4NQLA

The crystal structure of the dub domain of amsh orthologue, sst2 from s. pombe, in complex with lysine 63-linked diubiquitin
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
187
structure length
187
Chain Sequence
FKIHAYTEGGKPLRTIYLPKLLKKVFLDVVKPNTKKNLATCGILCGKLRQNAFFITHLVIPLQEATSDTCGTTDEASLFEFQDKHNLLTLGWIHTHPTQTCFMSSVALHTHCSYQLMLPEAIAIVMAPSKNTSGIFRLLDPEGLQTIVKCRKPGLFHPHEGKVYTMVAQPGHVREINSKLQVVDLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Insights into the mechanism of deubiquitination by JAMM deubiquitinases from cocrystal structures of the enzyme with the substrate and product.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Hydrolase/protein binding
molecule keywords AMSH-like protease sst2
total genus 51
structure length 187
sequence length 187
ec nomenclature ec 3.4.19.-:
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01398 JAB JAB1/Mov34/MPN/PAD-1 ubiquitin protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.140.10 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase, domain 2 4nqlA00
2A8NA 4MSMA 4OCNB 3B8FA 1ALNA 1ZABA 2HXVA 4LCPA 4P9DA 2OBCA 1TIYA 1YSDA 4HRWA 4WIFA 4PQTA 4P9EA 2G6VA 1WN6A 4EG2A 2B3ZA 4K1RA 1UWZA 2FR6A 2OG4A 4ILGC 4LD4A 4F3WA 2NYTA 1VQ2A 2B3JA 2D5NA 2HVVA 4G3MA 4HRQA 4D10F 2NX8A 4BGDC 1AF2A 1MQ0A 3RZUA 4OCMA 4ZD5A 4ZD4A 4LC5A 1UAQA 4OCMB 3E1UA 1JTKA 1OI0A 4E0QA 3G8QA 2O96A 3ZPCA 4QFTA 5M52C 1Z3AA 5GAOA 2FR5A 3RZVA 1R5TA 5M59B 4WIGA 1WKQA 2KCQA 2O3KA 1YSBA 1WN5A 4O8YB 3DH1A 1UX0A 4LCNA 2G84A 2KKSA 4P9CA 4OCNA 3R2NA 3OCQA 1CTTA 4O8YA 4JXEA 4ZFRA 5DCAJ 3ZEFB 2O7PA 1P6OA 4OWPA 2Z3IA 4O8XB 4MSDA 2D30A 4MSJA 4KITC 3ZPGA 4F7OA 4MS7A 1UX1A 2HVWA 4NQLA 4O8XA 1WWRA 1CTUA 2Z3HA 3OJ6A 1R5XA 3SBGA 3IJFX 5CW6A 3MPZA 4OWPB 2ZNVA 2P87A 2O95A 3DMOA 4MSQA 2ZNRA 4LCOA 4LD2A 1OX7A 2P8RA 2Z3JA 4OCLA 2RPZA 5C2OA 2W4LA 3EX8A 4OCLB 4ZFTA 4I43B 2Z3GA 2PW9A 1RB7A 2QLCA
chains in the Genus database with same CATH superfamily
2A8NA 4MSMA 2B1IA 4OCNB 3B8FA 1ALNA 1ZABA 2HXVA 4LCPA 4P9DA 2OBCA 1TIYA 4GGMX 1YSDA 4HRWA 1ZCZA 4WIFA 3ZZMA 4PQTA 4P9EA 2IU0A 2G6VA 1WN6A 4EG2A 2B3ZA 4K1RA 1M9NA 2IU3A 1UWZA 2FR6A 4EHIA 2OG4A 1P4RA 4ILGC 4LD4A 4F3WA 2NYTA 1VQ2A 2B3JA 2D5NA 2HVVA 4G3MA 4HRQA 4D10F 2NX8A 4BGDC 1AF2A 1MQ0A 3RZUA 4OCMA 4ZD5A 4ZD4A 4LC5A 1UAQA 1VK9A 4OCMB 3E1UA 4A1OA 1JTKA 1OI0A 4E0QA 3G8QA 2O96A 3ZPCA 4QFTA 5M52C 1Z3AA 5GAOA 2FR5A 1OZ0A 3RZVA 1R5TA 5M59B 4WIGA 1WKQA 2KCQA 2O3KA 1YSBA 1WN5A 4O8YB 3DH1A 1UX0A 4LCNA 2G84A 2KKSA 4P9CA 4OCNA 3R2NA 3OCQA 1CTTA 4O8YA 4JXEA 4ZFRA 5DCAJ 3ZEFB 2O7PA 1P6OA 4OWPA 2Z3IA 4J6EA 4O8XB 4MSDA 2D30A 4MSJA 4KITC 3ZPGA 4F7OA 4MS7A 1UX1A 2HVWA 4NQLA 4O8XA 1WWRA 1PL0A 1CTUA 1PKXA 2Z3HA 3OJ6A 1R5XA 3SBGA 3IJFX 5CW6A 3VX8A 3MPZA 4OWPB 2ZNVA 2P87A 2O95A 3DMOA 1G8MA 4MSQA 2ZNRA 3BH1A 4LD2A 4LCOA 1OX7A 2P8RA 2Z3JA 1THZA 4OCLA 2RPZA 5C2OA 2B1GA 2W4LA 3EX8A 4OCLB 4ZFTA 4I43B 2Z3GA 2PW9A 1RB7A 2QLCA
chains in the Genus database with same CATH topology
2A8NA 4MSMA 4OCNB 3B8FA 1ALNA 1ZABA 2HXVA 4LCPA 4P9DA 2OBCA 1TIYA 1YSDA 4HRWA 4WIFA 4PQTA 4P9EA 2G6VA 1WN6A 4EG2A 2B3ZA 4K1RA 1UWZA 2FR6A 2OG4A 4ILGC 4LD4A 4F3WA 2NYTA 1VQ2A 2B3JA 2D5NA 2HVVA 4G3MA 4HRQA 4D10F 2NX8A 4BGDC 1AF2A 1MQ0A 3RZUA 4OCMA 4ZD5A 4ZD4A 4LC5A 1UAQA 4OCMB 3E1UA 1JTKA 1OI0A 4E0QA 3G8QA 2O96A 3ZPCA 4QFTA 5M52C 1Z3AA 5GAOA 2FR5A 3RZVA 1R5TA 5M59B 4WIGA 1WKQA 2KCQA 2O3KA 1YSBA 1WN5A 4O8YB 3DH1A 1UX0A 4LCNA 2G84A 2KKSA 4P9CA 4OCNA 3R2NA 3OCQA 1CTTA 4O8YA 4JXEA 4ZFRA 5DCAJ 3ZEFB 2O7PA 1P6OA 4OWPA 2Z3IA 4O8XB 4MSDA 2D30A 4MSJA 4KITC 3ZPGA 4F7OA 4MS7A 1UX1A 2HVWA 4NQLA 4O8XA 1WWRA 1CTUA 2Z3HA 3OJ6A 1R5XA 3SBGA 3IJFX 5CW6A 3MPZA 4OWPB 2ZNVA 2P87A 2O95A 3DMOA 4MSQA 2ZNRA 4LCOA 4LD2A 1OX7A 2P8RA 2Z3JA 4OCLA 2RPZA 5C2OA 2W4LA 3EX8A 4OCLB 4ZFTA 4I43B 2Z3GA 2PW9A 1RB7A 2QLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A8N A;  4MSM A;  4OCN B;  3B8F A;  1ALN A;  1ZAB A;  2HXV A;  4LCP A;  4P9D A;  2OBC A;  1TIY A;  1YSD A;  4HRW A;  4WIF A;  4PQT A;  4P9E A;  2G6V A;  1WN6 A;  4EG2 A;  2B3Z A;  4K1R A;  1UWZ A;  2FR6 A;  2OG4 A;  4ILG C;  4LD4 A;  4F3W A;  2NYT A;  1VQ2 A;  2B3J A;  2D5N A;  2HVV A;  4G3M A;  4HRQ A;  4D10 F;  2NX8 A;  4BGD C;  1AF2 A;  1MQ0 A;  3RZU A;  4OCM A;  4ZD5 A;  4ZD4 A;  4LC5 A;  1UAQ A;  4OCM B;  3E1U A;  1JTK A;  1OI0 A;  4E0Q A;  3G8Q A;  2O96 A;  3ZPC A;  4QFT A;  5M52 C;  1Z3A A;  5GAO A;  2FR5 A;  3RZV A;  1R5T A;  5M59 B;  4WIG A;  1WKQ A;  2KCQ A;  2O3K A;  1YSB A;  1WN5 A;  4O8Y B;  3DH1 A;  1UX0 A;  4LCN A;  2G84 A;  2KKS A;  4P9C A;  4OCN A;  3R2N A;  3OCQ A;  1CTT A;  4O8Y A;  4JXE A;  4ZFR A;  5DCA J;  3ZEF B;  2O7P A;  1P6O A;  4OWP A;  2Z3I A;  4O8X B;  4MSD A;  2D30 A;  4MSJ A;  4KIT C;  3ZPG A;  4F7O A;  4MS7 A;  1UX1 A;  2HVW A;  4NQL A;  4O8X A;  1WWR A;  1CTU A;  2Z3H A;  3OJ6 A;  1R5X A;  3SBG A;  3IJF X;  5CW6 A;  3MPZ A;  4OWP B;  2ZNV A;  2P87 A;  2O95 A;  3DMO A;  4MSQ A;  2ZNR A;  4LCO A;  4LD2 A;  1OX7 A;  2P8R A;  2Z3J A;  4OCL A;  2RPZ A;  5C2O A;  2W4L A;  3EX8 A;  4OCL B;  4ZFT A;  4I43 B;  2Z3G A;  2PW9 A;  1RB7 A;  2QLC A; 
#chains in the Genus database with same CATH topology
 2A8N A;  4MSM A;  2B1I A;  4OCN B;  3B8F A;  1ALN A;  1ZAB A;  2HXV A;  4LCP A;  4P9D A;  2OBC A;  1TIY A;  4GGM X;  1YSD A;  4HRW A;  1ZCZ A;  4WIF A;  3ZZM A;  4PQT A;  4P9E A;  2IU0 A;  2G6V A;  1WN6 A;  4EG2 A;  2B3Z A;  4K1R A;  1M9N A;  2IU3 A;  1UWZ A;  2FR6 A;  4EHI A;  2OG4 A;  1P4R A;  4ILG C;  4LD4 A;  4F3W A;  2NYT A;  1VQ2 A;  2B3J A;  2D5N A;  2HVV A;  4G3M A;  4HRQ A;  4D10 F;  2NX8 A;  4BGD C;  1AF2 A;  1MQ0 A;  3RZU A;  4OCM A;  4ZD5 A;  4ZD4 A;  4LC5 A;  1UAQ A;  1VK9 A;  4OCM B;  3E1U A;  4A1O A;  1JTK A;  1OI0 A;  4E0Q A;  3G8Q A;  2O96 A;  3ZPC A;  4QFT A;  5M52 C;  1Z3A A;  5GAO A;  2FR5 A;  1OZ0 A;  3RZV A;  1R5T A;  5M59 B;  4WIG A;  1WKQ A;  2KCQ A;  2O3K A;  1YSB A;  1WN5 A;  4O8Y B;  3DH1 A;  1UX0 A;  4LCN A;  2G84 A;  2KKS A;  4P9C A;  4OCN A;  3R2N A;  3OCQ A;  1CTT A;  4O8Y A;  4JXE A;  4ZFR A;  5DCA J;  3ZEF B;  2O7P A;  1P6O A;  4OWP A;  2Z3I A;  4J6E A;  4O8X B;  4MSD A;  2D30 A;  4MSJ A;  4KIT C;  3ZPG A;  4F7O A;  4MS7 A;  1UX1 A;  2HVW A;  4NQL A;  4O8X A;  1WWR A;  1PL0 A;  1CTU A;  1PKX A;  2Z3H A;  3OJ6 A;  1R5X A;  3SBG A;  3IJF X;  5CW6 A;  3VX8 A;  3MPZ A;  4OWP B;  2ZNV A;  2P87 A;  2O95 A;  3DMO A;  1G8M A;  4MSQ A;  2ZNR A;  3BH1 A;  4LD2 A;  4LCO A;  1OX7 A;  2P8R A;  2Z3J A;  1THZ A;  4OCL A;  2RPZ A;  5C2O A;  2B1G A;  2W4L A;  3EX8 A;  4OCL B;  4ZFT A;  4I43 B;  2Z3G A;  2PW9 A;  1RB7 A;  2QLC A; 
#chains in the Genus database with same CATH homology
 2A8N A;  4MSM A;  4OCN B;  3B8F A;  1ALN A;  1ZAB A;  2HXV A;  4LCP A;  4P9D A;  2OBC A;  1TIY A;  1YSD A;  4HRW A;  4WIF A;  4PQT A;  4P9E A;  2G6V A;  1WN6 A;  4EG2 A;  2B3Z A;  4K1R A;  1UWZ A;  2FR6 A;  2OG4 A;  4ILG C;  4LD4 A;  4F3W A;  2NYT A;  1VQ2 A;  2B3J A;  2D5N A;  2HVV A;  4G3M A;  4HRQ A;  4D10 F;  2NX8 A;  4BGD C;  1AF2 A;  1MQ0 A;  3RZU A;  4OCM A;  4ZD5 A;  4ZD4 A;  4LC5 A;  1UAQ A;  4OCM B;  3E1U A;  1JTK A;  1OI0 A;  4E0Q A;  3G8Q A;  2O96 A;  3ZPC A;  4QFT A;  5M52 C;  1Z3A A;  5GAO A;  2FR5 A;  3RZV A;  1R5T A;  5M59 B;  4WIG A;  1WKQ A;  2KCQ A;  2O3K A;  1YSB A;  1WN5 A;  4O8Y B;  3DH1 A;  1UX0 A;  4LCN A;  2G84 A;  2KKS A;  4P9C A;  4OCN A;  3R2N A;  3OCQ A;  1CTT A;  4O8Y A;  4JXE A;  4ZFR A;  5DCA J;  3ZEF B;  2O7P A;  1P6O A;  4OWP A;  2Z3I A;  4O8X B;  4MSD A;  2D30 A;  4MSJ A;  4KIT C;  3ZPG A;  4F7O A;  4MS7 A;  1UX1 A;  2HVW A;  4NQL A;  4O8X A;  1WWR A;  1CTU A;  2Z3H A;  3OJ6 A;  1R5X A;  3SBG A;  3IJF X;  5CW6 A;  3MPZ A;  4OWP B;  2ZNV A;  2P87 A;  2O95 A;  3DMO A;  4MSQ A;  2ZNR A;  4LCO A;  4LD2 A;  1OX7 A;  2P8R A;  2Z3J A;  4OCL A;  2RPZ A;  5C2O A;  2W4L A;  3EX8 A;  4OCL B;  4ZFT A;  4I43 B;  2Z3G A;  2PW9 A;  1RB7 A;  2QLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...