UY6A 1J5OL 1EXU