4NQDD

Crystal structure of tcr-mr1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-d-ribitylaminouracil
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
200
structure length
200
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVKDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cell activation by transitory neo-antigens derived from distinct microbial pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 45
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdD02
2UVEA 1TJGL 4QNPE 1CF8L 1IEAA 4XBEH 3LQAH 1FFNB 3ZMRA 2DICA 2UZIL 4DN3H 1RJCA 4OCSL 2XA8H 4UDUB 5FUOL 3G5VB 2DTML 2XZAL 3N1FC 5EBMB 4V1DA 1O7SA 2FIKB 3MNVA 3HE7D 4X5WB 2F54A 5F7WC 4LSSH 4UOJA 1BZQK 1BVKA 2B5IB 4XBGB 3W39A 4P46B 5D71H 1HHGB 4BQ9A 4H25A 2SEBA 2JK5B 4D0BB 3NA4A 2XWJB 2XOTA 5F9DC 3LKSB 1QLFA 5C7XL 3EJYC 3KNBB 3GIVA 5GGTA 4JPIB 4FHBD 5DS8B 4OSUL 3W39B 4G5ZH 4WFGD 1MJ8H 2HJFB 4L8SA 2P8MB 3UP1A 3GIZL 3F6IA 3MNVB 3ZKSD 3IF1A 4OCXL 2X09A 5B8CC 2HFTA 4NO5B 5E8PA 5C0RL 3VXUE 4UT9L 5E6ZA 1H8OA 5T1DL 4X4YA 4ODBD 4OF6A 5AZEL 1MFCL 3BUYB 2R0ZH 1HKLH 5I8EA 3P0GB 2B0SH 1EEYA 5FUCE 5JOPE 4U7KA 3X3FH 3JWDH 4PRPD 4XPHL 2AJVL 1A64A 5JDJA 4XCFH 4FQHA 4MWFB 4PREA 2R23B 4KK9D 4ZNCD 4UILH 3V8OA 4D0BA 5SWZA 4ZFGL 1V3LA 2XG5A 3H9ZA 1MIMH 3W5NA 1QLEH 5FB8B 3TGXA 3L1OH 2IPKA 4KZEH 3BZEA 1OY3B 5DS8A 4JPWH 2BSRA 3QDGB 4HWBH 2DYPD 4X5XA 3GSWA 3S4SG 1JIBA 1EXUB 3ILPA 4ODUA 5AWNL 1YPZB 4WO4C 3M1BB 3ZKXB 1N8ZB 1A0QL 5JW3H 3QDMB 5IM7A 1HILB 4BZ1H 2NX5B 2VLJE 1CTOA 4DZBA 4Y19A 1G1CA 1BFVL 3KVQA 5B22A 3W11D 5J3HC 1J12A 2EH8H 3QCUL 1KPVB 5C0BE 3O2WH 4TUJA 5DFTA 3CSYA 1S7UA 4KRMB 2YPKA 5ESQA 4WENB 1BF2A 4YFDB 5I8KH 2V17L 4KVNH 3VFMB 3MV9B 3O3DA 4M61A 3WNPA 4ZTPH 3RKPA 1N7ML 1AGBA 1VA9A 2DTSA 1W72H 4JDZB 2ZCKL 1UCTA 4UV7H 1CD9B 3P9MB 3ZL4H 3AM8C 3IGAB 4XX1E 3SKJH 4YXLL 3ULVH 1A8JH 1PG7X 1U58B 1FVCA 4UQ3B 4RGMB 4K8RC 3ARED 3C6LD 1JGUL 3DVGA 3IETB 3AS3A 2EYTB 5BJTA 5DHYA 1UA6H 3T04D 3QZWA 4NHUB 1Z3GH 4YHLL 1Z5LB 4K3JL 4ELMF 1IQDB 2BHZA 2GTWB 2IPUG 2VN4A 3VG0L 1HYSC 2DKUA 3FFCE 3JV6A 4F7PA 5D7LE 1QHOA 5E8DH 1BECA 2VWEC 4OM1H 2KPNA 2XI9A 5K9OB 1RPQA 4ORGA 5TDPA 3L3GB 4IRJA 1WBZA 2FLBT 3IJHA 5C2BH 5CUSH 2QADD 4XNZC 4ETQA 4U1GB 3RKDC 1KUMA 1WBYA 4LHQB 4UT6H 4JM2F 4OF3A 1CXLA 1G7IA 3QFDA 3OAZH 1A9EA 1M7DB 4FS0A 4LBEA 6CGTA 3HZVB 1ZXQA 1PJ9A 4LLVA 4P23C 4UTAH 4M3JA 1TCRB 2G75A 1ED3A 4Q74A 3NVQA 5FHAH 4GFTB 3MCLL 2DQJL 5I18L 4HPYH 1DBMH 1G9EA 5DJCA 1KB9K 4JJ5A 5LBSH 5T3ZH 3UTTA 5JOFB 4UIMA 3UTSE 2R1XA 5IMKB 2HKHH 4JQXA 1S9XB 4UDTB 3FKUS 1MUJA 3BZFA 1NAML 3D3VA 4KI5F 4B0MM 4TRPH 5ETUA 1XF4A 4UI2A 4H1LG 3AU1B 5HPMA 3RGVB 2OCFD 5IMKA 2G5BA 3LMJH 2HKHL 4QRRD 2J6EA 5C6TL 1BQLL 1XZ0A 1GYAA 3QJHB 3MZGB 4QEGA 3HG1E 4YXKH 4CRPA 4CMHB 2VDPL 3D3VE 2D7PA 3LDBB 5MEPB 4OCYL 2W0PA 4PB9H 2VLME 5DK0B 5HGDA 1AR2A 2IH3A 3MV8A 3M45A 3BKJL 5F3HB 3DMMC 3GB7A 4X6BB 4P46D 3O3AB 4MCZB 2Q76B 3HZMB 5C09E 1OGAB 2J2ZA 5ID1B 1ZHLA 3AY4A 2LTQB 4WNQA 2EYTA 3TNMA 4IOFC 4KMTL 3WHE1 1F4WL 3BAEL 3TBSA 3MODH 1AR1D 5F9WC 4GG8B 5I75C 3R4DA 5J6GB 4F7PB 5I1HL 1UZ8B 3CFKA 3IDXL 5B38G 4Z95L 2HFGH 5I2IA 3OKOA 5I76B 5JLZA 1YJDH 3GSNB 4M6AA 5HGBA 1F4WH 5DVNA 1P2CA 2C3VA 3B5GA 4QRRE 4YHOL 5DI8A 5MENE 1RQ5A 4JHWH 1WVZA 3MNZA 5CEZL 5GS0H 5L88L 1W8OA 5I1HH 3EYSL 4X6CF 4WI2A 4I3RH 4NRZB 5K33A 1HSBA 3OJDA 3UTOA 3PABB 5HGHA 3FN9A 2WLZA 5E2UL 4R7DB 2W9EL 2DQGH 4ZAKD 1JPSH 3KPNB 4R97B 5JLZB 4O2CA 4MLSA 5BOZG 1K8IB 2OZ4L 3OXSA 3QCTL 1FBIH 3QWRD 1PG7H 4X4ZA 5D96B 1ZLSL 3DUUB 4OUUB 4U05A 2DQGL 4YIQA 4W68A 2WWMC 5DK2A 5J13B 3QULA 3L3GA 1NGQL 1ND0A 1T5WB 2ZUQC 4Z7VB 5T1KA 3EYOB 1IT9L 1E4WH 3MRFA 5KSVA 2MMXA 1K2DB 2ICEA 5HD8D 3DVIA 1JPGA 3PWNB 5DMIH 1S5HB 4WI7A 2I9TB 1F3DH 3AC0A 3O45B 3JXAA 1SEBB 5E6IB 1GGTA 1DVFC 2VDRL 3G5YB 2D7TL 1FL3B 4PJHB 1MLBB 1E4KA 2BVUA 3O9WC 2QTEA 5A3IC 5FGRA 1CI5A 1NBVH 5HI3C 1KLUA 1L6ZA 4JJHA 5TDPB 4MA1B 3GMLA 2XN9A 5TE7L 5KW9H 1YQVH 4RAVB 4XNXL 4HDIA 3T08A 1AHWA 2J8UA 2OBGA 3ZT6A 1HXYA 3IFLL 4PP1D 5BS0D 1RK0A 3D85A 3WNKA 4Z7WB 3HAEG 5DUML 4RGMC 1UXWA 2YK1H 2GTZA 3DIFB 3NOIA 2BP3A 1Z0NA 3TFKC 2MPAL 2H26A 5FOBA 4Z5RA 4X4XB 1HQ4B 1KLGB 3RUGE 1LEIB 3KS0J 5ENWA 3E0GA 2D2OA 3RBGA 3U4BL 5JHLH 2FO1A 5C6WH 1I1RA 2EDJA 2QEJA 1MREH 5EO0A 3S35X 1HIML 4FXGA 12E8L 4I0PA 2Z93B 4F7MB 4X4XA 3D39D 2QL1A 3LN5A 1MWAA 4D9LH 1P4LA 5F3BA 2YD4A 4PLKC 1FFPA 3B9VA 4PY7B 5E2VL 1RFDL 5GS2D 1K3IA 3D39E 1DTUA 1P53A 3WNOA 1NGWA 3Q6FB 1UB6B 2AK4A 3ULVL 2LFGA 4MJ6A 4LDEB 5EU7C 1LP9B 3QDJB 4Y4FD 1J8KA 3ZYJA 3LOWA 3V6OE 5FKPB 5CSBA 3O6KH 1KIPA 3BQUA 1XIWC 3UC0H 1QKZH 4NO0B 2Y6SC 1EIBA 4TVPH 3P4OA 3GSXA 4F9LA 5MERA 2R2BB 5IJVA 5ILTL 4HK3N 4YHPB 2X4UA 4OSUH 3QR2A 3O41B 2OSLA 1VDGA 2FH6A 3VXOB 1RURH 5J56B 4WCYH 1FFNA 2UYLB 2LABA 1LEKA 1W0WB 1QPXA 4U7SA 3SGEI 2NY6D 1GGIL 3S3SA 4F33B 4Y4KB 5EG6C 3O81A 2QQKL 3TA3C 4BZ1L 5IBTH 4JVWA 1CZ8L 1X4YA 5I19L 4G9FE 5T33H 2F8XC 4WCYL 2BNRA 3Q6GH 1NGYA 2XTJB 5FDYA 3GBNH 1C1EH 3JTSA 3F58L 4P2OD 3X3FL 2DWDB 3STLB 3VXOA 5CFHA 2NY1C 4I18C 4APQD 5K9OA 1EZVX 3QEUB 1BLNB 3S88L 3DXAD 3ESUF 4OLYH 4U1GC 5IG7A 2FX8L 1KYOJ 2Q7YA 2E7LC 2CLRA 1VKXB 3QDME 4TNVK 1YNKH 5BRZD 1XCTB 5IQ9B 4GW1A 5KSAD 3CPLA 4LU5H 3RWJA 4ODSH 1AXIB 1OAYH 3C5JB 3OKYA 4AMKH 3LIZL 3PWJB 1C08B 1T89C 2NXZC 3EYUH 5EN2A 1OAQL 3T0EA 3U36B 1EFXD 1AGDA 3G6JB 2X4QA 3LMJL 3GMLB 2OTWA 3SKOA 4M43H 2WWKT 2VXTL 1X44A 5DHXB 2C1OA 3LD8C 4X9FA 1EA9C 3G6JF 1IAMA 1JNLL 2HT2C 4PY7A 1C5DA 1IM3B 5INCB 3AREB 2E6JA 1F02I 4MLIA 4YPGB 1UM5H 3IDIA 4OD2B 5C0DB 2ERJC 3OAUH 4HS6B 4LQFH 5EU6A 1OB1A 3H8NA 3LEXB 1PVHA 1C5DB 1MQ8A 5E2TH 1BZ7B 5JZ7C 3EDJA 1YPZE 3V52L 4CNIA 2VZSA 2ZSVA 4PGEB 1MRDH 4TSCH 4W4OC 2P7TA 1A47A 4G6ML 2D9QB 1UZ6F 3RVTD 4PGZA 3PJSB 2FD6H 1CDGA 4LDOB 1XR8A 4K3JH 5I1JH 5LBSL 3DVNB 5D6DA 2ZWLT 4HF5L 2CR6A 3IETA 5C0NC 2K7PA 2EZ0D 4M3KB 2OR8A 1KG0B 4DGVH 3HMWL 1DN0A 3KYOB 4NWTL 4KUCD 4YDIH 1DQQB 1C5BL 5HBBA 4KQ3H 5GIRA 1FL6B 2QQNH 5J6HA 1D6EB 2ITCB 4DK3A 3HG1D 4MX7B 4ELMA 2VR4A 3N85H 1AXTL 4LHUG 4QTHB 3DV4A 5D70H 2YA0A 2B4CL 1AE6H 3QYCA 4HJ0D 1NCDL 2DQFB 2ARWA 3OKKA 5KVMC 4LCWA 3QFJD 3E2HC 5KOMC 3ARTA 3BEWB 5ACLA 3D0LB 4MYWB 4KDTA 3LQZA 1AQKH 3P77A 4BH7A 4QLRA 2Z4QB 3OQ3B 1IGTA 1SY6H 2UYLA 4U6VL 1R5WA 3BZDA 1MFEH 4G43A 2D9CA 2ZCLH 4JDTL 1N2RA 1LNUB 4ZDHB 1NQBA 1XH3B 3CDYA 5D1ZC 3RIAF 2QSVA 2YEZB 1BFOA 2X7LA 1BD2E 2OQJB 4NP4H 5DURB 2DLTA 1R5WB 4PRNA 1RUAL 2OTPA 1KIRB 4DGYL 1NCTA 3FT4A 1C12B 5IVXB 1XH3A 3TIDB 1OARH 5T5FH 3CX2A 1OTUC 1CTNA 3VI4E 3CFCH 2R0LL 1XGTB 1KC5L 3QPXH 1UWEH 1U91A 1O0VA 3H6JA 2XA3A 5D1ZD 4GW4A 3V6ZB 5LWYL 4X6DB 1RUQH 1ZK9A 5D7LD 3QRFM 2X4OB 1ROWA 3OG6B 4P2YA 4WU5A 3ULUF 1CK0L 1WFOA 1TNNA 4EI5A 1WAAE 1BEYH 1BJ8A 3HNSL 4NRYA 1FGVH 4YHNA 4UT7L 4CW1A 1MVUA 3HI5L 5GRVL 5HYEA 3NCFB 4L3EB 5E1HB 3ECBB 3REVA 4GLRH 2XZAH 4NQSB 2AXJA 4JRYB 3GKWL 1U42A 3BFOA 4ODUB 4IHOA 4LIQL 3I02A 4B7IA 4DWHA 5GGTH 2Y5TA 3D69B 5I66A 2Q1EA 5E00B 1GJIA 2OTUA 1G9MC 2C1PA 4Y4HA 3G6JA 2DWEB 5EC2B 1ZSDA 2NXZD 1ZHBB 5C7XH 3HZKB 3IFOB 5BMFL 3U46B 3VXSE 5HXMA 4NO0D 4JRYA 2QSCH 4LSPH 3QIBB 4HJGB 5INCA 5KANG 2VLJD 4KV5F 4YHKH 2VZ1A 2ZCLL 4PRHA 2XZZA 4WGVB 4NSKA 5A40E 5EBGA 4NKIL 4I9WE 5I1KH 3IDJA 2CR3A 1XGPA 3B9KB 4QHNA 4CVWA 4ZO6A 5KG9B 3VGFA 2DQUH 4Q9RL 1S7TB 2H45A 4BQ8A 2VKXA 4Y4KD 4YC2B 5ECJE 4JZJC 5EU5A 4P5TB 3RX5A 4JANB 5IJKA 1WEJH 4NNXA 1JGLH 1YNTB 4AIXA 1EJOH 2Q8AL 3PL6D 4FG6C 1A7BA 4OUUA 3OPZL 1BOYA 1AKJA 3CDFA 2DOCA 3PV6B 1IE5A 2QQKH 1ACZA 3D9AL 4XH2B 3VXTB 4HLJA 1S9YA 3DX6A 4TOYH 1ZANH 4TVPE 4LGRB 4S10A 1BVZA 1Q38A 3RTQD 5D7IA 5FUZL 1HWHB 4DZBB 4KDTC 4PBXA 3BGMA 3BPCA 5KSAB 4LLWA 4GBXD 4R7NA 1AJ7H 1EO8L 3ZDYE 2P4AB 4HC1A 1CXKA 1WFTA 1HKLL 2LU4A 3VFUB 4OGYL 1IEAB 5CKGA 3B2VH 5HGBB 4U6YB 2MPAH 4NOFA 1KSRA 4GAFB 4X7CC 2FHFA 2F58H 3D0LA 1G0DA 4XWGH 3D0VA 3U4BH 4WY7H 5JHLL 3IGAA 2QADC 1PKQB 3AM8A 5T3ZL 3TA3D 1I9IL 4ENEC 2V2XB 1JUFB 4N0FB 4OF0A 2ZUVA 4ZSOA 1TCMA 1MI5D 3N1MC 4LKCA 1J8HA 1FVEA 1IJ9A 4PJ7A 2IC2A 4GUPA 1CYGA 3RDTC 1K4CB 1JPFA 5D9SB 3OB0H 1FRGL 4JE4B 2R9HD 4KROD 2PYEE 5GJTL 3NIDE 4NC0B 2ED8A 1VESA 1MIEL 3GFUA 4Z7WF 5HYSA 5DEFA 4GAGH 5EOCL 1ZTXL 3VD7A 4NDMB 1MHCB 2NY4B 3GHEH 4ZUVA 1J0HA 4YWGL 2J88L 2C1OB 5HHNA 3T0WA 3U9PH 4X9HA 4OM1L 4Z5RB 1MI5E 3DUSB 4XHJC 2IFFH 4Z0XA 4OCRL 5BO1L 4K3DL 3MXWL 5EOQL 1J05A 3EDKA 4U6XA 2QHRH 3FQRB 1EDQA 4NZRL 5C0JB 2E27L 3OZ9H 4U1IA 1T1XA 1I7RA 1MHEB 2Q20A 5HGAB 3BYYA 4NC2B 1Q8MA 2UY6A 1A6PA 2GW5A 3VGHA 3VD3A 3C6SB 1TZIA 5CD3A 4RISH 2O61B 4R2GC 2CUMA 4ZFOA 4XAWL 2ZSVB 3MLYH 2VDNL 4PP2A 4OM0L 1QSFE 1FN4A 3FRUB 3BIAX 1F3JB 1KCUH 1A3RH 2G9HA 5C0EB 4FFYH 4QXGL 3F7VA 3KPMA 5FYKL 5ICXB 4Y5YA 2RIKA 4GRWH 3ROLA 2WUBL 4OV5A 4GS7B 1CFQA 1QQDA 2BMKB 3I50L 2QSTA 3ABZA 1MCDA 3T2OA 4ZUUB 1R5IA 4JFHE 2P44B 5IHUH 3VGBA 1Q72H 4LLDA 4PJXA 4JO3H 4NKOB 4U1LA 3TP4A 5DJZB 5JPMA 4R4BB 4GRLC 3ETBF 2H41A 2KDGA 3F7YA 2X1XR 2CKBH 1BLNA 1ZHKA 1BJMA 1J0JA 3ARDC 2DLFL 1P2CB 5I9QB 4K7PY 1S7XA 4JQIL 2QQLH 4GUPB 4I9WD 5CBAA 4H0GA 3P9LA 3I6GB 2YD7A 3PWNA 3V4PH 1HHJB 4D3CL 3SDAD 5ITBL 1KGCE 3GMMA 5HYJD 3KLHC 3V4UL 3MRFB 2UY7A 4UTBL 4ZPVB 1KTLB 1I8LC 4I3SH 3MACL 1U92A 4XNUH 5GGVH 5KSBB 3MLRL 1H3PH 1UWXK 5E9DD 3LKRA 5HHME 1NFDE 3JV5A 4KK8C 1T04A 3CLEL 5CEXB 4OF8A 2OS7A 1KTLA 1S5IH 4DW2H 3NGBB 4WFFE 5B21A 1T6WA 4P3CL 3BE1H 1EEUA 1L9NA 4H8WH 3PWPE 3KLAB 1QSED 1LEKB 1CLZL 1WBZB 1CIDA 2C4FU 3BKYL 2ZUYA 3Q5TA 4I3RL 1VFBA 4MJ5A 4F7EA 4IDLA 1DL7H 1T20A 4A6YH 5IFAH 1IM9D 4TPRL 4XMLL 1IQWL 5FYJU 3JVGC 3WIFB 4FFYL 2NZ9C 1UB5B 2NXZB 4X7TB 3H9SD 4PRIA 4LCYA 3KXFA 3NH7H 4LK4A 1I9JL 4MXVF 4P59H 5F9JB 4WI6A 1PW3A 3CMGA 1QR1B 2FECL 3SDDC 3GJFA 5EO9B 4AK1A 4O4YH 1AXSA 1A4KA 1LO4L 2JTDA 1QD0A 4M6NH 1V7MH 5IROC 3DECA 1I1AB 5TGBB 4M7LT 4R8WL 4M8QB 5EA0H 3BP7B 4NKIH 2VL4A 5D71L 2EDYA 4R2GD 4Q2ZA 5EORH 5ICYA 1BD2D 4E0RB 5DK0A 5E4IA 3VG9C 1G0XA 4ORZC 3C5ZD 2DWEA 2RAMA 3U2SB 1T1ZA 3MOBH 5TE6H 4DN3L 1U95B 2B1AL 1M7IA 4KKCD 5IFJA 1YN7B 2BOBA 3ARBA 2XFXB 1CDUA 1K8IA 1ZVHA 4HIIA 3J7HA 2AXFA 1MY5A 5C0CB 1XR9A 1BZ7A 5MEND 4PD4J 1T1WB 2BVQA 3SE9L 4GXVL 2CLVA 4FQXB 1W0VA 4JRWA 1T2QL 5ALCH 5JORB 2I26N 1OHQA 4Z7UE 5JR1L 3UPAA 5FO9B 3P30L 4MQSB 2BRRH 4Q2ZB 3NZ8B 1FAIH 3FB7B 4N8VA 4XNMB 2J5LC 1I75A 1DCLA 5HI5C 3ET9F 1WITA 3DYPA 2OL3L 1RZJH 1N5AB 4P49A 4U49A 1CDBA 2JB5H 2Y1VA 2BVEA 4PGJA 4JLRA 4E41A 2VQTA 2CIKB 3UPRB 4KFZC 4LSPL 3ZE0E 2OSLB 3BRFA 3TNNA 2OJEB 3ZE2F 6FABL 2ZNWA 3QNZA 5J12B 5A2JH 5CIPA 5ITFB 2VLLB 2CKBA 1MEXL 5IVXF 3KJ6H 2GSGA 2HVKA 3ARFA 1BZ9B 4X8JB 2EC9T 5J11B 3JWDL 2WIMA 5C9JB 2XKNB 1T0NB 4PS4L 1BFSA 2V5MA 4FMFA 3MRPB 4FTVE 4WV1C 4NYLA 2Y5EA 4TULL 3BPLB 2ORBH 1TITA 1D9KB 1K6QH 4RA0C 3QA3A 4DTGL 4L29B 2ZCKH 1VB9A 2Z4QA 4MB4A 5DK2B 4CGTA 1UH4A 2VLLA 1TVHA 1N64L 3QHZL 1LE9B 1KULA 4D0DA 3WKML 2VXVL 5C9JA 1DSFH 4X6CA 5AYUH 4K3DH 3U9UA 1ZT4B 1T04B 5D7JB 5LGHH 5BOPA 3CXHJ 1PSKL 2R0KH 5H8DA 4MJIE 4NJAL 4PG9A 5BV7H 4U1NB 4PJIE 5AAMA 1CICA 3NPSC 4S1DD 2BNQB 4NQEA 3HFML 4KKCC 2HKFL 4IRSB 5BRZE 4FQHB 4KV5E 1ORSA 2W9LA 1PY4A 2HT2D 3QSKB 3TBYB 2BCKA 5HI4D 1MFDH 1MFNA 4Z7UA 4JAMB 2XQBH 3S8WA 3QEGL 4JZNB 3KPOB 4HS8H 1FDLH 2UWEA 3RKDD 3ARUA 1U8MB 3H42L 4GKOA 3QDGA 2UUDK 4LPUA 5CBEA 3IJSA 4WHYG 4MNGB 5DQJB 2VUYA 4JKKA 3M1BA 2JJSC 2YUZA 4KK6C 2XRAL 3GJEA 5J8OA 4FQIH 3FO2A 5J12C 3H7BB 1OGTA 2ICWA 2KL6A 4E9LA 4AMKL 1C5BH 5I16B 2WIIB 4MA7L 4OLXL 1MHHA 5E95B 3T77A 4FFZH 2HAZA 4P23A 2Q76A 3HZMA 2AABL 3P2TA 5I1DB 5F6HI 1OAZH 1JBJA 2ZJSH 3O2VH 1RJLB 3DGGB 4Y2DA 43CAA 5C0EA 1JNLH 1R3LB 2PXYA 4ONGL 4OZHA 5E6IC 3GUTA 3HA0A 3P0YL 3V8CA 2VUOA 1VPOL 1L0YA 3B6SB 1FQ9C 4H0HB 2V6HA 4PJFE 3VDCA 4FQXC 4RRPG 5EOQH 1OP3K 5C70A 2EEBA 3WJLA 4PJBA 1A14L 4GQ9H 3I6KA 1KIQA 4XMKL 2ADJA 1KEGH 3EFDH 1DDHB 3EYVB 5I8OL 3EO1B 4HT1H 3UTZA 2EXYD 1R6VA 3WHXA 2VLKA 1M05B 4LGSB 4HIXL 4NP4L 3W11C 3DBXA 5J89A 2JK5A 1CD0A 1V3JA 2XN9D 4KKBC 1DANU 4MSWB 1V7NH 5I30L 2CPCA 1GCFA 4KJQC 4W6WB 3Q5YA 5F1SA 4KJWD 4X6DA 3EOBB 2FYYA 1HHJA 4R2GB 4AEHH 2J88H 4XWOC 4OI8A 2VH5L 5HPOA 4N1EA 4O51B 3QHFH 4BSVA 4NM8L 4Q9BA 1CVSC 2X4PB 1PD6A 3TV3L 4JHAL 1CFTB 3O8XA 3GJFK 4JGMA 5I30H 3IKCB 4JKLA 2YEZA 2F15A 3QFDB 1G7IB 3AREA 3GNMH 2PO6A 3K7UA 2X4SB 5T1KB 3QUXA 3V52H 4ODVL 4M1GL 4F33A 3KPOA 2F5BL 3P77B 1FG9C 5DJ6A 2OJEA 4FABL 1V5JA 4FQIL 5BS0E 3WFCL 1DVFD 4U0QB 1A6AB 4A2MA 4PV9A 4G43B 2DQHL 5E4EC 3I3DA 4UINL 5D7IF 1U8LB 3BKCL 2Z92A 4CVZB 1IL1B 1Z9MA 3U9UB 1BD2B 4HWEL 5EFIA 5DYOB 4F9PC 2AJYH 5DVLA 2FATH 4MAYA 5F21B 2X9WA 1AFVH 1F6LL 3BPOB 2GCYB 3SKUD 4MQTB 1GAFH 3CVHH 2AQ1A 1J11A 3GBML 5L2JB 1Q72L 2NY3B 1YEEH 2A74A 1QSFA 1I7RB 1MHEA 5FM5O 1BBJB 1S7RA 3SY0B 5J1AA 1WLHA 3MBEC 5CCKL 3GJFH 5TDOB 4Y4FB 4OB5H 5GS1A 1MPAL 4RX4A 4IHOB 2H8PB 1UWEL 4OAWB 2JCCF 5TH2B 2VWEE 4J1UA 4OZFG 1G9NH 2VIRB 1MFEL 2M1KA 5CSZB 4PJGB 4XMPH 1MVUB 3ZTJH 2ESVA 4MCYA 4MNQE 1GPOH 1CGXA 4NN7C 4ISVA 2VZOA 1JGVL 2WLYA 4NZUH 4UT9H 3TT3L 2H32A 4LSQL 5D6DC 3O6LL 2HJLB 4H8WC 2NY6B 3MMEA 4PTUB 2OR9H 4JRXE 3VWKB 3DYOA 3TM6A 3QIUC 1QYGH 4FQJL 5DSCA 3WIIH 1LE5A 3HPJB 5EOTA 5FB8A 4MJ6B 2JELH 2H32B 4FQ1L 2M2DA 1NLBH 4PJXF 3RX8A 3V9FA 3H7BA 2XTJD 1RVFL 3KPRD 4AQOA 3KHOA 5EC2A 5DT1H 3QPXL 2Z91A 2CD0A 4FQXA 2P24A 1YN6A 1VGKA 2A83B 3DNKA 2CSPA 4J4PD 1UENA 2E6PA 5IBUG 4DKDC 3BESR 4KJPD 4Q97A 1KJ3L 5DUBB 4Z9KB 3MGTB 1AD9B 2FGWH 2BJMH 5FDWB 3MV01 5DWUL 5BRZB 1CU4H 2J8UF 4X7DC 5ACZA 4HG4J 2BXZA 5K9QG 5F88B 2OI9C 1FLTX 5GGQL 2GFBA 1NFDB 4LAQH 5E8OA 5CD5C 2E8ZA 1T2XA 5EU5B 3MGAA 4V1DB 4PG2C 3BT2L 4S1SH 3MRDB 4F3FB 2HTKC 4JKPH 9CGTA 5IW6A 2OP4H 3B9DA 1KTRL 5AZ2L 5AG9A 4OZ4A 3H3PH 2NLJB 3RTQC 4E41E 3IB4A 2MKWA 3GZKA 4U0RB 4LAQL 3PV6A 1JE6A 3EYUL 1HHGA 2VDMH 1FO0A 4O00A 1EEZA 1DEEB 4BH8B 4XPFL 2CIIA 2BY0A 1UJ3B 5AYUL 5I15H 2DL9A 1QSFB 2VXTH 1AY1H 1U91B 1G9MH 4L5FL 2VE6A 3PP4L 4ORGB 3QWRA 3GMMB 1R3IH 1QBMH 4DEPC 3DO7A 4PJDB 1LMKA 2XQYG 1EO5A 5FUZH 3MRIB 3C5ZC 3VFWB 2AJXL 1Y0LA 3WFBL 4G9FB 4O2EB 4JR9H 4IMKA 5D72H 2BHUA 4OIIH 4OQTA 3D6GA 3BP4A 2OI9B 3FTGB 1HHHA 3B83A 4MZ3A 4EIZC 5I1AA 2R4RL 5L8LB 4FQ1H 2FEEL 4J12A 1I3RB 1QACA 4KROC 2IBZY 1FLRH 3V5KB 3DO7B 3IRPX 2NNAA 3U30C 3V0AC 5J9PB 4EI5B 2HT4D 4OD1H 5D6CB 1CFQB 1QQDB 2XXMB 1BQSA 5EU6E 3SGJC 3WN5B 4TOYL 3EAKA 5LGKA 2V9RA 1XIWA 1MCLA 3VFRB 3TBTB 4LRNH 4GRLB 1OD7A 5CKAA 3DPBA 2J8OA 1PLGL 4FXKA 4L3EA 3VRJA 4XVSH 4HPYL 5DWUH 4FQCH 3SDXA 1A7QH 1PQZA 3NN8A 4KJPC 3ZHKA 5DJ2A 4HQQH 3NFPA 4QHKJ 3HZKA 1XGPB 2B4CH 2HFEA 2O5YH 2E9JA 3MPCA 5F96L 3GHEL 3BW9A 2OTUB 3BJ91 3PHSA 1NFDA 5FF6B 2VLRB 3F7YB 1X3DA 4I0PD 4KC3B 4QY8B 2W59A 1TFHA 1G6RL 3QNZB 1KN4L 1P7KB 3CMOH 4Y5XB 3C09C 3I9GL 4IRJD 4GG8A 3U4EB 3FRPG 4ZTOH 1WGOA 1NUFA 4WI8A 5F96H 4D3CH 3MGOB 1ZLWH 2KQMA 1R5IB 1N5AA 1NEZB 3O6MH 5C08D 3BIBX 1CL7I 1RMFL 5F7EH 3SKMA 1X5IA 2ADGA 2R0WL 4WU7A 3ILQD 1RZKH 3SN6N 4G42B 5L2KD 5ICXA 3LEYH 4XGZA 3FT2A 3TO4A 4YXHH 3B4NA 1XR9B 4PJXE 1PYWA 5F7HA 5GGRB 3HAEB 3GDBA 2KBGA 1X5GA 5LQBL 1I85C 3BKYH 4POZC 1T4KA 4PLKD 1G7MB 1IILE 2V2WA 1H5BA 2PR4L 1UQSB 2EIBA 4QHUA 2F54B 2HN7B 5CMAB 3GK8H 3SJVE 1T5XA 5B39B 2NMSA 5AUMB 3CPLB 1YPZF 4IOIB 5J3HD 1YZZA 1E4JA 4Y4HD 4ALAH 4NUGH 4HIEA 3UJTL 1QG3A 2PYFB 1I9JH 1UJ3C 3VGDA 2NY3D 3GSVA 5MEOA 3PWLA 3NIFF 3CJJA 5ADOL 1AQDB 2DQCL 1U3HB 1CGSL 1KT2B 3HG1B 3K1DA 5I1LB 1AGEA 4AY0A 1B0GB 3VRJB 4PJDF 4PLJC 3ELAT 4OD3H 3UJTH 4JRXA 2Q3ZA 4M5YH 5CMAA 3WLBB 4ELKA 4P48A 4OBSA 4Z0BL 1QSZA 1J0IA 1E27B 5KSVB 4I48A 1H3PL 2NTFA 4QRPE 1Q94B 3FQTB 4MNQA 1UCBL 3RZCB 3D18B 3CVIL 5SX5K 3ZLQC 1A5FL 5EZIH 2YMXH 3MUZ1 1E27A 3S37H 2PKDA 3BOVA 3QI9B 4JY6B 3MREA 4P5TD 1HQ4A 4WW1A 3GSVB 5JPMB 4LFHD 5IF0A 2R0LH 4X6DF 3U7WL 1QFWM 5GGSB 1AGEB 3HR5B 1U9KA 3VRIB 1MJ7L 5ITBH 1WBXB 4APQB 1SMOA 5ESAB 3FQUA 5IV2A 2EYRA 3R1GL 5D1QA 4Z95H 2JJVA 4GBXA 2IH3B 3MV8B 4LCCC 5ALCL 1ONQB 2JJWA 2YN3A 4XX1G 2W60B 1A7RL 4EI5C 4N90E 1RULL 3W2DL 4JM2B 2R1YB 4WW2C 1NDGB 2MQ3A 1IMHC 4Y8DC 3BN9C 1BIHA 1X4XA 5FM5M 1YEFH 2NY1B 1KIQB 4HUMB 2P7TB 1AGCB 5TPWH 2HT3D 4XBEL 4E42A 2Z93A 1J5OH 4W81A 1RZFH 2G60H 5HI3D 4G3YL 1F3JA 1WISA 3N9GL 4X98B 3HRZA 5JW4Q 4X6DE 1EERB 1HIMH 5I1EH 3OHXA 1LGVA 3ARQA 1NAMA 5BMFH 2NY2C 5FKAA 4LVNC 3FQNB 3GSXB 1CS6A 2FJHA 4LLQA 5IHZA 1D5MA 3Q3GA 2NY3C 2X4TB 1F8TH 5SWQB 1NDGA 3MGTA 4LSTH 3RAJL 1R5VB 1A0QH 2WBJC 1S7VB 3VD9A 3TO2A 1T03H 1A7NH 1SJXA 2ATPA 3DI2B 1AHWC 1CD1A 1P6AB 1HKFA 1T7YA 3AMKA 5CD5D 4IRJC 3OKDA 2BFVL 2GITB 2BNUB 1CE1L 4Z7QE 2Y36L 5I0DA 2NY2D 4IBLT 3EO9L 4TSBL 4TQEH 4R8WH 1VSCA 5IB5B 1R5VA 4TSAL 4M1CC 1FIEA 1IKFL 3RVXC 2AJXH 2ICWJ 1HCVA 3ARGC 4G80B 2H2SC 3C2AL 2FB4L 5EZLB 3LAFA 2BVOB 4U1HB 1CXIA 3ZL4L 4I0PB 4U3CA 4JM4L 1RU9H 2HKFH 2LE9A 2XKNA 1DQLL 1F58L 3BD5A 3QULB 4D0CB 3V6OA 3ZO0A 2VITA 1ND0B 1T5WA 3N1GC 5DMGC 4MD4B 1GPOL 5GHWL 3RNKB 3RIFF 2FZ3A 4DK6A 3KPRB 1TVBA 4J1UB 4PRBA 4O58L 5DD0L 4ELKB 3B5TA 3RDTD 4UB0L 2RCSH 2A2QT 4G8GA 2DS4A 5I19H 3MA9H 2IAMA 3UJIL 5IESL 5CHNA 3HUJA 1S7RB 3KLDA 2FSEA 3DI3B 1V05A 3TCLB 3KXFE 3V0WH 4X6CB 2F58L 1ZGLP 35C8L 3BD4A 3SE4A 3GSUB 5C2BL 3WFDL 4BFIA 2IQ9H 3V5DA 1DQQA 4HUNB 3GM8A 1TVHB 2VNCA 4XAKD 3UPCA 1K4DB 1DQJB 3BQUD 1JHKH 5FOBB 3EDFA 4NPYA 4G7VL 1ZS8A 3BSZL 3INUL 4PJGF 1MCFA 3IJYB 1T7ZA 1Q0XH 1ZLVH 2JJTA 4X6CE 4MD4A 1XIWB 1VEOA 1GGCH 4K3HA 3V5HB 3K8MA 4YHYC 5KAQF 4GW5A 1IGCH 2DD8H 5JQ6H 2IH1A 3QJFA 5F8QC 3KYMA 1NKRA 4OT1H 3T1FA 5IHZB 2HT4C 3C6LA 4G8IA 4NQEE 3BHBA 4IS6A 4QRPA 5EO0B 1G7PA 4LGPB 2HMIC 1P4BL 2EDTA 1OB1B 3LEXA 5E8NA 1GH7A 3QWQB 3VXPA 3AS0A 3X12A 4S0SD 3MRKA 4M1DL 3BXNB 4NQXB 3QQ9C 4NO0A 4YK4C 3REWB 1UFUA 3MFFB 1MF2L 2X5PA 1MAML 3SDDA 3PHOB 4AYFA 2AEPH 4QF1A 5CINL 4JFFB 4NN7B 5DD5H 3O3UN 3DHMA 4QNPF 1UVQB 3QIWA 4JG1H 2VZ3A 5EWIH 5BRZA 3EDDA 1I8MB 1U93A 5HHOB 5JXEA 4RAHA 4ONHB 4XBPB 3BKJH 3Q2CA 1NMBH 2ZOKB 2ENYA 1RZGB 5CAYB 5IEKA 3WHXB 4PRID 2COQA 4EI5D 3EFFA 3V79C 2CO6B 4P2CG 5D72L 4F37K 1EFXA 2ITDB 1NDMA 2ICWI 3EO1A 1UH3A 4ONHA 5IW6B 5DO2C 4ZO7A 4LVEA 2BC4A 4HKJB 3QEGH 4IRSA 3MLSL 2Q87A 1KELL 2EDLA 5HYFA 4PPTA 1NGXA 2P5WE 1G6RH 3QIBD 4LPXA 2CK0L 3DSFL 1ZLUK 1IGJB 1NJ9A 5DJ8A 4C83A 5D70L 2HH0H 2WWKO 1U8JB 1XF5B 4HLZH 4ZPTB 4MB5A 4NQCE 2DM7A 5GXBB 1KEGL 4ZXBB 2GJZA 4G7VH 5E5UB 3N1QC 3MRQB 1NCDH 1YEHH 1LE9A 3IS0X 3SO3C 4YX2L 2VDQL 1YMHB 4I18B 1CGWA 2XWBA 4NN6C 2IEPA 1A1NB 1N4XL 4H5SA 1A6WH 4KHTH 4OAWA 1LP9F 1YEKL 3QWOB 4L4TA 4U6VH 5MERB 1RK1A 1C08A 1JMXA 5D7IE 4P46A 3W0WE 3BEVA 1NBYB 2XA8L 5ISZB 1EHXA 3S97C 4QWWD 5CZVH 5D2LA 3SGKC 3BI9X 2HFEB 1RY7B 3T0AA 1DLHB 1OARL 4JZNA 5T5FL 4AT6A 2P8LA 2FCBA 4M5ZH 4K2UH 1Q94A 1HI6B 1T21B 5EBWA 5BV7C 1ZA3B 3SDCA 3ULSA 5IVNA 3QWOA 4NZUL 1SBBA 2BVYA 1N0XH 4C56B 2NR6D 4JPVL 2IBZX 3OJ2C 5DRNB 3MRMB 4U1NA 2W92A 2APXA 3LSOB 1J10A 2LAAA 2YHGA 3HC0B 2D4FA 3HMWH 1H3GA 2RGSA 3MRCB 3J8F7 3K8KA 2J1KA 1KV3A 4FQJH 3K8LA 3LEYL 4PJAA 1U8QA 5BS0A 4UTBH 4QRTB 5ERWB 5E8EB 1DUYA 2YD6A 3QUZD 3O9WB 4G8EA 3SKMB 1P7QA 3CZJA 3DRTB 5I1AB 5CEZD 3TBVB 5CEZH 5MEQB 3VA6A 4KZDL 1A1OA 3ZHDA 3IKKA 3DARA 3KNBA 5ACZB 4JFXA 1J0YA 4X7SH 3ZYOA 2I60L 1CF8H 4F9PA 5CD3B 5HYIA 1FC1A 2GJ6E 4CDGC 1JK8B 2YRPA 3DMMB 5IWLA 1S9VA 4CADA 3PNWA 1F4YH 5C71A 2V7HA 5FV1L 1HDMA 4X80H 3EJYD 3SE3C 3MJ8A 3MLTA 4JFEE 2W0FA 1ZLUH 1D9KD 5CSGA 1CQYA 3IXAA 2ARJA 4FFWC 1NFIB 5EOTB 5HVWA 4QHNB 4HWEH 5JUEH 4MX7A 4JFZL 2BNRE 5H94A 4HUVA 2AK4D 4NHUA 4Y2OA 2X2YA 2CRZA 3QO0B 5I15L 3ARVA 2AXGB 2ZUTA 2A6JB 2E6QA 5HGGS 3CVHL 4K9EH 5IB4B 5IB3B 1UKQA 4ZQKA 4O2FB 2W0FB 3H7LA 4P9HL 5CZXD 1EHAA 1KJMA 1QBML 3MCG1 3PWPA 3WLWC 5E5MA 2HVJB 1II4E 5E7FA 4XNXH 5GZOD 4MSWA 3QUXC 2F53D 4LRIC 5IQ7H 3QAZC 4OKVB 2N7BA 3BJLA 2G5BB 1E4KC 3FTGA 3RU8L 2FLRT 5GS1B 5HSFA 2EEDA 3UJJL 1MCKA 2AJSH 1YA5A 4NFDA 5AZEH 1TQBB 4JM2D 4S11A 2I9LB 1FZKA 1HNGA 1W2KT 4X5WA 5EBLA 1NGPH 2NY0C 4UUJA 2NXYD 2EDNA 4NRYB 3TLRA 3WMSA 1U8HB 3TBTA 4JJ5B 2WAHA 4E5XA 4TTDD 1DE4A 4KXZI 4QRTA 2Z9TA 1DR9A 2YC1A 4MQ7A 2OR9L 2V5TA 4MAYB 2I5YH 4H20H 1BM3H 4S1QL 2DQIH 1IZKA 4WV1B 1IL1A 3MMEB 1EVTC 4HWUA 5DQ9B 1MEXH 2YUWA 4G9DB 2XNAB 4HG4K 3CXHK 2V9QA 5CUSL 4JY6A 5IFHL 1OW0C 1LNUA 1TTFA 4ZDHA 3GMPA 1AO7A 2X1OA 4OGAD 1HI6A 4K94C 4ZOAA 4I18A 1MY7A 4KRPB 1I3RA 3BISA 2F74B 2HP4A 3JTTA 4PJ8C 4WHCA 2DF3A 3T1WA 4LCYB 5IOPA 4AL8L 3EO0A 1D5XA 4RIRA 2VXVH 1NBYA 5ISZA 3RHWF 5CJ8A 1AI1L 3WUWB 3BH9B 2ZKHL 1QFWI 3OGOE 4X6BA 2N56A 4M1DH 4R0LC 5D93C 3S6CA 3NABL 3LPGA 4OLVL 3V0VB 4PJ5B 5LGJB 4ONOA 4P23B 1NCCH 4AL8H 2BSRB 5LCVH 4BQCA 1TMCB 5DDHB 3FMGH 1FNFA 3O8XD 3U7AA 1OF2A 1LHZA 3CSPA 3F7QA 3L5XH 4HUKB 5CWSA 1N8ZA 1UT9A 3SKJL 1TQCC 1SBSH 5E9DA 2PYEA 5FGCE 1MWAB 1TDQA 4JDZA 4KRPC 1HZHH 1H3UA 5GJSL 3F7VB 1XGRA 3PDOB 1MJUL 2Z31D 4J4PC 3SGEH 5JO5B 4MQXD 3PWPB 4YAQA 32C2B 1IVLA 2R1XB 4ZSOE 1FCCA 1S9XA 4UDTA 4RAUA 3ARBD 3S4SA 4MMXC 3B2UD 4LCWE 4HZLB 2AJUL 3T4AA 3TN0A 2O5XL 1EJ6A 4XAWH 4NJAH 2DIBA 4OF7A 2AJ3B 32C2A 1IGCL 1S7XB 3FRPA 4DOHE 4V1DE 4WY7L 1BX2A 1OAZL 3EKCA 2EDKA 3H9SA 1JZ8A 3ZDXF 2O5YL 1AGCA 3U46A 4NKOA 1EFXB 2X4PA 1LVEA 4Z7VF 2FX9H 4PFEA 4PGDB 1WIPA 2JF1A 4JFEB 1U3YA 4WFHE 1LO2L 1KJMB 2ICES 43C9B 3RI5F 3IXAB 2A9NL 4UQ2B 5JIIA 4BZYA 5JIKA 2J7LA 1CFBA 2PCPB 4P4KA 4XP6L 5GS0L 5D7JC 3UTQA 3TH3T 3EFDL 3RVWC 4NHCH 4OLXH 3ARFD 3JV4A 4U1SA 2Q8BH 4IIQB 1J8HB 1FVEB 4PJ7B 2N1KA 4ZQKB 1IAIH 2A6IB 3QCVL 5A2LH 1M6OA 2FDBP 1B0WA 4X4MA 4AEHL 2GJJA 1DBAL 3GMQA 3U7YH 2MQ0A 3GMRB 1CICC 2E9WA 4TNWF 2FSEB 3BDBA 1BP3B 2GT9B 4BQBA 2R2EB 4FZ8L 4LASL 1G7LA 4NM4H 2RR3A 2V5RA 4OCYH 4XI5C 3FOLA 5HHNB 3VU2A 3MCKB 3ZE1F 2W38A 2Y07H 4PRIE 4P3CH 1KB5A 1OAXH 4KVCL 4ZUVB 5ABDE 4EN3B 4AH2A 3QQ4A 3HG1A 5BVPH 3IU3B 4MD0B 1J88A 3MODL 5BZWB 3SKNB 2EE6A 1HQRB 1ZWIA 1I8IA 1DQDL 3QDMA 1TETL 4WTXA 1CFNA 4MMZC 5F9OL 2YBRA 1INEL 1N59A 3WUWA 2VZVA 1QBLL 3I2CL 2VH5H 1OD9A 2AKRA 3L5JA 1X5JA 1I1YA 3HUJB 4OFKA 4OIBA 4J3WA 4YZFE 2DBLH 3TZVA 3CVHA 4ZXBD 3GRWA 1QRKA 3ZSSA 3HI6H 1XAUA 2JCCE 3MLXH 1YEIH 3WNNA 4YDLB 1Z6JT 4PRAB 3ROLB 3GRWH 1SYVA 7FABH 4U1JB 5F7FA 3IRZA 3RWCA 3X13A 2RBLA 5DVKA 2OK0H 3IJYA 4BA8A 1MCSA 1FZMA 4GKSA 5DFVC 1A7PH 3NFSL 3NCCB 1FFPB 5F7YC 1U8KA 3ULUL 4AEEA 4KU1A 1LP9A 4KI5C 3WUZA 5HVHB 3L7EB 1MFBH 1ZVYA 4Y2DD 1MPAH 2PCPA 4P4KB 1J1OH 1U8JA 1XF5A 2A1WH 3QXDA 4DGYH 4XP4H 5D7IB 3GSNA 5EULV 5GIRB 1RZJC 3WN5C 4XAKE 4ODWB 4F7TA 3BO8B 3P4LA 1UB5A 1RJZB 4HFUL 5I74C 4BK5A 2BC4B 4RFOH 4TSAH 1VFAB 4IMLA 4LKXB 4AZ8A 3WO4C 3DV6B 2P5EA 3KXFD 1QFUH 3H0TA 5TF1L 3PL6A 1MSPA 1LO5A 2HYMA 5FKAB 1RUQL 2DDQL 1KCVL 1E6OH 2W07A 2CKBB 4F7TB 3UTZB 5CJ5A 3C2SA 1F45A 3FRUA 1H5BB 1U3ZA 4URTB 1OPGL 5JR1H 3KLAA 2RB8A 4JZJA 4X0KB 2DJUA 3P0VL 2V2TB 3MNWA 4HS6A 3D5OF 3OGCA 4UMGA 4MJ4A 5I1EL 1DQMH 5KSAC 5DD0H 3PXJA 4GSDL 4F15B 1OT1A 1KEML 2BSSB 3B9AA 4P3DB 3LKRB 2D7NA 1BD2A 5EFIB 1LILA 1VEMA 2BVTA 4YBLB 2LV4A 4FFVD 1ZT7B 4O4YL 3CGTA 4EDXA 3VXMD 1HXYB 3OBAA 2ZPKH 3WIHH 5TQ0L 2BJML 4GRLD 2VDLH 2PN5A 1VEPA 2AJVH 5E03A 1NFDF 3QUXD 1OGAD 3HNTL 5JW5A 5D7SL 1EO8H 5ETUB 1E6JH 5FYLL 3C5JA 3S34H 4ODHH 3BDYL 3RTQB 4NZJA 2NTFB 4DVBB 4Y4KC 4RFNC 4PS4H 1MRCH 2HA1A 3T1FB 4XVSL 3UBXI 1WWWX 3K4ZA 3EO9H 4WUKH 3VWKC 5MENA 3SDXF 2XPGB 2DD8L 1YEGH 2NY6C 5KZCB 3VXQB 3QHTC 1A1OB 4NNYA 1KXVC 2YXFA 2UWEB 5T1LB 2OZ4A 3EYQD 5CILH 1MOEA 3UDWC 3QUMB 1M4KA 1KB5B 3SBWC 4DUVA 5IVZA 3FFDA 3WDIA 4JM2C 1IC5H 4I48B 1EAPB 2VLKD 4V2BA 1KTDB 1KB5H 1QSVA 3OR7A 5DMKB 2DQEL 3QG7H 4YJZL 3G08A 4ZTPL 3KYAA 2P45B 3VMOA 5TJWK 1QA9A 3L3IA 4OCXH 5IR1B 5C09A 3JZ7A 4Z78B 1YNLL 2QSQA 5D1ZB 4PJIB 3STZB 2K3TA 4RNRA 2A73B 4I5BA 1D6VL 3C09B 4N9OB 4UV7L 5IIEB 1T21A 4KROB 4KRNA 5FAAA 4Z7NE 3KYOA 2N7AA 5ILTH 1OSPH 2AV7B 2DI9A 1UEMA 3AAZB 1GC1C 1YPZA 3PWVB 2W9DL 4PTTA 4W6YB 4X7TA 35C8H 2C3VB 1G9ML 4XCFL 2WQRA 3OWEA 1N59B 4WWKA 2VSCA 3VG0H 4BSWA 2R1WB 3MRLB 5DC9B 2J4WL 2KZ1B 4G80A 3OR6A 2N4IA 3RFZC 1S7WA 5C8JB 4OGYH 3CC5A 1Q0XL 2WBJD 5MHSD 2CIKA 3UPRA 2NW3A 4R4NC 1KJVA 3ILQC 5JNYA 3C6LC 1GL4B 3KYKH 4M6OL 2YD8A 4L9LA 4OLYL 4YDVA 1A6ZB 1G7QA 3BVNA 4LEXH 4OCMC 2L7JA 2FJGA 1U6AH 1ZEAH 1DBJH 5SX5H 4QTHA 4WWKC 2NZ9D 1YY8B 2XY2A 4EUPG 4K7FA 2NX5D 4RWYH 2VDPH 1IC4H 1RHFA 1KCSL 1VACA 2A77H 1T0PB 3L3KB 5F1NB 1DBJL 1T22A 2BY1A 1S5HA 3GMNB 4HKZB 3B9KD 4PJ5D 1RHHA 1IEBA 4KK9C 3O6ML 1QR4A 2RJMA 2VLKE 4YWGH 1N6QH 5C0CA 3SDAA 2GFBB 1BVKB 4Q0XL 5A3ID 5FA3B 5HYJA 2VDKL 1KB5L 2CDEB 4NQTA 5IQ9A 1G7HB 5AYQA 3RWIB 1RMFH 1PKOA 1IEBB 2XQBL 2YPVH 3QISA 4D9RD 3S3JA 2ESVD 3A6BH 4W4OA 3SJVD 2ZOLB 3FN0L 3WD5H 5JW5B 1PY9A 4L9DA 1U8PA 4RISL 4A2LA 3ZDYF 4LSUL 5CHNB 3U7WH 3V0VA 1BREA 4I1NB 5C1MB 1AXSB 2F19L 1HINH 4RQQA 1TZGL 4RZCA 3U48A 3WV0A 2EEAA 4JFYB 3V6FB 2G5RA 1X7QA 3MRGB 3KPRA 3B9KC 4PJFB 1U8LA 4JG0L 4TUOB 4UV4H 5DJXA 3O2VL 2Z92B 2ZJSL 1WAAA 5K9KB 3DHJA 1PZ5B 1HWGB 2EKJA 2NY5H 5FK9B 4NNPH 4PJEE 4KPHL 3RUGA 1K5NA 3QDJE 4YXHL 4GW5B 1CT8B 1EEQA 3ALWA 5E00A 4ZODA 1TXKA 5DK3A 1U41A 1XCTA 5ANME 2OK0L 1U8OB 1NC2B 3DWTA 4FQQB 4WI4A 3MLWL 1JNNL 1OVZA 4CAGA 4D0DB 3G6DL 4YFLF 3MLSH 2ZZUT 2R9HC 4OZGA 3RWGA 1MCOH 1LDPL 4R7NB 1FYTB 4PG2A 1S3KL 1AQKL 5F3HA 1S78D 3SDYH 25C8H 3C9NB 1J1OL 3O0RH 5CGYD 1P9MA 3CH8A 5CJOH 4F58H 3IU4H 5AAWA 2R4SH 1JNNH 5KS9A 4I8DA 3FB5B 1K9TA 5IM7B 5JDSA 1JPSL 1GZQB 4WHTA 3BH9A 3BP6B 4HFUH 1P4LB 5F3BB 4FTVB 5AEAA 1D5IH 4P9ML 4P9HC 1IGTB 2ZCHH 2DTMH 1YJDC 3REVB 3CK0L 3TCXA 2YS4A 3QRGH 1ADQA 4U4BA 2Z91B 3M8OL 3RWFB 4DGIL 3CU7A 4DCQA 4OLEA 4J3TA 2DQFA 3OKKB 4LSRL 1H0DA 5E2WL 1I7ZA 1SEQH 4XPHH 1K8DA 4TNVF 2Q86A 4Y0GA 1IM9A 1B4JL 1IFHH 4RGOL 3T0VA 4Z6AT 5HD8C 3CH1A 4HHAA 4AG4H 2ATKB 3OL2A 3QRGL 1KIPB 5AUMA 2AJSL 2PTUA 2F8OA 1PFCA 5C92A 1VGKB 3ARPA 4M03A 4MA8L 3UBXG 4P0DA 2EIZA 5I1DA 2ADGB 3GSOA 3NA9L 4G3YH 4PGCA 3S7GA 3IFLH 3RVUD 1CK0H 3HI1B 5GRXG 1MCPL 2AP2A 1UACH 2HJFA 3N0PB 1ACYL 4QKXB 1KB9J 3D9AH 3B5HA 5IKCB 3IDYB 2Q7NA 1KIRA 4GAJL 4HPOH 5DJDA 4PJBF 2HJKA 4KK5C 1QUNA 4KDVA 1ZT1A 2C5DC 1TNMA 1QEWB 5KVGH 2VC2H 4TNWK 5JOFA 1ACYH 3WDHA 1IGJA 2QJDA 4M7KH 1JPFB 1K4CA 2IF7A 3R06B 1PQZB 3NN8B 4EBQL 5KS9E 1YMME 3RX7A 1JF6A 1RIVL 4DN4L 3ARZA 5EBMA 3BDXA 3CX5K 4ZSOB 4OUOA 2VISA 3HE6B 2G2RA 3W0WD 5E56A 1OSZA 4R9HA 5T3ZE 2VDML 1IKNC 4U31A 2NY0D 5DA0B 3TVMA 1JNJA 2DQEH 5C0JA 3ULUH 3RWJB 3V5KA 1JGVH 5TH2A 2A74B 4FQXD 3MRMA 5FYKU 2UUDH 5E9DB 5HYSB 4BFBD 5EN2B 5J0BA 2YBRB 1RU9L 1XGQA 1K85A 4YUEL 4EDWL 1CFVH 2YUXA 5J13C 3CFBB 5IVZB 3BKML 1CICD 5H2BA 1A7NL 1NH6A 2P43B 3D69A 1B0RB 4A6YA 1QKZL 3UXFA 3WFBH 3PGCB 1HH9A 2HTLC 3E3QE 3WIHL 5KS9F 2VZTA 3CCHB 1YQ2A 1HOCB 1M71A 5BZDB 4QYOB 2OM5A 3HE6C 1ORQA 2YD3A 2FEDC 3KPPB 4CVXA 4PRAA 3MA9L 3QI9A 3UZQA 3TH2T 3MBEA 1WCBA 4OJFH 4HZAA 5H35A 4MS8D 2EDBA 4Z8FL 5FECB 4YHNB 4V2CB 3QXWA 4HZLA 3EYFA 3QUMH 2F74A 5BV7B 1P5VA 4H1LA 4N8CH 4JANA 4UQ3A 1FFOB 1LO0H 1DBML 2BMKA 1PGRB 1H9VA 1ERNA 2ADIB 3TNMB 3AXLA 4ZUWB 4HBQA 4RDQF 4KY1L 3EHBD 1I1YB 3BT2H 1FZOA 4HMEA 2NW2A 3MLYL 3RRQA 5AWNH 1IC5L 4YBHA 4Y5VC 1I1AD 2ZKHH 1UM4L 2OJZL 5EO1A 5CEYA 2FBJH 5SWSA 4F57H 4LHUA 1B6UA 3PWLB 4PJ8A 1EO7A 1IBGL 5IT2L 4DKEH 1NCCL 4G9FA 5LKNA 5T1LD 3OAUL 3SHSA 5IHLB 4N0CD 1RIVH 5E2JA 5DUPH 5CP3H 1ADQH 1E28A 1VADA 5E4EB 5I71B 4IMKC 4M62H 4HEPG 1UGNA 4AEIL 3B2UC 3AXLB 1MHPL 3PDOA 2QQQA 5HDLA 4WTZG 1OLLA 4NKDA 4LSDA 3G9AB 1UWGH 2XWJA 4NQCB 4LLQB 2X44D 4Q7DA 4OKVA 5GGUA 4LVOC 3K3QA 4J2XA 4OCWL 2I27N 5HHVL 4NFCA 2EDDA 5DD5L 4D9QE 1CE6B 4OT1L 4DOHB 2PUQT 1N6UA 1F2QA 3QUZA 1TVDA 4H1LH 4Q9QL 3E3QC 4LEOA 3ESVF 3QT2A 3AMLA 4RGNE 5F7UA 2X4RA 4WHYH 5I1CH 4PJ9B 4FA8A 4L8DB 4NWUL 4J3XA 1MAJA 3CLFH 4JCMA 1ES0A 1JTOA 2ZUXA 4JO4H 3WE6B 1NCBH 1RK0B 3QEQD 4N5EC 3K80A 4HUXA 4I3SL 1OCWL 3QUZB 4GLRI 4HUWB 3HNVH 1HXMA 3A6CL 2B1HH 3AY4C 3ARDD 3PWJA 5HPMB 4C56E 1VGEH 4Z7WA 2XWTB 1MFAL 2EDHA 3D3VB 1Y0LB 1EK3A 1ZT4A 2AABH 2I24N 2PO6C 4X6EA 3HCVB 2AKRB 4OZGE 3WIFA 3PWVA 4Z77B 3GBLA 3DUSA 3NFNA 5E94A 1I1CA 1P9MC 1HHKA 1TENA 3VGAB 3QP3A 1EFQA 5C08A 4XBGA 4JO1H 4O02L 4TUKH 1JYWA 2IAMD 4XI5D 2FBJL 3EYOA 5T5NF 4MD0A 2FJFB 3K4DA 1A6WL 2NW2B 4N0RA 1KCLA 2AEWA 4RBPK 4YH6A 4R0LA 3FQTA 4MNQB 4MXVE 1OP3H 5F1IA 3VFPA 4PJGE 3S98A 3OKMA 3MRKB 4ZMAT 4LHUB 1ADQL 2YPKB 3CFEA 2FATL 5JPNB 1NC2A 4FQQA 4L9LB 4YDVB 1OF2B 2B8OT 3DTXA 3TBSB 1OTSC 4XCNA 5FGBA 4F7MA 2AQ3A 3GSRB 4J3SA 4NZTL 1OGTB 3KR3L 4EQ2A 5F9WB 1MCQA 2H2PC 2CDGA 5DRWB 4XXDA 2BNRD 3LV3B 1JN6B 5T3XH 3PABA 1YEHL 2E7BA 2HG5A 5HI4C 4CN1A 3LKPB 4NHCL 1MI5B 4XVJL 4MXQC 4NZTH 1AD9A 3CXDL 4GRWF 4NSKB 4Y2DC 3UYPA 3HMXH 1T6VN 4KWUA 1UWXH 2BOCA 5KSAA 3CZFB 3LKPA 5D7LB 1DVFB 1F4HA 5GZND 1UXSA 3S36L 1W0VB 3NA9H 4HJJL 1ZT7A 1KYOK 5SV3A 3ZYZA 2GUOB 3Q1SH 1NGYB 3UJJH 3UBXA 2R15A 3CSGA 4LVNB 4G8GD 2F19H 5CEZE 3RGVC 2NLJA 3QPQC 5BQ7B 4M6ML 2JJTC 1NGZB 1VGEL 1F11A 1IQWH 3VH8B 1Z9SA 1V3KA 1FNAA 4YGVA 1KNOB 1IAKB 4PJHF 3FQNA 1KPVA 3QNYB 1S8DB 2IALB 3QA3B 2FX7L 1OM3L 2RHEA 5E1AB 5IGXH 4P5MA 4ODHL 2XPGA 1RAMA 2YSSB 1LDSA 1KNOA 2X89D 4Z77A 5TDNA 3MA7B 2CLVB 3FZUC 2ZSWB 3DOSA 4N8PA 4YK4B 1JTTA 1T5XB 5B39A 2F5AL 4H26A 1DQTA 1ZHKB 1J1XL 3VRLE 1LO5B 1FE8L 4DVRH 2HFFA 4M48H 1UH2A 4JPWL 2MJWA 3UROR 2CLRB 4QRPD 5CIPH 1HH6B 3QQ3A 3OF6D 4S1SL 3SDCB 2XN9B 4XZUA 3GMOB 3P9WB 3SE4C 2X4NB 4YHIB 1DUZB 1IT9H 1E4WL 5I75B 4C58B 4LPVA 4PRIB 4JO2H 2IALA 1U8MA 2NPLX 5IF0B 2DQUL 1CL7L 3O45A 1YNLH 3TBWA 4MXWL 1OAUH 1Q9OA 4NCC1 4AIZA 1RK1B 1U36A 2XQYK 1K2DA 4YZFF 5DVOA 1L4IA 4PRBB 3THMH 1D5XB 1EJOL 2HLFD 4NQCD 3Q6GL 1NLBL 3RY4A 5JHDB 3AAZA 1WEJL 4HWBA 5TE7H 2BOBB 3ARBB 5DRZB 3HC4L 5ACMA 3NIGE 3HNTH 1F2XK 1W72L 1FGVL 5KVEL 1KN2L 1BQHB 1MNUL 5EBWB 4Q6IC 5HHPA 1NBQA 4S1QH 2BRRL 4ZOEA 3WJJC 1A9BA 2RCSL 4PBWD 1S9VB 4QRSB 3EZJB 1QP1A 1B0GA 4KY1H 2AI0L 5EIIA 1QNZH 5DFVD 3CU1A 1XF2A 1D6EA 2R4RH 4PY8I 2OL3A 3BP6A 4BFEA 3L5IA 4Z7OE 1UJTA 3UDWA 4L3ED 4NRZA 3FFDB 3NAAH 4F2MA 5AD0B 2GK0B 3WIHA 3OMZA 1DBKH 1ZHNA 3OSKA 3ALXA 3OX8B 3DYMA 5DR5L 4GKZA 5KSUA 4UZGA 4ZXBC 3ARBC 4YNYB 4CU8A 1C1EL 1A9BB 1NEZG 4L4VE 4Z7QF 1JPST 5KVGL 4Y5VB 3IDGB 2IFFL 3ARFB 2CH8A 4X8JA 1IGMH 2BY3A 1U3HC 4JFQB 1F4XL 4JB9H 3UTPE 1Q1JL 1S7WB 5C8JA 4MCZA 4HEME 4XNZB 4GRMB 1B6DA 3OAYK 1D9KA 5F89B 1SYSB 4NFBA 4R6UA 4HW6A 5FYJD 1H3VA 1PSKH 4N1CA 4PR5A 3H9SE 2ITDA 3BWAB 4KAQL 4M43L 5GGRY 1T1WA 4JGUA 1S7QB 5IEKB 4WEMB 5BW7A 4YGAB 4IRJB 1IC7L 4HF5H 2B4CC 3L5WA 5KTEL 1U8HA 4P5TC 4JZJB 4NUJA 1YYMH 5C86A 4U33A 4LLUB 1Z3GL 1UM4H 2R56H 3PWPD 4WDIA 5HHXH 2IBGA 2WUCH 3MRQA 1K5NB 2IANA 3MV8D 1P7QD 1DDHA 3EYVA 3QHFL 5ALBH 2IGFH 4ZO9A 1D5MB 3Q3GB 2FEDD 1KLGA 4OLZH 5HHMD 4NKQB 5E9DE 5I17A 4HUXB 4YC2C 3VXPB 2VITB 3RNKA 2B7DT 4M8QA 2A9NH 4I4WA 3REWA 1KXTB 2WBKA 4LNRB 1KGCD 3PL6C 3QXAA 2XZCL 1VFUA 3ARFC 3C5SA 1MHHB 3WFCH 2WWMD 1PBYA 1Q9LA 3T77B 3SY0A 5KS9B 4M6OH 1HDMB 4GMSL 3VFOA 2ZOKA 3BKCH 3QJHA 4G8IB 3C6LB 3F12A 2RQ8A 4I13B 1AGDB 4ZO8A 4PREB 2JIXB 2Z8WC 3TN0C 5DXWA 3GJFB 5EO9A 3VD5A 1K4DA 5CP7B 5GISL 2CKBL 5K9JH 2JCCA 1BWMA 4QRQA 3ARGA 5EZJB 1N5YH 3FCTA 4ZS6C 3RVVD 1DFBH 3TO4D 3ILPB 4PTUA 3MUGB 4XTRD 1VENA 4BYHA 2ZCHL 3UTSA 1GOHA 1S78C 1I7ZB 3WXWH 5HHQA 4JFXB 5F89A 1DL7L 2VXQL 3BMVA 5F9AC 1AD0B 1ORSB 2CDFA 4YDLC 4DCQB 4LSRH 1ZKAA 1RUKL 4NM8H 4QRPB 2XT1B 3EHBC 3K74B 5CGTA 3T4YB 4BKLA 5BVPL 3KLHD 1RZ7H 5D1QC 5LQBH 3O3BA 1RUMH 4U6HA 1S9WA 5D2NB 5D7KE 3RA7L 1RUPL 3K0WA 4LCIL 1A6ZA 3DSFH 3CFDA 5AG8A 3P0VH 1FNLA 4OTXH 4YHMH 5HGHB 3F65A 1NEZA 1MLCA 4FG6D 4JDVA 1DLFL 4JRXD 4J8RA 1EUUA 2MQCA 3U79A 5CLWA 1TZGH 2MCG1 3P9LB 4ZS7H 1C12A 1QLRB 2K7QA 2FWOA 1YY9C 3KPSE 2A0LD 3GSNH 1JJUA 4OD3L 2R4SL 4MNQD 1IC1A 3I85A 3E8UL 3P3YA 1F5WA 1RZ8A 3RWDB 1MVFA 4AENA 4P4KC 3WFEH 3SDCD 2VQ1B 4WFED 1E6JL 4EBQH 4HS3A 5IMOB 4JO1L 1BGXL 4O02H 2EH8L 4IEFB 3TNNB 3V4VL 3LEVH 4HGMA 2WANA 5CEXA 2XWBB 5K9QI 2GJZB 2HVJA 2A6JA 4FFVC 5JXAL 4LFHG 4GG6A 3PG2A 2NXYC 3ZT5A 1ES0B 1NKOA 3IS1X 4WGWB 4KHXH 2I07B 2PXYC 1L0QA 4FZEH 4HWNA 2GYSA 1I9EA 4P4KD 4OD2A 3TEUA 4C59B 5A43C 3GRWL 1C8PA 3IF1B 4KKAD 4JFOA 4MAUL 3VWJC 4DZ8A 1ZT1B 2B1AH 4LSSL 1G9NL 1MCWM 4CW1B 4HIHA 4U1IB 2JB5L 5FGBC 3LKSA 1D5IL 4P9MH 3GJEB 1FH5H 4FNLH 3HKFA 2DIJA 1H15A 3DX7A 1D6VH 3A6OA 1UXWB 2DKMA 3GSWB 4H25B 4Y4FA 3UYOD 2GAZB 2AV1A 4TVPD 1D5BA 3GMRA 5ANMB 1OSPL 5GSVB 4DGIH 2VL5A 3TN0D 2YPLE 3O4LD 3FZUD 1VKXA 5HHOD 1FO0L 1NGPL 3VDBA 4R90H 1RZFL 2G60L 1HXMB 1CDIA 2BCKB 4L3CA 2E7CA 3QO0A 4HJJH 3IDJB 5T1DH 3DURB 4PJDE 4OIIL 5DT1L 2Y7QB 3BUYA 1T7VA 3QB7C 2JJSA 5D9SA 3LKOA 4DUXA 1FZMB 4HHAB 1OTTC 3VXUA 3AREC 3L7FB 4BQ6A 3RP1A 4OZIB 5D2LE 3HS0A 4Y4FC 4EZMA 5DO2D 3MJGX 3KWWB 3NCBB 1GC1H 1IGFL 1Q9KB 4XC1L 1UACL 5EUOF 4M1CD 5C07E 3RVXD 4RIRB 3W81A 3S37X 3L1OL 2VMFA 3NCEB 3BPLC 5A2FA 2YKLL 4LARL 3WUWG 5IMMB 3KJ6L 5HJ3B 4GBXC 3EYFB 5T33L 4QRUA 2FJFA 1JK8A 4BKLB 2C4FT 1OLZA 5D1XA 5FUOH 3VXSD 1WCBB 1AI1H 3VWJA 3F58H 3JV6B 1GHFH 5F88A 5IMOA 4WHTB 1AO7E 5HYQB 5J4MA 2XV6B 3RPIA 1J1XH 4XPTL 4OFPA 5FYLH 3RWEB 4TULH 3UTSB 3SGJA 3FB8A 4XXCC 3L3DA 2DJ4A 2YRZA 2Q86B 3PGFL 5IMMA 3MRNA 3VH8G 2ZUQB 5D2LF 1PKQA 3QUKB 4YBQC 5BS0B 3HLAB 5SWSE 4MVBD 3SDDD 2A0LC 3SDXB 2C3XA 2JIXD 5GRZA 4GH7B 3LS4L 4KKLD 3TO2B 4CKVX 4XPGL 5IB1B 4P4RA 3TO4B 5HDQH 1G7MA 4YPJA 5J6GA 4KMTH 1Y18B 2DQTH 3MA7A 3HFMH 5MEOB 3HAEA 2R0ZL 5JA8B 5GSRB 2OQJA 3MYJA 5HDOA 2VQUA 4NT6A 3NTCL 5ANMA 5C3LD 2UV3A 3BP4B 1FYHB 2VSDA 1FORH 1HHKB 1CFNB 2XRAH 2A6IA 3KHQA 2H32H 4RMSA 4Q6YA 3RL1A 3TZVD 1NSNL 3HCVA 4MWFA 1KFAL 4LRIA 1I7TB 3PP3H 5HVFB 4I0CC 3IDNB 4KPHH 2HJKB 2K1MA 2UVFA 5D96C 3RUGF 3WE6A 1WZLA 4UOW0 4PJCF 4MDJB 2OYPA 3SDCC 4NDMA 2AGJH 1X5KA 4L8BB 3MJ7A 4RWYL 1XZ0B 5L0QC 4HDIB 4EUPB 3RI5K 3FT2B 2J8UB 4OLVH 4AIZB 3KWWA 1FNEB 4G9DA 2AERT 4R3SB 3MLWH 4DEPB 4IOFD 4NJ9H 4MDJA 4J3VA 1EVUA 4L4TD 4H26B 1ZAGA 1IAOB 2Q8BL 4PRHB 3MBXH 5GGSA 1OSZB 4P2RD 4PJAE 1AP2A 2BNQE 3GIVB 2FJHB 1AXTH 3WN5A 1HH6A 3QQ3B 1BX2B 1B88A 5DJ2B 2RFXB 4EUPA 2P8MA 2OMNA 4J7RA 5GS2H 4ZYKA 5KANI 1A3LL 4Y5XA 1CBVH 1ETZB 4PLOB 1JV5A 1F6AB 4HIIB 3CVHB 1Q9WA 2R0WH 4ZNEE 4BZ2H 4OLWH 3BW9B 1H15B 15C8H 1J05B 1FFQA 3DX7B 1UWGL 3H3BC 4LF3A 3TIEA 3W9EA 2NTSP 3UTTE 5GGVY 3BAEH 5CJXC 3MOAL 3SPVB 4JREC 3JWOC 2XZQL 4YBQD 3LRSB 4IRSD 4JPKL 1F6AA 1WK0A 2P5WB 2D4DA 4LDLB 1N6VA 3FQUB 4XT1C 1K3ZA 4JRXB 5C09D 4OQTL 2RFXA 4MNHA 4JPVH 4Y19B 5FYKE 5JHDE 4R96B 1OP5K 1XF3A 2Y9RT 3BZ4B 4YGVB 2VJXA 2VLMD 5CEYB 1I7UB 5F9OH 5C0AD 3WSQH 3BQUB 2DBLL 2PR4H 1YY8A 3VWKA 3WFZA 1LD9B 4FQPA 5E7BA 2MHAA 3U0PB 1SYVB 1JV5B 1CLZH 1X4ZA 2QKIA 3MR9B 3QH3B 5CCKH 1S3KH 4S1DC 3I50H 1MCCA 4HPOL 3T3MF 3QDAA 2DLEA 3G6DH 2YXMA 5L6YH 3MLXL 3SOBL 3V4VH 2WK2A 4L4TE 5DA4A 3RL2A 2MHAB 4XVUD 3CDGB 3IDNA 25C8L 2NW3B 5EPMA 1ZHLB 1NUNB 4YHOH 1ITCA 1YECH 2ED9A 1QLRA 2VXUL 1F4YL 4HMDA 2DJSA 1X5YA 1KT2A 5I8OH 1FE8H 3P73B 5CWSB 3QDGD 4RGNC 2C3HA 3BPCB 1HSAB 3VXNA 2X10A 1FNEA 4MS8C 3QIUD 1JHTB 5IVXA 2CGRL 1CE6A 2PYFA 2MNUA 3QG6A 3MTRA 3QDMD 1JZ2A 2Z8SA 5GSRA 4K7PX 3MUJA 3CK0H 4IOIA 4XH2A 4K71C 1HSAA 3VXNB 2E7MA 3Q0HA 3PGDB 2IPTL 1QFUL 3T8XB 2WBWB 4RGOH 3JWNC 5DGRA 4HXAH 3VA2C 4ZXBA 4P23D 1KCVH 1SEQL 1IGYB 1JWMB 2VABB 3Q1SL 1RIHL 3TV3H 1QA9B 3L3IB 2F53A 3MFGB 3G5ZA 1EX0A 1CXHA 4RDQG 4M6MH 3WXVH 4BK4A 3QXAB 2B0SL 3JWOL 2O26U 3IAGC 4LSQH 1GGIH 4EDXB 2YSSA 4HIHB 4ODXA 2XKUA 3RVTC 1G0YR 1KPUB 4I2XB 4QTIH 2HTKD 2FL5A 1I1AA 5LAXB 5SWSD 3G9VA 2F53B 2ZPKL 4LBEB 4KTEH 4HD9A 1JWUA 1ZOXA 2HFGL 7FABL 1XF3B 1SJEB 4WTWA 2A9ML 2DAVA 3UCRA 5TDOA 4XWGL 3IFNL 3P30H 4P3WA 4MA1C 4HXBL 4X80L 1ZVSB 3E6HB 3BHBB 4Z76B 1AO7D 3D87B 1JVKA 5L6YL 5CZXC 3U4EA 5H35B 1J1PL 3AUVA 2M8XA 2MFNA 1Q0YH 1TJGH 2IADB 3MRRA 4CU7A 1A21A 3L7FA 4OQ1A 3HE7B 3WKMH 1XF4B 4ISVB 3BGAA 5ISZE 3RIAK 1QFWL 5ISZD 4OGXL 2NY7L 5C07D 1FNHA 5EU3B 4MHHI 3QNYA 3DRTA 5EOCH 2NQCA 3GMNA 3VMPA 4EI6B 2A38A 3N1PC 1GGCL 5DMGD 5DD1L 3NIGF 3I3EA 4PY8J 1YEDB 4R4FL 5IBUB 5J1TC 2KUTA 2CMRH 4OCRH 2R2CA 4WW2F 5BO1H 2P8PB 2CDGB 4FN0A 5DRWA 1RJYA 2NY7H 4HIJA 4YIQB 5JOEA 4M7LL 5KVFH 5IQ7L 2A6KA 3C2AH 3QEQA 4BM7A 4JFHD 4WW2B 2R2HB 1SVZA 2DI8A 4MD5B 4UILL 3VFMA 4NUJB 1X5FA 1E4XH 3WEXA 3FQWB 5JOPD 4K94H 4XHQA 1RJZA 2Z31A 5L8KB 4JFFA 2CMRL 4R26L 4XPAL 2NYYD 3MLVL 5EOCJ 4MAYD 1R3IL 1OP9A 2GKIA 2EH7H 4MJ2A 5ADPL 2GK0A 1YQVL 3LN9A 4JR9L 4EOWL 5FKPA 4ZFOL 5FGCB 3BIKA 3TVMC 1T20B 5IB2A 3UTQB 3GUTB 1BOGA 4G6KH 4NGHL 3MLUL 1LO0L 1ZANL 1DBKL 3EZ8A 3Q6FA 1FYTD 4J23A 4F7CA 4UNVA 3BDYH 3L6FB 1FNGB 3ZTJG 1F90L 3DX8B 4N9GA 1RIUH 2CRYA 2E5EA 5TFSH 1DEEA 4BH8A 3MLZH 1A6AA 1E4XI 4LCWB 4WTZA 5IHUL 4WVRA 1U8QB 4L4TB 3WEXB 1IGML 4X99B 4U1HA 2WP3O 2ED7A 2R2BA 3GSOB 4PJBE 5CILL 5DGQA 5E5RB 3GBNL 3NIFE 1CIUA 2EKSB 1A7QL 3N50A 4HT1L 4ZFFA 2VDNH 4HFWA 1PLGH 1O5DT 4ZPVA 4MJID 5ICZA 2EICA 2JCCB 3RJQB 4WFEE 4HQQL 3CDCA 1NMAH 2YKLH 1KENH 4LARH 4M9PA 4JHZA 2BK8A 2BNUA 4NO2A 3AGVA 3TBYA 5BW7C 2PYED 1REIA 1TIUA 3CD4A 1EV2E 4BSVB 5EIVA 3U0WL 3KPSD 2AW2A 5C6PB 1BF8A 4YXKL 3ARGB 4M7JH 3RQ3A 1MCRA 3QBTB 5C08B 3ZE2E 1RJLA 2WBJA 1FGNL 1JWMA 4J4PA 1M1SA 3W0WA 4M4PA 1I1AC 1KJ2L 4Q58C 5I1CL 3O2DA 3U4AA 4KKAC 4HKXB 3AU1A 1TJIH 4XCEB 3F5WA 1RI8A 2VXQH 3ARYA 3DO3A 5FA4B 3FT3B 3VFTA 1L7IH 4GRWE 2Y23A 1FFRA 5JW4R 1MAMH 4NN5B 2IGFL 4MNGE 3C5SB 4EEEA 1AHWB 1G7JA 4Z7UB 4R26H 1UM6L 4E42B 2NY4D 5ICYB 2DLGA 4PJ9D 4K2UL 1B2WH 3MUHL 1U8NB 4YHZH 4GKSB 4MCYB 5DYOA 1JF1A 4PJIA 3LZFL 2QQNL 3B8YA 4NQDB 3QXVA 4P46C 3X11A 1YMMA 2Z8RA 1A6UL 3G5XA 5E6ID 1OAXL 4KVCH 1L6XA 4ZUSA 1JF5A 3ARDB 3MLRH 3UTTD 2X89A 4JHAH 3X12B 2FX9L 1OAKH 4LQ1A 4RFEA 5EZOH 1P7KA 2R1WA 3C60C 4Y5VA 1X5LA 3D3VD 2FEEI 5HHQB 2CRMA 2P8LB 3QQ9D 3VDAA 4B41A 5J1AB 3FT4B 1UCBH 4LLUA 5CJXA 1I4FB 4OFIA 2X9YA 5I6XC 2HH0L 5JQHC 4XPBH 3LN4B 3DUHA 4Y16C 4NYLB 3CUPB 1J9CT 1DE4B 1DFBL 4PD4K 2EZ0C 2DQDL 3ZE1E 3MNZB 3LEVL 4BZ2L 2AGJL 5HI5D 1I4FA 3RGVD 1WICA 4P2RB 2ICCA 3I9GH 4GKNA 4QRUB 4BFGA 1RUAH 3HZVA 3M07A 2FHCA 4LHUD 3LHPL 3TVMD 2C9AA 1Y18A 4M5YL 5HYSG 5I73B 1AO7B 2VE6B 1NAMH 5BCAA 5E08L 1JYVA 2Q6WA 1MFBL 3CFCL 2CIIB 3IJHB 2Q3AA 3O3DB 1SY6L 1RIHH 3OAZK 5DJ8B 1XIWD 2ITCA 4XP4L 1EHNA 3O41A 3IDXH 4PUBL 4YHYB 1FSKB 4JO2L 5K9JL 3QUKA 1MRFH 5C07B 4E5XB 4YFEA 3MRPA 4K8RD 1L0XA 3MV11 4JLRB 4HIEB 4GJTB 1UYWL 4AT6B 4OZFA 3PUCA 4JHWL 4KMLB 3ZE0F 1F3RB 5IUSA 1S9KC 1FAIL 3FT3A 1JWSA 3EFFB 4RQQB 4MA8H 4RZCB 1S5IL 4DW2L 4FFWD 1U2CA 3T09A 4CVXB 2YRLA 4YHIA 1M7XA 1CFTA 4PV8B 4HKBA 4YO0B 5D5ME 4U1MB 5K9KA 3L3JB 1YEJH 3SCMC 1A6UH 4D2NA 2D31B 4X8XA 1GGUA 2Z31C 2WIIA 3EJZC 1MWAH 1XCQB 2GY5A 3HI6L 3LRSA 5I66B 1VERA 1QLFB 1OAKL 1LK2B 1ZA6B 2BSTB 1A7OL 1OGAA 1F3DJ 3GMPB 3IFPA 3TYGL 3OKMB 2HJLA 3ARDA 4K07A 4D8PA 2WBJB 4OZIA 1J1PH 3KPMB 3IU4L 2VISB 3HE6A 4WFFD 4F15C 1CLOH 2Y72A 3CAFA 4NBYB 2X1WL 3SDAB 3ES6B 3NZHH 5DZNA 2I5YL 2H6PB 4X4ME 2C4XA 3BGFC 2F8VA 1D7FA 2OTWB 3SKOB 3V6OC 4JN2B 4M48L 5JIHA 2AV7A 2NY4C 3RNQA 1G7JB 4LPYA 3KJ4C 5HYJE 5EIIB 4CU6A 1JZ5A 1FG2B 2VXUH 3D2UD 3LHPH 4OF5A 2GAZA 3NBNA 5I16A 4RBPH 1IKNA 4KQ4H 4LLAA 3QEHA 5CP7A 4YDJB 1BPVA 1LK3L 4AG4L 2NCMA 4O58H 2APWA 3LY6A 3QFJE 4OZFH 2L7UA 4JKWA 1A6TB 1GGBL 4JKMA 3T65A 1R24A 3VD4A 3PNWB 1I9RL 3ES6A 5B8CB 2QHRL 1JHTA 3QG6B 1G6RB 3VXMA 4WUUA 4PJ8B 1N0LA 3ME0A 3VFRA 5HHOE 4MAUH 5HYQA 1MIML 5F70A 1U8KB 1QLEL 2YPLD 1G6VK 1CDYA 2AAVA 3LN4A 1N3NA 4PB0L 5HTSA 5IOPB 3VWJB 3EO0B 1S8DA 5CJBA 3OPZH 5HJ3A 2VDLL 4JQVA 5CIPB 5ITFA 3QUML 1U58A 4YDKH 1INQB 3MLZL 4FQLL 4UB0H 4QXGH 3K2UH 1S7TA 4KKLC 4NRXB 1CLYL 1KCRH 1R3KB 3VE0A 4WUUB 2VLRA 5F93C 1CG9B 1BM3L 3DMMA 1EEZB 4PJEF 4L3AA 4O51A 3G04B 3KLSA 5DJAB 2OR7A 2PYEB 4LU5L 2YC1B 4MQ7B 4XC3H 3WL9A 1MNUH 4PJIF 4UAOB 1AQDA 1GIGL 4PRDA 1CLYH 2PTTB 2QLVB 4UUJB 1T03L 3ARGD 1J0KA 3BGMB 4XCCH 4ZTOL 3VW3H 3EBAA 2FHBA 4WI9A 1OW0A 4TVPL 1FZKB 1VFMA 5EBLB 3VE0B 1I8KB 1URLA 2OP4L 3MBED 4P2QE 5A2IH 5DQDL 5F7DA 5IEHA 4QHLA 5C0CD 4UBDC 4PGBB 5GZNC 2IJ0C 1TVBB 4N0YL 5C0FB 2WV3A 3LSOA 2VAJA 2XWTA 1RFDH 5GGRA 4P2QD 2V2XA 2IQAA 3TC9A 3KPLA 1Y6MR 1WF5A 2X4SA 4L4VB 4ZYKB 4OV5B 1SJEA 3T2NH 2IAMC 1OTUD 4Z8FH 4LLYB 4TUJB 1EEYB 1FAKT 5HGDB 5EU3A 3CCHA 4XB7A 1MF2H 2R56L 4GXUM 2YPVL 3DXAE 1IAOA 3CLFL 4UQ2A 4TTGA 4X4YB 4KK6D 4XMKH 4YXLH 5LG1A 3QDJA 4WO4B 1RUKH 3AB0B 3QUYA 4RMVA 5D7JD 3HN3A 4R4BA 5JW4M 1XGQB 4U6XB 3MGOA 3MXWH 1I3VA 4HK0A 4U1KA 5D7KD 1ONQA 4UTAL 3L3OA 3ULVD 1FYTE 1ZSDB 3S96A 2EH7L 5ADPH 3MSPA 1NAKL 4NWTH 5T1MB 3GI8L 4TVSa 4G8FB 5I8EB 4WO4A 4S0TD 5IFAL 3EOYG 1MUJB 3BZFB 3DXAB 3OKEB 1JP5A 1CGTA 1U6AL 3K2UL 4JO3L 4NJ9L 1JWUB 3T0XA 2W65B 3MNWB 5D93B 1JN6A 4Y1AB 4FFZL 1T1XB 2X4RB 4FXKB 1FZOB 4G6AD 3MV9A 4FMKA 3E8UH 1I9IH 3CFDB 2EXYC 2F5BH 1H3WM 2V9TA 4EVNB 2P42B 5MP6H 4ODSL 3O6FA 2W91A 5LXGL 3SJVA 1QHPA 1OT2A 4WWID 4Y16D 1U92B 3D48R 3PQYA 1MCWW 2AS5M 4L29A 4Y5XC 2LQRA 4PGCB 5C2UB 1SJHA 1HSBB 3OJDB 1YEKH 3LH2L 5T3XL 5B3NA 3HPJA 3FQXB 3AROA 2R8SH 2VO5A 2R29H 4Y88A 4PJ7F 1ZGLM 1OCWH 5C3TA 4C56D 4RRPA 4P2OC 5BJTB 3RHWK 4LEOB 1CG9A 1BFOB 3NPZB 5SX4H 3VXTA 1JI1A 4KQ3L 5GRUH 5F6IB 3JUYA 2ADFH 4JFPA 4RX4D 1WAAF 4KXZH 4ERSL 3KYNB 3EOTL 1L7IL 1RVFH 4HUWA 3MJ9L 3RGHA 1NC4B 4Y8AA 4RGND 3S3PA 5E5MB 3SDXE 4TSCL 3STBA 3FQXA 1IAKA 2IMNA 3HZYA 5J57B 3EYSH 3S35L 1NC2D 3MOAH 1E0OB 2DN7A 1INEH 4OGAC 4ERSH 4XVUC 4O2CB 1TETH 5TE4L 4G6JH 2Z35A 4U6YA 2DYPB 3SKNA 3VXRA 5DRXA 1E28B 1TLKA 1KJ2B 3OV6A 5FCUL 3S35H 4QCIA 5FYJE 2PTTA 3V7AG 3VWJD 1HEZA 2UZIH 4DUWA 1U3HA 3GMOA 4HWZA 4HKXA 3FOLB 3P40A 3HUJF 2W65A 2FECI 3UTPD 1YEFL 3KR3H