4NQKA

Structure of an ubiquitin complex
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
188
structure length
188
Chain Sequence
MTTEQRRSLQAFQDYIRKTLDPTYILSYMAPWFREEEVQYIQAEKNNKGPMEAATLFLKFLLELQEEGWFRGFLDALDHAGYSGLYEAIESWDFKKIEKLEEYRLLLKRLQPEFKTRIIPTDIISDLSECLINQECEEILQICSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for ubiquitin-mediated antiviral signal activation by RIG-I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/apoptosis
molecule keywords Probable ATP-dependent RNA helicase DDX58
total genus 58
structure length 188
sequence length 188
chains with identical sequence B, C, D
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16739 CARD_2 Caspase recruitment domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4nqkA01
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4nqkA02
4P4HI 3YGSC 4N1KA 4M9ZA 4EWIA 2NZ7A 2YU0A 3CL3A 1CWWA 4UZ0A 2O71A 2BBZA 2MPCA 3EZQB 2LWEA 4FH0A 2LWDA 3YGSP 1DGNA 1ICHA 2BBRA 1N3KA 4P4HA 4M9XA 4RHWA 2N83A 2MB9A 4O7QA 4E9MA 2LS7A 3KATA 1D2ZA 2HM2Q 3J6JA 1DDFA 2OF5A 4F44A 4IZ7B 2DBFA 4A2WA 1Z6TA 1FADA 4D8OA 3EZQA 3J63A 2NAQA 1WMGA 4IZ5E 4IZAB 4LWDA 2KM6A 1YGOA 2IB1A 2VGQA 4DWNA 4F42A 2GF5A 1D2ZB 2L9MA 2A9IA 3MOPG 4I16A 2NSNA 4N1LA 2A5YB 2DBGA 2N7ZA 2G7RA 4NQKA 3CRDA 4M9SA 3QF2A 1C15A 2MS8A 2N00A 2DBHA 2N80A 3LQQA 2KN6A 2D96A 2YQFA 1UCPA 2L6AA 2F1SA 2B1WA 1WXPA 2M5VA 4O6XA 2N97A 4JUPA 1PN5A 4A2QA 1WH4A 3LQRA 1A1ZA 3T6PA 2OF5H 3MOPA 2MN4A 2P1HA 4QOBA 4O9LA 4RHWE 1E3YA 4N1JA 1NGRA 1A1WA 2MS7A 2N1FA 2DO9A 4O9FA 2YVIA 2YGSA 1E41A 4ZBWA 1CY5A 3MOPK 4JQWA 2DBDA
chains in the Genus database with same CATH superfamily
4P4HI 3YGSC 4N1KA 4M9ZA 4EWIA 2NZ7A 2YU0A 3CL3A 1CWWA 4UZ0A 2O71A 2BBZA 2MPCA 3EZQB 2LWEA 4FH0A 2LWDA 3YGSP 1DGNA 1ICHA 2BBRA 1N3KA 4P4HA 4M9XA 4RHWA 2N83A 2MB9A 4O7QA 4E9MA 2LS7A 3KATA 1D2ZA 2HM2Q 3J6JA 1DDFA 2OF5A 4F44A 4IZ7B 2DBFA 4A2WA 1Z6TA 1FADA 4D8OA 3EZQA 3J63A 2NAQA 1WMGA 4IZ5E 4IZAB 4LWDA 2KM6A 1YGOA 2IB1A 2VGQA 4DWNA 4F42A 2GF5A 1D2ZB 2L9MA 2A9IA 3MOPG 4I16A 2NSNA 4N1LA 2A5YB 2DBGA 2N7ZA 2G7RA 4NQKA 3CRDA 4M9SA 3QF2A 1C15A 2MS8A 2N00A 2DBHA 2N80A 3LQQA 2KN6A 2D96A 2YQFA 1UCPA 2L6AA 2F1SA 2B1WA 1WXPA 2M5VA 4O6XA 2XV9A 2N97A 4JUPA 1PN5A 4A2QA 1WH4A 3LQRA 1A1ZA 3T6PA 2OF5H 3MOPA 2MN4A 2P1HA 4QOBA 4O9LA 4RHWE 1E3YA 4N1JA 1NGRA 1A1WA 2MS7A 2N1FA 2DO9A 4O9FA 2MJMA 2YGSA 2YVIA 1E41A 4ZBWA 1CY5A 3MOPK 4JQWA 2DBDA
chains in the Genus database with same CATH topology
4P4HI 3YGSC 4N1KA 4M9ZA 4EWIA 2NZ7A 2YU0A 3CL3A 1CWWA 4UZ0A 2O71A 2BBZA 2MPCA 3EZQB 2LWEA 4FH0A 2LWDA 3YGSP 1DGNA 1ICHA 2BBRA 1N3KA 4P4HA 4M9XA 4RHWA 2N83A 2MB9A 4O7QA 4E9MA 2LS7A 3KATA 1D2ZA 2HM2Q 3J6JA 1DDFA 2OF5A 4F44A 4IZ7B 2DBFA 4A2WA 1Z6TA 1FADA 4D8OA 3EZQA 3J63A 2NAQA 1WMGA 4IZ5E 4IZAB 4LWDA 2KM6A 1YGOA 2IB1A 2VGQA 4DWNA 4F42A 2GF5A 1D2ZB 2L9MA 2A9IA 3MOPG 4I16A 2NSNA 4N1LA 2A5YB 2DBGA 2N7ZA 2G7RA 4NQKA 3CRDA 4M9SA 3QF2A 1C15A 2MS8A 2N00A 2DBHA 2N80A 3LQQA 2KN6A 2D96A 2YQFA 1UCPA 2L6AA 2F1SA 2B1WA 1WXPA 2M5VA 4O6XA 2XV9A 2N97A 4JUPA 1PN5A 4A2QA 1WH4A 3LQRA 1A1ZA 3T6PA 2OF5H 3MOPA 2MN4A 2P1HA 4QOBA 4O9LA 4RHWE 1E3YA 4N1JA 1NGRA 1A1WA 2MS7A 2N1FA 2DO9A 4O9FA 2MJMA 2YGSA 2YVIA 1E41A 4ZBWA 1CY5A 3MOPK 4JQWA 2DBDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P4H I;  3YGS C;  4N1K A;  4M9Z A;  4EWI A;  2NZ7 A;  2YU0 A;  3CL3 A;  1CWW A;  4UZ0 A;  2O71 A;  2BBZ A;  2MPC A;  3EZQ B;  2LWE A;  4FH0 A;  2LWD A;  3YGS P;  1DGN A;  1ICH A;  2BBR A;  1N3K A;  4P4H A;  4M9X A;  4RHW A;  2N83 A;  2MB9 A;  4O7Q A;  4E9M A;  2LS7 A;  3KAT A;  1D2Z A;  2HM2 Q;  3J6J A;  1DDF A;  2OF5 A;  4F44 A;  4IZ7 B;  2DBF A;  4A2W A;  1Z6T A;  1FAD A;  4D8O A;  3EZQ A;  3J63 A;  2NAQ A;  1WMG A;  4IZ5 E;  4IZA B;  4LWD A;  2KM6 A;  1YGO A;  2IB1 A;  2VGQ A;  4DWN A;  4F42 A;  2GF5 A;  1D2Z B;  2L9M A;  2A9I A;  3MOP G;  4I16 A;  2NSN A;  4N1L A;  2A5Y B;  2DBG A;  2N7Z A;  2G7R A;  4NQK A;  3CRD A;  4M9S A;  3QF2 A;  1C15 A;  2MS8 A;  2N00 A;  2DBH A;  2N80 A;  3LQQ A;  2KN6 A;  2D96 A;  2YQF A;  1UCP A;  2L6A A;  2F1S A;  2B1W A;  1WXP A;  2M5V A;  4O6X A;  2N97 A;  4JUP A;  1PN5 A;  4A2Q A;  1WH4 A;  3LQR A;  1A1Z A;  3T6P A;  2OF5 H;  3MOP A;  2MN4 A;  2P1H A;  4QOB A;  4O9L A;  4RHW E;  1E3Y A;  4N1J A;  1NGR A;  1A1W A;  2MS7 A;  2N1F A;  2DO9 A;  4O9F A;  2YVI A;  2YGS A;  1E41 A;  4ZBW A;  1CY5 A;  3MOP K;  4JQW A;  2DBD A; 
#chains in the Genus database with same CATH topology
 4P4H I;  3YGS C;  4N1K A;  4M9Z A;  4EWI A;  2NZ7 A;  2YU0 A;  3CL3 A;  1CWW A;  4UZ0 A;  2O71 A;  2BBZ A;  2MPC A;  3EZQ B;  2LWE A;  4FH0 A;  2LWD A;  3YGS P;  1DGN A;  1ICH A;  2BBR A;  1N3K A;  4P4H A;  4M9X A;  4RHW A;  2N83 A;  2MB9 A;  4O7Q A;  4E9M A;  2LS7 A;  3KAT A;  1D2Z A;  2HM2 Q;  3J6J A;  1DDF A;  2OF5 A;  4F44 A;  4IZ7 B;  2DBF A;  4A2W A;  1Z6T A;  1FAD A;  4D8O A;  3EZQ A;  3J63 A;  2NAQ A;  1WMG A;  4IZ5 E;  4IZA B;  4LWD A;  2KM6 A;  1YGO A;  2IB1 A;  2VGQ A;  4DWN A;  4F42 A;  2GF5 A;  1D2Z B;  2L9M A;  2A9I A;  3MOP G;  4I16 A;  2NSN A;  4N1L A;  2A5Y B;  2DBG A;  2N7Z A;  2G7R A;  4NQK A;  3CRD A;  4M9S A;  3QF2 A;  1C15 A;  2MS8 A;  2N00 A;  2DBH A;  2N80 A;  3LQQ A;  2KN6 A;  2D96 A;  2YQF A;  1UCP A;  2L6A A;  2F1S A;  2B1W A;  1WXP A;  2M5V A;  4O6X A;  2XV9 A;  2N97 A;  4JUP A;  1PN5 A;  4A2Q A;  1WH4 A;  3LQR A;  1A1Z A;  3T6P A;  2OF5 H;  3MOP A;  2MN4 A;  2P1H A;  4QOB A;  4O9L A;  4RHW E;  1E3Y A;  4N1J A;  1NGR A;  1A1W A;  2MS7 A;  2N1F A;  2DO9 A;  4O9F A;  2MJM A;  2YGS A;  2YVI A;  1E41 A;  4ZBW A;  1CY5 A;  3MOP K;  4JQW A;  2DBD A; 
#chains in the Genus database with same CATH homology
 4P4H I;  3YGS C;  4N1K A;  4M9Z A;  4EWI A;  2NZ7 A;  2YU0 A;  3CL3 A;  1CWW A;  4UZ0 A;  2O71 A;  2BBZ A;  2MPC A;  3EZQ B;  2LWE A;  4FH0 A;  2LWD A;  3YGS P;  1DGN A;  1ICH A;  2BBR A;  1N3K A;  4P4H A;  4M9X A;  4RHW A;  2N83 A;  2MB9 A;  4O7Q A;  4E9M A;  2LS7 A;  3KAT A;  1D2Z A;  2HM2 Q;  3J6J A;  1DDF A;  2OF5 A;  4F44 A;  4IZ7 B;  2DBF A;  4A2W A;  1Z6T A;  1FAD A;  4D8O A;  3EZQ A;  3J63 A;  2NAQ A;  1WMG A;  4IZ5 E;  4IZA B;  4LWD A;  2KM6 A;  1YGO A;  2IB1 A;  2VGQ A;  4DWN A;  4F42 A;  2GF5 A;  1D2Z B;  2L9M A;  2A9I A;  3MOP G;  4I16 A;  2NSN A;  4N1L A;  2A5Y B;  2DBG A;  2N7Z A;  2G7R A;  4NQK A;  3CRD A;  4M9S A;  3QF2 A;  1C15 A;  2MS8 A;  2N00 A;  2DBH A;  2N80 A;  3LQQ A;  2KN6 A;  2D96 A;  2YQF A;  1UCP A;  2L6A A;  2F1S A;  2B1W A;  1WXP A;  2M5V A;  4O6X A;  2XV9 A;  2N97 A;  4JUP A;  1PN5 A;  4A2Q A;  1WH4 A;  3LQR A;  1A1Z A;  3T6P A;  2OF5 H;  3MOP A;  2MN4 A;  2P1H A;  4QOB A;  4O9L A;  4RHW E;  1E3Y A;  4N1J A;  1NGR A;  1A1W A;  2MS7 A;  2N1F A;  2DO9 A;  4O9F A;  2MJM A;  2YGS A;  2YVI A;  1E41 A;  4ZBW A;  1CY5 A;  3MOP K;  4JQW A;  2DBD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...