4NQDD

Crystal structure of tcr-mr1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-d-ribitylaminouracil
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
200
structure length
200
Chain Sequence
GQNIDQPTEMTATEGAIVQINCTYQTSGFNGLFWYQQHAGEAPTFLSYNVLDGLEEKGRFSSFLSRSKGYSYLLLKELQMKDSASYLCAVKDSNYQLIWGAGTKLIIKPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title T-cell activation by transitory neo-antigens derived from distinct microbial pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Major histocompatibility complex class I-related gene protei
total genus 45
structure length 200
sequence length 200
chains with identical sequence G
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF07686 V-set Immunoglobulin V-set domain
D PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdD02
4UQ2B 4U1GB 5C8JA 5DI8B 4IRSD 3SDAB 3ARFA 1U93A 2VLLB 3R0NA 4X6FB 3HUJF 3C9NA 4EQ3A 3MRIB 3GIVA 3UAJD 1T80A 3CH1B 2BOBA 1XF5A 2J8UE 5IQ9B 5EIIA 5BMFH 1BBJA 1RFDH 4X7TB 3KDMA 1IKNC 1U58B 1UADC 1P9MA 2RQ8A 3QNZA 4OF7A 4YHZH 2BVOA 2AJVH 4U1MA 1HXYA 3VE0B 5E8NB 2E27H 5EPMB 3SHSA 3KLHC 3RDTB 1BQHB 3P77B 2XQYK 3DBXB 4JQVC 1T2XA 5AWNH 1B6DA 2EKSA 2ATPA 3TESA 3WS6C 5GS2H 4DVBB 2F53D 2AAVA 1L6ZA 4PJAE 3V8CA 1BQLH 2AERT 1VGEL 2PW2B 3ARFD 3D39B 3SE9H 4D9QE 4LLQA 5B3NA 5K9KB 4N8VB 1PZ5A 2GY7B 4R90L 1MHEA 4YDLB 2YXFA 5AG8A 1RZGB 2BNQE 3EJYD 5AD0B 5JMRA 2VLMD 1SBSL 3VGBA 2IG2L 4Y4FA 1JNNH 4ELKB 3ZE2E 4CVWA 1I85C 1KLUB 1RHHA 2CKBH 1E4JA 1LD9A 3RX5A 3BFOA 1N3NA 3MX0A 4OCRL 4XHQA 3I6LD 3HFMH 5CP7B 4XRCA 3QHFL 1KG0A 3KJ4C 4X4ZA 3LS5H 4NQEA 2UZXB 5TPWH 2CKBA 1UXWA 3BJLA 2FL5A 3VFPB 2OQJA 2VDNL 1A3LH 4K9EH 3U0PA 3SCMB 4UINL 4R4ND 4JN2A 1FO0H 1NBZA 3MRDB 2WIIA 2O5ZL 3BMVA 1H8NA 4HK0B 4QRSA 4M5YL 4NO2B 4FQIH 1WC7B 1J9CT 4MD4B 4YHIB 2CO7B 3ROOB 5E03A 2E7LC 1VPOH 2HAZA 3E3QE 2V7NB 1SY6L 5EO9A 3LD8B 4NUGL 2ZUXA 1WSST 4OF5A 4C83B 4HT1L 2YD8A 2VAAB 4YDVB 5LCVH 4RISH 5IROC 5MERA 4OLVH 5BZWB 5GGVL 4FP8H 1XF3B 1S7WA 5K33A 4LDLB 1YYLL 5CD5D 5JHDD 1LO4H 4XPTH 1YY8B 4QY8B 1JGDA 2W0FA 3NA9L 2HMID 4EIGB 1JGEA 1CTNA 5FECB 2QSCL 4O58L 4TUKH 5DRNB 2F8OA 2MMXA 3EFDH 2MCG1 3RAJL 1DVFC 5TPWL 1ACYL 3BMWA 3DSFL 4MNQE 5HI4C 1FLTX 4OFVA 1A7OL 3C87A 2DWEA 5FA4A 4HWBA 5DUMH 3B5GA 3SKMA 5EUKA 1QFWI 2KH2B 2EDQA 1IGTA 2GQHA 1UJ3B 1G7LA 3CMOL 3L6FA 4Y4FB 4FN0A 3WDIA 3M8OL 3MV7D 2R8SL 5GJTL 1F2QA 4QRUA 3ARTA 4K3EL 5JR1L 5C92A 3JWDL 3RVUD 5LVEA 5AUMB 3A6BL 4PG9B 3RWEA 3T4AB 2DM2A 5DSCA 4P49A 1LQSR 4RA3A 4FXGB 2EKSB 3QBTB 1TXKA 3RIFF 3QEQE 1BQHA 3P77A 5BS0D 1JMZA 5DFTA 2DIJA 4F7PB 4RMTA 3VD5A 3NVQA 1UH4A 1MHHB 3WFBL 1ORQA 4JDTH 4UB0H 3KPRB 4WI5A 3O8XB 1I9RH 5HY9B 1T21B 2ARWA 4YXHH 2QSCH 2A9NH 2YKLL 3S37L 4J3TA 2JIXA 3X12B 1U93B 2GYSA 4UT9H 3HZYA 4Q0XH 1F4YH 1HK6A 4G9FA 1NCCH 3ULUH 2YEZB 4QXUH 4XPHL 5DK0A 5L6YH 4CL7A 5H2BB 1CFQB 4LSTH 5FB8A 5IKCA 4LLWB 3TF7C 4HAFA 4LFHG 5HPOA 4C56D 5M95B 3G9VA 1QG3A 1SJVA 3OSKA 3N85H 2DLHA 3HZMA 1Q9LB 2XPGA 4PTUB 3QCUL 3U0PB 4PJIE 4CU6A 3SDXF 1IT9L 3N1FC 1MCPH 4LGPB 2VZ1A 4R96A 3MLWL 2JJUA 4AK1A 2G2RB 1IC5H 4XWGL 3KPMA 2C9AA 3TT3L 4PJEB 4YBQD 4X6DB 5C1MB 1X9QA 3E2HC 4MQ7A 4L9LB 4QTHB 3WNOA 1JE6A 2HA1A 5DDHA 3MLTB 4KKCD 5L88H 1ZEAL 2I5YL 3IXTB 3L3HA 2JCCA 2DD8H 3C08L 3VWJD 2WSKA 4MJ2A 3IAPA 3PWPB 3WN5C 5JW4Q 4YAQB 3U0WL 1OGAE 1U3HC 3P9LB 4NKOB 5C0AE 1A4KA 4WWKB 4EVNB 1ZT7B 2LAGB 2BVEA 5IFJA 3BO8B 4M48L 2YWYA 2FZ3B 1EGJA 2W60B 2FJGA 3GKZA 2ATPB 1UVQB 4MXQD 2H2SD 3B5TA 3MYZA 4I3GA 1BQHG 2I9TB 4QXTA 5E2UH 1J05A 1KJ2B 1VENA 3G04B 3I6LE 2BY0A 4LAQH 5HJ3A 2HJFB 5EU6B 1T20B 2BOBB 3I50H 3LOWA 3LQAL 4H8WH 2P5WA 4WEMB 4WO4C 2VUYA 5ETUB 2L4OA 2F74B 4HCRA 3V0AC 2A6IB 3FB5A 4BFIB 1DE4A 4YHZL 1AGBB 4U6TA 1HH9A 4WFFD 1HZHH 4MB3A 3L3JA 1U3HD 2R2HA 1MVUA 1DN0B 4KROB 2XIDA 1HQRA 1KJMB 5F1IA 5TE4H 5DJ8B 4WFHD 3X3FL 3CXHK 1A4JA 5HHXH 5CEXB 5D2LE 2YC1A 2EYTB 4HIXH 3SDCB 4YHLL 1BIIB 4XPBH 2IPKA 3O2WL 5AZEH 2VXTL 3CFCH 4Z7WA 4JCLA 2IFGA 5CZXC 4OZIF 3C6SB 3WFHA 3SBWC 5T3XD 4KQ4H 5DHYB 3ZKMC 3TBSA 4JRYD 5C0NC 3HRZB 1FL3B 3FOMA 3L9RB 3H8NA 5DO2D 4JZOB 5KSBA 2DQGH 1P4IL 5HI4D 2YRPA 1IGYA 4PRDA 5ISZD 2C3VB 3GMOA 1T7XA 2D4FA 5HHVL 1LP9E 4S11A 2OI9B 1A5FL 4G6FD 4YO0B 3ULSB 1DEEA 3ROLA 2FH6A 2R0KH 2DWDB 3MRMB 4JZNB 4GT7A 5IMLA 5ACZB 3BD5A 1DBBH 3SDYL 2W0LA 1NBVL 1J88A 3MV9E 1JPSL 3PV7A 5DJZA 4JDZA 3BH8A 3BEVA 3OKLB 4O2CB 1FH5L 4JFDB 2EECA 4OM1H 4LMQE 5IW6A 1TJHL 3P9MB 5MP6H 4PJDB 1CDBA 3SJVD 5J9PB 1HH6B 2H3NB 3LN4B 2X4OA 1NFIA 4TQEH 5CEZH 1T0MB 5EOCJ 5HHOB 5C0ND 1DLFL 1F00I 4E5XB 2DKUA 5E00A 3FFCB 3K46A 2HLFC 1HWHB 5DEGB 5I17B 4Z8FH 3GI8L 5ISZB 4R8WH 4N0CC 3MRPA 5DUBB 4MA8L 1M4KA 3D69B 4G8GB 3QR2A 1KEGL 4QHUA 1NUNB 2ORBH 4ONFH 3NA9H 4PJ5A 4OV6F 3S88H 5EB9A 3EHBD 1HHKA 1A6WH 2NPLX 4CMHB 2FX7L 2ADJB 1I7TA 4Z7QE 1ACYH 4XAKD 3U83A 2VLJB 1S7SA 4LAJH 3CLEH 1KB5H 4GXVH 3BEWA 4FQXB 1T7ZA 3JBG7 1RK1A 4X4XB 2A6DB 2E3VA 2D9CA 5CUSL 4ODWA 3IFLL 5JDSA 3WIHL 1KIRB 4RIRB 4OZHA 4B7LA 1XF2B 5EUOB 5C3TA 1XR9B 5J12B 3LZFL 4X99A 3MRBB 4L4TE 1I1FA 4GW5A 3TZVA 3UTTE 5C6PB 1DL7H 2IBGA 1NFDF 4ODXA 2GTZA 3GGWB 2P5WD 1BGXH 1DR9A 2FO4B 2VNCA 4U6XA 1KLGB 4L8SA 4MJID 1R3JB 2ZP0T 4S1SH 1A47A 2VOTA 2QKIB 3OF6A 3I3EA 1QHOA 3INUH 3WFBH 2XZQL 3NFPA 4HXAL 5HHNA 5AG9A 3ORJA 3BZ4B 2XT1B 4I0PB 3X11A 3SJVB 3TFKD 1I9RL 1H3PL 3GMQB 5KSVA 1L7TH 4PLKC 1J0ZA 2EC9T 4M43H 1I9JH 4B5EA 1D5BA 5IHLB 4NBXB 4BH8B 2D7TL 3RY4A 1I3VA 4U1SB 2DQHH 5DMGC 4Z0XA 1P6AB 5JLZA 1BD2E 2LVCA 1I3RA 2VL5A 1KCRL 2VIRB 3BXNA 5L6YL 1ZSDB 2WBKA 2E6QA 4JKKA 1KB5L 1LEKB 4P2RB 4Z78A 1S3KL 3MRJA 3BRFA 2WANA 5IBLD 4Z7UF 4OLZH 5KJRH 4NUGH 1S8DB 3D2UD 4MXQC 1G7MA 1NSNH 5J1SC 3CFDA 5K9OB 2OTWB 4EIZC 1UB6B 3EO9L 5IEHA 5HVFB 4RWYH 1N8ZB 1TLKA 3FL7A 3I02A 5GRVL 2FJHB 2VLKA 3LKRA 1IM3B 3S35H 2AVGA 2ZUTA 4U3CA 5FGCE 2HT4C 4EJ1C 3W5MA 2AJSH 4OKVB 1ZAGA 4LLMA 1U8NA 4XH2B 5JIKA 4JFFD 3Q3GA 3HUJA 4TPRL 3MRNB 3OGOE 5C0BA 1U92B 4WV1B 3RY5A 5E08L 5F21B 1QEWA 2NZ9C 4NC0B 4G6FB 1I7UB 4XPGH 2H8PA 1YN7A 4LEOB 3SDCC 1M71B 1L9MA 3L7FB 3NA4A 2BCKA 2R2EB 5I1KL 5DQJA 3U6RB 1N59A 3VH8A 5FFLA 1KIQA 1QSFE 3EAKA 3HMXL 3VXMA 1TZGL 1S9YB 2AJYH 1IAOB 3MROA 3X14A 2FECI 2X89D 3KHOA 1W0WB 4I13B 4NQXA 3IKCA 3ZE2F 3EDEA 4AEFA 4YGVB 4UUJB 3ARWA 2IFFH 3MRGB 3TZVC 2I07A 4PGEA 1CBVH 4O5LH 2X1WL 1SJEA 4R90H 4FQLL 5BJTB 3VH8B 2WBJB 3JUZA 1OW0A 4R6UA 3C2AH 1EX0A 3LQAH 1AH1A 4HS6A 2FCBA 4W4NA 3OJDA 3QWRA 3IRZA 2Z9TA 4LCWD 4GLRI 3V6OE 1QRNA 1WV7T 4RFNB 4U33A 5IEKB 4QTIL 2VLJD 3CFBB 4HBCL 4MB4A 4M9PA 3HRPA 1RIVH 3QPQD 3VDBA 1RY7B 5GS0H 4D0BA 4Y2DA 1WBYB 3I85A 3U7WH 1KCUL 4O02L 1U42A 4LSUH 1VGKA 2I07B 2NCMA 3T0XA 3FN0L 4GAYB 4JM2F 5EO0A 4WWKC 4NQXB 4LU5H 5DVKA 4JM2D 2CXKA 1IM3A 4W68A 5E6IB 4YWGH 2F9BT 3U0TB 3KPQB 5C86A 3QUYA 3P3YA 1N8ZA 2J12B 5DURD 4HFWB 4YIQB 3TZVD 3ZE0F 4OIIH 1SEQL 1D9KD 4YDJA 1ZT1A 1M71A 1Q9OA 1G7PB 4Y19E 1I7UA 1OCWH 5J57B 1Q72H 4P48A 5C0EB 5FUCE 2H26A 4XXCA 3EKCA 4QOKD 5AAWA 1YNTA 1EEYA 4FP8L 1CE6A 1MFNA 3TVMA 1UM4L 1K5NA 3IKKA 1LK2B 1FZKA 3HPLA 4HKBA 5DD6B 2A73B 5GSVA 1JPSH 2ZG1A 4FTVD 3RVUC 1FH5H 5DXWA 2QKIA 1IFHH 1CICD 4XCCL 4NWTH 3EFDL 4ODUA 1BFVH 4L8SB 2LU3A 1Q1JH 2XQBL 2VZ3A 2YD5A 3UXFA 3A67H 4FXLA 1JVKA 3HAEH 4XMPH 2FB4L 4IIQB 5I8CA 3FONB 1RJCA 5LXGL 1J1OH 4HUVA 3G6JF 3D6GA 4CN6A 5FDWA 2FX8L 3OR7B 3WFDH 3T3ME 3MR9A 5E2UL 5FUCC 4HKXA 3GMNB 2CIKB 5DJ6A 2AXFB 4RIRA 4LSRL 1A1OA 3M17B 3MRRB 1T83C 2YBRA 4OTXL 4UMGA 1Y6MR 4PBVC 4Y1AE 5F8QC 3T0DA 3JWDC 4BH8A 1LP9A 3FRPA 5JR1H 5EU4B 5DJ0B 3FQNA 4JRXB 4I4WA 4BH7A 3F7VB 2LU7A 3TGXA 3QFJE 1IAMA 3P4LA 5EFIA 1YUHB 4X6CB 2HRPH 4J4PC 1CLZH 5FO9B 1OTUD 2RJMA 2WQ8A 5JPMB 2J4WL 4U6HB 2J7LA 4OKDA 2UWEE 4HPOL 5BW7A 5B3JE 5T1LB 2MNUA 1AD9B 3LS4H 4XI5C 1YA5A 5FM4A 4KAQH 4XWOC 3CFKA 2FO4A 5IROA 1CR9H 4G8EA 2PO6A 5DJXB 3HN3A 3QDJB 4M7LH 5FGBC 1S9XB 4LSPL 5BV7H 1WISA 4HS3A 3QDAA 3RP1A 1LO2L 4M93C 5JA9A 3G6JE 1U2CA 4FQPA 3ABZA 4EI5C 4JGMA 3PJSB 4JM2A 1G9NC 4HKJB 4KC3B 4IJ3B 4NSKA 5JIPA 3GJEA 4KXZI 1T5XB 2QQNH 3QDME 3FAXA 1RZJL 1JGVL 1BLNA 4IOFD 1BAFL 3D18A 1MFEL 4OLWL 1FORH 5E6IC 1DUZB 1AD0B 1OB1B 1YC8A 1KACB 4XGZA 4YHYC 5L7XH 3EW3B 4JFFE 2WWMC 3EO0A 3N1GC 1QSVA 2ITDA 2CK2A 3KG5A 1EFXB 2R0ZL 4F3FA 4WGWB 4PJ7E 1T03L 4PRHA 3STZB 1FGNL 1KIPA 5D1QC 3U4EB 4ZTOH 1H0DA 2DQTL 2Z31B 1FYTA 1BZ7A 2ENSA 5D5MA 4AEHH 4UIKH 1MCNA 3VXSA 5CKGA 2WW8A 5F7FA 3DYMA 1RZIA 5TE6L 4PJXE 3DWTA 2E27L 4U0RB 5GS1B 2EXYD 3RX7A 3GMOB 1AP2B 2QR0B 2HJKB 3ELAT 2EE3A 3T0EE 3ZZ1A 4OQTA 1H8OA 3GSNL 2HT3D 1MREH 4H88L 3BKMH 2HN7A 4JKLA 4TULH 4JZOA 3L95A 5KSBB 4XGZB 5FYJL 1HH6A 2E9WA 1R3KA 2K9UA 1MFCL 4IMLB 2PKDA 5K59F 3BRGC 1JF5A 3E0GA 1RZFL 3BDYL 1Z9LA 3FN3A 4G8FA 3WFHB 3LIZL 5IW6B 5LG1A 3SKJH 3ZKNC 4NO0A 3JUYA 2H41A 3GI8H 3JXAA 3WIHA 1A14L 4O2CA 3GSWA 4R0LA 4ZFZB 4DEPC 3N1MC 5JZ7C 1QYGH 4U1GC 1BWWA 5I1IH 4U1IA 1JF1A 2DQEH 4GKZA 2OS7A 4J1UB 4NKIL 4E9LA 4Z7VE 2FWOA 1S7RA 2OL3B 1N7ML 1KJMA 5F1IB 3AAZB 3ZTNL 1BJ8A 2P24A 4FQQB 4G8EB 4YFEA 1BJMA 1BX2B 1KBGL 3ARPA 4XTRD 3S3PA 1QACA 4M02A 5JUEL 3NIFF 3STBA 1AGDB 3REVB 5FO9A 4ZQKB 5J1AA 1MCBA 3CLEL 3MA9L 3ARDD 3OR6B 4GBXB 2ADGB 4HGKC 4DN4H 3MUHL 2OSLA 4ZTPL 5HYIA 2UYLA 2NTFA 1F4XH 3ET9F 3OGCA 4F9PC 4HIJA 4M03A 5J12C 3QH3A 1DBML 4Q9QH 3D3VB 4WENB 1V7MH 1NMCC 5DRXA 2JB5L 3GDBA 4QXTB 3VGAC 4JM4H 3ARRA 5DJ6B 2KQMA 2MKWA 3EZJB 3MLZL 2FYYB 3BZFA 4HJ0C 1I8IA 1S5HA 4FS0A 4FMFA 4J6RL 4J3SA 3OB0K 2X4TA 4PYHA 4CNIA 1SJHB 1TQBB 4ZODA 4W4OC 1I4FB 3B9KC 4MQXD 3ULVL 3NZ8A 3QEQD 4HJJH 5KSBF 2BY1A 2DTML 2EYSB 3IB4A 5JOPE 3EGSA 4GKNB 3QEQA 3LN9A 1QYGL 5KS9E 2XZQH 4OBSA 4LSDA 3FB5B 3U1SL 4CMHC 4I0CC 1GHFH 2RFXA 3BP7B 5ITFB 3AY4A 3BSZH 3ZTNH 3KJ4B 2E7BA 1SM3L 3IJHB 5D7LB 3U48A 1QLFA 5I9QB 3EYFB 3K4ZA 4JPWH 3KPSA 3VFTA 3P0VH 4U3XA 3O4OC 1GOGA 3OX8A 3PHQA 4M7JL 5J8OA 2EDWA 3BZDA 4ORGA 4JPKH 1CL7I 5FYKD 1ZHLA 1RI8A 4NN7C 1ULVA 5IF0A 2GK2A 1U8HA 1MAMH 1X5JA 2NZIA 3MV8B 2X9XA 1TMCB 4X9FA 4NDMA 2VWEC 4C56B 1UM6L 5DVNA 3LH2L 5E8EA 4JZJC 3HB3D 2ESVD 5C9JB 3LKNB 3HE7D 3SE3C 4YAQA 4LHJB 2AK1L 4S1DD 2V17L 4L9DA 4GQ9L 2GITA 1CFVH 1GC1H 4NNYB 1H3TA 4FQ2H 1RUAH 5I1LA 2RAMA 1MPAL 3S34L 3ULVH 4KFZC 4PUBH 2OK0L 4J4PD 5IJVA 4HUWB 5C07B 1U8MB 3MJ9H 2WAHA 4NIKB 4IM8A 4NCDA 4G6AC 2YSSA 4M6NH 1GHFL 4NQDB 1ZMYA 3MUZ1 4IOFC 4BZ2H 4PJHB 2BJML 4JFHE 1MHHA 1PJ9A 5FEBA 5IEKA 1OP5K 3C8KA 3SE8H 1S7XB 2XA8L 1G1YA 1EZVY 2EO1A 2SEBB 1FIGL 2CRIA 4EI5D 2MCPH 1GSMA 4P5TD 1J10A 3FO0H 3S96B 2BNRA 4F80A 5DSCB 2VZSA 1E4WL 4PG9A 3RWEB 2VKWA 5FB8B 5IKCB 4UBDC 5H94B 2NY0D 4S1RL 1OY3B 1UCBL 3L5WA 4CMMB 3MJ6A 2DYPD 5L8JB 1YEJH 3KYKH 4XXDB 1NEZB 3BPNB 4MDIB 3O3BA 2OXGA 5DC9B 1KIQB 3FO1B 4S1DC 5HHMD 3ULUC 4I5BA 1TPXC 3EJYC 3O6KL 4Y19A 4RGNC 4OCXH 4NKDB 3MLWH 5J6HA 2XKUA 3OV6A 1J8HE 4JO3L 1IGFH 2BMKA 3UTOA 2DWEB 3TT3H 2V17H 5CJQL 4GFTB 1I7RA 1U2HA 3QO1B 4OLEA 3GI9H 3V8OA 2JJWA 5FYLH 5DZLA 1TIUA 4AH2B 4G6AD 1S9VA 1WWWX 3VD7A 3J7HA 4PJFE 4PJ9A 5FYKH 4WFEE 2CMRH 2BNQA 1OAYL 4LRNH 2IH1A 1ITCA 3JV4B 5DJAA 4FXGA 4FTVB 3ZKXB 5KVEH 2XNAA 3STLB 1JGDB 2W0FB 1KLFA 4LRIC 1OVZA 3O11B 3U0WH 3CXDL 3SDAC 1N6QH 4OCSL 3MXWL 4QWWC 4PV9B 5JQ6H 1XFPA 3VFGH 4AH2A 5KG9A 1HIMH 3QO1A 5D7JB 4X5WB 5BZWA 4NBYB 3MACH 5KVFL 4YDVA 1PD6A 1RZJH 4MAYC 4YUEL 1YNLH 3QUMH 2BOCA 5ICYB 4FQJH 1KOAA 1S8DA 2NZ9D 3WFZA 5EUKB 3V6OA 2XQYG 3KR3L 3ULUD 5EU6E 1IQDB 2J8UA 1J87A 3NTCH 4HF5L 1JNLH 4LHUB 1KXQE 5EH1A 4PRPD 4YPGA 1EHAA 4P5TB 4XVUD 4YC2B 1UKQA 3SDDB 4Q6YA 2AQ2A 1FDLL 1UM4H 3S35L 3N06B 2DYPA 3AS3A 2DQFA 2E6PA 4Q58C 3NBNA 3JTSA 3NAAH 2OQJB 5JXAH 3AS2A 3B3IB 1UXWB 1MHPL 4YQXH 5F9JA 1BF8A 3C60C 3O6FC 1INQB 2D0GA 4YEEA 4DQOH 2P5EE 1U8MA 1ZKAA 1FG9C 5KN5A 1CICA 4LPYA 3G5XA 1VACA 4TULL 2FH8A 4RRPA 3P11L 4I3SL 5D9SB 4MD4A 4YHIA 4BSVA 2FD6H 4ZFFB 2MOVA 5CGYC 3U2SB 5C0CA 3WEXB 1IKFL 3ZYIA 3CDYA 1GGCH 4W4OA 1PKQA 4OZIA 5C0CD 5L2KB 5JOPD 1FNEB 1JV5B 1AGCA 3DVGB 5DLML 3IJSB 4JN2B 3BAEH 1M1SA 2YPKA 4TNVF 4X4XA 2ZSWB 1XCQA 5KS9F 3SDDD 3TP4A 3MYJA 3DTXB 4GMSL 3K1DA 4WWKD 2R69H 1KNOA 1P1ZB 1P7KB 4AG4H 4JLRB 4PRIA 3JZ7A 4HMCA 4OLUL 5D6DA 4IEFB 4WHYG 4HHAB 3IFPA 5E95B 1LD9B 3BHBB 3MLXL 2ICCA 4KJYB 3T2QA 4DZBA 1EHLL 1QLFB 5GRUL 2ZUQC 3D69A 1Z6JT 4XCYA 1INEL 5F96L 1FP5A 1RUKL 5F9AC 1TJHH 2QQNL 1FNFA 4DAGL 4YHPA 2N1KA 3U7WL 1XT5A 1AXTL 1HCVA 4DKEL 3D39A 3FN0H 2EYSA 3V79C 3O4LA 3PQYD 1NFIB 4I0KA 2OI9C 3LEYH 1AO7B 2VO5A 4JKMA 1FLRL 1EAPA 4P4KA 5TGBB 5CIPA 5DMJB 4EDXB 1A1NB 1DLFH 4N9GA 4LKCA 3SKNA 2D0FA 4Z7UB 1I1YA 3IS1X 3KWWB 4Z8FL 2UZYB 4Y5VA 2PYEE 3WUWA 1T03H 3LRHA 2BVOB 4K3EH 2XYCA 2IPTH 1MRDH 4KDVA 2W38A 3I6GA 2XN9A 1BBJB 3BAEL 3MXVL 4PBXA 3ULVD 4H8WC 2P8PB 1TZHB 4P3WA 4JFYA 1OAQH 2OSLB 1R0AL 2VZOA 1G6RH 3BPLC 3U9PH 3GMLA 3JV5A 3M45A 3SKOA 3KYNA 1A6WL 3PQYA 3LQZA 2NY0C 5ENWA 1KTLA 3B5HA 4LQFL 1QTYT 4ZQKA 5J1AB 3FN9A 5F3BB 4Z7OF 3C60B 3O6FB 4NRYB 1I3UA 1GL4B 2VDOH 5CEYA 4YDKL 3U4BL 2R1YA 2J5LC 1MRFL 4BFBD 1QHPA 4KJQC 2JJTC 1EERB 3D3VD 2FATH 3PWLB 3GNMH 2ICWI 1CVSC 1DFBH 4O2FB 4HJGA 4NM8L 3TJHD 4GUPA 4ZUUB 2JLLA 2FIRT 3PWVA 1OTUC 5KANG 2FO1A 5HGDA 1MCQA 3GO1H 5GHWH 4ZFZA 1C5CL 1H8SA 3ZLQC 4G6MH 5EUOF 3C6LA 3C6LB 5E8PB 2VMFA 3WNKA 5C07D 3KPRD 1PG7H 1ZTXH 3RJQB 4PGCB 2MPAH 3DV6B 3PWVB 2HKHL 4PJ7F 4ZPVA 4JG1L 1BGXL 2ZSVB 4LSRH 4O2FA 5F7KC 5DYOA 2V2XA 1Y6KR 3OHXB 3OB0H 2CIIB 1A6VL 1DN0A 4S1SL 1NCAH 3IDJA 1MVUB 1N5AA 3IDNB 4F37F 4TTDD 2OR7A 5I8OL 5ILTL 5ESQB 4APQC 3IJYA 2MQ0A 4K7PX 1IC5L 2VRAA 2VXSL 4XWGH 3B4NA 5GGUB 3BT2L 1R5VB 2A6IA 1B0WA 2QL1A 4XBPA 2V9TA 3PQYB 4OLYL 3WKMH 4LCWA 1M6OB 1TNMA 4TUJB 3H42H 4HUMB 4QWWD 4PBWD 3T08A 1FYTB 2DQJL 4PS4L 3IDMA 4A6YA 3W11C 2QQLH 4LASL 3RVWD 3O0RH 3HAEG 4P2OA 2WWKT 1F8TH 5F7HA 3VGFA 3PIQB 5D1QD 2ITDB 2I9TA 3ARGA 3IAQA 3QA3A 3TC9A 5KVMC 5DD1H 5E99H 3VDAA 5H8DA 1LHZA 1LE9B 1JFQL 4H5SB 2Q1EA 2H32H 4R7DA 5IVXA 2V7HA 1BVZA 4CVXA 1CF8H 1DEDA 5GHWL 3SO3C 5GS0D 5IFHL 4UT7L 3UPCA 3ESUF 4CVZA 1Q0YL 2GFBB 3JTTA 3MZTA 4PJDF 3OJMB 3O2VL 5L9DL 3VFSB 5TDNB 2FIKB 3RBSA 2EIZA 1AXSB 5CJQH 4X7SL 4JG1H 3BSZL 1YDPA 4QRPE 1Y0LA 1GYAA 3G9AB 2KZ1B 4ZAKB 3RVTD 3ZO0A 3DO7B 5GGSA 1T83A 1XH3A 4U05A 3TLRA 5DZOA 4JFXA 4D0CA 2J88L 1QSZA 4LSQH 5CGYD 1BVKA 1YQVH 5FKPB 3AXLA 5D70L 3TT1H 3QNYB 4QTHA 5K59E 4MVBC 3CXDH 4NQVA 4WFHE 2APTA 5AZ2L 4U6HA 5A2IH 3HC3L 5C0BD 3V5KA 3VFGL 1QFHA 3NPZB 4ZS7L 3C5ZD 3AU1A 2OTUA 3DRTA 4BH7B 4NRXB 3QQ3A 1FQ9C 2ZSWA 3DUUA 1Q9LA 4RX4D 3WD5L 1AR2A 2XV6B 4LVNB 4P2YA 2OZ4A 2GJZB 3PGFH 1TDQA 3SO5A 2R0WL 3AUVA 1A21A 4YNYA 4U4BA 3RTQD 1TZIA 2YBRB 3IU4L 1PLGL 3P30H 4Y16C 3F12B 4I18B 4JHBA 1PKQB 4OZIB 1TVHA 1MFCH 2AK1H 4P46D 3O2WH 5AZEL 3HTLX 4ZYKB 4ZO9A 2W9DH 4M7KL 3IFOB 1FFOB 5GGQL 1U8OA 3QULB 4X0KA 3RNQA 1D5MB 4XNXH 1XAUA 4Q9CA 5I8KH 3WSQL 3PWNB 2ZCKH 3Q5TA 2EEDA 4NGHH 1A14H 2NY3C 3RPIA 5GRWA 4AY0A 1EXUA 1QRNE 3RGVB 3MNVB 3SN6N 4OI8A 1HCFX 4ALAH 1UB5A 3ARXA 4OJFH 2XFXB 3EJJX 3RZCC 4K55A 4R7NB 5JXAL 4LOUD 2DQDH 1HOCA 2ZZUT 3MLUL 3GMPA 3RPKA 2A73A 5GSVB 4JAMA 1A9BA 4YR6B 5FKPA 4PV8B 5CEZE 1TJIL 1QO3B 1ZGLB 5IFAL 1JGUL 2P49B 2YD9A 1TETL 4NM4H 2CUMA 3VFWA 2Q76A 1JWSB 5CJOH 3GJFH 5JNYA 1CDHA 2IBZX 4PJAF 4YWGL 2FJFA 1G7PA 2ZJSL 3VWKA 4F58H 4Y7MA 3WIFB 4ELMA 5IESH 4QRUB 3F7PC 4OZFA 3W9EB 4XZUB 5I16B 1DZBA 3MBED 4PRIE 2QQKH 5D7KD 3RNKA 1YNKH 4U1NB 4K94H 4APQA 5HVHC 2ED9A 3ARBB 3CX5J 3HUJE 1D5ZA 1MF2H 5SV3A 5DJDB 4KUCF 5HHQA 4JKPL 4GAYA 4NP4L 4P2CG 3V5DA 5JW3H 1OLZA 1S7TA 1IZJA 1K8IB 5DRNA 1U3HA 2IQ9H 4ZMAT 3O3UN 3D85B 3SGEI 4OD1L 3T2OA 1RIHH 2PCPB 3KVQA 4WWID 4XBPB 3HE7C 4PRHD 3S88L 5T3XH 5D72L 2IANE 4NCC1 4X6DF 4PJEF 4L8BA 3CLFL 4CUCA 1KYOK 3FTGB 5MERB 1HHJA 3NABH 4XCNA 1FAKT 4HWUA 4PGZA 4Q74A 2VDLL 4NKDA 2WQRA 1OWWA 4P3CH 3SDXB 4GXVL 3PNWA 2GT9A 1INDH 1SY6A 1F6LL 3RJDA 4GSDH 4ZPVB 1Z3GH 5CSGA 3MRGA 4LP5A 4EI5A 4MCYA 5KVDL 2P48B 2CKNA 4NO2A 2RCSH 1QFPA 2YRLA 4QRSB 3ZT5A 1MCOL 4WHCA 3MROB 1FJ1A 3L5HA 3HPJA 4NQED 1LP9F 5HGDB 2OZ4L 5TF0A 4ONHB 4GUPB 1UENA 5DQJB 2DLTA 1LGVA 4MWFA 5F6HI 3FO2B 1OAQL 4NQTA 2XZAH 5F7MC 3RY6A 4FQ1H 2JE8A 4Y88A 1B3JA 3L3DA 4P2OC 2H1PL 5ADOL 4OBRA 3QDJD 4NRZA 4EZMA 4NQEB 1LNUA 1MFBL 4QHMA 1QEWB 1JYXA 3QZWG 2QEJA 1E27B 4OFKA 4X5XB 3BVNB 1N3NB 1CGTA 4G3YL 2OJEA 4WV1A 4JZJB 3FO9B 3UROR 1QPXA 1CK0L 2Y5EA 3CU7A 5JHLL 1YEIL 3EUUA 4GAFB 2BSED 4XPAH 1U8NB 4XH2A 1JRHI 1P4LA 4FXKA 4M62H 3TV3L 5CSZB 4DZ8A 2BC4B 3GHBL 3IF1A 4MMXC 2VXVL 2F53A 1ZE3C 1K3ZA 2BFVL 4PRBA 1P84J 2Z35A 4LP4A 1C7TA 4LPVA 1A7QL 3EYUL 2Q7YB 1MFEH 2HJLB 3FFCD 4Q7DA 3KWWA 5DLMH 5D6CA 3IDYB 2N7AA 3SKNB 2YZ1A 3VGDA 4P4KB 3EHBC 3UTPD 4WDIA 2Q20A 5KVDH 4WTWA 1J8HA 3SJVE 3KXFD 3DURA 4NWUL 3GSXB 4N0YL 3RDTA 1T4KA 4DKFH 2WUBL 3ARQA 4P4KD 2R15A 1X4XA 3F65A 2VLRE 4KMTH 1SYVA 5D96C 2ZCLH 5KSVB 2B1AL 5I73B 3C6LC 2X7LA 3T0EB 1G7HB 4L3EE 2QLVB 4WEBL 3X11B 1AO7D 5C8JB 3BHBA 5E08H 1MH5B 1AXTH 4M6OH 3QHZH 3QDHA 1H3GA 3OAYH 2ARJQ 3R0MA 2DICA 3RWDA 3O8XC 1CD1A 3GGWA 4CU8A 3E3QC 3S37H 4JJHA 3PDGA 5IVZB 1R24A 2ZUUA 5C6TL 4OGYL 2ZUYA 4CNIB 4ZUTA 4G42A 3MRBA 3LIZH 4KDTA 4YUEH 2K7PA 2Q3ZA 3UTQB 4JGJA 3BKCL 4BK5A 3CH8A 1KIRA 1IC4H 1QR1B 3LKSA 3U2SA 4TUOA 1P4IH 3QH3B 2BC4A 4NQCD 3UJJH 1SJXA 1JUFA 2VXQL 3QEGH 3MOAL 2C1PB 1G7QB 4EN3B 4HW6A 1HDMA 4LIQE 3BEWB 5J13C 1S9WB 1CWVA 4JY6B 5F88A 3MA7A 1GOFA 3DJ9A 1KBGH 3QIWC 2R4SL 1CTOA 3UJIH 1AGDA 5BO1H 2F5AH 5IT2L 1LDSA 1YJDC 3U46A 1DBBL 3SDYH 5D96B 1B4JL 3L3OB 1JHTB 4QTIH 4DGIL 1BX2A 3VJ6B 1GGUA 4OI9A 3VXNB 3V4PH 1EK3A 1KC5H 3TNNB 3B3IA 4Z7WE 2VJXA 1J0JA 2VISA 1EH9A 5EZOH 3RVVC 1IM9B 3CIQA 4RFEB 1V7ML 4F7EB 5ISZA 2XKNA 3MCKB 5FV1L 3CZFA 3R8BB 4AYFA 3MUGB 4J6RH 5HHOA 3OJVC 3VXMD 3GMRA 4YE4L 4OCYL 5IB2B 4MJIE 5I76B 4KI5E 2BP3A 4NO3B 3SDXA 3QJFA 4L1HA 2C4XA 2CR3A 3IGAB 4PJDA 2J5LB 3PP4L 2E7CA 1B4RA 1NC4A 4ETQA 5CCKH 4XC3H 4KI5F 5MHSD 5EORL 1XEDA 1E4KA 3EJZC 3ARDA 3EYQD 4LQ1A 4XT1C 4FRWA 4AT6B 3BH8B 5JXED 5HHMB 3MOAH 1JNHA 1YEHH 4D8PA 3QUZC 5B39B 2PCPA 2OM5A 4GRMB 3ZKQD 1LMKA 5BO1L 1RZ7L 4JPKL 2F53E 4QLRA 1KIPB 5HVWA 5IB3B 1K8IA 4C4KT 1AHWA 2P46B 1N5YL 2ADIB 3O2DL 5IV2A 1OF2A 2DBLH 1BBDH 2W9LA 3MGOB 4C56E 1H15B 2ICWA 4NWTL 4NPYA 1SEBA 5IUSA 3KGRA 4K7FB 3RNKB 3RZCA 5I66A 1NAKL 1XGUA 1OGAA 4P4RA 3BKJH 3HI6H 4KJWD 4XNMB 5CWSA 1KJ3H 2DTSA 1BWMA 5DGRA 1ETZB 4L4JA 4YDIL 3CDFA 3KPSE 3QFJD 1AKJB 1OW0C 5I18L 1YQ2A 2K7QA 3HKFA 2EDEA 3V6OC 1RUAL 3WJJC 2EYTA 4LPXA 1A6TA 5B4MD 4WTZA 3HA0A 4F2MA 3TIEB 3HE7A 1PY9A 1TQCC 2VH5L 2LAAA 3TIDB 3WYRA 3INUL 2IQAB 3BIAX 4X98B 3AS1A 1ZWIB 2NYYC 4QHLB 3TO4B 4PV8A 2DQGL 3QXUA 3KNBA 2A2QT 1RZKH 4JAMB 1MCWM 4LSSL 1X6LA 4YLQT 5C09D 1QA9B 4YEFA 4Q97A 4NQDA 5F7YC 2X70B 3LS4L 5LQBL 1H5BA 4HC1H 4AENB 4OGXL 2VDKL 4IRJC 3PDOB 3E2HB 3FFCE 3JV0A 1F3JA 1Q9KA 2HT3C 4LSPH 3RDTD 3C5JA 4JDVA 4YHNB 5HVHB 1XGTB 1RUQL 3QUYC 4UDTA 3IU4H 2BVUA 5E1HB 4GSDL 4L8DB 2EYRB 4KPHH 3IXAA 4M7KH 4NM8H 3WS6A 3W9DB 4GQPH 3CK0H 5KSAC 3QFJB 1G7JA 3BISA 5I8KL 4BZYA 5I1CH 4HUVB 5TDOB 4QXWA 1NDGA 5ESAA 4IHOA 3Q5YA 4QOKB 4OV5A 1RVFL 1UWEH 4U31A 3DXAD 2VLJE 3TVMD 4TQEL 5CEZL 2OTUB 3OKDA 5FYJE 3RKPA 5CINH 3ARSA 4P4KC 4P2QA 5EOQH 1MVFA 4L3ED 3FZUC 3KPNA 5JMOC 4YZFF 3KJ6L 3VA2C 4OD2B 1FL6B 1XF4B 4NQVB 3S4SA 5IQ7L 3FQUB 3EYOA 4JO1L 2ESVB 3DVIA 4M61B 2R1WB 1RK0A 3MLTA 1CK0H 5HI3D 3IJHA 3BYTA 5D7LA 2G9HB 4LLDA 2O5YL 1FL6A 1XF4A 3BP7A 1EO8L 3RWIB 5E9DA 3KPNB 4NFCA 4POUB 3UTTB 5D1XA 4DUVA 4AM0A 4TVPE 2HFTA 1J1PH 1EBAA 4NQSB 4YDJB 5IG7A 2VDKH 2DJSA 3QEQB 3DGGB 1DCLA 3W39A 4Z7WF 4G9DA 4RGNB 2QV2A 1RUQH 1Y18B 4JY4A 4U2ZA 2QHRH 5DMIL 4KI5C 2BSSA 4ZFOL 4H5SA 2Z91B 3BPNC 5ANMB 3WN5A 1XCTB 2AEWA 3DMMC 4OFIA 3GM8A 5IB4B 3VXRE 3QFJA 4EUPB 2JK5B 2B5IB 3TVMC 3FB8B 1NBQA 1MFAL 4WEUD 4C57C 5JOFA 1NANH 5I1IL 4Y1AA 5INDB 4DKFL 1LO4L 1IGJA 2YPLD 1QNZH 3S9DB 3BD3A 1DL7L 4HBCH 1RULL 4MD0A 1KYOJ 3MV9D 1H5BB 1RZ8A 5FAAA 5HY9A 2F5BH 2B7DT 3HNTH 4HD9A 3CFBA 1NGYB 1S9KC 2D7PA 3QHZL 5CBAB 4GKSA 1HILA 1VFAB 4HLZG 4NN6C 1A2YA 1S7UA 4HS6B 1WTLA 3OMZA 5HHOE 3VW3L 4LLAA 4H26B 4XP9L 2EXWC 3WDJA 3HE7B 4LGRB 1P5VA 5F1NA 1B2WL 1N64H 1X5KA 4YJZL 1DBMH 4PRNB 5AUMA 1JI1A 4NQCB 4NHCH 3VRIA 1IBGH 5FHAL 4G8GE 3H9SB 3TJEL 3M07A 1MJ7L 3HB3C 4U1KB 5DVMA 1I7ZA 4D2NA 1R3IL 4CDHA 2KKQA 2X4UA 1MY7A 3LRSA 1OGAB 3RHWK 3F5WB 1UJ3A 3B9VA 3V95A 4NZTH 3AVEA 4WI6A 1EGJH 1OTTD 4WW1B 3OB8A 1JWMA 3F7YB 5GJSH 1LO5B 5SV4A 4XMKL 3U1SH 3ZTJH 5C2BL 5I71C 4OSUH 2B5IC 4QHKI 5F3BA 1RURL 1DANU 4XP4H 4Z7VF 3PE9A 2W07A 3RIAK 3MRNA 4HG4J 3JWOH 3MV7B 4HZLA 4BUGA 1OAZH 2H9GA 4LCYB 4M8VA 3CFJA 1DTUA 4DAGH 3BP5B 1Q1JL 2AABL 1MNUL 1T2QL 4KUCD 5GGRB 4EI6A 2EXWD 5DQ9B 5BVPH 4PJAA 4DKEH 5EZJA 1EFXD 2YA0A 1TETH 1FNHA 4AL8H 4QRTA 3DV4B 3G6DL 3I02B 2VAAA 1X6NA 5HYQB 4JKWA 4FA8A 5I1AA 4D9RD 3P0GB 4P9MH 1AD0A 1P4BH 1OB1A 1RZKC 3L5XH 3K81A 4NHCL 3D25B 5IWLA 3MRJB 2AJYL 4RBPK 4XMLH 5FKAA 4XCFH 4YFLF 2VIRA 2NY3B 3FQTB 4QXGH 1UEMA 3MCKA 2WIIB 3MBXH 4P23B 1YNKL 5I1HH 3G6AA 1NBZB 4K7PH 4O5LL 5AYUL 3LPWA 1NGZA 5BRZE 1MF2L 2ICEA 5HYSB 3C5SB 4LF3A 5ALCL 2I5YH 3O41A 4YXKL 4YBLC 3ARBC 5HHNB 1YECH 3HNSH 1G9EA 2X2YA 5DA4A 3ILPB 2CXGA 2AJ3B 5TQ0L 2OP4H 3I6KB 5HGHA 4M8QA 5DGQA 5ACMA 4X6CA 2IALB 1P1ZA 4KK5D 4PB9H 5CJ8A 1GJIA 4OGYH 4QYOB 3O41B 2C1PA 4EN3A 5FOBA 5HYJA 5DRZA 3GSVA 5BVPL 1LP9B 1C12A 4M9OA 3NCEB 5HYJD 4QEGA 4TUOB 5SX4H 1QR1A 3PWUB 5EU3A 4OZHB 3UYOD 3QPQC 4K23H 2MTPA 3X3GL 5D93C 4EUPH 1KENL 2ARJA 5C0CB 3P2TA 1X5FA 3KYKL 5FDWB 1C12B 1LDPL 4RAHA 5D9SA 1X5XA 4LVOB 5HYJB 1A6VH 2AJXL 5DD3L 3TPKA 4PJHE 3BRDA 2UWEF 3G5XB 1J5OH 5EU5B 4K8RL 1DUYA 3G5YB 3RWDB 1CICB 2OZ4H 3VXTA 2Q7NA 4GRWB 4MA3B 4R2GC 1FNSH 1ONQA 5AYQA 2HP4A 2LFGA 3ECBB 4TSAH 3RWHB 5SWZA 4G7VH 4LCCB 3K1KC 4J7RA 5EIIB 1WEJL 4JANA 3DRQA 2DQJH 3BP5A 1FZKB 1K4CB 3EYVB 1EBPA 1ZLWH 3UZEA 3HNSL 3CD4A 5ID0A 1ERNA 2XWTA 4I9WE 1E4XH 4L9LC 4P23D 1QSFA 2NMSA 4XPAL 2WK2A 4XPBL 1TQCB 1FRGH 2PTTA 5DT1H 1F3DH 4NZRL 3TWCL 3D25A 2IGFL 4CDGC 3BZEA 5HGAB 5IFHH 2D7NA 4XBGB 4NNPL 4K3JH 2VR9A 5I1AB 1XIWD 5ID1A 2J8HA 3AY4C 2CGRH 1JMXA 4R4NC 4QRTB 5F7NC 4U1KA 3HG1B 2AW2A 4PJAB 4U1JA 5IMMB 2V5RA 3RWFA 5GGRA 4EI6B 4N0YH 3HMWH 1HHIA 4FXKB 5LKNA 3UTTD 3WNNA 2Q8BL 1K6QL 4IRZL 5E2WL 1OOAA 2DWDA 3MRMA 3BP6A 4JPIA 5GRJL 2IC2A 5ECJE 2BNQB 1T1ZB 2IADB 1KGCE 3QB7C 1AFVL 4HX1B 5BOZG 4GAGH 4R2GB 5EA0H 4ZS6C 1LO5A 1I7RB 3RWJB 4Q9QL 5C0JA 4ZOEA 1FAIH 2Y7QB 4TRPL 3OJDB 2F54A 1JJUA 4MWFB 4H25B 5DC4B 4R97B 4X4ME 1YEFL 4NZUL 1I85A 1JZ8A 3IKCB 1BIIA 3LN5B 3WSQH 4JY5L 5JORB 3AGVA 3MV9B 3B9EA 1BAFH 1IAOA 5F1NB 4HGWA 1T1YB 4PJXB 1BHGA 1QFUL 3S96A 5IMOA 2NY7H 3U6RA 4BQBA 4JY4B 2R2HB 2Y4SA 1A6PA 1QLEH 5KOVC 2NW3B 2X10A 5IW1B 1HHJB 1S7XA 1A0QH 2MFNA 1Z9OA 3QIUA 5A1AA 1YN7B 4WI4A 5B39G 1NCDH 1AC6A 4M7JH 2R4SH 4U6YA 5FF6A 2I27N 1RZ8B 5ALBL 2A9MH 2R9HD 3LSOB 1AGFA 3D85A 5IJVB 4KKLD 1Q0XH 1K4DB 3IS0X 4ONGH 1P5UA 1MCWW 1F4HA 4Y1AB 1TFHA 1S7TB 4Y2OA 3G04A 2YA2A 1IQWL 5LAXA 3TJHC 3DYPA 3OF6D 5IESL 1HYSD 4P3DB 3QG6B 2JK5A 4N1CA 2XZCL 3DX9B 1D5IL 5DWUH 5FHAH 4C59B 4UTBL 3FHAA 1FL5A 2P4AB 4XNQA 3WN5B 4X6CE 4J3VA 4NDMB 1SY6H 3T0EC 1XR8A 4OV5B 4OZGE 1DBKL 4XZUA 5D7IE 5I16A 1M7DA 4GG6A 1ROWA 3BO8A 4P99A 3CMGA 5CIPH 3ZDZE 5TDOA 4JFEB 5JW4N 4ELMB 3QDJE 4RGMB 4BK4A 1ITBB 4N0FB 3P9LA 4OZ4B 2VL5B 5D1ZD 1OAKH 4UILH 1EVTC 1QFUH 1O7VA 1DSFL 4ORGB 4JO1H 3P40A 1KXVC 1QOKA 3PHQB 3BPCA 3SGKA 4UDTB 3KXFA 1RK0B 2P8MB 1ES0A 4FFZL 2VC2L 4ZO6A 3DROA 1EAJA 1EO8H 3FCTA 2PO6D 5LJYH 5CZKA 3BQUB 3GRWL 4Q9RH 4L4TB 1GOHA 1L7IL 1ZHNB 5IVXE 1TTUA 4DCQB 4G6KL 3GBNL 1VEOA 5DEFA 1MRFH 3FRPG 3C8DA 1IEHA 3KNBB 2VE6B 2DIBA 3RGVA 3GMMB 1MI5E 3CSBA 3O8XD 4PJ7B 1T2JA 1P4BL 3WLWD 3QQ4A 2WINA 3K4AA 4Z7OE 2X4TB 3GEWB 4I0PC 4Y5XC 3QULA 4X99B 1G7JB 1WVZA 1FFOA 3TBVA 4LLWA 1T3FB 3HZVB 3O6KH 3D0VA 5B38A 4JM4L 4L8DA 5I1GH 1GZPB 4IRJD 4BYHA 5JA8B 3DIFA 1ZTXL 2GK0A 3DI2B 2GJZA 4ODWB 1QFWH 4IS6B 1H9VA 2AQ1A 2XOTA 5I66B 2IMNA 4P2RE 1QFOA 3RGVD 2FRGP 3PHOA 4Q9BA 1S7SB 3MGOA 3P0YL 5KSBE 4WRLA 1PKOA 1KEGH 3RTQB 2X42A 4MJ4A 4LNVA 4WU5A 5C0AA 3L7EB 4K3DL 4EEEA 5KW9H 2FX7H 2B4CC 1GC1C 3DO7A 3SE4A 2QBWA 4JFOA 4JREC 1HINL 2DQIH 4RZCB 2AXGA 3ZL4H 4HC1L 2W1NA 4D8PB 1LEGB 1AXSA 4G6KH 5LBSL 5I1EL 3B9KB 5IJKA 4MMZC 5ELIA 1YEKH 4Y16D 4H0HB 3ZT7A 4G7YH 3L1OH 1KPVA 5DD1L 5E99L 4YBLB 4XNYL 1IGML 1QBMH 4MB5A 5F8RC 1CGWA 4NZTL 2V7HB 5D6DC 2Z31D 3LPFA 1R3KB 3QCVH 3ARZA 4AIZA 3V6FA 1KB5A 2NY4B 5E70A 3C09B 5JO5A 3EOAA 3HI5L 4JHAL 5ABDE 2HJKA 3NACL 5GISH 2W9EL 3BEVB 1GC1L 2F19L 2O5XH 1T1WA 1RIVL 4KI5D 2B1AH 5FECA 1OAZL 1CFTB 2XACC 5KSUB 3GFUA 1V3KA 4DGVH 4EDWL 2PYEA 4OIBA 5IBUG 1MCSA 3O3EA 1EJOL 1BP3B 1ADQL 2CSPA 3OL2A 3VXRA 3MRFA 3RGHA 1U8KA 3QNXB 3PHSA 2YD6A 4AT6A 4OLXL 1DJSA 4KRMB 5A3IC 3HC3H 2C3VA 2CDGB 4MSWB 1XGYH 5B8CB 1AC0A 2PN5A 4DWHA 1WZ1H 2FD6L 5HHPA 3KHQA 1Z5LB 4NC2B 3QJFB 3SCMD 1A6UH 3OHXA 1NGPL 4ZUSB 5KS9B 1J1PL 4TTDC 5GGTA 2WZPD 5DMKB 1JUFB 1W72H 4ZOBA 5C0AD 2YN5A 1IILE 3M1BA 3TYGL 4S2SA 1DDHB 1NUGA 3GSRB 3PGCB 3ZKXC 1IL1B 3MGAA 4RWHA 1WBXA 5J1TC 2G5BB 4BJLA 1CG9A 3LPGA 3KPTA 4WI2A 4UOW0 3OKMB 3LHPL 1FBIH 2OP4L 4X8JB 5FK9B 3T1FB 5A40E 1G7IB 4I48A 4NRYA 3MLUH 4HQQH 2VXUL 4KRLB 4KH2A 1A9EA 2F5BL 3WMSA 2R29H 1F58H 4JFFB 2HFEB 4P5MB 4QRRE 5GRYA 4ODHH 1YMHB 3P4OB 1KEMH 4I4WB 5DJ0A 1CGUA 2R0LL 2PTUA 4PRPB 2ICES 4HULB 3GK8H 1PW3A 4F7TA 3HHRB 5SWSE 3UC0L 1FO0L 1J05B 3CFCL 2YUXA 1KCSH 3QUXC 4E41B 5K9KA 4G43A 3B8YA 3GMNA 1CGXA 3F58L 2HH0L 3T0ED 1VERA 1W0VB 4JY5H 2EDTA 1CDJA 5I8CB 3CDGB 4KU1A 3HMXA 2W60A 3FMGL 3FB7B 2XWBA 4PJ8B 4RRPG 5D1XD 6FABL 2VWEE 4M7LT 1RZJC 2WWKO 1GGTA 4L29B 1MY5A 1MWAA 3CX2A 2FSEB 3BWAB 1MH5A 2D4DA 5TQ2L 3MLSH 3IT8D 5HDQL 5HYFA 5JW3L 1F4AA 2CLRA 2GJ6A 1DQLH 2DL9A 3MJ7A 5FCUL 1K5NB 1SYVB 1N2RB 4XB7A 4DZBB 1Q0XL 1MLBB 3VRLF 2VSDA 4N90E 4N8CL 3K4DA 2EIDA 3T3MF 4FNLH 4RAUB 3RU8H 4MQ7B 3ISWA 2OR8A 4PJEA 5I75C 2QSTA 4NZRH 4QHMB 4XVUC 5F7DA 4PRIB 1I3GH 4V1DE 1J18A 4NRZB 4HPYL 1Q9OB 2PR4H 3PL6C 3EYSH 3BKJL 2XA3A 2G5BA 3FHQA 4WUUD 4QGTA 3UC0H 4Y2DD 4LIQH 1NDMB 2HKHH 2X4RB 5L7XL 3MUJA 3KPLA 4FHBD 3T0WA 2CR6A 2YD1A 1OM3L 1CFQA 1IM9D 3TO4C 4MCYB 4I2XA 5BZDA 3V4VL 2IANB 4QXGL 1JCKA 1MLBA 2UY7A 3BT2H 4KV5E 4NO5A 3QDMB 4X80H 3PDDA 4JZJA 3NFSL 4Z0BH 1X5LA 5D8JH 3C6LD 4XCNB 4XHJC 4PJHF 4WUUA 1IAII 4ZG1A 2QADB 3BWAA 4CRPA 2CRYA 3KPRA 1SBBA 2BY2A 3MBEC 5T5NF 5BXFA 4UIMB 1U8KB 1YECL 3GIZH 3MLXH 3GSNH 5DUPH 3GBNH 1DQJB 2OCFD 3MRHB 5TQ0H 1MLCA 4JE4B 2Z93B 4AEEA 5JHLH 2WBJA 1YEIH 4C55A 2IH3A 1U3HB 1MIEH 2H2PC 2GCYB 2GJJA 3EIFA 1SJEB 4GS7B 1FO0B 5C0DA 2X44D 4YPGB 5CEZD 2VABB 3UTZB 1W72B 4ZUWB 5FOJA 3LEXB 3MRCA 1SYSB 4R4BB 2Z92B 3ZYJA 3HC4H 1Z9MA 4M4RA 1TJGL 2DBJA 5E0QA 4LDOB 3Q6FB 1NC2A 3P4OA 1IGTB 1CDYA 1JPFA 4P5MA 3MREB 3U7AA 5MEOB 4NC1C 4DTGH 5GRVK 2KL6A 2YWZA 3PWPD 9CGTA 2ERJB 4I3RH 2FDBP 5M7QA 1C16A 3IYLW 1JTPA 5C6WH 4NOBA 1GGBH 4JG0H 5F9OH 2I60H 1JWSA 4Y0GA 2XNAB 2ZOKB 3STLA 2OL3L 4XVSH 5K9JL 1G6RL 2BSTB 3VFMA 5L0QC 5E5UB 4FTVA 4NHUB 2AJVL 1R5WA 1LO0H 1ND0B 5JHDB 1YY8A 4QY8A 4TYUA 1A9BB 4PP1C 3O3DA 4DN3L 3IETA 4ODVH 3ULVC 2A6KB 1S7WB 1MHCA 1KFAH 1PZUB 1HOCB 4DFIA 4KJPD 1MWAH 4F8QA 3KYOA 1S3KH 1PLGH 3P30L 4JFDD 4HG4K 3DETD 4DK6A 3QXAA 5DT1L 3DVFA 3KPPB 4TNWF 3LDBC 5H35A 1ZK9A 4RWYL 1UZ8B 3I3DA 2Q86B 5HHPB 1Q8MA 3V5HB 4ODBD 4Z78B 3HAEA 4L3EA 2FNBA 2VDQL 4OF8A 1TTFA 3AMLA 2HG5B 2FBJH 1TJGH 2HKFH 3QNXA 3HS0A 1KJVA 2BNRB 3VFWB 43CAB 3QUZD 1TNNA 3OKEA 3CZJA 1U41A 3BE1L 3GRWH 1UJTA 1JZ3A 4P46B 1G84A 5F6IB 1JGUH 4NM4L 2VDNH 1V3JA 5TF1H 1MIMH 2G60H 2XRAL 4OLYH 1QBBA 3F7QA 4AIZB 1LO0L 4HIHA 4GAGL 1OTSD 5EA0L 1YMME 5SWSA 4PJFB 3O0RL 3UO1H 5AD0A 4X0KB 1A64A 1W72L 1J8HD 4K9EC 2Z8SA 4ZYKA 3R06B 1VPOL 3MNWB 1PZ5B 3F12A 4I18A 4M93B 2JJSC 3T65B 1YEFH 4KKLC 4YNYB 2YUVA 4K94L 1RZFH 5DQDH 3MFFA 4WFED 1NUDA 4CVXB 3QDMD 5DD5H 4NRXA 1T6WA 1BFSA 3AU1B 1LE9A 1JK8A 3MJ9L 4WCYH 1CS6A 2ENYA 4HMEA 4P5TC 5C2BH 2BX5A 1U6AH 3VE0A 4U1LB 1IEBB 2RGSA 5JPNB 4IDLA 1U8QB 3RWCA 3MZGB 4HDIA 2KQNA 3PHOB 4QHNA 2VXUH 5HHVH 3EYFA 2VKXA 4D0CB 1T6VN 3ZE1F 3MRIA 1XH3B 3QXWA 3WIIL 2R0KL 4OFPA 3KLAA 2WM0A 1FCCA 2CRMA 3SDAA 5D70H 5FF6B 3TT1L 2GK0B 3FRUA 3BGAA 1MIML 2G60L 1PX3A 2CUIA 4OAWA 1OARL 3S3SA 2Q8AH 5E24E 1MCEA 4S1RH 5E00B 3UTPE 3JTTB 5C07E 4GKNA 3EGSB 2FGWH 4OFDA 1T3FA 5EIVA 3NZ8B 5MP6L 1NCBH 3EOTH 1MCOH 4FG6C 2H3NA 4KMLB 4H0GA 4M1DL 1EFQA 5MEQB 2CRZA 3A6BH 1BQLL 2VQ1B 3OKYA 5HD8D 3ARGB 2XWJA 12E8L 1UWXH 3L3IA 5C0GB 1V05A 4P2OB 3S4SG 5I18H 4MS8D 1FYTE 3DVNA 1ZHNA 3N1QC 1KJ2H 2GSGA 4RNRB 3FZUD 4HIJB 4KRPD 4JDZB 1AI1H 3FCTB 3H0TB 3LKQB 4HJGB 4H25A 4QRQA 2EZ0D 1I75A 4PJ8D 3ZMRA 3IDYC 1JN6A 4N8CH 3LRGA 3WNLA 2AV7B 5ESQA 4HIIB 4HIIA 5HDBF 3UJTH 4PB0L 5CD3A 4CN1A 4X6CF 3C60A 3O6FA 2EH8L 1WZLA 1KTRL 3BPOC 1BFVL 1NGPH 3S5LB 2VXVH 3UDWA 4KKNA 3KYNB 3FOMB 3L9RA 2V2XB 4NNXB 1IC7H 4UOJA 4FQJL 3WO3B 1X5IA 4K8RD 4Y4KA 1NUFA 2PW1B 3EJZD 1S78C 1FL5B 4G5ZL 4F58L 4PLJD 5DK2B 3D85D 3WIHH 32C2A 3G6JB 2Y72A 5HXMA 2PUQT 3SO3B 3DECA 2UUDH 1II4E 5E4IA 2QHLA 1LVEA 4ZUUA 3QDGB 4OZFH 1G9NH 1S7VB 2UWEA 4D3CL 4ORZC 1IZKA 3UTSD 1HQRB 1UYWH 3GSNA 2NY5H 1T89C 1EIBA 4GJTB 3HE6A 4QO1A 2F15A 5IIEB 2GSIA 2NY6D 3BP4B 4X7CC 2J4WH 4Y8AA 1VKXB 4BFIA 1C08A 4O51B 3ES6A 5ENWB 3ARUA 4RMWA 2B1HL 1F6AA 1VADB 1YYLH 3KLAB 1QSEB 4LARL 4PREB 5BV7L 1TVBB 5BQ7B 5HDOA 1H3PH 4ZAKC 1U91A 2P8PA 1T7YA 4PJBE 2A74A 4O58H 4HDIB 3SDDC 5T3ZE 1N0XH 5FM8A 3HR5B 4M6AA 3F58H 1IEBA 2B20A 3RL1B 2R39A 2GTWA 3OBAA 4N0RA 3H3BC 1CGSL 2IGFH 4KY1L 5IR1A 5E9DD 4XTRC 3MOQA 4LKCB 1CL7L 2NYYD 4PLJC 5T1MA 1WWAX 5JIHA 2HFGL 5I0DA 4RFOH 1BD2B 3RRQA 3HG1E 1IC4L 4X9IA 2CUHA 2QHRL 2AJZA 2QSQA 4NN5B 5E4EC 3VXUA 3ZTJG 2CGRL 4PP2B 3WBDA 3AROA 3VG0L 1BLNB 2VB5A 5MEND 4MAYB 3DYOA 4MDJA 4WI3A 2ZOLB 1U8JA 3GJEB 3FAWA 4NSKB 3BN9D 5F7EL 3PJSA 1H3XA 4JM2B 3SCMC 1I9IH 5F89B 1RIUH 1RUML 1M7XA 4LLYA 4PRID 1HSBB 4UAOB 1M7IA 5DRZB 3ZHKA 3BP6B 4DGIH 1LEIB 1FVEB 4QYOA 4WIQA 1NCWL 5GRZA 3QDJA 4KJYA 1ZVSA 1HKLH 4G80A 4MD5A 3CFKB 1BOGB 5F96H 3BX7C 1HZHL 5FGCB 4UAOC 4IRJA 1DP0A 2OXHA 2BVYA 4OZGA 5D7IA 3LS5L 1VFBB 4U1JB 1WCQA 4ZPTA 1FFQA 4URTB 3JTSB 4BKLB 3ULVF 3MYJB 1T22A 1C5DA 1GGYA 5HYSA 4XBGA 1HIML 4KTEH 2HVJA 3CJJA 1VSCA 4UTAH 1AGCB 2DM4A 4KK6D 4R4FL 3MRRA 1WQVT 3SE4C 1VEMA 4KZDL 5EC1A 1DBAH 2YK1H 3JWNC 3WEXA 4QXUL 4WFGE 1A1MA 5BS0B 4CJ1A 2VDML 5DK0B 4PGJA 3V4UH 5E5MA 2FBOJ 2EH7H 2XWTB 4ZFGL 1G0XA 2C3XA 1AQDA 3OAZH 3NTCL 4NN7B 3FJTA 5T33H 3AFLA 5D8JL 5KN5B 4L3CB 1T04B 3DRQB 5T1DH 4XCEB 4YK4C 1JL8A 4IMKA 3REWB 1ORQB 1MHCB 3ECBA 5KG9B 2CO6B 1BD2D 5DD6A 3LDBB 5BCAA 4BSJA 3WXWH 3QQ9D 4LVNC 4LCYA 1DUYB 2XY1A 3MJ8A 5C09A 3MRKA 3JWOL 4R0LC 2E9BA 1WUNT 4FABH 3OAZK 3SDDA 1F58L 3RAJH 1D6VH 5LGJA 5C0EA 3P4NA 4PJ9B 4F7CB 5D7LE 1UG9A 1GGIL 2JCCE 5IBLC 2F54E 4LU5L 3F7YA 3CC5A 3FQXA 3QUKA 3EOYG 3PXHA 2MPAL 2DKSA 1J1XH 1L6XA 1NBYA 4UTAL 3GSVB 1NC2B 1MCKA 4YIQA 3Q6FA 2X4UB 2G75B 4D0DA 2IPUK 1TCRB 4UZGA 4C4KO 8FABA 2Z31C 3BDXA 5LGKA 2COQA 1CFNB 3V52L 2AS5M 5D1QB 5E8OB 5MEPB 3MV8D 1GAFL 3JWDH 4R4BA 3B2UD 4FZ8L 3LEXA 3I2CL 2AJ3A 4ZO8A 5GSRB 4XX1E 2WLYA 2W0PA 1YZZA 4M1GH 3RL2A 4F9PA 3UJJL 5TE7H 4G80B 5T33L 2XN9E 4U49A 4U0RC 5GS1C 2BVPA 2Z0BA 25C8H 5JTWA 1HSBA 2R2BB 4FQCL 4HZAA 2VERN 1DQLL 4G9FE 4MQSB 1FV1B 4B53A 2I9LA 1XF3A 5A16A 4MDJB 2Q8AL 1HSAB 3W82A 2YSSB 2EE9A 1CN4A 1JHLH 4C83A 1NFDB 3VXRD 3UBXG 1WCBA 5EZOL 1BD2A 2CQVA 3VD3A 2V7NA 1KF9B 3WO4B 4PGEB 4XXDA 3RVTC 5BZDB 3CVIH 4GW4B 5HHXL 5BRZB 1UGNA 1J1OL 2ED7A 1RVFH 2GTWB 2DLEA 1B88A 3O3AB 4F9LC 5DFWH 1EA9C 2Y23A 3KPLB 3S36H 3DUSB 2J3SA 2ILLA 2ZKHH 1U91B 5EBLA 2R23A 1UC6A 1A7RL 3QCUH 3NIGE 1TTGA 2X4QB 3C5ZC 1KB9J 1IGIH 4HXAH 1C08B 4O51A 4A2LA 2CKBB 1OPGH 4PJHA 4XC3L 4BZ2L 4TSAL 3RQ3A 1FPTL 1Z0NA 1ZHLB 3QEUA 4LLDB 2D7TH 3VI3F 3C08H 1J11A 25C8L 2DD8L 2D2OA 1HINH 2DQIL 3VCLB 4DGYL 1HE7A 1RHHB 4M61A 4GRLC 5EWIL 5C0CE 2BRRL 3LY6A 2RHEA 1I7ZB 2B39A 3N9GH 3TO2A 3UPAA 5DMIH 3QWOA 1MEXH 3WL9B 2EDRA 2K3TA 4PY8J 5CMAB 3LKNA 2RR3A 4G5ZH 4L29A 1OD7A 3WKNA 2B4CH 4BSWA 3S35X 1X7QB 4GRWE 3OG4B 3AC0A 3HE6C 4P9HC 1NCTA 4FZEL 1WFNA 1MFAH 3P9WB 2PTVA 1D5XB 3TBTB 4J3UA 1NDGB 1U8HB 3LCYA 1KJ3L 1A2YB 1S7UB 4TTGA 5IF0B 1I8IB 5E6ZA 3WUWG 1RULH 1PDKA 4KK5C 5FUZH 5IHUL 2DQDL 7CGTA 2YR3A 4O4YH 4AIOA 3ZE0E 5SWQB 3H9HA 1FG2B 3DX7B 4MJ5A 1QVOB 1ZVYA 3OX8B 4X7TA 1NCAL 4QRRD 4A6YL 1KGCD 1OSZB 4F7TB 1XF5B 3DX6A 1XGQB 4YHNA 4XNUL 3VFOB 3SQBA 1YMHA 4JG0L 5ITFA 1IGJB 2CDEB 2ADGA 3WHXA 3NPSB 1N6QL 2HRLA 3MUY1 5MHSE 3DVNB 4ZDHA 4L4VB 4M1CD 3CSYA 3FQWA 5FUOL 1AFVH 4GRLB 2F8XC 1A6UL 4RA0C 2DL2A 2ZNXA 1FAIL 1TZGH 5LQBH 4KY1H 2QQLL 2J8OA 4N90D 4NQEE 5DS8A 3X13B 3O9WC 3V6ZB 2FHFA 1Y18A 5B21A 3TIEA 4TSCH 1R3IH 1BQUA 3KR3H 1JF1B 3QXDA 5F3HA 1CBVL 4X83A 3BUTA 1NKOA 4JR9L 4AM0B 2F58L 3D3VA 3RWIA 1T0PB 5CWSB 4LMQI 2IEPA 2NTFB 5HPMB 4P4RB 5C3LD 4Y4KD 1GPOL 5C0IA 4S10A 1JZ2A 1EMTH 1P7QD 4TVPL 2ESVA 4BA8A 3LMJL 1RIHL 1H15A 4H1LB 4XAWH 2FLBT 3UJTL 3MV11 3WO4C 3SGDI 4U1LA 1LK3L 5LWYL 1AR1C 2FHBA 3DARA 3LB6C 1JK8B 1RZIB 3VA6A 1P7QB 3VXRB 1XIWC 2P8LA 4G8GA 3G6DH 1HQ4A 2JCCF 1RFDL 5ESAB 5I1DB 2Z31A 5DTFB 5B38G 4R0LB 1YC7A 1YPZF 4NO0B 3F8UB 1NC4B 5IB1B 2N56A 3QUMB 5BOPA 2VLRA 1NGQL 1YEEL 3FT2B 5DD0L 3W2DL 3QWRD 4PY8I 1F90H 4LGSB 1CI5A 5E8DL 1L0QA 1F3JB 3SE9L 1G9MC 5AYUH 4AENA 3UPRA 4IOIA 3QUMA 4O9HH 2NY4D 4HJJL 5ALCH 1AP2A 2QR0A 1AO7E 1T5XA 1NGXB 1T1XB 4HKJA 1T5WA 4Y4HD 3BI9X 4ALAL 4NQCE 4HV8A 4PJCA 2WUCH 3LB6D 4I9WD 4HCRH 4QHLA 2FECL 2P8LB 5H37G 1B9ZA 2VC2H 2EDBA 4HFUH 4XPFL 3L7EA 1VFMA 1IJ9A 3MLYL 2R56H 4J4PA 3TNNA 5E2VL 2X4SB 4F2MB 4IOSD 4HKZA 1RU9H 2XTJB 3VJ6A 1D6VL 1AD9A 3WIIH 2V2WB 3EYUH 1E6JH 2BSRA 2XICA 4PJ8C 1FLRH 5I1KH 4OCNC 3DPBA 2QTEA 4F33B 1PYWB 1P53A 4DFHA 4AJ0A 1MSPA 2AXFA 4Q2ZA 2QQQA 5F3HB 2ZUVA 2YC1B 5TFSL 4M1GL 4F15C 2D7QA 1R0AH 1KTDA 4XBEH 1Z9SA 2WNGA 4P2QE 4JFQB 3TNMB 1ZLVK 1CD1B 3TCLA 4GRMA 4YX2L 4WEBH 4LQFH 4NP4H 4FFYL 3CDCA 4RGNE 2JELH 1AGBA 4ZNCD 1FVDA 4HIEB 3VRJB 3WJJA 2IQ9L 2D03H 3HE6D 2WUCL 4HCRL 4HAGA 3MREA 1E4XL 2J1KA 4IOIB 4AEIL 3T0EA 3IGAA 3LKOB 1CXFA 3HPLB 4HWZA 2BVTA 1BJ1J 5E2JA 4FMKA 3WV0A 2P8MA 1CDCA 1T20A 4RDQG 3V9FA 4B50A 1FIGH 1YNTB 4KHTH 1MNUH 1T2QH 2MJWA 3T09A 4X9HA 3DX7A 2AJUL 1AJ7L 1T4KB 1ACZA 5FYKE 1U8IA 3SOBH 2GI7A 1FNGA 4KVNL 1QRND 1ZVHA 4LVHB 1M05A 3L1OL 5J6GA 1WAAA 2ITCA 5DRWB 1YJDH 2YPLE 3CXHJ 1D5XA 3MFGB 1B0GA 2I26N 1MLCB 3VGAB 4ZXBB 2FZ3A 4WI9A 4V2BA 4XMLL 1ZT7A 3DSNA 3UP1A 4BSWB 3CFEA 4HUUB 2HJLA 4I3RL 5MENB 4IRZH 2JKXA 3KPSD 4JHAH 2AGJH 1OPGL 1HYRC 2HTLD 3U46B 3ZSTA 3O6MH 3UYRH 4DW2L 1ZV5A 4I0PD 3MA7B 4EDWH 1CE6B 1S9WA 4UU9B 2AEIT 3OPZL 2X4PA 3GSQA 4TRPH 3BVNA 2B1HH 4ZSOA 2H26B 4Y5YA 4G3YH 3VFVB 2ZNWA 1RUPH 2D03L 1PVHA 3TYFA 4OZGF 5D7IF 4YPJA 3F62A 3QIUB 5C09E 4YXHL 1JP5A 1JWUA 4RMRA 5IW1A 1NDMA 3CAFA 1AE6H 3BDYH 4XCCH 4JQXA 3MLVH 4XVJL 2W92A 3MLRL 4G42B 4ZUTB 1YEGH 3V6ZA 3MC0A 3TFKC 1RJZB 2DJ4A 1YNLL 1O7SA 4HGWB 2YN3A 2NY6B 4Z9KB 3SGKC 5D1XC 1MI5D 4RAVA 3VGHA 3Q1SL 4Y4KC 2EXYC 4EI5B 1I8KA 2EKJA 2C4FT 1ORSA 2WBWB 4PRHE 3QIWA 2X7LB 3R4DA 3ZHDA 2HLAB 2EIEA 3MJ7B 2LQRA 2BHUA 1FHGA 3DX6B 3EOBB 3L5JA 3TA3B 1WIUA 2A9ML 1HSAA 4PG2A 3VWJC 2FSEA 5L0QB 2EZ0C 4JHZA 2Q87A 3QZWA 4F7PA 1QRNB 1F4XL 1T1ZA 2AI0L 5IBTH 2DN7A 1RAMA 2XWBB 5D4QA 1KCUH 4WDIB 3FKUS 1PFCA 1NAKH 3LQMA 1KEML 3TBTA 1HHGB 3CVIL 5HHME 4UQ3B 3V5DB 2ZUQB 3RL2B 5DJDA 5CP3H 4E41A 4EOWL 1EEZA 1KCSL 3ALXA 3B9DA 2DAVA 2VLKB 1RJLB 4LCUA 2H32B 2B8OT 2ZKHL 2F53B 4M3JA 5EBMB 4ZFOA 5FV2A 5ESVB 3G5ZB 4S0TD 4KZEL 5K9OA 3BKCH 4BQ8A 1CXHA 4U6VL 1ZS8B 5E94B 3K0WA 3OXRA 4OZFB 4WTXA 4ZFGH 5D7JD 1AIFA 5T5NG 3QUKB 1C1EH 4OGZA 1JIBA 4LEOA 3QEUB 1OCWL 3FT3A 5CJ5A 3B83A 4KKBD 3VXUE 2A6JA 4XHJD 5FK9A 3T1FA 3FOLA 4PRPE 2Q76B 7FABH 5C0BB 3UTSE 2EC9U 4HJ0D 3HUJB 3HLAA 1K6QH 5E2WH 1ZLWK 5FO8B 3PP3K 1GVIA 1EHLH 4YR6A 3GMQA 1WBXB 1CFSA 1BIHA 4EXPX 3HPJB 1KC5L 1IL1A 3DX8A 5CBEB 2NY5C 4S2SB 1Q38A 5SWZB 3R8QA 2R4RH 2KDGA 2XY2A 3VXQB 1W0YT 3I3BA 1KLGA 5D7SL 3VXTB 2KUTA 1DQML 5D2NB 1GGIH 3A6CL 3QWQB 5CZXD 4S1QL 1GZQB 1A6AB 3VXPB 4ZUSA 3W0WB 3PWNA 5FYJH 4YHLH 2YHGA 3UCRA 1I1FB 4GW5B 3TZVB 1A3QA 4MSWA 5B8CA 2CDGA 2DS4A 1I9EA 3U82B 2VN4A 4U1SA 1AI1L 2XXMB 3MRDA 3V52H 2YMXH 4LBEB 4ZXBD 4Z7UE 5I1JH 4U6VH 2VUOA 5D1ZA 3L3KA 4YHYB 3DUUB 3SCMA 5FOBB 3KLDA 3E8UH 3VFPA 3SJVA 3H9YA 4KMQA 2IJ0C 4G6JH 4Z0BL 3SE8L 5L2KD 1EEUA 4HXBL 2R56L 1D9KC 3I6KA 5HGHB 4QOKE 5J0BA 5HHQB 1D5ZB 2DQHL 1R3JA 3MCLH 5ALBH 1NGWB 1BVKB 4LKXB 1P9MC 3MJ9A 3QUXA 4JFXB 4QF1A 4ONGL 3WUZA 3C5SA 4LF3B 4ZAKA 3CMOH 1NBYB 3OWEA 3MRPB 4M5ZH 5DUBA 5EO1A 2Y5TB 1XF2A 2MHAB 2HTLC 4W6WB 2V5MA 3EO1B 2DLGA 3NZHL 1OQOA 1JRHL 5C0RL 3B9KA 2JB5H 2IBZY 4MAYA 4KVCH 1E28B 2PW2A 5CJXC 2R1XA 3WE6B 5GISL 1F97A 5IVXB 1EHXA 4Z6AT 1F11B 5T1MB 4N5UA 4JRXD 2O5XL 3MMEA 4FQ1L 4YGAB 1T89A 4YX2H 2Z8RA 1I7TB 3ME0A 3BUYA 3PIQA 4CADB 4NUJB 4BFGA 3D2UA 3RBGA 5EZJB 3BGMA 2V9RA 4R7NA 4AIXA 1QP1A 5C0FB 5HI5C 3GB7B 1UB5B 3VWKD 3MNVA 3E8UL 3C9NB 4FFZH 3OZ9L 4IS6A 2MWCA 1QSEA 3MNZB 2H2SC 3WKML 3ARFB 4NQUA 1PAMA 3IDGB 1XF1A 3GHBH 1DEEB 3RNQB 4KHTL 2CLZB 5I17A 3VXME 1CGSH 3D0VB 3QUML 3C5ZB 3QIWD 1TVHB 1IGYB 1CT8A 1MREL 4H88H 4RGOH 1N5AB 5F93C 4KHXL 4V1DD 4WY7H 4GG6F 3F5WA 4ODTH 3UMTA 3N85L 3VMPA 3LRSB 4O9HL 3TBWB 4PGCA 3DRTB 1EGJL 4OM0L 2PYFA 5D7LD 4NWUH 5E6ID 4PLOB 3K80A 1T7WA 1BEYH 3IDIA 4I8DA 4EBQL 1HEZB 3OKLA 2UV3A 4L4TA 5HVGB 1ED3B 3VRIB 2AV1B 2PW1A 2NY1C 3VD9A 1X5HA 3AXLB 3FFDB 3ZKSD 1XGRB 1CLYH 4MD5B 4V2CB 1A4JB 4OZHE 4XPFH 4O4YL 3ARFC 3DXAB 4HQQL 4LNRA 5INCB 4NNXA 1G6RB 2QSVA 1FSKB 5GS0L 1MCFA 4YO0A 4LCCC 3H9SD 5IQ7H 2Z8VC 5F89A 3EDDA 5HYJE 2UY6A 2FIKA 4N0FA 4KJQD 5J3HD 1R3HA 5BMFL 1BFTA 1V8HA 4JFEE 4D9LH 1FL3A 2YRZA 4PP2A 3VFNB 1VCAA 4ISVA 2AJZB 3H0TA 1ZXQA 4JFYB 1GGCL 4R7DB 4RMQA 2QJDA 3TN0B 1FGVH 5A2JH 1QKZH 1VESA 3SKUD 1QSED 1IC1A 1VEPA 2AXJA 1NAMH 2XTLA 1BVLB 5DF0A 3QG6A 4KUZL 3E6HA 1KULA 3SDCA 4Z7UA 5LAXB 3LV3B 4EUPA 3BDBA 3Q6GH 3QP3A 5MEQA 4XP5H 3WLBA 1A1NA 2W9DL 4CKVX 1YEJL 3GJFA 4ODTL 5D7JC 1QD0A 1MCJA 3IDMB 4A6YB 1FNLA 4Z7NF 5GGRY 4PP1D 2AEPL 2DDQL 2YUWA 4PR5A 1VFUA 3ALWA 5CGMA 2OTPA 3O4LB 5EZIL 1J0KA 4UNVA 1MI5B 3WJLC 1B4JH 2WP3O 1YMMB 2CKBL 4OIAA 4KDTC 3UTTA 3BP4A 3DO3A 1ZGLP 3HE6B 2F19H 3RUGB 2F74A 3BWUC 3S98A 4UDUA 4XCYB 5FYKL 1RHFA 4PR5B 4P2RD 1NMCB 1EUTA 2R1WA 3PP3H 2ZSVA 3A67L 4HUKB 3QDGA 5HJ3B 4GRLD 3DV6A 3MV9A 3R1GH 3QIUC 1CICC 3E6HB 1IAKA 1BVLA 1S78D 3LEYL 4NZDA 5E8PA 3T04D 5I6XC 2NLJA 4CAGA 2NQCA 3VWJB 1N64L 3TN0A 5KVFH 5FYJD 2FJGB 3ARDC 3EOTL 1Q94A 5DD3H 5I2IB 3HZMB 1QKZL 1MCPL 2B2XL 4P5KB 3BIKB 3BGFB 3QI9D 3OXSA 4RFNC 5SX5H 3D87B 3T65A 1A22B 1BJ1H 1UXSB 1IEAB 2G5RA 2HRPL 1MAJA 4MNHA 1CFVL 4BSVB 2EYRA 1D9KB 2PF6A 1YEHL 4G9FB 1KJ2L 5E2TH 1WEJH 3PWPA 5L8KB 3C2AL 5GZOD 1XGTA 4QRQB 4E41E 4ETYA 5T1LD 5T3ZH 2APFA 3VU2A 4X6DA 5C0FA 1G1CA 5IMMA 2X6MA 1HEZA 1MFDL 2D3VA 3D2UB 3HG1A 5I71B 4HFUL 1NC4D 2G2RA 1MHPH 3RIAF 1QUNA 4TSBL 4LLVA 4XVJH 1RU9L 3THML 3OAUL 5EZLA 4HBQA 4XXCC 3TO4A 4FQXC 4O02H 1ZA3A 2DQFB 4EDXA 1CD9B 43CAA 4K94C 3BZEB 1CD8A 3RTQC 3R1GL 1WF5A 1SMOA 4P5TA 2R1XB 5ERWB 3P4MA 4PJBA 4X5LA 1I1CA 1PG7L 1YMMD 1BFOA 1CE1L 2PNDA 3M8OH 2P5WE 3HNVL 1K2DA 2CLZA 5GS3A 5BW7C 2E7MA 5I19L 2L0DA 1AHWC 4RMUA 2UVFA 3KPPA 4OIIL 4OFYA 2BOCB 5I1JL 3RZCB 3GB7A 5F9OL 5GZOC 2R69L 4NPYB 1B0RA 4U1HA 1UA6L 1U8QA 1ZT4B 3RWCB 3EYQC 1C7SA 2CPCA 5FA4B 4WO4A 4LSSH 4NUJA 1ONQB 1MQKH 1OF2B 2H1PH 5ADOH 5FM5M 1P7KA 2LE9A 5EU5A 4NHUA 4UB0L 1JGEB 4R9HA 1F8TL 2ZOKA 2GUOA 1XCQB 5E9DE 5ITBH 4PJGE 3T4AA 3MXWH 1NLDH 1JNHB 3V7AG 1X5GA 1UH3A 2IAND 1TQBC 3MNWA 3PWUA 3DMMA 1G9MH 4QCIB 4ETQB 4OQ1A 1I8MA 4W81A 4APQD 4ZFFA 1NCCL 4KKCC 3ULUL 1JPFB 2E7HA 4HSQA 1WAAF 4KVCL 1U3ZA 1GRWA 2WIMA 4NO3A 3PABA 5C08B 1VACB 3U36B 5JW5A 1RPQA 1HN1A 4Y4FD 3WFDL 3SPVB 2J6EH 5F9WC 1NGWA 4ZD3L 4N8VG 4F15B 4QRRB 1A7PH 5J3HC 2UVEA 1WC7A 1WT5C 2ADFH 2APWA 4HK0A 1UFUA 1E6OH 2P1YA 1NLBL 2J2ZA 2GCYA 3MXVH 1NBVH 5TDPB 5TF1L 2Z93A 2SEBA 5FO8A 1DQJA 3SDCD 4P9HL 3RKDD 2JJTA 4OM1L 5CHNA 3FOLB 2CJUL 2A6JB 1JHTA 3SDAD 5F1KC 5CP7A 3DHMA 2Y06L 5SWZD 5CKAA 3HAEB 4L3EB 5EC2A 4RDQF 5DUPL 4QNPF 4U2YA 3D39E 5ITBL 3MLZH 1A6AA 3VXPA 1F45A 2DM3A 4PD4K 5KAQG 5ICYA 1HDMB 4J23A 2M2DA 5E5RB 5EOCH 2F58H 5DD5L 1JGVH 5C7XL 4X5WA 4NGHL 4H1LG 3DX8B 5CBEA 2DI8A 5DQ9A 5JHDE 3HCVB 1GXEA 2ZCHH 2FEDD 1EMTL 5JHDA 3T0VA 3GBML 5IVZA 4JB9H 3QEGL 2VXQH 3L3GB 2FL5B 1JZ5A 2IH1B 5T1DL 4JPWL 3HMWL 5EPMA 5EBWB 1NEUA 1KG0B 2EEAA 3ARED 4U1MB 4NN5C 2W0KA 4WW1A 3QIBA 2I60L 1ZGLM 3O81A 3RWGB 1G7HA 2LU4A 2NXYC 4KROC 4J2XA 5BS0E 1NL0H 1MAML 5DVLA 4XP1L 5DI8A 4UQ2A 1AXIB 2BNRD 4LCUB 1I1AB 1YPZA 3SY0A 1SYSA 2VL4A 1EEZB 4N8VA 4M6ML 5DD0H 2RB8A 4PRNA 4RAVB 1JHKL 4O2EB 2C26A 4WHDA 4OF3A 3FB7A 3CCHB 4IJ3C 2E9IA 1I4FA 4HK3N 1RJZA 1WBZB 1QLRA 2VLRD 5IOPB 2OJZL 1X5ZA 1HXMB 3WHE1 5E8NA 4JO2L 5CBAA 1L0YA 1OP5H 2Q7YA 4X4YB 3TYFB 2EDLA 4M6NL 4N9OB 1B6UA 3KDMB 2Z35B 5IQ9A 3EOBA 3TA3A 4AMKL 2X4PB 3GSQB 5T3ZD 4POZD 1RQ5A 1S7QA 3NN8B 5AAMA 4U3HA 4NZJA 1P69B 3REVA 4LSUL 4GG8A 2VDOL 4EKXA 4RCAA 4YFDB 1IMHC 5GXBB 4JRYB 4CW1A 3O2DH 4DN4L 4GAJH 4X9BA 4OUUA 1BMGA 1LILA 3H3KA 2X4RA 1Z3GL 3GHEL 3NPSC 4C56A 1NL0L 3CVHH 4P5KA 4QGYA 1CZ8L 5E1AB 2BK8A 1MJUH 1Q94B 4LEXL 4G9DB 3PV6B 4GKZB 1W8NA 4J1UA 2FHCA 4XC1L 1C5CH 3NFNB 4PGBA 3UO1L 3VFRA 1IGCL 3PGFL 2ITCB 1HHHB 3HI6L 3O9WB 4XVTL 3AM8A 4WJ5B 1EZVX 3M1BB 1IAKB 3BPLB 1A6ZA 3QPXH 5I8EB 4K7PL 4MXVF 2VZTA 3NOIA 3CVHA 3E1F1 3T77B 3VFTB 1BREA 3KPSB 5D5MF 3VI4F 5EOTA 1N2RA 3JSSA 4KKAD 2HN7B 4JJ5A 1IE5A 5I8OH 4OD3L 3LKOA 1NJ9A 2GJ6B 1Q9WB