4NQDE

Crystal structure of tcr-mr1 ternary complex and non-covalently bound 5-(2-oxopropylideneamino)-6-d-ribitylaminouracil
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
243
structure length
243
Chain Sequence
AGVTQTPKFQVLKTGQSMTLQCAQDMNHNSMYWYRQDPGMGLRLIYYSASEGTTDKGEVPNGYNVSRLNKREFSLRLESAAPSQTSVYFCASSVWTGEGSGELFFGEGSRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major histocompatibility complex class I-related gene protei
publication title T-cell activation by transitory neo-antigens derived from distinct microbial pathways.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 62
structure length 243
sequence length 243
chains with identical sequence H
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nqdE02
5JIIA 2GUOA 1B0GB 3RWEA 2DM2A 3TVMC 2ICEB 1D5BB 5E00A 4TNVF 3GIZH 4QGYA 4CDGC 1MIML 2NW2A 2A2QT 3B4NA 2KUTA 5D9SA 4U6YA 1PEZA 4S1DC 3HMXL 5T3XL 4V2BA 1YN7A 1RHHB 3S5LA 3HAEA 1MIMH 4L9LB 4OF6A 3UTTB 1J05B 4KI5D 5CZKA 2P24B 2OJZL 3ZDYF 2HP4A 2YMXL 3B3IB 5T3XH 3SE3A 5IW1A 3N0PB 4P59L 3TC9A 2FWOA 5TE4H 4X8JA 2PTVA 4PGDB 5B8CA 3NTCL 4NQDB 4PREB 2OJZH 5JXAH 2YMXH 2O26U 1D7FA 5K59E 2FL5B 1QBLL 4LQFL 4PRNB 4RNRA 5I76B 3NTCH 4JRYD 3U9UA 4G7YL 3E6FA 5DJ6B 3D39D 4M61A 3MMEA 4GH7B 1JIBA 1CFTA 1WIUA 2BMKB 4AIZB 3REWB 5T3XE 4M62L 1FP5A 4L8SA 1R3LA 3FB7B 1NCAL 1EHAA 5KSBF 1KV3A 5D96C 3I75A 4A6YL 1NAML 5I2IA 5FA3B 2JE8A 5EU7E 4QOKA 1XGRA 5KW9L 5I1EL 2FHCA 4XXDB 4U1KB 5FUOL 3QNYB 1AO7B 5JTWA 5A40E 1I1FA 4K94L 4HWBA 2ATKB 4M6NL 5EU3A 3ARWA 2BHUA 5KW9H 2BDNL 3V8CA 3VCLB 2WUCL 4Y5VB 4X9IA 4P4KC 3KPSB 1AFVL 1ZHKA 2XZAL 4Z76A 4B5EA 4HXBL 2X1OA 3UTSE 2FX7H 4K94H 4J1UB 1VFBA 2Y36L 5DR5H 4HLZH 2OL3A 1WFOA 4B7IA 2BDNH 2WUCH 5DD3L 4P2QB 3HTLX 4V1DA 4JY6A 4WI3A 4HWNA 2XZAH 2CUIA 4NWUL 4CMHC 4HXBH 4HGWA 5FGBC 3DYPA 1GGIL 4K3EH 3MLTB 3QUYB 3ILQC 3KXFE 4I2XE 1H3UA 4I8DA 1OLZA 5DUBA 1INDH 1A1OB 4N0YL 4LVHB 4LPXA 1Q38A 4N90D 5DD3H 5GGRB 5L6YH 1CLCA 3EO1B 4JFYB 3NIFF 3AVEA 3IDYC 3NGBC 3L3JA 4NWUH 4PJ5A 5T5NG 1GGIH 4P46D 2F19L 1LP9F 1NAKL 4ZNEA 4ZFGL 2H2SD 1WBXB 1UG9A 4F7MA 3PGCA 1HSBA 1M7IB 3N1PC 4N0YH 5CZXC 4YNYB 2ZKHL 5D5MA 1RZKL 1T7YA 1NQBA 2NY5L 3C5ZC 3MLXH 1W0VB 3NABH 4R8WL 4F58L 4ZFGH 2WP3O 4HDIA 4I9WE 2WLYA 1RZ8A 4OTXL 1WAAA 4N1EA 3L3IA 2A83B 2A6JB 3BGMB 2BX5A 4JAMB 4G5ZL 2ZKHH 2QADC 3AAZB 2NY5H 2R23A 1G7MA 1BOGB 2IBZY 1IGYB 5E2UH 3V6FB 2WBJA 1AGEB 4R8WH 4F58H 4NP4L 1NFIB 4ERSL 3CD4A 5DJAB 2P46B 3ROLA 1HHHB 2MQ3A 2DS4A 5FCUL 5MERA 2APTA 4YHYC 4I3SL 5ADOL 4MQXD 4NNPL 5FUCC 1A14L 4KK8C 4XH2B 4NP4H 4ERSH 4V1DD 3A6CH 4PLOB 2H41A 3SDCA 3KPPA 1DUZB 1BREA 2F53A 4IMKC 4UDUA 3QWQB 5HPMA 3QO0A 1GCFA 3MRKA 2X4UB 5IB2A 3TBVB 4NNPH 3GMRA 1A14H 4Z7VF 2X4QA 4HK0B 3OKNA 1DN2A 1MJJB 4JHAL 4QXGH 2A0LC 2WBKA 2WP3T 2XZCL 4PJ5D 1MCSA 1GOFA 1D9KC 4PBVC 2EIZB 2ZUWA 4MVBD 5JHDD 1G6VK 3D18B 3PGDB 4BH8A 2IPTH 4JHAH 2XZCH 3B5HA 3ZO0A 4X6CA 3TBYB 3K46A 3BQUB 5TPWL 1NCTA 4LOUC 1OP3H 4OD1L 1DSFL 1HSAA 2W9DL 4WFGE 3O41A 3VE0A 4XRCB 3MRCA 4XT1C 3ZYOA 3WE6B 2P8LA 1MELA 2FGZA 3FQUA 4IOFD 3SKOA 3MRLB 1O0VA 4KKAC 5F7MC 5TPWH 4HHAB 1TJGH 4M1DL 1DSFH 4OD1H 4WO4C 3GSVB 5C8JA 3GSRB 1WBZA 3BYTA 4FQXA 2GK2A 2DQUL 4GKZA 4OZ4B 3X17A 4PJ9C 2P42B 1Z6JT 3PWJB 4M1DH 4XCCL 1UWXK 2AV7A 2PTTB 3OAYH 1OL0A 1OTUD 4KU1A 3SDCD 2Y9RT 4HIJB 4RFEB 4G8GE 4G8FB 2F53D 2GUOB 1N4XL 3NCFB 4B7LA 3ZHDA 1I4FB 3O4OC 2A6IA 3QB7C 4XCCH 4OQTL 5J6HA 5H35B 3BZ4A 4MD5A 4LCCB 1CLOL 5KVGL 2IALB 1YY9D 3QRGL 1FVEB 1N4XH 2X4NB 1JNNL 3NMEA 4F7CA 3U2SA 4HUVB 4QY8B 1HHJA 4IOIA 1E6JL 4WU7B 3W5MA 4MJ6B 3ILPB 3RI5F 2WK2A 1JHTB 3SGJA 1CLOH 4LIQH 4L1HA 5KVGH 1MREH 3MODH 4L1DA 1MCRA 1B4JL 1JNNH 2HKHL 4G9FA 3TJHD 4OCYL 5DD0L 5HD8D 1E6JH 4GRWF 3MLYL 4NSKA 4NDMA 2XIDA 4PJ7B 1KTDB 3S34H 4NQEE 1B4JH 2HKHH 3B5GA 1JGVL 3ETBF 1B0WA 2V6HA 4RNRB 4FQXD 4OCYH 2R0LL 5DD0H 4NN6C 3WJLA 5TE6L 3MLYH 2Z0BA 2KPNA 2Z4QA 2ADFL 3U9UB 1G0DA 1T2XA 2BHZA 2NY0D 2J8UF 3E6FB 3NZHH 2NW3A 3IDJB 1OWRM 2V7HB 1U93A 1NCBL 4P46B 2R0LH 4LIQE 43CAB 3T4YB 1HWGB 2A6KB 5FYKU 2ADFH 1S7SA 4QYOB 2EDYA 5IP4A 1JF5A 3CSYB 3DO3A 4I0PD 1NCBH 1XF1A 3I75B 4WHDA 5I2IB 4E0RB 5DI8B 2GITA 4DWHA 3ZL4H 1I1AA 1JWMB 2AP2A 4LCUB 2GJ6A 4Z7QE 3SOBH 2W91A 4GMSL 1CBVL 1ZHKB 4Z76B 1WWCA 2QR0A 1AIFB 1BD2A 4NCC1 5EU6D 4KJWD 4LSUL 1TJHL 4QHUB 4H20L 5D93C 3ARZA 4NFDA 3QJHB 1DTUA 4YXKL 3LCYA 1MRCL 5IESL 2PO6C 4GMSH 1CBVH 1A6VL 1KLGA 3S5LG 1UACL 3QCTH 1NUDA 4HGWB 1FLRH 2ITCB 3QDHA 4LSUH 5JOPE 1TJHH 4N0CC 3DIFA 3HC0B 5GS1C 5E5RB 4YXKH 4QNPE 2OI9C 4YK4C 1LO5B 1A6VH 3GGWB 3QQ9C 5F96L 4YXLL 4PJ5B 1G1YA 1GZPA 4OFDA 3VI3F 2UVFA 3PGCB 2QJDA 5JHDB 3B6SA 3ZKXB 4TRPH 4ZAKD 5LBSL 2W59A 4YXLH 2NY6C 1AD0A 3RDTB 1WCBA 3FQWB 1C16A 5BV7B 2P49B 1ORSA 4YWGL 2Y6SC 2VDPL 2KQNA 1BF2A 2EYTA 2V2XA 3L3IB 3T2PA 3SE9H 5LBSH 3QCVL 5DYOA 4XP9L 2PTUA 3MJ9L 3RIAF 4D9RD 5C08E 4WI8A 4Q2ZB 5DTFB 3QAZB 3DGGB 1FNEA 3QP3A 1H8SA 3SBWC 2MWCA 4X0KB 1WBYA 3OKYA 4NFBA 4XNUH 3X11A 3BRGC 3SO3B 2AJUL 4YWGH 3BO8A 4BZ2L 1TVDA 1M1SA 3QCVH 1MVUA 3MJ9H 5BXFA 1M71B 5MERB 4LLUA 3L95A 1OAQL 4XCEB 1RI8A 1CGWA 2E7LC 2GTWB 2AJUH 4KK9C 4JQVA 4NM8H 4WUUA 4KTYA 3ZE2E 1I3VA 2ZSVB 1NMAL 3RX8A 3SDCB 4BZ2H 4GW1A 5IROC 4BA8A 3QO0B 4JFEA 1OAQH 4K3DL 4J3UA 3LS5L 1JPGB 4H8WL 2G2RA 4JHZA 3T65B 2ITDA 1NMAH 2XA8L 5FECA 3I3DA 4U7SA 3W39B 1KN2L 1KEGL 2R2EB 1LO4L 2B5IB 3AS1A 5DFVC 1UH4A 3HS0A 4K3DH 5F9AC 2V7NB 3LS5H 4H8WH 1LEIA 5HBBA 3QQ4B 3RZCD 1P5VA 4X6CB 1N59B 1EUUA 4XB8A 3OSKA 5F7HA 3OXSA 4GRLD 3VA6A 1I3RA 1P9MA 3TEUA 1LO4H 3KWWA 3AY4A 2KL6A 5EU5A 1FYHB 2P8LB 5HI5D 3FQUB 4OF0A 3SKOB 4YO0A 2F9BT 2IC2A 4HCRL 5FKPB 4CW1A 3DX6B 5GZND 3EKCA 2GT9B 3DUHA 2XQBL 5C8JB 3MA9L 4Q6YA 2EYRB 3FJTA 5IFHL 5AD0B 4LEOB 5C0JB 3O3UN 3OGOE 4WENB 3GSOB 2HVKB 3L7EA 1TVHA 5F6IC 1UB5A 2CR3A 2E7BA 5C0CA 3O2DA 4NHUA 1I9EA 1NANH 3IKCB 2NY0B 1JZ4A 3C60B 4CRPA 4XCFL 1XR9B 2XQBH 2AV7B 3MA9H 3WS6C 3M1BA 1Q0XL 3L3DA 5IFHH 5EORH 4WCYL 1BM3L 3HUJF 5ALCL 2RFXB 5FIEA 3IFPB 1CG9A 1ES0A 2BXYA 5E2WL 5KVDH 4JFED 1DL7H 2GSGA 1EIBA 2VZ3A 3SPVA 3TBWB 4Y5VC 3LH2H 1E4JA 4I0PB 3VXSE 2FJFA 5J6HB 1Q0XH 3EOBA 1BM3H 3BPNB 2QQKL 32C2A 5E2WH 4YFLF 3U2SB 3RBGA 1HHJB 4FXGA 5DQJB 4WWKA 2FHFA 1II4E 1FNSL 3JUYA 4PJGF 1G9ML 2Z8VC 1OGAE 2QQKH 4G9DA 1MUJB 35C8L 3VI4F 2EC8A 1DEEA 3UP1A 2F54E 5EU6B 3IFOA 1RJLA 3MLZH 1A64A 3G6AA 1OSPL 3S37L 5SX4I 1S8DA 2W0LA 3SN6N 3SY0A 4Z7UA 3ARFD 5DVMA 2RJMA 1XCQB 4ZUTA 4QTIH 4OAWA 2EDHA 3MUJA 4RWHA 3VMOA 1OSPH 3S37H 1S7VA 5I1HL 2Z4QB 4BFIA 1MVFA 1F2XK 4JEGB 2DQCH 5A16A 4NBYB 1KN4L 1PG7L 2EXYD 3D3VD 4OKVA 4QRSB 5CJ5A 5MEOA 3HHRB 4QXWA 1OB1A 2NTFA 3JV4B 2NQCA 1JCKA 3O6KL 4LMQI 4ZAKB 1H3TA 3RJQB 1S7SB 4G6JL 1RIHH 5FUZH 5HI3D 3RWFB 1V7NH 1KN4H 3PHQA 1R5IB 1YPZB 3BFOA 3CFCL 3O6KH 5HHPA 5DMKA 3I3BA 1OAYL 1P84K 4G6JH 4WJ5A 3UYRH 4Z77B 4RFNC 3S37X 1CFQA 1A7BA 1L6XA 3OKOA 4HWEL 4XP4L 3VH8B 1J8KA 1W0YT 3CFCH 2XN9D 4RIRA 3N9GL 4NN7C 1KJ3L 1OAYH 2X41A 4BQ8A 4F15B 3K2UL 3MROA 1FAIL 3WSQL 3L3HA 4IJ3B 1QFWM 5CUSL 2L0DA 1U8IA 5L88L 1CL7I 4HWEH 3TIDA 2M1KA 4XP4H 3RNKA 1MFDL 4YZFF 5IMLB 4AY0A 3LKQA 3N9GH 1ITCA 3N85L 3I02A 3I6KA 3EDDA 5MHSD 3FB6B 2Z8WC 1UA6H 4IDLA 1FAIH 5D7LE 3WSQH 5CUSH 4D2NA 3BQUC 2HLFC 1JI1A 3GSNA 4OZHA 4ZUUA 5L88H 5TE7H 1MFDH 4Q7DA 1A6UL 1K3ZA 3N85H 4O9HL 2R29L 2G75A 1GZPB 1IBGL 2H32H 1A9BA 1RJYB 3MGOA 1JTPA 4FQJH 4KFZC 3RZCB 3ES6A 1A6UH 4GW4A 1LK3L 1UJ3C 4OD3L 1ZWIB 4O9HH 1AD0B 2R29H 4DKEH 1MPAL 4GRLB 2EDXA 3RY4A 1IBGH 1PG7W 3T8XA 2PYFA 1T5WA 1NBZB 3ZTJH 1LDPH 3ALPA 5A1AA 1JI2A 1G7QA 1IQDA 5GPRA 4NO3B 2EH7H 4OD3H 4NKOA 4PLNC 3OJVC 1HQ4B 1LE5A 4ONOA 1Q0YH 4LLDA 1JPST 4M8VA 3DGCR 4Y16C 2EXWC 2ICWJ 4KZEH 5BXFB 4H25B 4X4MA 4G8EB 3EOTL 4FFZL 1HYSD 1UZ6E 2IAMA 1FZJB 5J0BA 3VGBA 1U8KA 4M02A 2JK5B 4HV8B 2J6EL 2NY4C 3BPLC 3LPFA 4OFKA 1U3HD 3S3SA 1OD7A 1S5HA 3S8WA 3VH8G 1FC1A 3EOTH 1N0XL 4EQ2A 2G60L 5FUCE 4JKMA 4GRMA 1XT5A 1CQKA 1UWGH 1JNLL 2H6PA 2EDJA 1HKFA 3DROB 5T1KA 4NKMB 5FECB 3CAFA 2QSTA 3AXLA 3HG1B 4KDVA 4OGAC 5CJBA 4K07A 4PRHE 3SKUD 3WHXB 4HIIB 1KSRA 3NFPA 1YMMA 2BC4A 2J5LC 4ELME 2HA1A 5DJCA 2G60H 3S97C 5KSAD 2YD8A 1RQ5A 1JNLH 4R0LA 3TJEL 3R06A 5FB8A 1RFDL 4LGPB 5T3ZD 1BFTA 3OXSB 1HHGA 1VB9A 3F62A 1QUNA 5C86A 5K9OB 1XIWD 3UBXA 2XXCB 4KKCC 2OS7A 1RFDH 4CW1B 1HXMA 1ZHBA 4ZODA 1Q9WA 3ARFB 4IRSA 3O2VL 3K8MA 1P69B 4FXKA 1AJ7L 1H3VA 2FO4A 1NC4A 1QHPA 4CU7A 1A7OL 3GBNH 4XP1H 5IEHB 1DBAH 4RCAA 4F9LC 3P4MA 2IAMD 3I85A 3O2VH 3L3DB 2CLZA 2VL4A 1AJ7H 3D3VB 4OCRL 1EO8L 2QSVA 1A7OH 1CG9B 4Z78B 2VSDA 4JPVL 3LDBB 4TQEL 3WDIA 2P8PB 2CDFB 3R4DA 2FJFB 3SDDA 1Q9KA 5I66B 1ZLUH 1LVEA 2FLBT 3D69B 3SGKA 4OCRH 5T1KD 4K23H 3D6GA 4BELD 3P4NA 4UQ3A 3QDMA 5EIIA 5D1QA 2C7UA 3AU1B 4JPVH 1EAJA 3LQZB 4TQEH 1YMMD 2XTLA 1H8OA 4FXGB 1QR1A 4Y5YB 1P7KB 1FL5B 3OPZL 4Q74A 3HLAA 1A2YA 1R3KA 4YX2L 4QCIA 3U9PL 3C8HA 4EDXA 3RGVC 1YYML 3DI3B 5DURB 4FQHB 1JWUB 5ENWB 1HYRC 2XN9B 2F8XC 3WL9A 5BZDA 3U82B 3IFOB 4IDJL 3EYOA 1LD9A 3U9PH 4YX2H 3H6JA 1YYMH 1MWAA 4MVBC 4ONHA 2PW1B 4WFFE 3MV9D 3O6ML 5L2JA 4N9GA 5GZOD 4ZFFA 3RI5K 3VFMA 1NC4D 4JREC 3OL2A 3O9WC 4IDJH 3G6JE 1CICA 2AI0H 3RVXD 5IG7A 1VACB 3RDTC 4JM2F 1YQVL 5E8EB 1BZ9B 5CP7B 3PJSA 5HHQA 1AH1A 3O6MH 3VD3A 1ZT1B 4HH8A 1PQZB 4PJEF 2YRLA 4QXTA 1JE6A 4PYGA 5B38A 1OAZL 1T83A 2DWEB 4LRIC 5HYEA 1E4KA 3SO3C 2FATH 2ATPA 5GGSA 2Q87A 3DECA 2BOCA 5HYIA 3LHPL 4U7MA 5D1QD 1VADB 4MS8D 5DMKB 5F9DC 1OAZH 1UM5L 3T0XA 2XG4A 2AJ3B 1OTUC 5E8OB 5JW3L 3GKWL 2FJGA 3CVHL 3A6BL 2NX5A 3LEXA 2BSRA 1YDPB 4RIRB 5F7EL 1E4XL 4ZYKA 4WHYH 2OP4H 3VFVA 3BISA 3O6LL 1JYVA 3QDGA 1AKJA 2XWJA 3L3HB 3KGRA 3GKWH 3GJFH 4OLYL 3CVHH 3A6BH 4RX4A 3LKQB 4GKSB 5F7EH 1E4XH 4PJXA 3WLBA 4H26B 1U3HB 5IW6B 3O6LH 5KG9A 1CICD 3RWHA 4LVNB 1EX0A 4DZBA 2NMSA 1HWHB 3PUCA 3L3KA 5HD8C 4DKFL 3F7YB 3B8YA 4MNGB 2WIIB 3BN3B 2OK0L 2EIBA 3MGOB 4R90L 1DQLL 3W11C 2UWEE 1U8JB 3RKDD 5KSAB 2UV3A 4XCYA 5K9QI 3OKDA 5FXCH 3KG5A 4ZPVB 2OK0H 1CE1L 4FQCH 4YFEA 1MAKA 4K8RL 1T20A 1XIWB 4R90H 5GGVL 3C60C 1I8LC 1I9RL 5J89A 3VFWA 3DX7A 3TFKC 4ZOBA 5EFIA 1CE1H 4BSVA 2NX5D 4GT7A 5I1GL 4LLYA 1X9QA 5J11C 4K8RH 1KJ2A 2F5AL 1FGNL 4IS6B 1N3NA 4I0PC 2YRPA 1I9RH 3QDGD 3GI8L 3P3YA 1EFXA 4BUHA 2KH2B 4ETQB 5FK9B 4GS7C 3DVNA 5HY9B 3I9GL 3TZVA 1J87A 1MQ8A 4RX4D 2AVGA 4XBGA 3JTSA 4K7FB 2F5AH 4MLSA 1FGNH 1S7QB 1SQ2N 3RIAK 4W4NA 5GGTA 5GS2H 1XF2A 4JB9L 4QRTA 3GI8H 4PJCB 3KPTA 3TESA 2ZUVA 5HVHC 5I1AA 3VGEA 1HDMA 4KJYB 5F7NC 5T1KB 4WHTB 2FSEB 1M05B 3BEWA 1CVSC 4JZNA 5CFHA 3V52H 1TZIB 4GSDL 3P0YL 3UTTE 4JB9H 1A6PA 4JZJB 1WC7B 1ZA6B 4NZUH 3UJTL 4R4FL 3AREC 2CMRL 5FGSA 3HZMB 4GMTL 1ACYH 5HHME 1SJHA 4NQUA 2LU4A 5FB8B 3BWAA 1IL1A 2LAAA 4GSDH 5CJXC 1QLEL 3UJTH 4R4FH 2ZCHH 1CT8A 4PJDF 1WIOA 2P4AB 5BO1L 3DX9B 3W9DB 1HXMB 1F90L 5D8JL 3MV9B 4L3EA 1LQSR 1QLEH 2Q8BL 4ZAKC 1OD9A 2FO4B 1NC4B 3EYSH 3BDXA 4PG2C 5BO1H 3SDXF 3OZ9L 4EI5D 4OCWH 4Y4HA 1F90H 5D8JH 5FHAL 5TJWK 3TZVD 4ZO6A 2Q8BH 5GS0L 3MYJA 1JMXA 4K3GA 1TQCB 4TVPE 3BYYA 4IRZL 5CAYB 3X3GL 1E4WL 5CD3B 1WICA 2R8SH 1ZA3B 2ED8A 5KTEL 5CKAA 1CIUA 1F6AB 5FHAH 1VEOA 2PW2B 5I16A 5LXGH 4F15C 1U2CA 2IPKB 1DBML 3P4NB 3PDDA 1E27A 3QEGL 5D7IA 5B39A 3X3GH 1E4WH 5EZJA 5F9WB 1IGJB 3C2AL 3M45A 5KTEH 2VQ1A 3W9EB 1QR1B 2NR6C 3O4LE 4QEGA 1JZ5A 5SWZA 3KPSE 3WUWA 4P2CG 4EDXB 1P2CA 1DBMH 4G6KL 1CGYA 3QEGH 5B3JF 2GCYA 5C0GB 1BQSA 4JO2L 3NCCB 2MFNA 2Q86B 1LEKB 1TJIL 3U0WL 1HILA 4APQA 5ICZB 2YC1A 3OHXA 1HHKB 4G8IA 5CBAA 5EOCH 4O00A 4G6KH 4PGZA 1BVLB 5K9KB 3U36A 1ROWA 5GGVY 4N9GB 4JO2H 1TJIH 4RA3A 3RZCC 3U0WH 4JPWH 1CICB 1J12A 3VJ6B 5C0ND 3TM6A 4CVXA 4AIOA 1UQSB 1R3IL 5I8CA 4Y4HD 2UYLA 2VLLB 4J3TA 4KDTC 4ZFOA 1YEKL 5F70A 4OUOA 5FFLA 4MQ7A 4GFTB 2B1HL 4LNRA 5J6GB 1U8QB 1W2KT 3RUGF 1R3IH 4HKBA 3MACL 4WTZG 3CFEB 1YEKH 4O2CB 3U79A 4FFWC 2DL9A 4AM0A 2B1HH 5KSVB 3FKUS 1A7QH 3C09B 5KS9F 2A74A 5JW5B 3O3AA 3OKLA 2FIKA 3MACH 4PJFE 1JVKA 1U95A 4NN5B 3ZE1F 5CMAA 2NX5B 4GUPB 1NCCL 3CIQA 3LEXB 2BSRB 4HUMB 1OAUL 5IB4B 4MNHA 4QHLA 1NEUA 4GG8A 1T21A 4D9QD 4APQD 5I18H 4AIXA 1J8HA 4YBQC 3ARGA 3CJJA 1MCBA 1RUML 1OAUH 3WD5L 1RJZB 1JUFA 4HD9A 4FQIH 4F8TA 3T3MF 3QPQC 3VFSB 1ZHLA 2JCCA 5I1LA 3PL6A 2JJTC 1T2QL 1AE6L 1RUMH 2D31A 2EDWA 3WD5H 3C6LA 5BS0D 5HYQA 1DQQA 1JWSB 4G6AD 4LQ1A 1OHQA 3WN5B 4R97C 1I7ZB 2Y23A 3PHOA 5EZLA 2R2HA 5HJ3A 2HKFL 5CEZD 2IQ9L 1OVZA 2J4WL 3VGAB 4XCYB 1X5GA 3MUGB 4FA8A 1N8ZA 1IC7L 2P5WA 1MCKA 2D7MA 1QSVA 4NHCL 5GGRY 5ADPL 5DMYA 3JUZA 1UZ6F 1EJOH 1T20B 4XHQA 1D5ZB 1T89A 5JZ7C 1F5WA 3WNPA 2O5YL 4KV5E 4UT6L 3VXQB 4Y4KA 1N5AA 2CK0L 4F7PA 1BQLL 1SJEA 2DTMH 5JLZB 4LLYB 4OM1L 1DQJB 4Q9BA 4BSJA 2CDGA 2GAZA 5F88A 3CSPA 4N0UB 1T2JA 2NNAA 3NCYS 3GMPA 1AP2A 1EBPA 1S7UB 2O5YH 3QWOA 3BKYH 4UT6H 5K9QG 4EI5B 2HAZA 2CK0H 1UH2A 3ARGD 1BQLH 5EBMB 3HB3D 5BVJB 1KGCD 3TZVB 3FN0L 4M7KL 3P77A 4OM1H 3OB0K 2J8UA 1XF2B 2NLJB 1KG0A 1ZK9A 1WGOA 4PJIB 3PL6D 1GZQA 1ORQA 5I1AB 1BIIB 1KB5A 1ZOXA 1HDMB 3FN0H 4JCMA 4M7KH 4PJAF 5IVNA 5CGYD 1P4LA 1YEEH 12E8L 1EAPA 3C6LD 2DKUA 4LCWE 1LHZA 2ARJB 4ODWB 3IXAA 3IJHB 1DQTA 5INCB 2JB6B 5BJTA 1L4IA 4I77L 2ICES 4L29A 3BWAB 12E8H 5EOQL 1F4XL 2DD8L 1IL1B 4HWBL 2W1NA 3ZYIA 2BY2A 3IJSA 4PGBB 4PJ7E 4WI2A 2R56H 2K3TA 4K3JL 4CVWA 4OCNC 3V6OC 2DD8H 4YLQT 2C3VA 4XHJD 2AJZA 5BW7A 4WHCA 3DMMA 4PJHA 1FFOB 5JDSA 4JPIA 1S7WA 3CPLB 4M43H 4CN1A 4YQXL 3U7WL 4Y4HB 2X4RB 5EUOF 1M7DB 1T1YA 1IC4L 5KVMC 2VR5A 3S7GA 3TN0A 1JHKL 2OTUA 1CXHA 1A1NA 4NRYA 3U7WH 2BK8A 2A77L 1FIGL 1KTLA 1DANT 2XI9A 3ZT6A 2HT3D 5I16B 4ISVB 1IC4H 1UZ8B 5CP3A 3V4PL 3GSUB 1IGFL 5IBLD 5CHNA 1FSKB 3P9WB 5CLWA 1E27B 5B39B 1MFBH 5EZJB 1NDGA 2A77H 5BV7L 3HKFA 3LOWA 3MJ8A 3V7AE 2WWMC 4GAGL 2MCPL 5EO0B 1MEXH 4OZIB 1UT9A 1G6RB 2GK0A 1U3HC 3OQ3B 4HUWA 5EUKA 3V4PH 1IGFH 1XAUA 4LSSL 5FA4A 3TIEB 2CKBA 4P5KA 3MNVA 2ENSA 3QULB 5BV7H 1ZLSL 2DM4A 2AS5M 4GAGH 2MCPH 2AGJL 3OHXB 3F7VB 1BFOA 3WIIL 4DEPC 3F12B 3U4BL 1X6LA 4LSSH 4PJBE 1TENA 1F8TL 4XMLL 5CIPH 2YZ8A 5TGBA 4L4TD 5ID1B 3IDIA 4POUB 4F33A 4MAYC 1T1ZA 3WS3B 1ZLSH 2DTSA 3MRMB 5H94B 3WV0A 4L4VA 4O5LL 3FOMB 1K8DB 3U4BH 4UB0L 4ZFOB 1KTKE 5HYSB 1F8TH 4XMLH 4HKXB 1C08A 1FV1B 5JHDE 5BS0B 2RB8A 1FN4A 1TCMA 3HNSL 3UPAA 4U3HA 4WEBL 4OV5B 4O5LH 4OIAA 1FNLA 4UB0H 3ARBA 4WW2B 2FB4L 4HK3J 4JR9L 3HNSH 3IDNA 4N0RA 3QWRD 5D1XA 4IRJA 4WEBH 2EZ0D 1XCTA 1BZ7B 3V4UL 3D85B 3QIBA 1TNNA 3GJEA 3WDJA 2YD1A 4JR9H 1R5VB 4ORGA 2OTPA 3O6FC 4M9PA 5CMAB 5I8EA 3KPQB 1QFUH 1FFNA 3V4UH 2DL2A 4MNHB 3HZKA 4HH9A 4GG8B 5TDPA 1T21B 3QNZA 1TCRB 3T08A 3QNXB 3ARGB 1AXTL 2YA0A 4DGYL 5EO9A 5B39G 2FYYA 3HE7C 4JZJC 3L5JA 4MA3A 2E27L 1EHXA 2XWTB 3B9DA 1DLHB 1N26A 2JCCB 3OTTA 5I1KL 2W0FA 3PL6B 3SDYL 1AXTH 3WFDL 1H15A 3GK8H 3MRGA 1ZSDA 2D31B 3L5WA 2E27H 2WQ8A 4X7SL 1MI5B 1YEDA 4U33A 1T7XA 4MQTB 1CFBA 2LFGA 4JFFA 5D7JC 5HJ3B 3FZUC 4URTB 5L8JB 3RWGB 4DVRL 3BIAX 2GIYA 1CU4L 1XGTA 2VDQL 5GZOC 3ARBD 1AGFA 4FQ1L 4M9OA 4PTTA 1RVFL 5IR1B 1Y6NR 3T04D 4X7SH 5JPMA 5D1XD 4PJGA 1GIGL 3F6IA 3PP3K 3QSKB 1G7JA 4DVRH 5HYSG 4BQBA 1EXUA 1CU4H 4O51A 2N56A 1YEJL 4FQ1H 3EHBD 3W2DH 2HFEB 4F7PB 1TQCC 3Q3GB 4OGYL 1GIGH 1WTGT 2IH3B 1BX2A 4UUJB 2W65A 1JJUA 4JQXA 1KPVB 1U8LA 3T77A 3OXRB 1BOYA 3PV6A 2DKMA 1FYTA 4X4XA 3BIKB 4J3WA 2NNAB 3VXMA 4Z18A 2FJHB 1NFDF 3QWOB 1C12A 1XGQA 4P9ML 1YEIL 2DMCA 3VWJA 5JW4Q 4OGYH 3GRWH 2X7LB 3HNVH 4JGUA 4HG4K 5ABDE 5JHLL 1FAKT 4LF3B 3P77B 5C9KA 3DSFH 1DANU 1G1CA 1EERB 2QQNH 3NIGE 3QUXA 5HHNA 1EK3A 1OLLA 1ZE3C 1BFVL 5T5NF 4HG4J 1I75A 4K7PL 1YEIH 4JANB 3KYKL 3KYMB 1NLDL 2FR4A 1ORQB 1KC5L 5JHLH 5E08L 4XVUD 3ULSB 4P2RA 4RGND 1R24A 3UTSA 3FAWA 2R1XB 1QSFD 3SKMA 4NQTA 2H45A 2QHRH 5C6WH 1BFVH 5IGXL 15C8L 1I1YB 2FZ3A 2LTQB 2ZG3A 1KIRA 2F58L 4K7PH 3KYKH 3E2HB 1NLDH 2FEEI 5EULV 3QJFB 5DQDL 1KC5H 5E08H 3ISWA 2WQRA 4FQ2L 2HT2C 5AAWA 4L29B 3THML 5JO5A 2YEZB 1I8KB 3KXFA 4I2XA 3IYLW 3V95A 2IJ0C 2ZWLT 3DO7A 2F58H 1VKXA 4EBQL 5IV2A 5DQDH 4LVOC 4IEFB 3U83A 3B9VA 2Q6WB 3RL2A 3NPZB 5HGBB 3EO0A 5F97E 2DQDH 4ODUA 2Q1EA 2AJZB 4L4TB 1KIPA 4KKLD 3MRNA 4EBQH 1MCJA 4JPIB 1H5BA 4M5ZL 4NFCA 5BRZA 4E5XA 3WLWD 3MSPA 1QZ1A 1CR9L 3B43A 5IF0A 4XPBL 2C5DC 3HR6A 3BKJL 1RULL 3HPLA 2DLFH 2IBBA 3QUXD 4M5ZH 1TDQA 4BSWA 5DRZA 4MD4A 4Z7WB 3ARDC 4UT9H 1OSZB 3EJYD 4FFVD 5DHVB 5C0BB 4R4BA 5CKGA 1CR9H 1SY6L 1YPZE 3K4AA 4OFYA 2ZG1A 3UTSD 2D9CA 4XPBH 3BKJH 4X7TB 1RULH 1A4JA 4HFWB 5INDB 3ZDXE 1TPXC 2IANE 3DBXA 2EIEA 1C5CL 4KMLB 2Z93A 1V7ML 5T1MB 4ODVL 4NWTH 3GM8A 1NDMA 1XF5A 1SY6H 4KRPD 4LBEA 1RIUH 1VFMA 3NOIA 3BWUC 1WUNT 1U3ZA 3KXFD 4NQXA 4JY4B 2FNBA 4P5KB 1C5CH 5HDBE 4EKXA 2ZNXA 4POZD 4GG6B 1I8IB 1V7MH 4ODVH 2FBJL 4KK5C 3Q6FB 4J4PA 3IAPA 3STLA 5EBLB 5CJOH 4N0FB 4MA8L 4F7TA 4C58B 5CSBA 4JDZA 3IDIB 2C9AA 3S35L 1A22B 2PUQT 4YAQA 1T1ZB 2ADIB 3DVIA 4KJPD 3VGAC 2FBJH 1KPRA 3PWPE 1RK0B 3TCLA 4U1LB 4I9WD 5F3BB 1UM4L 4MA8H 1C08B 3BDYL 4G6FD 2VSCA 3S35H 2A1WL 3RHWF 3ZKMC 2BJML 1EV2E 1XF4B 2DQTL 3CH8A 1KCUL 1B3JA 2PF6A 1W72H 1FCGA 3KLHD 1J18A 2E9BA 5GRVL 3PQYE 2W9LA 1CLYL 3BZEB 5JNYA 5IFJA 2XT1B 3ARBB 1UM4H 3WJJC 5ITBL 4JKPL 2A1WH 1DBBH 2VYRE 3RIFK 4XI5C 5TDNA 4KZDL 4DZ8A 2DQTH 4K7PY 3VD7A 3MO1B 1A6ZA 3GJEB 4CDHA 1BQHA 1J0KA 1DN0A 1CLYH 5ITBH 3FO2A 1I7TA 2MTPA 4G8GA 1J10A 4JKPH 3GZKA 3LD8B 2I07B 4R6UA 3QG7H 2AEWA 3BD4A 3QZWB 4UIKL 2R1YA 2R2BB 2VZSA 3S35X 5CGMA 3MJ7A 4EEEA 4LCIL 1XGPA 2WANA 1Y6MR 2MCG1 1V3MA 1I9IL 4KI5F 5HTSA 3TO2B 1QFOA 3SEPA 2XY1A 1QEWA 4ZO8A 2FYYB 1S9WA 4MA3B 5AZ2L 4UIKH 3HA0A 5ETUA 3O2DL 4LCIH 1NUGA 1DEDA 2QQQA 4L8BB 5T1DL 2VIRA 5SX4H 4I48B 3DTXA 3LKOB 5JOEA 5JXEA 4Y2OA 3IFLH 5HHOA 4RGNB 1JZ7A 3HG1E 5FEBA 1QSFB 4D94A 3VFNA 3GHBL 3REVB 1DQDL 4MA1B 2Q76A 5SX5H 3V8OA 2XWBA 4NQEA 3ULUC 1XGTB 3V5KB 4AH2B 3GHBH 3PDOA 4H0IA 5FDWA 4QHMB 5DC4B 1IARB 4MQSB 4PV9A 4TUOB 5GRYA 2YN5A 2NZ9D 3IF1B 4G8GD 4NQCA 2BRRL 1HKLH 1PY9A 1U8LB 2R0ZH 3T77B 1Q9OB 4DVBA 3IS1X 1CDBA 2ZSWA 3BZFA 1OAXH 1C12B 2CRYA 1MCFA 1FSKC 1CF8L 1FRGL 1NGWA 3H9HB 3HR5B 4U1HA 5SX5K 4JM2A 4XVJL 1ADQH 4ZTOL 3D0VB 3SE3C 5EC1B 3CC5B 5HYFA 5CEYA 4LMQE 4KMQA 5F3HB 1R0AL 1CLZH 1CL7H 3ZTNL 2UUDH 2RCSL 2FR4B 3QZWG 1JYNA 1FL3B 1R5WA 2YXFA 4PJEA 4XVJH 1INEL 2WMPA 2I9LA 4U2ZA 3SKMB 4I18A 2GTZA 1GL4B 4NJAL 4QTHB 1R0AH 3GMMA 3ZTNH 4NQED 4PP2B 4OF5A 1H8NA 4AL8L 1INEH 1X5JA 3FFCD 4HZLA 4X6BA 1MF2L 4NJAH 3D9AL 4CVZA 5IOPA 2XG5A 3ZKSD 4NQVA 2MNUA 2YSSA 4NOFA 5IV2B 4E42B 2F74B 1ZV5A 3K0WA 4UV4L 3JWDL 3RL2B 5MHSE 2HRPL 4TOYL 3EFFA 5DRWA 2UUDK 3D9AH 3HPJA 1KIPB 5DA4A 5E7BA 1QFHA 3O3DA 4FZEH 1X5XA 5GXBB 1QSZA 3HE6A 3OJDB 3FO1B 4IIQB 1MHPL 4UV4H 4X99B 4F57H 3QIWD 2VOTA 3MXVL 2X9WA 2QQLL 4JFHD 3V6OE 2DLHA 4G6FB 4R3SB 4ZD3H 3GSNL 4HS3B 2H26A 5I8KL 3HPLB 1FVDA 3HZVB 5C08A 1JRHI 1MHPH 4AK1A 2QQLH 4R4BB 1LE9A 2AEQL 4F37K 4YHOL 2CGRL 3CSGA 5FYKE 4XBPB 4I5BA 5AEAA 4WWID 1X4XA 3WNOA 4U3CA 3Q5YA 5I8KH 2LVCA 1TXKA 1RUKH 1F13A 2GQHA 2Q7YA 3V5HA 1CQYA 2YPKA 2Z93B 3G04A 3QPXL 5T3ZL 2AEQH 4PRDA 4ZXBA 2CGRH 3UBXI 4EIZC 4ZS6D 3OF6A 3ZYJA 4U1IA 5JOPD 5LWYH 1J7VR 3MC0A 2EDQA 1C7TA 3ZKNC 2JLLA 4UT7L 5ERWA 3QPXH 3WFHA 4X7CC 3P9MA 4NKIH 4CNIA 4NIKB 5D5MF 4RQQB 4HFUL 3JTTA 4GO6B 2RIKA 3DV4B 4FG6C 5C0AA 4F7TB 1ZEAL 2CDEA 4UT7H 4XPTL 1WAAF 4PTUA 3MJ9A 1NC2A 4P23A 3HE6D 4S2SB 4JKLA 1KPRB 1CE6B 4HFUH 1ZANL 1OTSC 3LB6D 4FZ8L 3LKPA 1U92A 4G80A 4MNGE 1FQ9C 1QHOA 1ZEAH 2WBJC 2CIIA 1FBIL 4MA7L 4NZJA 3BXNB 4XPTH 3DVGA 3GMLA 3U7AA 4XTRD 1M6OB 43C9A 1ZANH 4FZ8H 4FTVD 3QYCA 3VG9B 5IFJB 4UILH 2Y5EA 5DK0B 4N1CA 2ZCKL 3BAEL 1QVOB 1VFAA 4HJGA 5IB5B 1HCVA 2JJSA 5I17B 4JDVB 4CN4A 4RAHA 4BKLA 1JV5B 1YMHA 1U91B 2O61B 1S7XA 4PJDA 4EXKA 4G8GB 1EMTH 1YEHL 4M7JH 2I60L 3WEXB 2ZCKH 1HH9A 1I7RB 3BAEH 3FT4B 1NBYA 1MCDA 5HDQL 3VGHA 3N50A 4QHNA 4UTAL 3MJ7B 1JN6B 3VXSA 2B4CL 2HT3C 5I0DA 1L7IH 4XXCA 4NOBA 5F89B 2JB5L 3FOLA 4MCZA 4X6CF 1YEHH 4CMMB 4ZSOA 3CX2A 4HPYH 3W0WA 4F7EB 5HDQH 1S3KH 2XFXB 4UTAH 4X5WA 4D8PB 4PJCE 2B4CH 1NC2D 3KNBB 4P23D 1OGAA 1J1PL 5ANME 4CJ0A 5D2LB 3DTXB 1JFQL 4Y4FA 2F54A 4HSQA 2YA2A 5AWNH 2X1WL 3WFEL 2E8YA 3VFNB 2E9IA 3V79C 3WFCL 4HULB 1JTOA 5J12B 1J1PH 1BPVA 3H9SA 4OIIL 2EDDA 3RWIB 4YHLL 4OLXL 3FFCB 2HJFA 2HT4D 3WFEH 1BWMA 1IGTA 1DE4B 4DGIL 3TO4C 1AGBA 4YDIL 3WFCH 4M7LT 3MJGX 5FKAA 5FDWB 4JY5L 2BSTA 4OIIH 2WINB 5D72L 4KMTL 4YHLH 4OLXH 5EPMA 1UH3A 2HTKD 2YUWA 4DGIH 1X6NA 4YDIH 2VUYA 1HINL 4JY5H 1WIPA 2ZSWB 2BNUB 5D72H 4KMTH 3VXSD 4JN1L 3VXRA 1CS6A 1LDSA 2CK2A 1IM9A 4LAQL 5CEXA 3QIWB 4YDLB 5E5MA 2AJVL 1SVCP 3SGJC 1KFAL 1YQ2A 1HINH 3TVMD 1KEML 4HIEA 2R1WB 3VXUE 2ID5A 4JN1H 1KYOK 4OCLC 2RHEA 5JW4N 1V3KA 1OGAD 1A6TB 4LAQH 4Y1AE 2OJEA 3L5XH 1AI1H 2AJVH 1LO0H 1MHCA 3KYOB 4M4RA 4S1DD 2V2TB 3CSBA 4HWZB 3RUGA 1S5IL 1KFAH 2F54D 1KYOJ 1KXTB 2DN7A 4HX1A 3ZE0F 2CXGA 4QRQA 1KEMH 3G08B 3VW3H 1HCFX 4PGEB 4DW2L 1P7HL 3WKNA 4DGVL 2DI7A 4U2YA 3STZB 5JQHC 1I85A 3TWCL 5KS9A 4HIHA 3NN8A 4JFDA 5C07D 1IC5H 1P1ZA 4P4KA 5C0DA 5EB9A 4HZLB 3ARQA 4DW2H 5MEND 4X6BB 4DGVH 4MHHI 5D7LA 2HH0H 3T1FB 5IHZB 3HN3A 3VFOB 4FFYH 3TWCH 1MCPL 5TF1L 1A4KA 2YSSB 4AG4L 1IAII 5B3NA 3BUYA 5DT1L 3NCYP 3LEYH 3KLAA 2ARJQ 3HFMH 2A9NL 3QFJB 3EFFB 2VISB 1MCPH 5F1NB 5F6HJ 5TF1H 1A3QA 3BP5B 4KUZL 1NMCB 4ODTL 5DT1H 1KXVC 5FO8A 3FONB 5ISZD 4NNXA 4HWUA 3O11B 2GHWB 3HRPA 5F1SA 1A6WH 1NJ9A 1I1AC 3BP7A 1HQRA 3LQAL 3O45B 2NZIA 2VLJD 4L4JA 5ESVB 4O4YL 3UZQA 3EYVB 2BCKB 1KJMA 4KUZH 2PNDA 3RWCB 3IB4A 1FE8L 3HZYA 2VZ1A 1A7RL 1T22B 3BH9A 3GHEL 4X4YB 4FTVB 3OX8A 4PJ8A 3CLEL 4L5FL 3LQAH 4PRBB 3MUHL 3CGTA 4O4YH 5A3IC 2YD3A 3FQNB 4LRNH 2X89A 1YC7A 3CZJA 1X4YA 2H32A 1K4CA 1HXYB 5HI4C 5J4MA 3AMLA 4YEEA 3V5HB 4ELKA 3BGFB 5IM7B 3CLEH 4PR5B 4C83A 4P4KD 4KGLA 2IPUG 2DAVA 4MB5A 4RMVA 3LKRB 4YDVA 4HKZA 3WFHB 4XVUC 4GBXA 4RGNC 3LSOA 4JO3H 4YIQA 1Q72H 3P9MB 5D6CB 3RVTC 2R0WL 3MRRA 4CNIB 1U8MA 3KAAA 5IVXB 4YGVA 4TSAL 3FTGB 1C1EH 4PRHA 5J9PA 3NZ8B 4IM8A 4MA1C 3ILQD 1NFKA 2YA1A 3P9LB 4ELMA 2M26A 5C2BL 1BWWA 5EOTB 1NC2B 1DBKH 5DD6B 3GUTA 2R0WH 4LHUD 4Z95H 3DUUB 3LKPB 4TSAH 1U92B 1D9KA 3B9AA 2ICWI 5GGTL 3GDBA 2HYMA 3BUTA 1CTNA 1VGKA 3VFRA 1EHLL 3N1MC 1U2HA 2EKJA 1R3JB 5CZXD 3GNML 43C9B 1Z3GL 1X5LA 1U8NA 2W07A 1BAFL 5ACZA 3NCEB 3C5ZD 3S98A 5C7XL 1ZVSB 3QEQA 4LPUA 1KCLA 4RGOH 2ARWA 2X89D 4QRPE 5F7YC 4ZNCD 1EVTC 4GAJH 3GNMH 5DJYB 5IKCB 4G42B 3RZWA 1Q1JL 4BJLA 2WSKA 3MLVH 4WTXA 2VN7A 3CNKA 3QUZC 3RHWK 2XKSA 4WO4A 3PGFH 4H5SA 1A1MB 5DRXB 5GGSY 3IVKA 3H9ZA 3BEVA 4HUKB 2OCFD 1JZ8A 3TNMA 1M7XA 4PJ9A 1Q1JH 9CGTA 1K8IA 3A6OA 4KK8D 1AR1C 2AJYH 1Z9LA 1LEGA 5HXMA 4MCZB 3UTQB 3IJYA 4PRHD 3N1GC 3UYPA 1UADC 3TVMB 2ADJA 4K3HA 5I8OH 3DRTA 3BGAA 4GKNA 1DLFL 5AZEL 1P9MC 2NPLX 1SYSB 3ARUA 5IK3A 3ULUH 1OGAB 2H9GA 2A0LD 1T0MB 4U49A 2CIKA 3OR7B 3QIUC 1D9KD 2F54B 3I2CL 5E4EC 3LRSB 1N7ML 1X5IA 5DS8A 4J8RA 3LV3A 1DLFH 5AZEH 4NC1E 5D71H 5JIKA 1CD1B 2DKSA 1C5DB 5C07B 3QHTC 3I2CH 3QUKA 2OXGA 2HJFB 5MENB 4N8CH 4ORZC 1D5MA 2W92A 2VE6B 2BSTB 2EECA 3PWLA 1G6RL 3EGSB 5LKNA 1G9NC 1NGZB 2W9EL 3RTQD 3ULUE 2DI9A 4LHJB 4WO4D 1A7PL 2H2PC 4X6FA 2FX8L 5C6PB 3UJJL 1VPOL 4JM4L 3QBTB 2DIJA 5F9JA 1G6RH 4K9EL 4PJ9D 5I1DB 4YHNA 5C09D 2W9EH 2B0SL 3TPUA 3UTZA 5ISZB 4UIMB 5E94A 3U0TA 3CXDL 1A7PH 1YN6A 4WWKC 3RNQA 5FOJA 5TF0A 4PD4K 1VPOH 4JM4H 5F93C 2NTSP 2VLJB 2E9JA 1RUAL 4N5EC 3NFSL 4GXVL 1QD0A 4K9EH 3L6FB 4R7NA 5EZOL 1WV7T 3ESUF 2FH6A 4ZFOL 2B0SH 5ACLA 1X44A 5KSBB 5D96B 3CXDH 3QFDB 1Y6KR 4MJ4A 1RUAH 3TT3H 4HX1B 4QRQB 5CEZL 3VXPB 5DC0A 4MAUL 1CDUA 5C3LD 3P30L 1T4KB 4WFFD 4OLZH 5H8DA 1F42A 1P1ZB 4P4KB 3VU2A 5C0DB 3LN4A 1UXSA 5CEZH 3FT3B 1U58A 2J7LA 4QF1A 1NL0H 4IHOA 4Z0BH 4AJ0A 5DFWH 3MLRL 4ZQKB 3DUSA 4U6VL 3VFTB 3DETC 4BM7A 1CGXA 2OBGA 4ZPTA 3NAAL 4CMHB 3BKML 1IILE 1K4DA 4JRXA 3PABB 2ZJSL 5I74C 2OZ4H 4GW5A 4Q9CA 3JWOC 4M8QB 3MLRH 2UWEA 5GS1A 3TV3L 4U6VH 3MOQA 4KHTL 3GSXA 4LHUB 1PZ5A 3IDYB 4BQ6A 5JPNB 3GJFA 3NGBB 3NAAH 1H0DA 1V5JA 2IADA 3BKMH 5BS0E 3P4OA 3CVHA 4X6DE 4LLWA 2ZJSH 3FRPA 4MHHG 3BP7B 3NIDF 4TNWK 3MRPA 5MEPA 1OGTA 5IJVA 4YC2C 3X12A 1G0XA 1LP9B 5CEZE 4HS6B 4QOKE 5DJZB 3TV3H 4LLQB 4KHTH 1MFEH 4UMGA 3HZYB 3M8OL 5GJTL 2HWZL 3BJ91 3SGDI 3C5ZB 3JV6A 2VLRA 1Q94B 1T1XA 4Y2DA 2OTWA 3HI6H 4WIQA 1F3DJ 3RPIB 4Z0XA 3UDWC 2P7TA 1ERNA 3IU3A 5GGUB 1AGDA 3H3PL 3M8OH 5GJTH 1EEYA 1E28A 1WZMA 4XPGL 5CS7A 4NO0D 3L1OL 1PYWA 3L3OB 4MXVE 2BVQA 1VEMA 2JJUA 5ILTH 1EGJL 1VFOA 1OP5H 3IDGB 4QRRB 1UEMA 2CXKA 5FM5M 4U31A 3L1OH 4M93B 3EDJA 5A2FA 2VR4A 3FN9A 2H1PL 2E7LA 1RHHA 2PO6D 2YUZA 2JF1A 1SBBA 1DFBL 1EGJH 4JVUA 3UTTA 4X9FA 1J05A 4OZGE 2P24A 3K1KC 4N0CD 1ONQB 2MSPA 3B3IA 3OKKB 2H1PH 2VAAB 5EBWA 4Z7VB 1CDIA 1DFBH 3QQ9D 4CAGA 1KCSH 4KVNL 1FFPA 1D9KB 4PGDA 2F15A 1MI5E 3U30C 4PREA 4NQDA 5AG8A 4P3DB 5M94B 5LGJB 1P7QD 3BX7C 3HMWL 4UAOB 1JGLL 2FL5A 4YFDB 1QG3A 1EFQA 1K3IA 2GY5A 4DQOL 3ZDZF 4JG1H 4KVNH 2NY6D 5I76A 1A02N 4XGZB 3HMWH 2Y6SD 1YZZA 5MI0C 4Y7MA 4LHUG 1JGLH 5LJYH 4NO5A 5DJ6A 1RZIB 3VRIB 1EZVY 4DQOH 4YDLC 4AIZA 1WSST 3FB5A 3RTQB 5LCVL 1Y18B 4WO4B 3FB7A 4H5SB 3TGXA 2QSCH 3S88L 2E6JA 3CFDA 1PLGL 2Y06L 4LLMB 5FA3A 2C1PB 5C09B 3WFBL 5L9DL 4U1KA 5LCVH 3QNYA 4ODXB 1ZLVK 5FYLE 3WS6A 4XAKE 1G7LB 4HLJA 3T2OA 3S88H 2YZ1A 2AXGA 3Q48A 2ATKA 4Y8DC 4R0LC 5CCKL 2APXA 4AEIH 2Y06H 4YE4L 1MCHA 3OJ2C 5J1AA 3VCLA 3O4LA 4Y5VA 3KPSA 3EYQD 4ZS6C 5HHMD 5J1SC 4J1UA 3UMTA 1KELL 2FEDC 5CCKH 2WWKO 3ZTJG 5DFVD 2QKIB 4J8RB 1BQUA 2JELL 4OUUB 5DMGC 1YJDC 5GS2D 2ED9A 3BRFA 3VXOB 1MHEB 4RBPK 1PKOA 5IHUL 4LK4A 4MNQB 2YD2A 3MLTA 4TTDD 3QUYA 4MJID 1HIML 4Q9QL 1A1OA 4LPWA 3IKKA 5DHVH 5GGRA 2JELH 3EO1A 3G6JB 4JFYA 3EYUL 1BJ1H 3LB6C 5IHUH 2VQTA 5E2TL 5HGAA 1F4HA 3LRGA 4LPYA 5LG1A 1M7IA 4Q9QH 2CKBL 3RVWD 4LKCB 4TVPD 4XWGH 4NN6B 4YNYA 3SDDC 3EYUH 1W0VA 3SGKC 1A8JH 5E2TH 1T0NB 5EBGA 1MJ8H 3BW9B 4DCQB 3UTZB 1DVFC 1OTTC 1DP0A 5E94B 2YOCA 3GSWB 4PRAA 1A9EB 4Z7OF 2A83A 2A6JA 3BP4B 3BGMA 4BYHA 3RNQB 1BJMA 4JAMA 1N0LA 1IMHC 4PLKC 3QEHA 1QTYT 3BGFC 3FCTB 4HUXB 1FNAA 4XVSL 4ZUVB 1IGYA 1HI6B 4Z7WE 1PBYA 4XNMA 1IQWL 4PB9L 1MLCA 1NFIA 4PJFA 3HC4L 3O4LD 1ZT7B 5C0BE 3BJLA 5DJAA 2JIXB 2VWEC 1HHHA 2BNRB 3V4VL 2YPLD 3QT2A 2VXSL 4XVSH 4YFLI 3VG0L 4H0GA 4PB9H 1J1OL 1EEZA 3F7PC 3HC4H 1QBAA 4DK6A 4PGJA 1T1WB 4NO0B 4U0RB 3MRIB 1DUZA 3QQ3B 3PE9A 3V4VH 1Y0LA 1AD9B 2VXSH 2X4UA 3TBVA 3LN4B 3C8KB 4HK0A 4GG6E 4S1SL 1MJJA 2QV2A 4IHOB 3M17A 3KDMB 2GY7B 4LP5A 3AS0A 2EIZA 3SKNB 2B39A 1DBJL 5F1IB 2PO6B 2DRUA 3EYFB 2LVEA 3D18A 2QBWA 5L2KE 3F7RA 2V5MA 4S1SH 3OJMB 1QACA 2VXVH 2VZUA 4E41E 1OPGL 2AQ2A 3BQUA 4TPRL 1DBJH 3GSXB 2OI9B 4YK4B 1GYAA 4RFOL 4XRCA 1H0DB 4TUKL 3WE6A 4U4BA 4LAJH 1J0ZA 1U8HB 3MOBL 3MQIA 5MEPB 3V9FA 4QT5A 1P7QB 1OGTB 1OPGH 3MRLA 1Z5LB 3PWVB 3P11H 1V05A 5AAMA 4HHAA 3ULVC 1N2RB 4LASL 1RZJC 4JFPA 1AC0A 4RFOH 2HJKA 4TUKH 1T1XB 2YHGA 4OZ4A 2IEPA 2P8MB 3MOBH 4Z0XB 2P7TB 3IU3B 5IJKC 4MWFB 3GIZL 4PJXF 4LASH 2GJ6E 1Q9LB 3FAXA 1ZVYA 2PTTA 2X70A 4J3OC 1NGPL 1D5IL 5GRWA 3MV01 4HIJA 4RFEA 2CO6B 4G8FA 1PYWB 3EOAB 4M6OL 1KTRL 2BVQB 5LVEA 1I4FA 1UGNA 3CX5K 2N4IA 1CIDA 3SJVD 2DM3A 1CFVL 4Y16A 1KCRH 4PG9B 3RA7L 3SGEI 5H35A 2NY2C 1NGPH 4LCCA 2J2ZA 1D5IH 4YHPB 2HN7B 1RMFH 2IALA 3CX5J 1FG2B 1FVEA 5JOFB 2X4NA 4M6OH 1MJUL 4CUCA 5TE4L 4HUVA 1CFVH 4QY8A 3PHSA 4WU7A 3RA7H 2J88L 4MJ6A 3ILPA 4GXUM 1JHTA 5JXAL 1NCWL 5K33A 3BQUD 2HLFD 4I13B 5HHMB 5EBWB 1GC1C 1MJUH 2HJLB 4RGNE 1ZAGA 1QSFE 1FFPB 4I4WA 4WY7H 2J88H 4PJ7A 3TCXA 1NCWH 4H1LB 1KTDA 4HPOL 2CO7B 4Y88A 5DHYB 3N1FC 3EO9L 2VXTL 4QXUH 2O5ZL 1NH6A 1U36A 3S96B 4WHYG 1SEBB 4MJIB 3DSNA 5CINL 4HPOH 1VSCA 1T5XB 4NO5B 3IDJA 3EO9H 2V7HA 2COQA 4OB5L 2VXTH 4P46A 3KPOB 2O5ZH 3FRPG 43CAA 3C6SB 1CXFA 1F2QA 1IFHL 1TMCB 3FB5B 3EIFA 3NPSC 4PJIF 2ZPKL 3T4YA 2A6KA 2PKDA 5CINH 4QYOA 4Y16D 2EXWD 3CSYA 4PY8J 1VESA 4U6HB 3CFDB 4OB5H 4EIGB 1SJVA 2B1AH 5F6IB 4WUUE 4P5TB 4M3KB 4E0RA 4F9LA 1IFHH 2ZPKH 5DI8A 2CJUH 2FX7L 4LCWD 2X4OA 2AXGB 3IS0X 2NY4D 5F9OL 1JWMA 5DR5L 3B2VL 3HUJB 3EFDL 4LCUA 4M6MH 5J1AB 4U1GB 4JFZH 3O4LB 4ESKA 1G9NL 2FCBA 4XNZC 1AIFA 2P1YA 4K3EL 2YPLB 3C5SA 5F9OH 4QHUA 4OBSA 1W0WB 4OGAD 3OBAA 3B2VH 4KUCD 1INDL 1NGYB 1XGUB 3EFDH 3QJHA 1GGCL 5L6YL 1QRNE 3MGTB 2D4DA 4NYLB 1T7WA 4P3CL 1G9NH 4U6TA 2ITCA 2VQUA 3RL1B 3WMSA 3RGVA 3SO5A 4FN0A 2CLRB 2G5BA 2DJSA 3HC0A 4HGMA 1GGCH 1KACB 1FO0H 3L3GB 1LO5A 4KKCD 3GGWA 3NABL 6CGTA 3MLXL 4P3CH 1MCOL 1MRDL 5HGAB 2AV1B 4LLVB 4H1LG 3VRLF 5JHDA 5GSVB 3N06B 1I1RA 3WO4C 1YEFL 3MUZ1 4OGXL 1F3JA 4HGKC 1WZ1L 1MCOH 1MRDH 3KLDA 5E2UL 5D7IF 3RDTA 2HRLA 3FQWA 1XR8B 2IF7A 3MREA 1YEGL 4EVNA 1BECA 1WT5C 4MDJB 4PRAB 5D2NB 4OZIF 1YEFH 4OGXH 4XP5L 5CIPA 3QEHB 4Q2ZA 3Q5TA 1WZ1H 5DTFA 4HF5H 2APWA 3DGGA 4XNMB 4X0KA 1MLCB 4PJFB 4LRIA 2OSLB 3A6CL 4UTBL 2AXHA 1YEGH 4I0KA 2IFGA 3CLFL 1PX4A 2MHAB 2M8XA 4XP5H 3KPLB 3EBAA 5FOBB 1M71A 2Y72A 3FHQA 4M93C 4XCEA 4PBXA 3JWOL 3MRBB 2EEAA 1EEZB 1WJ3A 4QXGL 1JNJA 2GTWA 4UTBH 2X09A 2ZSVA 1HHIB 4RFNB 1EJ6A 3CLFH 4DN4L 3RGVD 1MLBB 1Y0LB 5LAXA 3LN5B 3R0NA 3MRQB 7CGTA 2X9YA 3SJVB 5ESAB 5J3HC 3JWOH 1SEQL 5E4IA 4NN7B 1JPGA 5TH2B 2IPTL 1PKQE 3M17B 3T65A 4JFOB 4NC0B 5DSCA 4DN4H 1IC1A 3W39A 1CDYA 4S0TD 2R2EA 5IT2L 2EDLA 2HLAB 3GO1L 1A0QH 5DC9B 4WW2F 1UWXH 4UAOC 4W4OC 1SEQH 2J12B 2V7NA 1NUNB 3QQ4A 4P9HC 3O9WD 4X98B 1N59A 1Z0MA 1R3HB 4HJ0C 3RDTD 1OCWL 1TJGL 2P45B 2WAHA 5IT2H 3GO1H 5F7FA 1J88A 5DEFB 3WIHL 3KR3H 2K7QA 5TFSL 5J1TC 3D5OF 4EOWL 4L8CB 4QT5B 1OF2A 5FKPA 1OCWH 3DX6A 3RTQC 3RWDB 2GT9A 2ZUQB 4JFPB 2EYRA 2VZOA 2HJKB 1UJ3B 4UQ2B 4LEOA 3WIHH 5AD0A 5C0JA 4FRWA 5BQ7B 3GSOA 2HVKA 4DN3H 5TFSH 4EOWH 2XPGA 4MJ5B 2G5RA 5T5FL 3IKCA 3C60A 1XR9A 1I8LA 3QHFH 1MCLA 2X70B 5DDHA 5E7FA 4WTWA 2ZUUA 4NBZB 3BD3A 2JCCF 3UEZA 2RFXA 4U1MA 3IFPA 1G7PB 1QSEE 2FDBP 2C1OA 2DQGH 3ARSA 1GGYA 5T5FH 3TBWA 1IKNA 2ERJB 3IXTA 1X5AA 4OM0H 4Y16B 5IIEB 4I0PA 2GSIB 4LIQL 5IB1B 1MREL 3MODL 4GJTB 4LCWB 3WO3B 1ZT4B 2NY4B 3BPLB 4OZHE 5DQJA 4RA0C 3BMVA 4XWOC 4XPAL 3S34L 1IEAB 5D2LE 3KPNA 1MAML 1MUJA 4L3AA 3D1MC 1T89C 4ZMAT 5EU6A 3GRWA 3RX5A 5FM5O 5F71A 4NUJA 4I4WB 2X9XA 2EYSB 5B22A 4NPYB 4XPAH 2GKIA 1JRHL 2J5LB 1MAMH 2MQCA 3AREA 3NZHL 3RWJB 3W11D 4J23A 3FO9B 2Z8RA 3FFCE 1XCQA 5EU4A 2VKXA 3BI9X 5CJXA 4PUBH 4LGRB 2HFFB 1JRHH 3Q2CA 3HCVA 3C60D 5IWLC 5I1CL 4HBQA 2ADGA 5GSRA 1K2DB 4QRSA 4EN3B 1X5ZA 1J11A 3TFKD 3JV4A 4ZAKA 4FMFA 3BT2L 5D70L 4Q0XL 1N6VA 3FHAA 4KTEH 3ABZA 3IDUA 3AUVA 1VENA 3RWFA 3MNWA 3ZL4L 5I1CH 4PG2A 4X7DC 3SOBL 1R5IA 1YPZA 4M1CC 1FC2D 4JFHE 3BT2H 1KPUA 3MYZA 4Q0XH 5D70H 3RY5A 3J7HA 2X4OB 1JGDB 4Z77A 3INUL 5LGKA 3O8XC 1YJDH 1F4YL 4U0RC 4Y8AA 5IMMB 2ZUSA 3VH8A 3QCTL 1FLRL 1REIA 3C5SB 1FDLL 3INUH 4YUEH 2D0HA 1MQKL 2L4OA 1F4YH 5DJ8B 1YA5A 4YGAB 1HH6B 2ESVE 4PJHF 3ARED 1LMKA 4DOHB 4ZUWB 5CGTA 5IMLA 1FNHA 3DMMC 3VGFA 4KROB 4PJBB 1KIQB 3FB6A 3RGVB 1FDLH 5DO2C 1MQKH 2G5BB 1NEZB 5FDYA 1T6WA 4TRPL 1RURL 3V6ZA 1K9TA 4PS4L 2M2DA 1UFUA 2CH8A 4BK5A 2E6QA 3H7LA 4X5XB 2RGSA 1I8MB 3QFJE 4DAGL 1SY6A 3IRPX 5EZIL 1RJYA 5JW4M 2XTJC 1RURH 4KY1H 3SE9L 4PS4H 3RZCA 1F3JB 4LARL 4JREB 3O9WB 1ZWIA 4GRLA 4XNUL 4DAGH 4LHQB 4MXQD 4KDTA 3MREB 4Y0GA 5EZIH 4EVNB 2D7QA 1NBZA 1IAMA 5DWUH 2CSPA 3WNLA 4XCNB 4LARH 4JLRB 2IAND 5CIPB 1U8PB 3DURB 4NO3A 1LGVA 1QLFB 1HQ4A 3HI5L 4L3CB 4BH7B 4OI7A 4FTVE 3NACL 4RMQA 5D6DC 3QDME 4NM8L 3FB8B 3ALXA 3SDAB 2DOCA 2BRQA 2VITA 3S3PA 4H25A 4YHZL 4G8EA 4Q6IB 3STBA 5I73B 4Z9KB 3HI5H 4LSVL 2HVJB 4M4PA 3NACH 1FZJA 3V6BR 2JK5A 2NR6D 1QA9B 4HV8A 1CGSL 1W72A 1YECL 4S1RL 2BFVL 2VWEE 5LAXB 3L5HA 2UY6A 3WKML 4YHZH 3V7AG 1N6UA 5JMRA 4ZG1A 2BY1A 4LSVH 2I5YL 3EYQC 5KZCD 2KDGA 3GMQB 4DKAA 5AUMA 1OAKH 3DROA 1RK1B 3PWPD 3U46B 1TTUA 1CGSH 2D0GA 4NKMA 4QWWC 5DSCB 1YECH 5IVXE 4S1RH 2BFVH 5CWSB 3HG1A 3WKMH 4J2XA 1SM3L 2DB8A 4HIIA 3WHXA 4MCYA 1HK6A 2I5YH 3CFJB 2Y5TB 3ULVH 4LSRL 4TTDC 3PQYD 1NEZG 1OWWA 2AAVA 3B2UC 1SM3H 2JJTA 5K9OA 3QIBC 2NY3C 3BKCL 5M95B 1R6VA 3RAJH 2AXFA 4XP6L 1PGRB 4WDIB 4LSRH 1OF2B 4OGZA 2Y07L 3CH1B 4Z5RB 1EEUA 4G3YL 3ARFA 1UXWB 1MOEA 5BVPL 3RVWC 3BKCH 2J1KA 4C4KO 5EORL 4FFWD 1QFPA 3U0PB 3WDHA 5KVDL 1T80A 4XP6H 1DL7L 4KQ4L 5IEHA 2XPGB 4P5TC 2Y07H 3LH2L 3X13B 4G3YH 2DQIL 3ULVE 5BVPH 5DDHB 1GHFL 2LU7A 1DDHA 4Y19E 1GC1L 3D3VA 4U1MB 4P2OC 4YEFA 4LPVA 4Z78A 2C1OB 4KQ4H 3H3BC 5DD5H 2AERT 4U1GC 5J11B 1D6EA 5CJQL 5HVGB 3IXTB 5E99L 2P8PA 2CDFA 4Y5XC 2DQIH 5CD5D 1UEYA 1S9YB 5I66A 1GHFH 3D69A 3BP6B 1GC1H 1IAIL 3MFFA 4AEHH 4TUJB 4YBQD 5K59F 4GS7B 3HG1D 5IMOB 3AU1A 3LQZA 4MJ2A 1L0YA 2ORBH 5CJQH 5E99H 2EDTA 1UKSA 5EG6C 2BOBB 3K2MC 1P7KA 3MLZL 1FL5A 4Y5YA 3RQ3A 3UAJC 5AG9A 3ARRA 4UOW1 4UINL 3MV7E 1IAIH 3QPQD 3KPNB 4C4KT 1RZGB 4FQHA 3T2NL 1JWUA 4U1SA 4TNVK 5ENWA 5HVHB 4TSBH 1WEJH 1YYLL 2XN9A 3GIVB 3C8DA 4ZTPH 4QTIL 4NUJB 1J0YA 5E24E 1ADQA 4CBPA 4UINH 1L6ZA 1OQOA 2FBOJ 2CLVA 3T2NH 3AREB 3MGAA 2PW1A 4JQXC 1YYLH 2OQJA 5C07E 2DQCL 3P40A 3ZDYE 3U4EB 5MENE 3LN9A 5EU4B 5IBTL 4UZGA 1VACA 2X4SB 5E8EA 3LEVL 3VWJC 1BZ9A 5CP7A 3QXAA 5FUZL 1RIHL 5SWSB 3HCVB 5LQBL 5JZ7D 3MRHB 2IMNA 1U3YA 5DGRA 1V7NL 5D2NC 2ADGB 5GSRB 5JR1H 1ZT1A 5IQ9B 3V6OA 3FQTB 3I6LE 5IBTH 1PQZA 1P4IL 1S78C 1TVBA 2HFGL 3LEVH 2DWEA 3UYRL 5LQBH 5AYQA 3MNWB 5FV1L 1DUYB 2VDKL 2D2OA 5ISZE 3BDBA 1WFUA 4HS8L 3S36L 3SDXB 1P4IH 2V5RA 1VADA 2HFGH 2UVEA 2VLJE 1KPUB 1FZMB 4D0BB 2AJ3A 4HKJB 2AKRA 2IANB 3WXWL 5D7SH 2VDKH 5E8OA 3VMNA 1KB9J 4HS8H 3S36H 4O58L 5KSBE 5DURD 3UZEA 1YDPA 3TA3B 4J3VA 1BBJB 4CADB 2BVPB 1UA6L 5IQ7L 3WXWH 1FZKB 4YBLB 3T0WA 5C0RL 1JZ6A 4O02L 4M48L 1CD8A 4O58H 2D7TL 5EIQA 5TE7L 4NJ9L 4I3RL 4FQPA 5FM8A 4GKSA 4ENED 4A2MA 5HYJD 4K94C 4H26A 1U3HA 5IW6A 5IQ7H 3KPMB 3MBEB 3EUUA 5C0RH 4O02H 2YRZA 4M48H 2D7TH 3V6ZB 4FQJL 2AK4B 4NJ9H 4I3RH 5KZCB 3MZTA 3VFGL 3IRZA 3PWPB 1KLFA 3F7YA 4MNGA 4DKEL 2WIIA 3S36X 1F4AA 3U6RB 5TQ2H 1KCVH 1RV6X 3MRFA 1LDPL 1U8JA 4XMPH 3VFGH 1T6VN 2ZUQC 5KSAA 3ESVF 2EH7L 1U41A 3PQYB 1Q0YL 4WI6A 4ZPVA 4NRZA 3NIFE 1FZOB 5FYKD 3Q5OA 1XIWA 5KANI 1MNUL 1LP9E 4KZEL 2R9HC 1YNTB 3CDGB 1IE5A 2ZZUT 4P2YA 4IMLA 4LKXB 5FV2A 5A2LH 2ERJC 2P5EB 2OM5A 4IS6A 1MNUH 1RZKC 2VITB 2NY5C 3SCMB 1FJ1B 1G7IB 1Z0NA 4P9HL 4ETQA 3QHZH 5FK9A 1MH5B 5HY9A 2VL5A 1UWGL 3EW3B 4HUNB 1DR9A 2DQJL 2WWMD 3T0EB 4K7FA 3QUMB 2ZOKB 1W72B 5F8QC 1S7QA 4KRLB 4EI6B 3O6FA 1TTFA 3SE4C 4Z8FL 2R39A 5EN2B 1FVCB 1IZKA 1WFNA 2HMID 3OKEB 4LEXH 4YHIA 1RSFA 4HEPG 4I0CC 4QRRE 2AXJA 5B4MC 4PJCA 3MCKB 4P9HH 5ANMA 4KJYA 2DQJH 5AUMB 1GRWA 4NUGL 4WHTA 1MFNA 2JJWA 2FSEA 4Z8FH 1M05A 4YDJB 1TZIA 4P4RA 3HE7A 4JZJA 1WC7A 1ZA6A 4FQQB 4MCYB 4RAUA 4MAYD 3GFUA 3HZMA 3LIZH 2I25N 4NUGH 1XGYL 3T0BA 4Z7VE 3MRJB 3MV8D 3KYNB 2VLKB 4PY7B 2C3GA 2FHBA 3QDJB 2DMBA 2X1QA 2AXFB 3GBNL 1ULVA 4R97B 4XP1L 4FOMA 1DBAL 1XGYH 3DX9A 4EN3C 2BNQD 2VDOL 3W9DA 2NXYC 3MV9A 4EUPB 4WTZA 4K71C 1XZ0B 1RUPL 3E8UH 4NNYB 1N5YL 2XQYK 3MRDB 4NC2B 2VDOH 5DFTA 5BZWB 5F7WC 5L0QB 1DDHB 3TLRA 3R8QA 4K23L 1RUPH 3O6FD 4JG0H 1N5YH 1J0IA 5I6XB 1Z9MA 3MXWL 5DEGB 2W60B 3MR9A 5CD3A 1JYWA 4OCXL 1D6EB 1JGEB 5JXEC 1J8HE 1XF3B 1ZA3A 3DX8B 4OSUH 1F6AA 2PW2A 5C09E 4Y1AA 3U4AA 2PN5A 1S7RB 3MFFB 1B0RB 2Z31B 5E70A 2IPKA 3MXWH 2C4FT 4AENA 3HE7D 3GMOB 4OCXH 1IGJA 3OG4B 3NCBB 4GRWH 3W9EA 4U1NA 3RRQA 3MNZA 2H3NB 4KROC 4EQ3A 1KUMA 1A7NL 4U1SB 4O2EB 5CJ8A 5C0GA 4RMSA 1MFAH 2Q86A 1LEKA 4D0CB 4PJAB 5ICZA 4LLAA 5E1AA 2AI0L 2R0KH 1HHKA 3B83A 5D7JD 1FCCA 2CLVB 3FZUD 1A7NH 2XZZA 7FABL 4MNQE 3DYMA 5E6YA 1BVLA 5K9KA 1UKQA 5C70A 2OQJB 2IH1A 5HYJB 4KGJA 5E8NB 5J57B 2HTLC 2Z35B 1PZUB 3QI9C 2O5XL 3VJ6A 1U6AL 3CFBA 5DVKA 1ZGLM 1UQSA 4WI5A 3E6HB 3QXAB 3IGAA 2DBJA 1AHWC 4W81A 2VLLA 7FABH 3TNNA 2FATL 4JM2C 3SGDH 4GRWE 4MDIA 4DTGH 2C3XA 3GMNA 5I0ZA 5F7DB 5J6GA 4Z7QF 1U8QA 5IUSA 3I6GB 2O5XH 1TVBB 1U6AH 1ZGLA 2DLEA 3VXUD 1P6FA 4JFXB 5E9DE 4EUPG 3CFEA 4O2CA 4U0QB 3SDAC 1MCEA 4Y1AD 5FYJH 3CZFA 1LK2B 5KSVA 1PDKA 4FNLH 4EDWL 5SV4A 4Q6IC 5I73C 5ESQB 5JW5A 1X5YA 5EUOB 2OP4L 4GQ9L 2AKRB 5E6ID 3VDAA 4U3XA 3ARDA 4QNPF 1B4RA 1X5FA 4CJ1A 3LMJH 4GUPA 4EDWH 4F2MA 2BNRE 1CGUA 5IB4A 2ZOLB 1MCIA 4GQ9H 1UJTA 4MMXC 1ND0B 4YJZL 1LNUB 5H37G 1J1XH 4N68A 4LCYB 5FYJE 1RJZA 2HT2D 1JPTL 2YWYA 2GJZB 3LRHA 5D4QA 3VFSA 1I3GL 2Q3AA 3FFDB 3VFPB 1JGUL 4WU5B 1XEDA 1JWSA 2DJ4A 1U42A 1QR4A 4DEPB 3WN5A 1I7ZA 1JPTH 4FQCL 5TDOB 1O7VA 5I9QB 4LSDA 1I3GH 3MRFB 4MAYB 1JGUH 3MUGA 4Q9RH 4NT6B 3D0LB 4KH2A 3AS3A 3MV8B 4AQOA 2HFTA 4NRZB 1CGVA 4LSPL 3ZE2F 4QRPA 1D5ZA 2IGFH 1IGIL 3GB7A 1HOCB 4ZXBC 3VI3E 3S4SB 2XTJE 2ZG2A 1MHHA 5F7KC 3VXQA 4G7VH 5EC2B 2BNQB 2LU3A 3ARDD 4CU6A 4IMLB 3HC3L 5JLZA 2E8ZA 1DQJA 3QH3B 3WJJA 4LSPH 1IGIH 3ARYA 3BRDA 1S9XB 2IQAB 3LAFA 4N0UA 4OF7A 1S7UA 1BJ1J 4EI5A 5EBMA 5BVJA 3HC3H 3C5JA 3G5ZB 2VL5B 4OZFB 4HQQL 2EE6A 1T66D 3MUY1 4H1LH 3O6FB 3DYOA 4LSQL 3V52L 1LILA 4YHIB 2NLJA 4NZUL 5DJDB 4PJIA 1Z9SA 2C4FU 1F11A 2MKLC 1BIIA 5ANMB 3PP4L 3OB8A 4HQQH 3RY6C 1ACYL 1J0HA 2QL1A 1PVHA 3ROOB 4LSQH 4KK5D 2YPVL 4TVPL 5CSZB 2ARJA 4ODWA 1F97A 2Y7QB 4P4RB 3HE7B 2ZCHL 4RAUB 3IJHA 5DA0B 5INCA 4AT6B 2DLIA 2JB6A 3PP4H 4XNXH 2VERN 2YPVH 4TVPH 4MSWB 3VXTA 4OD2B 2R4SH 5J56B 4JKWA 3AC0A 4PGBA 1A6AB 4QRPD 4HIXH 3EYSL 5F72S 5D1ZD 1QKZH 3ZKMD 4U6XB 3C87A 3T4AB 3QXTA 5C71A 2WM0A 5D7JB 4JJ5A 4OCWL 3H7BB 4NGHH 4KAQL 3H0TB 3UPCA 1B6DA 4MJIE 4GAYA 2K9UA 1FFOA 1JK8B 1UCBL 4XXCC 3C9NA 4OI8A 4XI5D 3CPLA 3RX7A 3LZFL 2R8SL 2X4RA 1XH3B 4MXQC 4NBXB 4F3FB 1M7DA 1GPOL 4KAQH 5LXGL 1IEBB 3OAUL 1I3UA 3S4SG 1VDGA 1UCBH 5DUML 3RBSA 3EDKA 3EJZC 3IETB 3F65A 3TT1L 3VXUB 4Q97A 3MR9B 3LZFH 2OR9H 2DQEL 4Y4FC 4F9PA 5T33L 3G5YB 3TA3C 1GPOH 4ISVA 4Y1AB 3OAUH 1UZ8A 2VABB 1YUHB 3GSUA 5HDLA 4YBLC 5DUMH 1QBML 4EZMA 1NFDB 4AENB 3TT1H 3HUJE 2DQEH 3HMXH 4OZFG 5T33H 4U1NB 5EO0A 3MNZB 5E6IB 4XAWL 4OZIA 1G6RA 5EOCL 3MBEC 2VKWA 1QBMH 3TIEA 2YPLE 4P5MB 5DQ9A 3D2UD 1AR2A 4JFFE 4N8VA 3QULA 2R4RL 3KYAA 4P59H 4JPWL 5E1AB 1ITBB 4XAWH 3F7VA 2L7JA 3VRJB 3F12A 3ULUD 2I9TB 1F6LL 2IH1B 4PJGE 4Y89A 5FO9B 5ID1A 3KPRB 3QG6B 4CVUA 1VHPA 2EE9A 2VLME 2R4RH 3WS3A 4POYA 3MRMA 5H94A 1G9MC 5IEKA 4OF3A 3VI4E 1QBLH 3CFBB 4LQFH 3FOMA 5I75B 4OLVL 2RR3A 1K8DA 1MY7A 3IGAB 3CMOL 2IBZX 3TNNB 5HYSA 4MDIB 4LVOB 4HKXA 1FV1A 5BS0A 4HUUB 3GMNB 4G7YH 4X6DA 4NKQB 1ED3B 1OM3L 2NY1C 1A7QL 1FYTE 4OV5A 4KKNA 1C7SA 2XKNB 3VXME 1ZGLB 4UV7L 1KULA 4OLVH 1BVKA 3DI2B 1KJVB 3CMOH 3UYOD 4M62H 2OR8A 4WW2A 3CZFB 1NCAH 4D9LL 5D2NE 2WZPD 1OM3H 3SCMC 3MCG1 1I85C 1BZ7A 4A6YH 3D85A 1NAMH 3FQXA 4UV7H 4C57C 4O2FB 1EVUA 5I1EH 3SGEH 4IBLT 2OZ4A 3VA2C 3T0EC 5FUOH 5I18L 1R5VA 4P2RE 3T0DA 3ARDB 4D9LH 4YDKL 3KPQA 3F5WB 4F2MB 4M6NH 5F8RC 1GGTA 1AXIB 3EZJB 5CD5C 4FQIL 1TCRA 1AFVH 1TPXB 4FS0A 1MJ7L 4UI2A 3QNXA 4PRPE 4YDKH 1S7TB 2PYEB 3QISA 2Y36H 1NGQL 5FCSH 1L0XA 5E03A 3SJVE 2XWTA 3JXAA 2NXZC 3UTPE 4GOSA 4OZGA 2AJSL 5DRNB 4EXPX 3V0WL 3QEUB 5I1IL 3VWKB 1DLHA 1MJ7H 5HGHB 2SEBB 4PP1C 4M3JA 3CCHB 4X4ZA 4CU8A 1NGQH 1WCQA 5IB3B 3L9RB 5I15L 3AFLA 2PCPB 3RGHA 1MI5A 1J5OL 2AJSH 4YZFE 2VAJA 1EJOL 4X6EB 3V0WH 5I1IH 3CFKA 5BRZE 2F19H 3RWGA 4PJ8C 2BVOB 2D03L 3QA3B 1NAKH 1TFHA 4QOKD 3OB0H 3U7YL 1OY3B 5I15H 5IR1A 1J5OH 5FO7B 3BVNB 2DQFA 2DTML 1RZKH 3MV11 2DWDB 3D85D 4QRPB 1AXSB 2D03H 1EGJA 3B9KC 3PWUB 2C4XA 1AGCB 3GB7B 5D1ZB 3U7YH 1MHHB 3F6LA 5L0QC 2Y4SA 2VN4A 4OTXH 3BKYL 3DXAB 5DJ0B 2XKUA 2HFEA 1DZBA 5I6XC 1I7UB 3Q3GA 4G5ZH 2IH3A 4JFQB 1JPFA 4UUJA 5ECJE 2RBLA 1KPVA 3OXRA 4YR6B 2D3VA 2VXQL 1NCUA 4GBXC 4KJQC 4NQSB 2Y25A 3BIKA 1IAKB 2FJHA 5DMJB 2Z31C 2ZNWA 3RP1A 3AM8C 1K5NB 4BQ9A 4ELMF 2X7LA 1G9EA 3C5JB 5FCUH 4LF3A 4I3SH 5ADOH 3RVUD 2VXQH 1YEEL 2DICA 5HGGS 4S0SD 3ZMRA 6FABL 4B53A 3T2QA 4JANA 3KYMA 3ZKND 1F11B 3ULSA 3BMWA 4FQLL 2R1XA 2J8HA 1BLNB 1MI5D 3VGDA 4KC3B 3UROR 1I1YA 2BSED 6FABH 3QO1B 4FG6D 5IMKB 3H42L 1KIUA 3FT2A 2BSSA 1X7QB 2R56L 3QJFA 5H2BA 4ENEC 4FQLH 2G9HA 2YEZA 3BOVA 3LQMA 1I8KA 3VXTB 1OTSD 5CSGA 1BBDL 5DJXB 3D2UB 3H42H 4X83A 1AY1L 2WBJD 1MSPA 3BN9C 5C2UB 1CFSB 2W9DH 2Q6WA 4M43L 1ZHNB 5HGBA 4JJ5B 1U0QA 2Z91B 5T1LA 5C0FB 2PXYC 1BBDH 4UU9A 2DM7A 4L4TA 4JRYB 4XZUB 5HVWA 1KLUB 1AY1H 2KZWA 4GAYB 5C9JB 2DF3A 3D39B 3C9NB 4WNQB 3TO4A 2DQUH 4ZO9A 3RWEB 5FYLD 8CGTA 4XAKD 4DFIA 5E00B 1FFQA 1OP3K 4X9BA 1A3LL 5C0EA 2NW2B 1LWRA 4Z7WA 5D9SB 4U6YB 1MFBL 1AQDA 1OSZA 5DHVA 1ACZA 5DMIL 5C0BA 1YN7B 4DUWA 2UY7A 1MEXL 3QCUL 3QWRA 3S5LB 4X7TA 3HAEB 1A3LH 2F8VA 2ILLA 4HFWA 4OQTH 5INDA 2FRGP 4WUKL 5DMIH 1WZKA 5T1MA 3QRGH 5IW1B 2FWOB 3G6JF 4YPGA 5HHOE 3QCUH 4M1GL 2HMIC 2QHLA 4X8JB 1U8OA 3OAYK 5B8CB 4JY4A 4M5YL 5DQ9B 4N8VB 4WUKH 1GH7A 1UM6L 4GG6A 1I8IA 3ZKQD 1VEPA 4DOHE 3Q6FA 4R7DA 4M1GH 1IRAY 1JZ2A 5EBLA 3UPRA 5T1LD 5I9QC 5E0QA 4N0FA 4M5YH 2BXZA 5L2KA 1X5KA 1DCLA 1UM6H 2ADIA 4LU5L 1GOHA 1RJCA 4M61B 4E41A 3MMEB 3TO4D 2EO9A 5IEKB 1JGVH 1CFTB 1RK0A 3OAZH 4U1LA 5F3BA 5DK3A 5TE6H 1OT2A 1V8HA 4NQCE 3WNMA 2N1KA 4L8SB 3QRFM 1R3LB 5DLML 4X6DB 3OGCA 2A9ML 4LU5H 5C1MB 4KK6C 3NA4A 1XF4A 1V3LA 4QOKB 1XGRB 1BVKB 5C0BD 3BZEA 4FABL 5DLMH 2Z8SA 3KVQA 2A9MH 4LPCA 4J3SA 1I1FB 1A47A 1QFUL 5EU3B 3MO1A 3FQXB 2K1MA 1GJIA 1A3RL 4X5LA 3H3KA 4XPHL 2IPUK 2X5PA 3L5IA 1A21A 4PJEE 4XPFL 4FABH 4G9FD 4P99A 1OW0C 2I07A 3KJ4C 1EBAA 1VFBB 5KAQG 3QZWA 1JZ3A 2R2BA 3OAZK 2OL3B 4G43A 1OP9A 1A3RH 4XPHH 4R2GC 4V1DB 4JY6B 5C92A 3TO2A 4XPFH 2YK1L 3HAEG 3PG2A 4ONGL 3PP3H 4JO1L 2FIRT 2UWEF 4B41A 3RVVC 4H20H 3GK8L 1CYGA 3GKZA 4WV1C 5DUBB 5L2KD 2AABL 1NCDL 4OZGB 1MRCH 1QP1A 2E7HA 5IESH 4L8BA 4E41D 2YK1H 3L3JB 1UACH 4MX7A 4I48A 4ONGH 4JO1H 3LKOA 4P0DA 2EDNA 1IVLA 4NZRL 4N8VG 4F7MB 1HSBB 1QSFA 2E3VA 2AABH 3REVA 4EJ1C 1NCDH 5D5MB 5F96H 4R4NC 4PGCA 3CFKB 3P4LA 4Y2DC 4PRIE 4LP4A 2Q3ZA 4UOJA 4NZRH 4HDIB 1RZ8B 4PV8A 3V5KA 4AH2A 3W2DL 3CVIL 2DQFB 4X80L 2R23B 1G7M