4NQDD

Crystal structure of tcr-mr1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-d-ribitylaminouracil
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
200
structure length
200
Chain Sequence
b'GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVKDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title T-cell activation by transitory neo-antigens derived from distinct microbial pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdD02
3CSPA 4Q2ZB 2GYSA 3I9GH 1I7ZB 2GJ6B 32C2A 2R56H 4WUKL 3OKNB 4UQ3A 1UEYA 4ALAH 5IFJA 5EZIH 1FZMA 1YEJL 1J18A 5C7XL 4NRZA 4HWBL 4X6DB 2AERT 4I1NB 1QRKA 4NNYB 2H6PA 1CLZH 2CDGB 3LSOB 2EECA 3RZCD 3CLEH 2H1PL 4GOSA 2VMFA 3QO1B 4PP2A 2ADIB 5DJ8A 3KR3L 4PJAF 2J6EA 5ITBH 4L3EB 4WHCA 2AEPL 1Q9KB 1H8OA 1T6VN 2V7NB 3H3PH 5E6ID 4NQCD 1K2DB 1KT2A 4QRRD 4OIIH 5JHDD 3O6FA 3GSXA 2XTJC 3V6ZB 2WLYA 3IF1B 4WW2A 4JG1L 3JSSA 4JFHE 1FG2B 5HHPA 2APWA 5KSAA 5C09D 3MUY1 2APXA 3QZWA 4Y5VC 3G04A 3ZDZE 1IQDB 1J10A 1BQSA 2BY0A 3MRJA 4WUKH 4G3YL 5E7FA 1RZ8B 4MA7L 1YEJH 4NCC1 5C7XH 4HWBH 2VUOA 1W8NA 3O2DA 4H0GA 3VRJA 2GEEA 3GIVB 3C6SB 2AKRB 1T0MA 2Q20A 1GHFL 2BERA 4I0PA 2ARJQ 4QGYA 1MFEL 2H1PH 3EFFB 2XY1A 4YFLF 4LGRB 3KR3H 4EI6A 2BNRD 3BMVA 1C08B 3R8BB 4UUJA 1XF1A 2AEPH 2X6MA 5D6CA 4ZDHA 1U91B 3VRLE 2X2YA 3PL6D 4HBQA 1I75A 3N85L 1CD0A 4PR5A 2HVKB 4JG1H 4HG4J 1MSPA 3RWEA 1S5HB 2BHYA 4AIXA 2GTWB 5DJCA 1VA9A 2OXHA 1F8TL 2GJZB 1B2WL 4NN5C 4G3YH 4TUKL 3WLWC 4MA7H 5D1ZD 4Z77B 4H8WC 1GSMA 4JB9L 2G75A 3UTSB 2G5BB 4N8VA 1TCRB 4Y5VA 4OLUL 3REWA 1ETZB 3IJSA 3ROLA 1GHFH 3MGOA 1MFEH 2Y1VA 1FFRA 1Y18A 1OAZL 3DI3B 3SO3B 5CD5C 2R2EA 2GIYA 5CZXD 3SY0A 4NT6A 5C6TL 1JHTB 4NO3A 3N85H 5TDNA 1LNUA 5JDSA 2HTLC 4M6OL 1TIUA 3GMRA 4PJGB 4TVSa 1AO7A 1I85C 1M1SA 1F8TH 5KSUB 1B2WH 4WTXA 5EU6E 4TUKH 4RGOL 4H25B 5CGYD 3D0LB 4JB9H 4FQLL 3DXAB 2IF7A 4R6UA 4OLUH 4NQEE 2APFA 1UCTA 3IYLW 4LRNL 4A2MA 1UJTA 4YXHL 1OAZH 4MA8L 1KPVB 2VISB 3GB7B 2DM7A 5ITFB 5DK0B 3PNWB 3HCVA 5I1CL 1IGCL 5T1LA 2A83B 5L88L 4PLKD 4LHJB 4FTVA 4RWHA 1B4JL 4QTHA 5C6TH 3RWDA 4GW5A 5MERB 3F8UB 1G0XA 1D9KB 3AXLB 2ZUSA 1I7TA 3EW3B 2EEDA 3FL7A 4PRBA 4M6OH 1KIQA 3N1FC 3B8SA 4C83A 2D3VA 3QG7L 1UZ8A 4H5SB 1JPFA 4I48A 2YUZA 2W0FB 1SYSA 1HHIB 2H2SC 3QSKB 4PJCB 3PQYB 4HWZB 2H9GB 4X6FB 3QP3A 2IPTL 3HE6B 1JYNA 2YXFA 4RGOH 4JCMA 3S5LB 4F33A 1ED3B 1KLGB 4FQLH 3ZDXF 2WV3A 3H9SE 1EO5A 4H1LA 1LMKA 4G6FB 4LRNH 5HJ3B 2AV7B 3L3JB 4YXHH 5IEHA 4X5XB 4MA8H 3TF7C 4HLZG 5I1CH 2Q76A 3MRLB 1IGCH 4LCYA 3CFCL 5L88H 4U6XB 4Y5YB 1RIUL 2GSGB 1B4JH 1U36A 4P2RB 3BUTA 1XCQB 4GRWF 4OIBA 2V2WB 2GFBA 2ADGB 4RX4A 1BHGA 3L3OA 3O4LB 5BZDB 1TQBB 4NQSA 4G8GA 5H35A 3QG7H 4Z7WE 4P2OA 3G6JE 1SY6L 1X5LA 5CILL 1L6XA 1IM3A 2YHGA 5FCSH 2IPTH 1NPUA 3DRQA 4FG6D 2BOCB 4M6ML 1ERNA 1IJ9A 1UXWB 5F21B 2XA3A 5F9AC 3Q5OA 2IG2L 1I1AD 3C5JB 4NYLA 5IJVB 1T1XA 4OGYL 5HBBA 4Y88A 3F65A 1JPTL 4NN6B 5BXFB 3ARDB 3CFCH 5DRWA 2A74B 1QPPA 4YDLC 1RIUH 3X17A 5JR1L 4MDIB 4OCLC 4PJFB 2W60A 3RWIB 3WUWA 3VGFA 4X9GA 1WFNA 2I26N 1A1OA 2VDOL 1TZGL 2XA8L 1S9XA 1G9MC 1NCBL 5JO5B 3WFHA 1U3JA 3DUSB 2DLEA 1G7JA 1CK0L 1X5AA 3NFPB 3ARBD 4LSTL 3BQUC 2M1KA 2Y5EA 4XXCC 4HKBA 1SY6H 2NY3C 3LB6C 5CILH 2E7LC 5DLML 3WIFA 4G9FD 2M26A 4WUUD 2CQVA 3T2NL 3NOIA 4D0BB 4M6MH 2CRIA 4R97B 4EUPG 1RIVL 3HZYB 3NFNA 2IG2H 4P9HC 2QR0B 1T80A 5GGSA 1L9MA 4BKLB 4OGYH 4MJ6A 5L2KB 1JPTH 1Q94B 3O4OB 3LPWA 4OI8A 2C1PB 3KPNB 2ZUYA 3MRGA 4RFEA 4X5LA 3V2AR 5JR1H 5EG6C 4P3DB 5E9DE 1X6NA 3CX5K 3IGAA 2DTML 3M45A 4WRLA 2VDOH 1TZGH 2XA8H 5I75C 5BQ7B 1NCBH 4K3JL 3WUZA 2ARWA 2PNDA 4JPKL 2NY4B 3MO1B 4UAOC 4OZIF 1CK0H 4LSTH 3ALXA 3ZSSA 3SDXF 4LVHB 4FOMA 3VFUA 5D8JL 1QR1A 1ZWIA 1NDGB 3AB0B 1A3LL 5DLMH 3T2NH 2CXKA 3PDDA 4WTZG 3BQUA 3QQ3A 32C2B 1QFWM 1RIVH 2P8PA 4XXCA 2P8MA 4UQ3B 1FBIL 1T7WA 3PWPB 2E7LA 1E6OL 1FNGB 3ZL4L 3WIHA 3CVHL 3PP3K 3D25B 1Y0LA 3CZFA 3VH8A 3LD8C 3B6SB 4EXKA 5HHQA 1MIEL 1T20B 1YN6B 4QT5A 4NRYA 3C6LC 3S37L 1HSBA 2DTMH 5DJ8B 1XT5A 4D0CA 3I6LD 3OKOA 4K71C 4IIQC 4K3JH 1A3QA 3CH8A 2PTUA 4JPKH 5I8OL 2ZCKL 5I2IA 1KT2B 1NBYA 3UYOD 3O6FB 3RWJB 4O4YL 3TFKC 5D8JH 5DRZA 3HG1A 2ORBL 1A3LH 4NNXA 3LKSA 3UZEA 2MHAA 5KSAB 3VFTA 3QZWB 1L0XA 3G04B 4PBVC 2OSLB 3ZKMD 3MRJB 1FBIH 1BD2D 2I25N 3V6BR 3GSQB 1U3YA 1ZHKA 1E6OH 3TZVD 3ZL4H 3O11A 3TIDA 5DJAB 3VRJB 2EE3A 2BSED 3CVHH 4RNRA 1T0MB 3DO3A 1C5CL 3OJDB 1MIEH 4AEIL 4JQVC 3S37H 2HFEA 1RFDL 1YNKL 4KKLD 5FYLD 4EI6B 5DI8A 3T0ED 4UUJB 1LO3L 3V6FB 4PJDA 1TVBA 2OCFD 5D6CB 5ALCL 4ZDHB 2ZCKH 5I8OH 5DC4B 1WFOA 3OAUL 4KTDL 1XF2B 4AT6A 4IIQA 4O4YH 4PR5B 5FKPA 3HC4H 2NY6C 2ORBH 3RFZC 2IH1A 3UPRB 4E41A 2OK0L 3JTSA 5DJCB 4XB7A 2XTJB 4ODXA 3EYVA 1BZ7A 1N64L 1OAXL 5L8LB 4P2QA 2G75B 3TPUA 5BJTA 5FDWA 4Y5VB 3T3ME 2QSTA 2VDPL 1PQZA 3IJSB 3ROLB 3FOLA 4LRIC 1C5CH 3FB7A 4AEIH 2NTFA 1LE9A 4WU5A 1Y18B 1C1EL 1RFDH 5E2UL 1YNKH 1N3NA 4L9DA 3GSNL 4GKZB 3CFIC 4TNWF 1LO3H 1OOAA 2MCPL 3SY0B 5ALCH 5CCKL 4KTDH 3OAUH 5HI4D 3KLHC 4NO3B 5BS0D 2X4NA 2MTPA 4L1DA 3SJVD 4M43L 2W1NA 5TDNB 4PJHB 5HHOE 5JDSB 4XHJC 4JKKA 3GMRB 2FGZA 1JUFA 4QWWD 4LIQE 2OK0H 1AO7B 1QRND 1OTTC 1FYTD 4OZGF 1QA9B 1WBZA 4HAFA 4X80L 3DGGB 4OLZL 1B0WA 2NX5B 3KG5A 4N1EA 2WINA 4YUEL 1N64H 3BPLC 1OAXH 4Q6IA 3HAEA 3VWKA 1HHJB 1UKTA 3M1BA 2ZUQC 3QDGD 4ELME 2VDPH 3V5KA 1MVUA 4NN5B 5LQBL 1C1EH 4LHUD 3HNTL 1IRAY 4KKAC 3HCVB 4PLJC 5E2UH 5EO0B 3T77A 5IB2A 3OZ9L 3GSNH 3CCHA 5DJ6A 3VGBA 4FTVB 4ZOEA 2D7TL 2BRRL 2MCPH 4LRIA 5CCKH 4GW5B 4PGJA 4Y89A 5HD8C 4U6HA 4HKJA 5JHLL 4M43H 1I7TB 4M7LT 4YDVA 2X40A 4PRBB 3SBWC 4JGUA 5KANG 1UZ8B 4KJWC 1JPFB 3S96A 2EXWC 2ZNWA 1SYSB 4X80H 2Y4SA 1A14L 4OLZH 4YUEH 3L5WA 3QXTA 4E5XA 1ACYL 4OKDA 4F33B 4H1LB 5E1AB 1FN4A 3KPLA 3STZA 2FIKA 1BFOA 5LQBH 5IEHB 5ILTL 4MZ3A 2RIKA 43C9A 3HNTH 4GSDL 4Y7MA 4ZYKA 5DRNB 3OZ9H 2YD7A 1EDQA 2Y06L 1OP9A 2I9TA 4M1CC 3K81A 2D7TH 2BRRH 2ITDB 1F3DH 1FAIL 3UTPE 3MV9B 2B8OT 5DSCB 4EIZC 1CFNA 2GFBB 2ZUVA 4U6TA 5JHLH 4LGPB 3HUJA 3L3OB 2DWEA 2LAAA 4OQ1A 4XNMA 4F9PC 2IWGA 4NQSB 4G8GB 5SX5H 3QPQC 4R4ND 1EAJA 3ULUE 4PJAE 1JYWA 5C0EA 4WY7H 3B83A 3RTQC 4NWTL 1IM3B 4PUBL 1A14H 3DRQB 2ITCA 1ACYH 3SBWA 1MCFA 4JN1L 3WD5L 5HYQA 5GRWA 2UY6A 1CBVL 3GBML 4NYLB 2FWOA 1HHHA 4FQ1L 1N5YL 1T1XB 4MCYA 5I1EL 3RHWF 5ILTH 4GSDH 5F7LB 5DFWH 1HCVA 3TVMC 5DRWB 2Y06H 3NPSB 4JFFD 4Z7NF 4HWNA 2W60B 3S35X 1FAIH 3WUWB 4NKDB 1MI5A 2N7BA 1A1OB 1EUUA 5FM8A 3QDAA 3VGAB 1JNHA 3IKCA 1G7JB 2WBJD 4XPTL 5D5MF 3GRWL 1J0YA 1JGDA 2GCYA 4NWTH 5ACLA 4PUBH 5BVJA 2XG5A 4F9PA 4JN1H 3WD5H 1F4YL 2CKBB 4GKNA 2WWKO 3NFNB 1D6VL 1CBVH 3RTQA 5L6YL 5GGSB 3GBMH 2DQUL 5IEKB 4FQ1H 4V1DE 5DJ2A 5BZWA 1N5YH 4HUMB 5FA3A 1LQSR 1EMTL 5I1EH 3D39A 2I07A 3OXSA 1HSAA 2FCBA 2LABA 4DGVL 4JO1L 1AGFB 5DD5L 5ESQA 3IGAB 4OFVA 3RWFA 4M3JA 3A67L 4J4PC 3TVMA 3MRIA 1ZLUK 3D0VA 4YDLB 2VXQL 1AD9A 4HMEA 4M93C 4XPTH 2XZAL 2J8UF 2ZPKL 3VFUB 2VQTA 2YZ8A 1ZWIB 3BPNC 2VLJD 1QR1B 1SVZA 1F4YH 3N1PC 3BQUB 1V5JA 5GZOC 4FFYL 2P8PB 3KLAA 2P8MB 1D6VH 1YEDA 2NY3B 5L6YH 5C0AB 2DQUH 3ZE2F 3JV4A 4MQSB 4JGMA 1EMTH 3SKNB 5C08E 4QXWA 4DGVH 1Y6NR 1YEGH 1Y0LB 1IGTA 3CZFB 4JO1H 4DN4L 3VH8B 4WO4D 5IBUG 4ENED 3D3VA 5MENA 3W11D 4QT5B 4NRYB 2PR4L 3HRZA 1HSBB 1R5IA 4KRPD 4EI5C 3OKOB 3A67H 3KPMA 1GJIA 1CU4L 4OV5A 4LKCA 3OG4B 1DUZA 1AGCB 4JFDD 3MZGB 2VXQH 3VXQB 2GTZA 5I2IB 1ORQA 1NGXB 4OF6A 2XZAH 4J4PA 2ZPKH 1VFUA 4HW6A 3HG1B 4UAOB 5C9JA 5GRUL 4NNXB 1WUNT 1RZKL 1P5UA 4U31A 3VGGA 3VFTB 2ICEA 5DTFA 3BAEL 4FFYH 5DMGD 4JRYA 2Y7QA 3BT2L 1ZHKB 3W9DA 5KVFL 3O11B 1AQDA 4FMFA 4Y2DC 1RUML 1FV1A 1ZHBA 4RNRB 1FSKC 4DN4H 4XI5D 4KFZC 4GRMA 3ZDXE 2PR4H 5TE4L 5F3BB 2Y6SC 1CU4H 4DKFL 4XWOD 3SPVA 4PJDB 4OGXL 3LD8B 1TVBB 3GMPA 3EYQC 2PYFA 4WHYG 3C6LB 2P42B 4K71B 4AT6B 4GXVL 4D8PB 4EI5A 4IIQB 3ARTA 3JUYA 2IH1B 2D03L 5GRUH 1RZKH 4MD5A 4GRWE 5FGSA 1KOAA 2R2BA 3JTSB 1KCVL 5SX4H 4Q9RL 3BAEH 3VFMA 1QPXA 4XRCA 4ODXB 2GY5A 2VITA 3EYVB 3E6FB 3JWOC 1CXFA 3BT2H 1PX3A 4XP6L 2Z91A 4KTYA 4P2QB 5KVFH 3X3GL 4POZD 3TPUB 4J2XA 1AH1A 4OM1L 5DHVH 1RUMH 5BJTB 5FDWB 1PQZB 5I1DB 1A7RL 3P3YA 3FOLB 2XIDA 5DD1L 2A6JB 3H9HA 4NQEB 5ISZA 3T65B 2NLJA 3FB7B 2NTFB 1LE9B 4WU5B 2J12B 4Z7OF 3OAZK 3QDJB 1N3NB 4Y2DA 3LZFL 4DKFH 4NFBA 2A6KA 4TSBL 1BF2A 4GUPA 3V4VL 4PRPE 4OGXH 1GZPA 4NSKB 1F4HA 4XP5L 4PS4L 4GH7B 4GXVH 3CGTA 1NEZA 2H2PD 3K74B 1U92A 2D03H 4OIAA 1JUFB 5DUML 1HNFA 4Q9RH 1KCVH 1DANU 1OF2B 2DS4A 1KGCD 1WBZB 4NC2B 4Y16C 5HVGB 4POUB 2WINB 1X5HA 1X4ZA 2NY6B 3EJJX 4XP6H 3HMXA 3HAEB 3G5YA 1MAML 3EYSL 3X3GH 4MXQD 2OM5A 4OM1H 1A22B 3V5KB 3WEXA 1MVUB 1A7RH 1KC5L 5DD1H 3I75A 1D5BA 4FFZL 4ONHB 4QRTA 3GSRA 1J0IA 3R1GL 3T77B 4D0DB 5IB2B 3LZFH 4BK5A 3VD5A 1OB1A 4TSBH 5DJ6B 2MFNA 4QHMA 3B5TA 3V4VH 4MNGA 3V7AG 3O6LL 1F3DJ 3FQNA 4LLYA 4XP5H 3V7AE 1INDL 1ZS8B 1UWXH 5FYJE 3W39B 5IOPA 2JJTC 4YDVB 4DGIL 5HGBA 4LMQI 4DVBA 1GVIA 5DUMH 2F9BT 3S96B 3T4AA 4LDLB 3K8KA 4BSJA 2XN9D 2YRZA 5HI3D 1N0LA 1W72A 1MFDL 4ERSL 2NZ9C 1MAMH 3EYSH 3SDXE 1QO3B 2ZCHL 3QEQE 1FN4B 4Y16A 1T2QL 3KPLB 1KC5H 2X9YA 3WBDA 4FFZH 4ZYKB 3GI9L 4KI5D 1A6WL 1M4KA 4CGTA 1SJVA 3O6LH 5D93B 3AMLA 5HHME 5AEAA 5I9QB 4WU7A 4A6YA 3P4OB 3MGAA 1INDH 5CKGA 4W6XB 1EHAA 4QEGA 4B5EA 1CFNB 4GQ9L 4HS3B 3HUJB 1FL6A 2OL3L 4DGIH 5IKCA 1SMOA 1ES0A 4OD3L 4I5BA 4WHTA 2QHRL 4KROD 2A77L 1F4XL 2EIBA 2JJTA 4MHHI 1GH7A 2ITCB 1MFDH 4ERSH 4LNVA 5HYQB 3UTTD 2AJXL 4LLDA 2ZCHH 5IW6A 4MAYD 4U1JB 1T2QH 3FN0L 4PY8J 5E2JA 3MLZL 5E1HB 3GI9H 1DBAL 1A6WH 3W0WD 3Q3GA 5FGCE 1BPVA 1JNJA 4IM8A 2FH8A 1I9RL 4RFNC 5HDLA 4XPGL 2C26A 4PY8I 4GQ9H 2HVJA 4KK9C 2E7HA 3WNMA 1JNHB 2D4DA 2OL3H 3IKCB 3QUXC 4G6JL 4XC3L 1GOFA 3KAAA 1DLHA 4OD3H 1RUQL 4U7KA 4C57C 2QHRH 3R06A 4N9GA 2GCYB 2A77H 1F4XH 2EE9A 5BVJB 1DVFD 1FNHA 2AJXH 4GKNB 3EYUL 3LRSA 1LO4L 3DUHA 1RJLA 2F53D 3RTQB 4K8RL 2GK0A 3DYOA 5DJ2B 5T3XD 3FN0H 3ZHLA 4AEHL 1S7SB 2I07B 4DZ8A 3OXSB 1HSAB 3MLZH 1NFDF 1DBAH 2VZ1A 5ESQB 1MWAL 4HWEL 3UTQA 2P49B 3RWFB 1I9RH 4DAGL 4ZXBC 3ARED 1JVKA 5KTEL 4XPGH 3TVMB 3MRIB 3D0VB 3ILQC 4JRWA 5L2JA 5K9QG 5I16B 2P5ED 1AD9B 4EN3C 3BP5A 4G6JH 4XC3H 3P40A 1RUQH 4FFWC 2YPLE 1QACA 4CVXA 2LVCA 1U8NA 3ULSA 4NBZB 4YHML 3QUXA 2VLLA 3QRGL 3AS0A 4WFEE 3EYUH 3KLAB 1EEYA 1HQRA 2HJKA 1LO4H 1YEDB 4V2CB 3CSGA 4K8RH 3T1FB 4AEHH 3JV4B 4NZDA 1T6WA 2X4QA 5EO1A 5INDA 1LEIA 4OZGE 2VZUA 1IGTB 1OP3H 3UZQA 4RBPH 3D3VB 5MENB 1MWAH 4HWEH 1T5XB 3HRZB 2VYRE 3KPMB 4DAGH 3PV7A 5KTEH 4OV5B 12E8L 4LKCB 1CGVA 3FT4A 3CMOL 1CDHA 4PB0L 4HPYL 3VXRE 2NY0D 1K3IA 2GTZB 2F74A 5D7LA 1FCCA 4LPWA 1GC1C 4ZXBA 3T08A 1VB9A 3NZ8A 4QRUA 2X09A 4HGKC 4PJBA 4YHMH 4EN3A 5C70A 3QRGH 4M93B 4Y19E 3FTGA 5DTFB 4QHLB 2HG5A 5HY9A 4YFDB 1INQB 3QQNA 1CGXA 3BPNB 5JXED 1AQDB 4MWFB 2WUBL 2PW1A 5A3IC 1ZHBB 3MUGA 3MCLL 4GRMB 3AU1A 2JCCF 2F54A 5D7IF 3OKLB 2DBJA 4RMSA 12E8H 2DMBA 3SPVB 4JM2D 4RAVA 3HPJA 4F2MA 3CMOH 4PB0H 4HPYH 3GMPB 4O02L 2PYFB 2OYPA 5AYUL 4ZODA 3ZE1F 5T3XL 3HR5A 3PGCB 4EI5B 1ZGLP 1WQVT 1EXUA 3ARFB 3VXMA 4UT7L 1DQJB 2A73A 5AAWA 2R2BB 3RJDA 2RQ8A 3VFMB 1F13A 4XRCB 3W82A 1SJEA 5IT2L 4L4JA 2VITB 2PCPA 1EEZB 4PGCA 2Z91B 4XCCL 1DE4A 2X7LA 4HMCA 1B0GB 2WUBH 2ZSVA 1F90L 4LCWD 2XYCA 5ISZB 3H9HB 4MB3A 4JFQB 3MCLH 2NLJB 2FJHB 3FONA 5B39G 1NGPH 3O3EA 4HS6B 4QRPD 4CDGC 3HN3A 4Y2DB 3TNMA 1R6VA 3ZDYF 2DJ4A 2A6KB 1FSKB 4GUPB 1VERA 2VDNL 4O02H 3MLWL 1X44A 5AYUH 2C4XA 2R9HD 4HJ0D 5T3XH 5H2BA 1U8MA 1ZLSL 4Z7NE 1NEZB 4UT7H 2GUOA 1U92B 3QH3B 2UV3A 3EJYD 2BC4A 1H3PL 5SWSA 2XPGA 4I8DA 4LCCC 5IT2H 5IW1A 2IAND 5KS9F 1NANH 3T0AA 2X42A 2YPVL 3MA7A 4XCCH 3G5YB 3BW9A 1TPXC 2ZSWA 3F7YA 2DQEL 1PKQE 1F90H 5C0DA 1OW0C 5DEGA 2VL5A 1QUNA 2IQ9L 3I75B 1BFSA 3EDFA 2IBBA 4QRTB 3KLDA 3GSRB 5KJRL 1OB1B 4OFDA 4QHMB 3KXFA 2R2HA 1X5GA 2VDNH 3MLWH 3PWUA 4JRXE 3FQNB 2VAAA 4LLYB 2COQA 1S7XB 2GK2A 2IAMA 5C0CA 4JFYA 4Y4HB 1ZLSH 2Q6WA 4X9IA 4E41E 2CLVA 4IRJC 4J12A 5IOPB 4XZUB 5EUOF 1CG9A 4OZHA 1T66D 3HMWL 4GW1B 2R1WA 3T4AB 1RK1A 1NCCL 1YYML 5I18L 1H3PH 1OL0A 1VCAA 1I9EA 1IFHL 1W72B 3RDTD 2WP3T 2YPVH 4FP8L 3KPSD 3RPIA 2DQEH 4ZTOL 4C4KT 2HAZA 4HEPG 3W81A 4LCCA 4HCRL 2IQ9H 1NMAL 3BI9X 5BO1L 5KJRH 3ULVL 4OFYA 5LXGL 1OW0A 1LEGA 1FPTL 2HKHL 4J3UA 4HH8A 1JPSL 3FHAA 2DYPD 5AAMA 1IARB 2CDEA 4WU7B 4A6YB 4QOKA 4N0FA 2JTDA 3QJHA 5IGXL 1FL6B 2CO7B 3HE7C 4N5EC 43CAA 1DSFL 4IRSC 5IKCB 1FDLL 1A7BA 1D5XA 1ES0B 3OXRA 3HMWH 3JWNC 1JTPA 4I5BB 2AGJL 4WHTB 2YPKA 4MNQE 1NCCH 1YYMH 5D7JD 5I18H 4IRJA 4XCEA 3MLXL 3H42L 1IFHH 3DIFA 5TH2B 1EIBA 4FP8H 4ONFL 1UGNA 4MJIA 4LLDB 4ZTOH 3P9LA 1QSFD 2VKXA 5CD3A 5HYJA 2F19L 4HCRH 1NMAH 5CP3H 5EBGA 4V1DB 4P5TC 5DD0L 5BO1H 4ODBD 3ULVH 5LXGH 2RBLA 1FPTH 2HKHH 3Q3GB 2Y9RT 5KZCB 4P5MA 1JPSH 4NCC2 2C7UA 1RVFL 3VXSD 4UV7L 3KPRE 1E4JA 1J87A 4ZS6D 5M94B 3N06B 5IGXH 1YMMD 1DSFH 5A43C 1FDLH 3MC0A 5E2VL 4KQ3L 1DLHB 2HRPL 4P99A 4RGNE 2LQRA 2AGJH 2AABL 3P0YL 1I7RA 3MV8D 3LCYA 3MLXH 3H42H 1SBBA 5A16A 3HE7A 3BHBA 1ULVA 5ERWB 3TO4D 4IRSA 4OI7A 1KB5A 4ONFH 1PY9A 4WEUD 2FYYA 3P30L 4BELD 2A38A 1YZZA 1RJLB 4U33A 2ICWB 1FH5L 2F19H 2GK0B 4P2YA 1JTTA 4U0QB 1ZLVK 4CJ0A 1BWMA 4DZ8B 2H3NA 1FC1A 1T1WA 3KPQA 5DD0H 3QWQB 3BH9A 5E2TL 4DWHA 5GGRA 2KL6A 4X98A 2YUWA 1PAMA 2X1PA 3V6OC 5GS0D 3AGVA 2DIJA 2P46B 4NZRL 2AK1H 5J3HC 1U41A 3UTQB 1U2HA 5IBUB 3MJ9L 1RVFH 4IMLA 4P5TA 3VFWA 4UV7H 4DUXA 1CT8B 5TDPA 4PJ9D 1KTRL 4LASL 5GS2H 4Z7OE 3BP5B 5E2VH 4KQ3H 5EOTA 2HRPH 3WNPA 2AABH 3JWDL 3P0YH 1U8NB 3ULSB 5SWZD 3U46A 4ZFGL 2VLLB 1A6AB 4F3FA 3IFOB 4XWGL 4XAKD 1HQRB 3P30H 4OCNC 1FH5H 3QDMB 4ZUTB 4CU7A 4D9RE 1JGEA 4JG0L 1A1NA 4PGDA 4HWBA 5ANMA 5EO1B 5INDB 3QCVL 1LEIB 3GJFB 5E2TH 2VKWA 1G9NC 4KAQL 1MI5E 4GRLD 3DHMA 3VA6A 2QBWA 4NZRH 4X7CC 4JZOA 4ESKA 3MJ9H 2ESVD 3FT4B 2WW8A 3ZLQC 5JMOC 3K7UA 4LASH 1T1YA 2DI9A 2F74B 2FNBA 4RA3A 3V6OA 1Z2KA 5L8JB 2NYYD 4M03A 4NC1E 4ZXBB 4YXLL 2CK0L 1NC4D 3NZ8B 3JWDH 1DN0B 4K07A 4UV4L 3O2DL 4QRUB 4TNVK 4ZFGH 4PJBB 3QFJD 4EN3B 5DGRA 3FTGB 4XWGH 1MLBA 3D39E 3GZKA 2QJDA 4OCXL 4PTUA 1QSED 1T3FA 4PJ7F 4JG0H 4KUCF 1CDYA 3QCVH 3H3KA 2PW1B 1J8HD 4KAQH 4XPAL 3AU1B 2F54B 2VSDA 4XVTL 3DVGA 1T83C 2MWCA 2BVYA 3W9EB 4F2MB 1T5WA 4KC3B 1MY7A 2YEZA 3AAZA 4XNUL 1FL5A 3CSYA 3RZCC 2VIRB 5F96L 4JY5L 4YXLH 1EXUB 2CK0H 3UXFA 3CDGA 3SEPA 4UV4H 2VR4A 3O2DH 4YPGB 4PJXF 3F58L 1L9NA 2BNQA 4PBXA 1AKJD 5E6IC 3CVIL 4OLYL 3FRUA 2R1YA 1CGUA 1DUYB 4LU5L 3VMOA 2PCPB 3QYCA 2ICES 2WNGA 4OCXH 4POYA 1DE4B 2X7LB 3VXTB 4TUOA 3VFSA 4L3CB 1T04B 2ZSVB 2A6IA 5D5MA 1N6QL 2WM0A 4YLQT 3FONB 4XPAH 1SYVA 3QUZD 4F37K 3LVEA 3MRNA 1NANI 4G8IA 4XVTH 1L6ZA 3TNMB 3RY4A 4IOFD 1I1RA 4ZMAT 4LNRB 1YC7A 3GUTA 3FT3B 3VXNA 5F7DA 5F96H 1U8MB 4JY5H 5H2BB 1NAKL 1T83A 4Y1AE 2GUOB 1WC7A 1KTLA 3BUYB 3F58H 3U79A 2AXHA 4JVWA 3JTTA 4JRYE 3CVIH 4P0DA 4OLYH 3T4YA 3S4SA 1KYOJ 2BC4B 2KKQA 5SWSB 4XHQA 4LU5H 5IW1B 7FABL 3OR6A 1BGXL 3X11A 4OZIB 3MA7B 3WXWL 3BW9B 2D9QB 1WCBA 3KDMA 3QQ4A 2IEPA 2ZSWB 3F7YB 1M7IA 5E6IA 3BFOA 5C0DB 4MMXC 4NQCA 1N6QH 4YDIL 3V5HA 4FNLL 1I7UB 5D1ZC 2CH8A 1XIWD 1BLNB 2ENYA 5C09A 3RVVD 5HI5D 2R2HB 3I3EA 5EBLA 3PWUB 5F3HA 2WZPD 2VAAB 1NFDE 3F7VA 2NXZD 4NZJA 3RUGF 5C0CB 1NAKH 4JFYB 4ZO7A 2CLVB 3QO0A 3RU8L 1IM9B 1CG9B 5CZXC 3VXUE 2ZG1A 4OZHB 1F00I 2AQ3A 2CKNA 4ODVL 2R1WB 1RK1B 7FABH 2BNRA 1BGXH 4J3TA 1I9IL 3WXWH 4M48L 2VQUA 4XCNA 3RPIB 1BOYA 1IAOA 1YMHB 3U4BL 6FABL 4JFHD 3TBWA 4BFEA 4M5ZL 4AK1A 4LCCB 1BF8A 2YD3A 4M8VA 4YDIH 2N56A 1TPXB 4FNLH 5CGYC 2X1OA 3AFLA 4OT1L 4MVBD 1LEGB 4AQ1B 2EDTA 2A9ML 2ADJA 4HT1L 4QCIA 2CDEB 4MJ2A 2ATKA 5D1ZA 3SE3C 2EEAA 3O3UN 3RU8H 2EC9T 3QJHB 2CRZA 3BESR 4PLKC 1QTYT 4QGTA 43CAB 4H1LH 2DI7A 1IAKB 3OXRB 1LHZA 4ODVH 5GISL 5J13C 1MCRA 3BGAA 5AG8A 5HTSA 4XCEB 1VKXA 5K9OA 3F6IA 4L1HA 3DIFB 1K8IA 1I9IH 3RL1B 3TNNA 4M48H 3O0RL 4MJIB 3IAGC 1FCGA 1WBXB 2DMKA 2H41A 4QHKJ 4WVRA 4OD1L 3U4BH 5A2KH 1P7HL 3T04D 3P9LB 6FABH 5CD3B 4GBXD 4M5ZH 5HYJB 2G2RA 4U1SA 1P7KA 1C5BL 3MQIA 2OXGA 2DAVA 3LN9A 1GOHA 4MNGE 5C0BB 4ONGL 3GDBA 4OT1H 4QHKI 3T2OA 2X89D 2K9UA 4P5MB 2A9MH 4JQIL 4HT1H 2C7UB 3BRDA 2XNAA 1HHKA 1QLRB 3VU2A 4DOHE 3IXAB 2CKBL 2JCCE 5D7IE 1WWBX 1X4YA 2NW3B 4PY7A 3S36L 1MFAL 3SE3A 5GISH 4JHBA 3G08A 2AEQL 1I7RB 3FFCE 2HT2D 3HE7B 3ZE1E 4IRSB 3O0RH 1KB5B 2JJVA 3EJZD 5HXMA 4OD1H 3WS6A 2FYYB 1T7ZA 3MLRL 4HUWA 4LLWA 1IAMA 1NUFA 3SOBL 2H3NB 5EU6D 1T1WB 4FG6C 3BH9B 4ONGH 2VXVL 3RQ3A 5GGRB 4X98B 1I1AC 4JQIH 1G9ML 4PRIB 1XF5A 3MUZ1 4IMLB 1BVKA 4P5TB 4QO1A 3UPCA 3VFWB 2Q7YB 2XXCB 3QDGE 5TDPB 4G7VL 2V6HA 1J05A 2EDWA 1F3RB 2BNUA 1AHWC 2CKBH 2UZXB 4LHUG 5EOTB 4YHYC 4MD4A 2GSIA 3S36H 1MFAH 3HNVL 2AEQH 4CVUA 3WIHL 3U46B 1F02I 2X1QA 2IH3B 3MRPA 4P9HL 2Z92A 3T8XA 3ARBC 4IMKC 4Y19B 3MLRH 4OUOA 4CMHB 2NNAA 2M8XA 3SOBH 1BJMA 5BOPA 2NXYD 3PV6A 5EFIA 1JGEB 1A1NB 2GITB 3OWEA 4PGDB 5ANMB 2AJZA 2FHCA 2VXVH 5IK3A 5F72S 5KS9E 2WQRA 3FB5A 1X7QA 3H9SD 5T5FL 1U8OA 1TDQA 1G9MH 3ECBB 5D72L 4JZOB 1R24B 5FF6A 1URLA 3T0XA 3U1SL 5CEZE 2N1KA 4G7VH 1TNNA 4JM2F 2ED9A 1IGYA 1T1YB 5EO9B 5EU5A 5F9JB 3CUPA 4UDUB 2DQCL 5I1AA 3HNVH 3L3IA 1PDKA 2UWEA 2E6JA 3WIHH 1JHKL 4P9HH 2GW5A 5IBTL 1NFIA 3O9WB 1MLBB 5EUOE 2EDEA 2C3HA 4PJIF 1MHPL 5AD0A 2ZWLT 4ZG1A 2R4SL 1QBBA 3ARBA 4IMKA 2VNCA 5SWQA 2MKLC 3LHPL 5T5FH 1S7WA 1G1YA 2AJVL 1TVDA 4NQXA 5D72H 3DVGB 4WUUA 4TYUA 4HJJL 2L0DA 3U1SH 1T5WB 5F9WC 2YEZB 5LVEA 3ZE0F 4L4VE 1VEOA 3QJFB 1V7NL 3AAZB 1B0RA 1NJ9A 1FL5B 5JDJA 2DBLL 3LH2L 2DQCH 3TGXA 5F7NC 3CDGB 1CIDA 1LP9A 5GIRA 2DDQL 3ARGD 2HKFL 3VFNA 1JPGB 1JHKH 2EZ0C 5IBTH 3FRUB 5DK2A 2R1YB 1RMFL 4XH2A 2IBZY 1MHPH 4JLRB 4TUOB 2R4SH 3RKDD 4LPTA 1EAPA 2PYEE 5D5MB 3NPZB 1V8HA 4WHDA 3WKNA 3LKOB 3LHPH 3ZKMC 4C56E 1KLUA 2AJVH 1KB9J 1KN4L 4G8IB 3TZVC 1Q9OB 4HJJH 4DEPC 3U7YL 3QXDB 5C3LD 1S8DA 1V7NH 3GUTB 4KGLA 3VXNB 2DBLH 5F7DB 3CH1B 3LH2H 5E9DD 4WW1B 3WFBL 1DP0A 1RU9L 3T0EC 1KTLB 3DARA 2MKWA 2DDQH 1U2CA 2HKFH 3RZCB 1KG0A 1HOCA 1PW3A 3JTTB 3T4YB 3S4SB 3QI9C 1RMFH 4CL7A 1OVZA 2X1XR 3V52L 3X11B 4YHIA 1WCBB 3KDMB 3QQ4B 3IDYC 1NDMA 2AK4A 2Y07L 1M7IB 1U58B 5E6IB 2J8UB 4NQCB 4QRRB 5JHDB 3KJ4B 5D70L 1VFBA 3V5HB 3PDGA 2V5SA 1KN4H 1UH4A 4NGHL 3QQ9D 4BFGA 5C09B 3LN4A 5EBLB 3HKFA 3U7YH 4KRMB 1YPZA 5F3HB 4W6WB 3VXME 3BIKA 1BD2A 3HI1A 3F7VB 3X13B 3TZVA 1CFSA 1WITA 3QO0B 4WENB 3HAEH 3WFBH 1RU9H 1N26A 4Z7VA 1X5JA 5E8PA 4G6KL 1RD6A 1A7PL 2BVPA 3E3QE 2BNRB 2VLME 5DVMA 3V52H 5JOFB 3T0EA 3C60D 2DKUA 2R69L 4XCNB 3GMNA 5BRZE 2Y07H 5H37G 1UEMA 4S2SA 3TBWB 3QI9A 4MX7A 3PL6B 4U1IA 1D5ZA 5D70H 4WTWA 3SGDI 1PGRB 3WNKA 3B2VH 3D2UD 1UJ3C 1MCJA 4NGHH 2HT3D 2DB8A 1I8KA 4U3XA 4H0IA 3NIDF 4QCIB 5JOEA 1HH6B 1T7YA 1DLFL 2ATKB 5D1ZB 2BX5A 4I0KA 2F5AL 3ARRA 1T7VA 4DGYL 4D9QE 3EOBA 5F6IC 1DEEB 1V3KA 1TTFA 4PD4K 1AFVL 3B2UD 3RNKA 3PWLA 4G6KH 2OMBA 1A7PH 4ODHL 1CXIA 4XB8A 2V2TB 1B6UA 4X9HA 1VKXB 5K9OB 1K8IB 1WAAE 2R69H 1FNAA 2F15A 4UIMA 3UYPA 1YY9D 3MJ8A 2RB8A 5BS0A 5F93C 5CEYA 4FMKA 3SJVA 4FHBD 4U1SB 1P7KB 5D2LF 1U93B 1LO0L 1KN2L 3KXFE 1J1OL 3MCKA 4X6CA 4RFOL 4HKXA 4MQ7A 1QRNA 3MR9B 5HHVL 1FYTA 2YWYA 2ZOLA 5FYKE 4PJ7E 4YC2C 4YEFA 3TJHD 2R0WL 2F8OA 4OZFG 3O3AB 1FNSL 1CFTB 1DLFH 1UJ3A 2XXMB 1HHKB 2F5AH 1QBAA 2I9LA 4DGYH 3QHZL 5HVHC 1AFVH 4BZ1L 3AUVA 4DUVA 4ODHH 4F58L 3G08B 1S7VA 2FEDD 4EUPH 1U8KA 3D87B 3UDWC 1MUJA 4GG6F 4N5UA 1ZVSB 5HHOD 2CJUL 1D5IL 5J13B 1RHHA 4HUWB 1IEAA 4HC1L 5IVXE 4PJXE 1SVCP 4KV5F 4P23D 3WDHA 1LD9A 1FQ9C 5DVKA 3MRKA 5K9KA 1LO0H 1KN2H 5I17A 1J1OH 4RFOH 1A2YA 3PXHA 1E27A 1A3RL 5F7UA 1KGCE 4Z7UA 5HHVH 4QOKE 3FN3A 2PF6A 2R0WH 3RI5K 1FNSH 2VZOA 1BVKB 2B5IC 3BYTA 4O58L 4F15C 5JZ7D 4AH2B 1J05B 3LY6A 3QHZH 2BNUB 5EN2B 1RZKC 2YD2A 4BZ1H 4MD4B 2GSIB 2VLRE 5IMKB 1T7XA 4F58H 2CR3A 1WZLA 4LOUD 5DJZA 4YAQA 2CJUH 1D5IH 2WBJC 4AEFA 1NCNA 1B4RA 2EO9A 4HC1H 3DGCR 2NNAB 2DQJL 1TVHA 1S7UA 3PV6B 5EFIB 3UDWA 1EBPA 3JV6A 2IFFL 5I1IL 4HK0A 4F7CA 3SHSA 2AJZB 2J2ZA 2YD9A 1SEBA 3BEVA 5IK3B 4L4TE 1A3RH 1RZIA 4QYOB 3JV5A 3FB5B 1X7QB 4LSPL 1U8OB 4Q7DA 5EU7C 1OGAA 4BZ2L 5FF6B 4DKDC 5LGKA 2GT9A 4CVWA 4O58H 3T0BA 3WO4C 3SGKA 5CWSB 1IGYB 5J1SC 1I1AB 5EU5B 3KHOA 3SDDD 5E6YA 3OX8B 5K93A 3DLQR 5I1AB 4NHCL 5LAXA 3UTPD 2UWEB 1TQCC 2PTTA 1E4KC 1AHWB 4JFFA 3R4DA 4BFIA 3RUGE 4HUXA 2ZJSL 2FBOJ 3VD7A 2UUDK 3B8YA 3HNSL 4K3HA 3L7FA 2HMID 4WFGE 3HHRB 3U9PL 3PHOA 2DQJH 3WS3A 4F7MA 4DUWA 5F1SA 5I1IH 3O8XD 4AMKL 5AD0B 2IFFH 5E95B 3RBGA 3ARSA 3ARBB 2WBJA 2Q8BL 4OFKA 3S7GA 4D3CL 1JK8A 2X70A 2EYSB 5DT1L 4LSPH 1S7WB 1U8PA 5T1KD 5MEOA 4NQXB 3GNML 4BZ2H 4G9FB 4WUUB 5J7CC 1YNTA 3BP6A 4PTTA 2AJYL 4ZSOA 1B0RB 1NJ9B 4WO4C 1MQKL 4X7TA 3OKEA 2HLFD 1U3HD 1FVEA 1HI6A 4PRHE 4KRPC 4NHCH 2XKNA 1LP9B 1RV6X 1LK2A 4JO3L 5EB9A 5CBEA 3S6CA 2BCKA 4RMUA 5JA8B 3OKKB 2VDRL 4GG8A 4I3SL 5HDBF 2ZJSH 4Z7QF 3HNSH 1PZ5A 5DK2B 1HWHB 4XH2B 4QTIL 4KJQD 4QNPF 4M62L 4GO6B 3U0PB 3U9PH 3EGSB 1E4KA 4AMKH 1L4IA 1NGWB 4I4WA 1EAPB 1R3KA 1A4JA 2VUYA 1FVDA 3DX7A 2Q8BH 1MJUL 4D3CH 3NAAL 5JW5A 1YDPB 5DMGC 5DT1H 1KLUB 3GNMH 2QQQA 4OCWL 3VA2C 5HYSA 5F70A 5DHYA 1KJVA 4YNYA 3LKRA 1EFXA 2NY5C 2AJYH 1SHMA 2F58L 2G9HB 2XTLA 1MQKH 3PJSA 1LK3L 1PG7L 1NCUA 4MA3A 1ZE3C 5FOBB 1EFQA 3LPFA 3HMXL 1JYVA 4N0CD 5F9WB 4JO3H 5JTWA 4WO4A 3BP7A 2VDRH 4I3SH 1AI1L 4PRDA 4O2FB 4DKAA 3NCFB 1JF6A 3UTZA 1FGNL 1KBGL 2Y36L 3J8F7 4PIRF 4R2GD 1DR9A 2XICA 4QTIH 5D2NC 5I8EA 4M62H 1UQSB 1BZ9A 1YY8A 4L8BA 5I0DA 3K1KC 4JFDA 4PJEF 2VXSL 1YEFL 3T0VA 5DZNA 1RZFL 3VGEA 4YXKL 5HYFA 2UVFA 3KWWB 1MJUH 1VFBB 2B1HL 3NAAH 1C5DA 3OKMA 3S98A 1QVOB 5IESL 1DANT 2AJ3A 3ZDZF 4MXVF 4OCWH 3SE8L 5BMFL 4POZC 3IDGB 1L0QA 3MNWA 1R3LA 1NH6A 3LN4B 5C08D 3DHJA 1I3GL 1YPZB 2F58H 4XNZB 4ZFZA 1YYLL 1LK3H 1BD2B 1N4XL 1J88A 1PG7H 3HI1B 2FHBA 3BIKB 4FZEL 4RMQA 3TZVB 3HMXH 4LLMA 1FYHB 2BNQE 4DEPB 2BVOB 5F8QC 1BJ1H 3J7HA 4O2CA 3UAJD 3TBYA 3HR6A 1AI1H 1CXKA 2DQIL 2PXYD 3IDIA 1FGNH 1KBGH 2BVPB 2Y36H 2BHUA 4JPIB 1RIHL 4LGSB 2A0LD 3L1OL 3T0EB 2ARJA 4IHOA 3GMNB 2BK8A 2OJZL 1HILA 4NBYB 3QUYD 3BX7C 2VXSH 1YEFH 1GGUA 4K7PX 1RZFH 1P2CA 4YXKH 3CJJA 4MX7B 2O5ZL 1MCKA 1YEHL 5D2NA 4U1IB 1QSVA 3EIFA 4A6YL 1K4CA 1P84J 2B1HH 1GZQB 2YD4A 4CVZA 5IESH 5JLZA 4JAMB 3SE4C 2E9BA 3IDYB 4NQUA 1JNNL 2OI9C 3SE8H 5BMFH 4MXQC 2PUQT 3RGVD 1I8KB 1OQOA 4BSWA 2HH0L 4R8WL 1C12A 1E0OB 1I3GH 1YYLH 3LRGA 2IC2A 1N4XH 1ZSDA 2X4SB 3UZVB 4U3CA 4FZEH 1BM3L 8CGTA 1J0HA 3DSFL 1I8IA 3EOBB 4YK4B 5DF0A 1BVLB 2XZZA 3GO1L 4RQQA 3CD4A 5TQ0L 2JIXD 3DV4B 2P8LA 3RNKB 4L8DA 4WJ5A 2DQIH 2PO6A 1VPOL 3MCG1 1UA6L 4KXZH 3L1OH 4K8RC 3BJLA 4E42A 1I3VA 5EIQA 2EDOA 2OJZH 3CC5A 5KSBF 4YHOL 3MJ8B 1EERB 5DR5L 2HWZL 5BS0B 4F7TB 2O5ZH 1YEHH 5CEYB 3SJVB 4A6YH 3MLUL 2FO4A 5HI3C 4MD0A 4JHWL 4OZ4A 3MCKB 1VADA 4X6CB 1JNNH 3K0WA 5DURD 4HKXB 4NQDE 4G42A 4MQ7B 1QRNB 1FYTB 2HH0H 4R8WH 3RIFF 5C0IA 4YIQB 5E8DL 1BM3H 3DSFH 1QQDA 2I9LB 5FCUL 1IGML 4KI5C 4MB5A 2XZQL 3QDGB 4ZO9A 3GO1H 1AXSA 1VESA 5TQ0H 4PRPD 1S7VB 4LHUB 1VPOH 2Z8SA 1U8KB 1UA6H 5FGRA 5F6IB 3BD3A 5DQ9A 5T3ZL 1MUJB 1AR2A 3FQXA 4YHOH 4R7DA 1RHHB 2HWZH 5DR5H 4BQ8A 1IEAB 4YPJA 4KROC 4M9PA 2CSPA 3MLUH 4NNPL 4JHWH 3MRMA 5K9KB 1YA5A 1A2YB 1E27B 3SCMD 4QHUA 4LPYA 3FO2A 4MAYC 5IM7A 4I0PD 2XN9A 1MWAA 1DQLL 1EJOL 5E8DH 3MXVL 1YUHA 5F7EL 4BQCA 1KSRA 3OKYA 5CZKA 5FCUH 4NO0A 3WL9A 1IGMH 4WFHE 2XZQH 1PLGL 4DN3L 4Q2ZA 2FDBP 1I7ZA 4YC2B 5JW4Q 1JZ4A 3MJ7A 3RL2B 5K59E 3KPPB 5T3ZH 5HVHB 3B9DA 5FYJD 4HUVA 4ZNEE 1MCHA 4PP1D 1DCLA 3FZUD 3OTTA 2ADIA 1TVHB 1S7UB 3JV6B 4NNPH 4R26L 4HXBL 3G6JF 1DVFC 4L3EA 3SQOL 3QA3B 1SEBB 1CD9B 1Q9KA 1WCQA 5EZJA 4NKIL 1BQHB 3QEQD 3V6ZA 5E0QA 1DQLH 1QD0A 1EJOH 1UB5B 3MXVH 5F7EH 2ZNXA 4AL8L 4JM4L 1PLGH 4MAYA 4DN3H 1OTUD 1MCCA 3TM6A 4MCZA 2B5IB 4F15B 5LAXB 5HHMD 3AREC 1RZ8A 2X5PA 2L7UA 2NY1D 3GJFH 2EDFA 4JFFB 3W0WA 1CXHA 3C6SA 3BWAA 3X14A 4Z95L 3L7FB 4TVPL 3EFFA 4R3SA 3PHOB 4F7MB 5LCVL 4CMMB 4R26H 5ICXB 2JJWA 4HXBH 2WBJB 2H26A 2NR6D 3LKNA 1MOEA 1IAIL 2O93L 3EDEA 2EDLA 2X70B 4WHYH 1U8PB 5IJKC 4NKIH 3MROA 1DVFA 1F58L 2DIBA 2B39A 5IQ7L 4DQOL 1AE6L 1YNTB 1KJ2L 2HVKA 5T1LD 1CL7L 4MQXC 4PTTB 4P57B 2DWDA 4ZSOB 4JM4H 4AL8H 3BDXA 2F53A 2GTWA 4YQXL 4XNYL 3OKEB 2XKSA 1FVEB 5IG7B 1LK2B 3WO4B 1F4WL 1VEMA 2BCKB 2DLHA 3UTSA 5KAQF 3NIDE 2WBWB 3I3DA 2NY0C 4NC0B 3KYNA 1ETZA 3U4EA 1PZ5B 4Z95H 5E56A 3AREA 1OGTB 4J1UB 4TVPH 1TQCB 5LCVH 3C8KB 2HTLD 1KCKA 4UDTB 3S3JA 2P5EA 2LAGB 3ZHKA 4XCYA 4X8JB 1P6AB 4B7IA 1A4JB 1FVDB 3DX7B 2C3XA 5T33L 4NJAL 3MV8E 1JHTA 1IAIH 5JW5B 5DC0A 4WV1C 4M61A 2VLJB 1UH3A 5JXEC 1H8NA 2DQHL 1F58H 5HYSB 5IQ7H 3HE6C 5DHYB 5FYJL 1AE6H 4DQOH 1KJVB 3G9AB 4YNYB 1KJ2H 3LKRB 1CL7H 4PJGA 2Y72A 5F8RC 3PJSB 3D85D 1TNMA 4YQXH 4XNYH 5IJKA 1WWAX 4WI5A 4U7MA 1F4WH 3D0LA 1BJ1J 3DXAA 4WO4B 2CPCA 3BP7B 4OLVL 4PRDB 4KQ4L 4KJYA 3NCYS 4P2OD 4KRPB 1D7FA 2RHEA 5I8EB 1KPVA 3GB7A 5ITFA 1BZ9B 1YY8B 4L8BB 1Z9SA 5DK0A 4JFDB 2YPLD 5DJDB 2A83A 1JN6A 3ULVC 1HYRC 3AS3A 1I1FA 1TQBC 5FO9A 5T33H 2VTFA 4NJAH 2R15A 5MERA 3OKMB 2GAZB 1C5DB 4WFED 5I1KL 4GG6E 1KTDA 2AJ3B 3N0PB 3QUMB 2DQHH 4DJMA 4UBDD 4JN2B 1H3VA 4Q58C 5FYJH 3MNWB 3DVIA 4X9BA 4KV5E 5GSVA 3BGMA 2VLKE 4WV1A 2W0PA 5JXEA 4HWZA 2H9GA 3HE6A 3ME0A 4NM4L 3NGBC 4LLMB 1DQQA 1U8QB 3LS5L 2RCSL 1JZ6A 3PDOB 2XI9A 2AQ2A 4O2CB 3TBYB 4OLVH 5CZVL 5D9SA 3TO2A 3VXRD 2R9HC 4HJ0C 4KQ4H 4MA1B 1ACZA 5HJ3A 2ESVE 2AV7A 2WWKT 4PRAA 1FZJB 2ARJB 3EOAA 4CN6A 3MRLA 1T4KB 4IHOB 1JZ8A 1RJZB 1HILB 3U48A 3OSKA 3EJYC 2CO6B 2GSGA 1QFUL 1P2CB 4JVPA 1RHFA 4P2RA 5J4MA 1K4CB 5A2IH 4CVZB 5I1KH 2H8PA 2WLZA 4OB5L 5CP3A 2V2WA 4I2XE 2ADGA 1X5YA 4N0YL 2HRLA 4KDVA 4BSWB 1CR9L 1WVZA 5HSFA 1ZSDB 4X7EC 5I71C 5FV1L 1ZT4A 1I8IB 1CICD 1KCRL 5JW4N 3MYJA 4NM4H 2BOCA 4RQQB 3LS5H 2RCSH 5GGTL 4LCWA 3V8CA 4UT9L 2P8LB 5CZVH 5EUKB 2OR8A 4N0UE 3C5JA 4N8PA 1I4FA 4QRPA 4OF8A 2AK4E 2F5BL 4E42B 5HVWA 4O9HL 2CGRL 1T66C 3NCMA 1QFUH 4LHQB 2FO4B 4NRXA 3L5JA 4LVHC 1F11A 3AY4C 4PV8A 4OB5H 5JO5A 3RDTC 3HB3D 3T2QA 4LMQE 1VADB 5I8CB 3AB0C 3DUSA 4N0YH 4G42B 2V9TA 1UM6L 1JF1A 4RRPG 1CR9H 1DN2A 2WWMD 1MJ8L 4G7YL 5C0IB 2IANA 3VG0L 3DMMD 2C4FU 2VZVA 1QQDB 1KCRH 4MAUL 1KB5L 4NO5A 4Z7VE 5E03A 4RCAA 1GRWA 5GGTH 5CLWA 4UT9H 1IAIM 5MP6L 2QR0A 2ICWJ 5EZIL 3L9RB 5L2KA 1FFPA 5DQ9B 1XGQB 1Q94A 2F5BH 4ORZC 2IJ0C 2C1PA 3L5IA 4WIQA 4O9HH 4R7DB 2CGRH 5BV7C 4M5YL 4Z0XA 4TRPL 1HXMA 3QEGL 2HLAA 5HDBE 3H3BC 3MRMB 4Z7QE 3UBXB 3GSOA 2W0KA 3MO1A 5ECJE 1F3JA 4QHUB 2BVTA 3FO2B 1UM6H 2SEBA 2XN9B 4MHHG 4Z0BL 1MWAB 1MJ8H 4G7YH 3IVKA 1U9KA 3AY4A 4PJ5E 3QWOB 3RDTA 3VG0H 3OGOE 1CXLA 3KPSA 4MAUH 1X3DA 3B3IB 3BPCA 5FUZL 1EO7A 2D7MA 3IAPA 3MJ7B 1MAJA 1RPQA 3PG2A 5MP6H 1KIUA 4PYGA 3PWPA 3L3DA 4JRXD 4OCSL 3MV11 1FNGA 3MUJA 4ZS6C 3BZEA 3FCTB 4E41D 3D25A 3TH3T 4HUVB 5B21A 3B6SA 2DYPA 3NFSL 1T20A 4M5YH 4NWUL 4TRPH 1YN6A 5CGMA 3QEGH 3RVUD 3C5SB 4UNVA 3K8LA 3ULUF 1SMAA 3TO4C 2LV4A 4LDOB 2HN7A 4KROB 4XBEL 4Q97A 4PJEE 5EZJB 4KHXL 4Z0BH 3LKQB 4ZOBA 3RWJA 3I6GA 5JORA 1CQYA 4OUUA 3BXNA 3UTTB 4KMLB 3BN3B 25C8L 1QSFA 4MAYB 4ZO6A 3X3FL 5KVDL 5FUZH 1JMXA 1CDJA 3QHTC 4MXVE 1O7VA 2OSLA 5GS0C 2JF1A 4MCZB 3GSQA 4OCSH 1YN7A 4FXKA 5DJAA 1J0KA 4PJ9C 2OZ4A 3W0WB 2AEIT 3CSBA 4OF7A 3BWAB 1FIEA 4QXTA 5DFTA 3X14B 3NFSH 3QIBD 3OJDA 3VFVA 2QQLL 5J9PA 2IPUG 3VXSA 4NWUH 4I3RL 5DEFA 4R3SB 1G1CA 2VB5A 3U83A 5KSVA 4MNQD 1LILA 1YMMA 1G9NL 3VWKD 5IFHL 4Z7UE 1BEYL 3ILPA 3V6FA 2H26B 1NUGA 3LKNB 2NY2D 3MV7E 1XF2A 4XBEH 5F9OL 5DHXB 4EEEA 4KHXH 3MROB 4U1LB 5A2FA 1DVFB 1FVCB 3TO4A 4PG9B 1GGCL 1G7QA 3UPRA 4KH2A 5C07E 5C1MB 2DWDB 2Q3AA 25C8H 2F8XC 3WMSA 2P5WE 4PPTA 3X3FH 1UWEL 2F53B 2CMRL 4LBEA 5EC2A 3VMPA 5KVDH 4W68A 3B5HA 4YHNA 2Q87A 5GGSY 3ZYOA 2AVGA 5AZ2H 3HPLB 5EBWB 2VSCA 3T1WA 4N90E 3OV6A 2Z31D 3KPRD 3KYNB 2WQ8A 3U4EB 1MJJB 2NYYC 2QQLH 1AR1D 2CLRB 3AREB 4I3RH 4U05A 4RGND 3VW3L 3U0TA 3ZKND 4PJ9A 1HH9A 1S9YB 4XHJD 4KUZL 4GKZA 1G9NH 3QXVA 2P5EB 5IFHH 4GT7A 5ENWA 1BEYH 3CZJA 4XCYB 3D69B 1OTTD 3NH7L 1QFWL 3TBSA 1OGAE 5IVOA 2NY7L 5F9OH 4M61B 5E4IA 5SWZA 5KSBE 4PJHA 1ZV5A 1GGCH 2XT1B 4TULL 1UWEH 2CMRH 1QA9A 3DGGA 4PJFF 2V9QA 2NX5A 2DKSA 3L7EA 1HHJA 1MFCL 3VRIA 2GY7B 3I6KA 4KJYB 4HSQA 3QULA 5B38G 1RZJL 1DEDA 4KRLB 2FATL 3VW3H 5EO0A 4PB9L 2NY0B 1JN6B 2AJSL 4KUZH 3IFLL 5ID1A 3MLVL 2QLVB 2VXUL 1I1FB 3FN9A 3NH7H 5FO9B 1QFWH 4C58B 1R3IL 1NC4A 2IFGA 2NY7H 1KTDB 1RZ7L 4M7LL 3B4NA 4HIJA 3QFJA 4D9RD 5C0RL 5GSVB 1IT9L 3BGMB 4TULH 3OHXA 3KJ6L 3MRHB 4WV1B 5J6GA 4WFFE 4JFEE 4FQXD 4WI7A 4H88L 1MI5D 1QSEA 4R4FL 3QPXL 4ZOAA 5HPMA 3OAYH 1DQQB 1HWGB 4IOFC 1N5AA 4M1CD 2D0GA 1DL7L 2D31A 5TE6L 1OP5K 5FEBA 1Z5LA 4HIXL 3NPSC 5D9SB 1MFCH 1I85A 5E1AA 3TO2B 2WIIA 4U1GB 1RZJH 4PRAB 4L8CA 4JM2B 1H3UA 2FATH 3NCJL 3EOAB 4PB9H 5DRNA 1ZOXA 2AJSH 3IFLH 3VGAC 3MLVH 5EIIB 3QPQD 2ITDA 2P47B 2VXUH 2E7BA 4J3WA 3DX9A 2DI8A 3MV9A 5DSCA 1R3IH 2H8PB 1RZ7H 4M7LH 4K7PY 3D39D 5C0RH 1AKJA 4GXUM 3KVQA 1IT9H 3KJ6H 3MBED 4X4YA 4PJIB 2ZP0T 3NIGF 4ZFFA 1A0QL 1A6UL 3VE0A 4H88H 4R4FH 1ZT4B 3QPXH 3MYJB 4WWKD 3MREA 1XIWC 3QNXA 4LCWB 3RVVC 5HI5C 1BQLL 1DL7H 5TE6H 3SGEH 4HIXH 1VHPA 1I4FB 3IDJA 3L95B 4QRPB 3NGBB 3L5XL 4L8SC 3NCJH 5J6HB 4WW2F 1EPFA 9CGTA 3TPKA 3RZWA 4NKDA 4KVNL 4PRNA 4NRXB 5JUEL 1F11B 4PV8B 3MUHL 3LEXA 3WFCL 1JF1B 2QSCL 3CX2A 5C71A 2IANB 1A0QH 1A6UH 3Q5YA 5GPRA 5EWIL 4NO5B 1GOGA 4MQTB 1RY7B 3P0VL 2CKBA 1BQLH 4O5LL 4MZ2A 5I71B 1PBYA 4L29A 2H32B 2JE8A 5TE7L 5IEKA 5JQHC 2MNUA 1FFPB 4K3DL 3L5XH 1XIWA 4Y1AD 3EDJA 5E8OB 1AGFA 4MJ5B 5CJQL 5D2NE 3AC0A 3IKKA 5KAQG 4S1RL 1UXSA 2XACC 4Z0XB 3W5MA 1HXMB 2EDDA 2HLAB 4JRYD 4KVNH 1OAQL 4L8SA 3F5WA 5JUEH 1JI1A 3DURA 1IBGL 3GSOB 5JA9A 1F3JB 3WFCH 4CNIB 5FM5M 2QSCH 2SEBB 3HS0A 5FKAA 3IVKB 5FAAA 3RVTD 5I66A 3RDTB 4ZS7L 3TJEL 4YHZL 3KPSB 4IRZL 5EWIH 3BPCB 3UMTA 4HUKB 3P0VH 3WFDL 4O5LH 5C0AA 3L3DB 5TE7H 3U2SA 4K3DH 3BZEB 3SKNA 2Z0BA 1Q9LA 3KNBA 4EOWL 5CAYB 1KNOA 4P5KB 4PREA 2RJMA 3EOYG 5CJQH 3IDNA 3EZJB 2DYPB 2FJGA 4S1RH 3VXUD 1FIGL 5DO2D 4LLVB 3VXPB 1FNFA 4M6NL 1OAQH 2DIAA 4N1HB 1AGCA 5DJYA 3VDBA 1G7PB 3EJZC 1IBGH 3RX8A 3E2HC 3VXQA 2HN7B 5BV7B 1NGXA 4MB4A 5D7JB 5IHLB 5IB3A 1N2RA 3MODL 5I8KL 3I6GB 5DRXA 5ESAA 5JORB 4ZS7H 4OUUB 3HC4L 3TJEH 3BXNB 4IRZH 4YHZH 2DL2A 1OP5H 1BIIA 1QSFB 3SKJL 4TOYL 1NKOA 3WFDH 5GRZA 5SX5K 3QR2A 4KK5D 4RISL 4M1GL 4BK4A 1ROWA 3MX0A 1YN7B 3KYKL 4FXKB 1IE5A 2HYMA 4MYWB 2X89A 4EOWH 1KEML 3VXOB 3IB4A 4AIZA 2E5EA 4QXTB 3MBXL 1MELA 3VFVB 5J9PB 3VXSB 4W70A 1FIGH 4AEEA 5DEFB 5F3BA 3ALPA 5KSVB 4M6NH 4HGWA 1CIUA 4XXDB 1YMMB 2FZ3A 1CD8A 3CFKB 4TNVF 3ILPB 1VFAA 4WEBL 1PG7W 5F7WC 3C6LA 4NO2A 1NBZA 1FP5A 3WLBA 3MV8B 4D8PA 5CMAB 2QQNL 2NXYC 3MODH 5I8KH 4J3OC 3TO4B 1G7QB 2GJ6E 3SKJH 5HPOA 4TOYH 5EC2B 4LBEB 5IQ9A 5D2LB 2W9EL 1C7TA 4PV9A 4YHNB 4RISH 4M1GH 4X6DE 1CTNA 2XWJB 3E6FA 5DD6A 3KYKH 5CLTA 2WBKA 2ICCA 1KEMH 2KQNA 4LSDA 5I1DA 3P73B 1EA9C 3C5ZD 3MBXH 2A6JA 3VFGL 4NQEA 3T65A 2EO1A 3GKWL 3BKYL 4MSWB 3KYMA 4L3EE 3QDJA 3U0TB 2A6DA 4PJ9B 1HH9B 5EU3A 3FFCD 3H2WA 4P3WA 8FABA 5ENWB 2P24A 3RY5A 1ZVYA 2MJWA 4JY4B 4NSKA 4WEBH 5F1KC 4JQVA 1S7TA 3TBSB 4Y16D 5SWZB 4J6RL 2QQNH 3UCRA 4GG6B 5GRVL 1KXQE 5CJOL 3C9NA 2J8HA 5DVNA 5C86A 5C3TA 4UNTA 1QFWI 2IQAA 1OF2A 2W07A 5FA4B 3F12A 2W9EH 1WBYB 3F6LA 4F37F 3DVFA 3L7EB 1MRFL 1GAFL 2D7PA 3VRIB 4GRLB 5B3JF 3I6KB 3MOAL 3O2VL 1OT2A 3VCLA 3VFGH 5IIEB 3QULB 4FQQA 1WSST 5D93C 3GKWH 3BKYH 2ZUXA 5I9QC 2ESVB 4ONHA 4UZGA 4BQBA 1KUMA 4U3HA 2XY2A 4D0DA 4H20L 5CIPB 3QNYA 3ARGC 2IPUK 3ZKXC 5ID1B 2Z35B 3DVNA 1U8IA 3LEVL 4W81A 5CUSL 1NC4B 3BZDA 2ZUTA 1ZS8A 4J6RH 4HIJB 1IGJA 3ARZA 3QFJB 3W39A 4ZUVB 3RKDC 5CJOH 5EH1A 3VFPA 3OHXB 5GZND 5J6GB 4WY7L 3L6FA 4Z7WA 5HYEA 4L9LC 5FYLL 3OF6D 1QSEB 1PYWA 2DM2A 3UTSE 3U9UB 3RY6C 5HPMB 2UY7A 3HZVA 4UIKL 1MRFH 1AD0A 1GAFH 1OPGL 3DUUA 1N5AB 3DWTA 4PGBA 1J8HB 4N68A 2D31B 3NIFE 1Z5LB 1QO3A 4Q0XL 5CEZD 3MRFA 2WIIB 3MOAH 4TTGA 3O2VH 2DLGA 3WNOA 4N0UB 1NLBL 1NCDL 4L8CB 4H20H 1ZK9A 3RP1A 3SGEI 3BKJL 2BVUA 4JHZA 3DX9B 3LEVH 5CUSH 3P4OA 2IADB 1NCAL 3ARGA 4HS3A 4PJGE 5EOCL 4HJGA 1A4KB 5DWUL 2VZTA 1AKJB 4QXGL 1QFOA 4P46D 1N59A 4X4YB 3BP4A 1JZ3A 1G0YR 1CD1A 4ZFFB 3VE0B 3WHE0 4Z76A 5FYLH 3DYPA 3GI8L 4NPYA 3DXAE 5FECA 3A0OA 3MREB 1IC1A 4UIKH 3QQ9C 3QNXB 1OPGH 4UNUA 2QADD 3NCCB 4X4XA 4Q0XH 3RIFK 4U1JA 4L4VD 3QUZB 4L9LA 3IDJB 2V5RA 3RY6A 4EUPA 1NLBH 4OLEA 35C8L 1NCDH 5F7YC 4KK9D 1YECL 1KPRA 3E1F1 1WICA 3QUXD 3BKJH 3FRPG 4LL9A 3GMOB 3FJTA 5E9DA 1QP1A 4PRNB 3RIAK 3N1QC 1NCAH 3C60C 4U4BA 2R23B 5EOCH 3EBAA 5IB4A 5DWUH 3UJJL 4Y5XC 3LEXB 4QXGH 4EVNA 1BIHA 4PJCE 3PQYE 2PYED 2FD6L 3S5LG 3GI8H 1HN1A 4C56D 5C6WH 1O0VA 1XF4A 2HT3C 1ZHLA 1UC6A 3O3DA 4PJDF 5D7LD 3MLTA 4L29B 4WTZA 3VG9C 1GPOL 3ZTJG 1H0DB 1S7SA 35C8H 4TUJB 1XIWB 4HULB 5HGGS 3CU7A 1YECH 1YEGL 3LQMA 2B2XL 5E5RB 1XH3A 4P2RE 4XVUD 1UXSB 2NXZB 3L3GA 3WJJC 4AZ8A 3EFDL 4BQ6A 1FFOA 1V3LA 4HC1A 4OSUL 4X4ME 4L8SB 3O4LE 3F5WB 1KULA 2EDKA 1AY1L 2XQBL 1CVRA 2HA1A 3DURB 1FZOA 3MMEB 4PJ8D 5DZOA 3UJJH 4MS8C 5I16A 1YY9C 3GHBL 4L3AA 1WJ3A 5C0JA 3HS0B 5FKAB 2FD6H 3QIWD 1FHGA 5I66B 3ISWA 3C60A 1Q72L 1UWXK 4Y5XA 1VGKB 2EXYD 4LPUA 1JMZA 1O7SA 4CN4A 3PWJB 3TJHC 2FB4L 1P4LB 1N8ZB 2YC1B 5JW4M 1GPOH 3U2SB 3T1FA 3VXMD 1Q9LB 3KNBB 1KNOB 4PREB 5LG1A 4PJFE 2B2XH 5E7BA 1T22A 3IDNB 4ONOA 2FJGB 3QG6B 3TA3D 2FEDC 1T5XA 3EFDH 4AM0A 4OSUH 4N0RA 1QHPA 2K1MA 3ARFC 1AY1H 2J88L 2XQBH 5DJYB 2VLMD 4KKCD 4Q9QL 3GHBH 4ZFOB 5BRZD 3WJJA 5CKAA 5IB3B 4S1QL 1N2RB 2EIEA 4P23C 1CTOA 1P53A 4GMSL 3UPAA 5DRXB 5ESAB 1Q72H 1HYSC 1BIIB 4GBXB 4QHLA 3BKML 4DTGL 5L2KE 1INQA 3DX6B 3E0GA 2FB4H 2X9WA 3ARVA 4U49A 4LPVA 1KCSL 1MEXL 4MWFA 3GKZA 3O45A 5DQDL 1CXEA 4D9QD 4AIZB 5MI0C 1RURL 1I3RA 2L4OA 2BJML 3CDCA 3OL2A 4LDEB 3BYYA 3OKLA 4HGWB 2A9NL 5EULV 2UYLA 2FZ3B 2J88H 2CLZA 4LOUC 5E5UB 1VFAB 3OBAA 4Q9QH 1IKNC 3A6BL 3DPBA 1QLFB 1DQML 4NO2B 1NBZB 3WLBB 3PGCA 4S1QH 3ARFA 4GMSH 4X99A 1DQJA 3QCUL 3E2HB 5JIIA 4Y4KD 5HHOA 5KVMC 3PGDA 3KXFD 5T1DL 4OFIA 5IQ9B 3PWPE 2JJUA 4P23A 3BKMH 4PV9B 2XWTA 4DTGH 3WCYA 2WAHA 2IAMD 5FYKD 4KUCD 1X9QA 1EEZA 5DD6B 5EU6B 1MFNA 1KCSH 1MEXH 1B0GA 1HHGA 3NIGE 4DKEL 1IZKA 3HUJF 5DQDH 3TLRA 2Z93A 1QFPA 1ZT1B 4ELMA 2VE6A 3SDDC 1RURH 4JFQA 3NA9L 2VC2L 1YQVL 2FJHA 4YHPA 2BJMH 4WI8A 3EO0B 3KYMB 1GXEA 4XP9L 4HS6A 2A6DB 1DBBL 3QEUA 4OD2A 1T0NA 4Y4HC 2A9NH 5EU3B 8FABB 2DQTL 4K23L 1SJXA 2P24B 5GRYA 3A6BH 1S7TB 2JLLA 1DQMH 4YBQD 5DZLA 2BDNL 4OKVA 4AJ0A 3ULUC 2BP3A 3O8XC 3MRRB 3QZWG 4OFYD 3QCUH 3C9NB 1IKNA 3QH3A 1RJYA 1CQKA 1KEGL 5T1DH 4F7PA 2AXGA 2IQAB 3F12B 2NXYB 4P49A 4HKZA 3X12B 4QOKD 4KDTC 4OQTL 4A2LA 1J1PL 5IB1B 3CFBB 3S37X 4DKEH 2APVA 4F80A 1B9ZA 3H9SB 2FL5A 1ZXQA 3VFRB 4OV6F 1L7TL 3VCLB 3F62A 4DFIA 4FQQB 2HLFC 3NA9H 2VC2H 1U3HC 1YQVH 3NN8B 4UILL 3QUML 4IRJD 2VLRD 1IZJA 4XP9H 1DBBH 3GK8L 1MVFA 3QNYB 4BA8A 3PE9A 2DQTH 4K23H 5ACMA 5DYOA 1OP3K 3RX5A 3SDDA 3DVNB 1U8IB 1S7XA 4U6VL 4RBPK 3VMNA 1WK0A 1Z0MA 2BDNH 4Y4HA 1IGJB 2NY5L 4XZUA 5I73B 3E8UH 1YC8A 1F45A 3VFPB 1KEGH 3FAXA 2XTJE 4GW1A 4L4TD 5AUMA 3L6FB 4Z7WB 4PJAA 3G6JB 4N8VG 3O8XA 1PYWB 4CAGA 2UVEA 3I2CL 3HZVB 1ZHNB 3HA0A 1AD0B 5ICZB 4OQTH 3DUUB 1J1PH 4PGBB 3IDUA 1YJDC 3MRFB 1Z0NA 3DJ9A 3OB0H 1L7TH 4ETQA 4YE4L 3P9MB 1IMHC 4UILH 4KDTA 3QUMH 3KGRA 1F2XK 4N0CC 3UYRL 1IEBA 1XMWA 3GK8H 3QHFL 1U3HA 5FYKL 4R2GC 4U6VH 2BSSA 3NA4A 1RJCA 4PJHE 3VFOA 4MDJA 3ZKXB 3ARGB 4WFGD 4HJGB 4JO2L 2NY5H 5DJ0B 3TCLA 1AO7E 4LSQL 1V3MA 5GXBB 1N59B 3BP4B 1CD1B 2NX5E 4Z76B 4NPYB 2P44B 2D0FA 2VDQL 1WFTA 5FECB 4JANA 3I2CH 5INCA 5ESVA 5TH2A 3OKDA 4K9EL 1RUPL 2DL9A 4X4XB 4CN1A 3B9KD 2HT4D 4L9LB 4K7FA 4YE4H 3WFEL 4EUPB 2IGFL 1MCDA 4V1DA 4AENA 2B4CC 1KPRB 4FTVE 4JFOA 4PRHD 3UYRH 3FO1B 5I1HL 5FFLA 2J8OA 4K3EL 5DMKB 3QHFH 2OJEA 2B1AL 4XX1G 2PXYC 5TJWK 5FYKH 5E9DB 5KN5A 4R90L 4XX1E 2A0LC 4OZFH 1IQWH 5IB4B 2PTVA 4JO2H 3QUYC 1MRCL 4LSQH 4ZQKA 4EVNB 3GGWB 4JZJC 1NUNB 3THML 4M4RA 2R8SL 5C0GA 4H1LG 2VDQH 1TETL 5DFVD 5ERWA 1XF4B 4K9EH 1EX0A 1ZHLB 5IHBA 1RUPH 3RGVC 3O3DB 4YDKL 1J86A 1QBML 4D2NA 3MLTB 4P4RA 2ICWA 1IVLA 3RKPA 5JXAL 3WFEH 1OWWA 4QHNB 3OPZL 2IGFH 4XMPL 4NHUB 1NMBL 2H45A 5C08A 1MREL 1XH3B 5I1HH 4Y8DC 3MV9E 4K3EH 1MCLA 3BMWA 4X5WA 2DD8L 2B1AH 3L3GB 4X7FC 4NN7B 1FFOB 2BSRB 3MJ6A 3WNNA 4R90H 3BOVA 1EBAA 3ZKSD 1BFTA 2UZYB 1CT8A 2VZ3A 1TTGA 4JR9L 5C0FA 1FZOB 4G8GE 5GSRA 3MNZA 1MRCH 3FQWA 2PXYA 5CSZB 5C0JB 3THMH 4BQ9A 1FJ1B 2R8SH 3C60B 2ZUWA 3Q6GL 3K46A 4Y5XB 1AIFA 4HV8B 1G7HB 1TETH 3QUYA 5FHAL 5MEQA 1A6AA 4OGAD 3HRPA 4JZJA 3IFOA 1ODAA 4YDKH 1QBMH 1WWWX 5JXAH 3QDMA 1KYOK 3D2UB 4ZUTA 3RI5F 1I8MA 1JHLH 4NKOA 3OPZH 4XMPH 1NMBH 3RGVA 3GJFA 1ZLWH 3WUWG 1MREH 3ARPA 2BNQD 2EDBA 1T22B 2I24N 3VG9B 4EXPX 2DD8H 3VDCA 3U36A 4AM0B 4WGWB 4ZOCA 5EPMA 5B3JE 4WW2C 2Y25A 4JR9H 1S78D 2JIXA 4LFHG 2D7QA 7CGTA 4UT6L 4OF3A 1DN0A 3Q6GH 4XMKL 4OF0A 1VEPA 2WK2A 4CW1A 4TSAL 4QXUL 5FHAH 2V2XA 3SCMC 5JNYA 1F4AA 1AGDA 4ZD3L 5EA0L 1S7QA 4I0PC 2OTUA 3V7MA 4ZPTB 3LOWA 5EBMA 5KBNC 4XAWL 3IFPA 3ARWA 4U6YA 1A6TB 3O45B 4NZUL 1S5IL 3FQRA 5F44A 5SX4I 2BZDA 3CFEB 1I3RB 1FO0H 4FQHA 1RUKL 4JPVL 2HP4A 3FFDA 1NGPL 5GGUA 3WDIA 1G6VK 2UYLB 2CLZB 2CIIA 3W9EA 3LV3B 5IVZB 1PY4A 4PRPA 2MQ3A 2VIRA 4PP1C 5E24E 3FZUC 3GMLB 4UT6H 5GS3A 3QXAB 4LVNC 4X99B 4QF1A 4XMKH 1JNLL 2AEWA 4YPGA 1PVHA 2IBZX 5HHOB 1KJ2A 1JWMB 1QR4A 3PGDB 2BXZA 4NCDA 4TSAH 4QXUH 5C0AE 4ZD3H 5EA0H 1HXYA 4NQDD 4P23B 2XWTB 5BW7C 1DUYA 4BYHA 1CGYA 3B9EA 3VH8G 4XAWH 5ETUA 3VXTA 1HHGB 4L3CA 1T04A 3SCMA 3K80A 4NZUH 1S5IH 1OTUC 2Q1EA 2Z93B 1OY3B 5KW9L 5GGRY 2BOBA 4ELMB 4XVJL 2VE6B 2Q8AL 1FAKT 3GMQA 2D7OA 1RUKH 4YHPB 4JPVH 4FRWA 1JE6A 3QEUB 2NY1C 4OD2B 1T0NB 5LGJA 1UKSA 4YHKL 4EBQL 4LNRA 4K94L 5MI0B 3FT3A 4NDMB 1MCSA 4HFWA 2ZCLL 4ZAKD 2IALA 2DJUA 4OKVB 3HG1E 1TITA 1UH2A 5JIKA 4BH7A 1JNLH 5IROC 3BUYA 4GAYA 1RJYB 1XGRA 2X4PB 4XBGA 4YHLL 2ZOKA 4F7PB 2NR6C 4X6BB 2AXGB 3O2WL 1MIML 4YEEA 4HKZB 2XOTA 3OMZA 4OZIA 3S34L 3BO8A 3G5VA 4J23A 4XBPA 3SDAD 3SDXA 3I84A 1CVSC 2XQYG 2AQ1A 2FL5B 3STLB 4PYHA 4WFHD 5KW9H 5BW7A 1PEZA 4NIKB 4XVJH 2Q8AH 3QEQA 1AP2A 1LDPL 5EDXA 1I7UA 4PJDE 1V3JA 1BLNA 1P9MC 2VABB 4YHKH 1R5WA 4EBQH 1BZQK 5DYOB 4K94H 3SDDB 3TBVA 1MPAL 3H6JA 5IV2A 2ZCLH 3RA7L 1KPUA 5FV2A 4DZBA 1IM9A 3S35L 5J8OA 4YFEA 1GGBL 5FDYA 3RWCA 4YHLH 4JFZL 2EICA 4ZPVA 5AUMB 3O2WH 5D1XD 2ERJC 4PJAB 1MIMH 3O8XB 4P2QE 3OG6B 5B4MC 5IROA 4HGMA 3S34H 5D1QD 1YMHA 4HIHB 3H0TA 4R4BA 2YD6A 3RWHA 4FN0A 5T1KB 4ETQB 3QDJE 1GGIL 1LDPH 3IS1X 1IEBB 3K4DA 3V0VA 5FO7B 2EE6A 1RULL 4JJHA 4KK8C 1MPAH 1U3HB 3SDCD 3G5XB 2QHLA 4P2OC 2BSSB 3VFOB 3RA7H 4MDJB 3S35H 1P9MA 2FHFA 3TCLB 1JGVL 1GGBH 3D48R 3GMMB 5GJTL 1IAKA 4JFZH 3HAEG 4OF5A 5IB5B 4JANB 5INCB 3RL1A 5ESVB 4UBDC 3OKDB 3K4AA 4WNQB 3DETD 1W0WA 1WBXA 5GGTA 1E6JL 1H8SA 3RVWD 4FZ8L 2EC9U 4K7FB 1Q0XL 1GGIH 3H9YA 4P2CG 3E6HA 4AENB 3BDYL 1JZ2A 4JFOB 1E4WL 1I9JL 5C0BA 3MFGB 1EGJA 5T5NF 3D85A 5L0QB 4I13B 4PJBF 2O5XL 1RULH 2OJEB 3IRPX 5KN5B 3H7BA 2AK1L 2Q3ZA 1QLRA 3WHE1 3IXAA 4IEFB 4TQEL 1RAMA 3KYAA 1JGVH 2R0KL 1TZIA 4ZQKB 1ZGLM 2NW3A 4R2GB 5GJTH 5DVLA 4UTAL 5C0GB 4JEGB 4CMHC 4P48A 2YPLA 3MYZA 3BE1L 2J7LA 3LQAC 2YA1A 2Y5TA 1QEWA 1MCWM 2YD5A 1E6JH 4CRPA 4P4RB 3DNKA 3RVXD 4FZ8H 2JELL 1Q0XH 2E9WA 4LSUL 1CICC 3BDYH 3D9AL 1E4WH 1I9JH 2C4FT 5C08B 3V5DA 2C3VA 4OZGA 4M8QA 2O5XH 4X5WB 4KZDL 4PRIA 3HUJE 1JI2A 1KJMA 1KB9K 2Q7YA 4KRNA 1FFNB 1TCMA 3UBXI 5C0FB 3MLSL 5GSRB 4TQEH 4ISVA 5ALBL 2IPKA 3VXRA 3MNZB 1IGFL 4I3GA 1AGBA 3FQWB 2PXYB 2R0KH 2X4RA 2H32H 2QKIA 2XV6B 3O9WC 4NP4L 4TTDD 4PGEA 4UTAH 3PXJA 4YWGL 3BE1H 3HB3C 1AIFB 3QUYB 5MEQB 2NW2A 1FLRL 2IH3A 4G8FB 1I1YB 2FSEA 4JZJB 5I30L 5I1GL 4ZO8A 2WWMC 4UOW0 4Y19A 5MEPA 1M71A 3HZMB 2VLKD 2JELH 3DMMC 4XVSL 1I8MB 3WDJA 4NKOB 4LSUH 2GITA 1CGWA 3RGVB 4DVRL 3D9AH 3EYFB 1XR9A 5IMMA 5BV7L 1F6AA 3QT2A 1OHQA 4NKMA 4KZDH 4EKXA 3U36B 5DMYA 3ECBA 1R24A 1CICA 1VFMA 2IMNA 4M02A 4DW2L 4GS7C 5EPMB 3C2AL 3CDYA 2JIXB 3MLSH 2P48B 1KTKE 5ALBH 5LWYL 1IGFH 5EO9A 1WAAF 5F9JA 1EVTC 4UDUA 4I9WE 4NP4H 1EK3A 5A2JH 4YWGH 1DDHB 2AJUL 3F7QA 2HFGL 5HHXL 2OZ4L 3IU3A 4CW1B 2V2XB 1FLRH 4FABL 3IRZA 3BGFC 5JNYB 4GRWB 5I30H 1AGDB 2APBA 1EZVY 1S7QB 5I1GH 3O9WA 5IFJB 2OTUB 1FZMB 3QWRD 2E9IA 5EBMB 3VI3F 4NRZB 4XVSH 5ADOL 2ATPA 4IJ3C 3IFPB 2H6PB 2JB5L 4U6YB 4G8EA 5DURB 5IBLD 4DVRH 5B3NA 3FQRB 2X4OA 4FQJL 5BV7H 5IMOA 2R0LL 1P4BL 4FQHB 4OZHF 4PP2B 2L7JA 3DMMA 2JK5A 2E8ZA 3FFDB 5GGUB 1WIOA 2HJLA 1FZKA 2R29L 4DW2H 1BFVL 3MFFA 5B39A 1IL1A 3C2AH 2CIIB 2AK4D 2CRYA 4G43A 3QJFA 2EZ0D 1Z3GL 2X44D 4PRPB 5LWYH 4JFPA 1AXIB 3OB8A 3GSXB 5LJYH 4UOJA 5F89A 3RVUC 4WW2B 4DFHA 4QF1B 3GJEA 2AJUH 2P43B 5IVXF 2HFGH 5HHPB 5HHXH 2OZ4H 4UB0L 1KJ2B 2VQ1A 2N7AA 4FABH 1JPGA 5GS0L 1FNEA 1CE1L 2DICA 4XTRD 1LGVA 1HXYB 5FUCC 3IT8D 3KJ4C 4E9LA 3NCBB 1RZJC 2W65A 1LDSA 5ADOH 3MJGX 4JLRA 5ETUB 3PHSA 4XPHL 4HX1A 1LO5A 1CF8L 2JB5H 3SCMB 1LWRA 2I60L 2NQCA 4XMLL 5EZLA 3D3VE 4I0PB 4LKXA 4FQJH 5MENE 1PKQA 2BOBB 3LKOA 2KPNA 2R0LH 1JYXA 1P4BH 4OLXL 5KVGL 3GMQB 3Q1SL 4B41A 4O51A 3EO1A 3JZ7A 5FXCH 4HIIA 2R29H 2DKMA 5TPWL 5LGJB 3SKOA 4J8RA 1BFVH 1Q9OA 2EDRA 3ABZA 4KKBD 3QXDA 1Z3GH 2FEEL 4HFWB 3QIBC 4HLJA 3MRBA 3QI9D 5D96C 4HXAL 4JRXA 5C0ND 3CH1A 2IALB 1LE5A 3A6OA 1P7QD 4FQCL 4WW1A 3KPTA 4RGMC 1XGTA 4BH7B 4Q6IC 3VWKC 3RWEB 1F6FB 4GAYB 4UB0H 4YX2L 1XGRB 3RZCA 4XBGB 2ZOKB 5GS0H 1X4XA 1K5NA 2KQMA 2NY2C 1CE1H 1J8KA 2O26U 4YBLC 2AAVA 3PL6C 2YRPA 4LVNB 5T1MA 2CK2A 2X4TA 3UEZA 4N8VB 3BO8B 3G5VB 3NCYP 4PJ5D