4NQUA

Anti-parallel fc-knob (t366w) homodimer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
208
structure length
208
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Antiparallel Conformation of Knob and Hole Aglycosylated Half-Antibody Homodimers Is Mediated by a CH2-CH3 Hydrophobic Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nquA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nquA01
3MLRL 4PJHF 1IC5L 3VXTB 2F74A 1Q38A 2Z8SA 1NGXB 1BM3H 4WGWB 3X3GL 2ZG2A 4YX2H 5JZ7C 3S9DB 4TNWF 1VEOA 1Y6KR 1DL7H 4YBQC 5C0RL 5KVMC 4LSSL 4NQXB 3GHEL 2A9NH 2ORBL 2WBJB 3FQUA 2XWTB 2M8XA 5C6TL 4WY7L 3BP4A 5CKGA 4LPUA 5FUCC 1UEYA 4FTVA 2OP4L 1KPVA 3BZFB 2NX5D 3GIZL 1P6FA 4ZTOL 4FQ1H 5AZ2L 2VDKH 2F53D 1CQKA 3BP7B 1RHHB 2EC8A 1C5CH 4NQCA 4AIOA 2OX5A 4EDWH 4AZ8A 3HNTL 1S78D 4X7CC 5HHMB 5DEGA 3OJ2C 4H1LG 1CD0A 2VH5L 5EFIB 1RJZA 4DWHA 4WDIA 3B3IB 1J87A 1FGVL 3P0GB 2N4IA 4XBPA 5GS0D 1REIA 5EIIB 5DWUH 1KIPA 1RURL 2YPLD 3MROB 4A6YL 2CRZA 4HUVB 1CD9B 1JHTA 3TT1H 5FECB 4KRPD 3STZB 1MCWM 1QFWM 4DK3A 1K3ZA 5HYFA 1F6LL 5EO9B 1TNNA 1KCVH 3EFDH 3V5HB 4XP6H 4FXKB 1P84K 3H7BB 1P6AB 3QCTH 1T22A 1TQBC 4BJLA 3TH3T 5BZDB 4OM0L 3QR2A 5I1GL 2IH1B 3BOVA 4X8JB 3BAEL 2OBGA 3TN0C 3NABL 4HIEA 4BKLA 1X5IA 3KPNA 4XPGH 5E8NA 1YYLL 3EYUH 3D3VB 1QR4A 1FL5A 1F00I 3BIAX 3WHE0 2BMKB 3KGRA 2HVKB 2JCCF 2VN4A 4JFYA 3TLRA 1NDMB 4RFEA 5DVKA 4HUWA 5A43C 2AJVH 4NN5C 3I50L 1T20A 1B0GA 5CJQH 1MHCA 4EIGB 4JKLA 5C08D 1QNZL 3WHXA 4Y88A 4YUEL 4LCCB 5FYJU 4KTYA 3OKKA 3O6FD 4M48H 5IHZB 3TO2B 3U1SL 2BVYA 5AWNL 3KR3L 3WEXA 1OWWA 3UCRA 3MOAH 4X4YA 1HH6A 3WLBA 5EZOH 1NGWB 2DQTL 3PP4L 5MP6H 2H3NA 4A6YA 2EH8L 5DQJA 1FGNH 2NXYD 1P4LA 5AG8A 5HBBA 3QDAA 1HI6A 4I3SL 3W0WE 4ORGA 1G9EA 5HHOB 4HV8A 3O2WH 3PHQA 1FLRL 2HTLC 1UM6H 1H3UA 1R3IH 1UA6H 5TF0A 3GMNB 5I18L 3FO2B 4XP9L 5IG7A 1VA9A 5FO7B 3ZZ1A 2C3GA 4JZJA 3PWPA 5FDWB 1TJGH 4FQ2H 4RMWA 1NFIA 4K3HA 1GIGH 3SDXF 3M17A 3OPZL 3K2UL 3HI6H 3ZE0E 3BPOC 1S7UA 4URTB 3VXOA 4TSCL 5HYEA 4DTGL 4F33B 2NY6B 5IOPB 5B4MD 1EFQA 3NFSH 3PDOB 1MHPL 2VXTH 1CS6A 4JFZH 5CGYD 4U6VH 4GG6A 1CK0H 2ERJC 3BZEA 1BVZA 2A6IA 4PTUB 2YD3A 4XC1H 1X5FA 3EYVA 5ILTH 2BX5A 5CWSA 5JW4M 3QNYB 4X7FC 3MCLL 1QPXA 1C5BH 3IAPA 2Z91A 1NGQH 5ISZA 2E7MA 3PGDB 3BIKB 2DQJL 4YK4C 1CYGA 2PYFB 43C9B 5IIEA 5DC9B 3G6DH 3NA9H 5HGAA 5T1LB 5FM4A 4O58H 1UCBH 4G6MH 4L29B 1IE5A 5L7XH 4EVNA 5I1LB 1K6QL 1MCHA 4PY7B 4YDKL 4HG4J 1KXVC 5E7FA 2J5LC 3ORJA 4X8XA 2QQLH 1G0DA 3C09B 5DJ0A 1AI1H 5I15H 4GSDH 1T03H 4P2OB 2D4FA 1Y18B 1QFUH 1S5IL 4MJ5A 4ZAKB 4NT6B 3OF6A 3DYOA 3LSOA 2EDKA 4PGBA 5DT1H 3O6LL 2QSQA 4K55A 5T1KB 4CN1A 2F5BL 3KWWB 4YE4L 3LOWA 5C2BH 4FQXD 3L1OL 2JIXD 1RJYB 3HN3A 5I8EB 5GGTL 1WZ1H 3MRPA 3KPOA 4WFFD 1A4KA 2BCKB 4ZFZB 2BP3A 2XG5A 1X5ZA 2AV7A 3QPQD 4ZFOL 4H8WL 1UZ8A 3FB7B 4XVUD 2C9AA 4X9HA 3WHE1 4XPFL 1UADC 1KFAH 1J10A 1V3LA 2BVQA 1SBSH 4LVNC 2B2XH 4Y4KA 2MKLC 4RIRB 1Q0XH 1P9MC 4LLQB 3FKUS 1TZIA 1FP5A 1QYGL 4WW2B 1J1XH 1ZHKA 1FDLL 3WIHH 1CGXA 5IGXL 2NY7L 5SWSE 4JM4L 4BUHA 5F7NC 3QUMB 5IKCB 3LEXA 5GS3A 2Q7YB 1LEGA 3MJ7B 5C0BA 3NFPA 2I24N 1FV1B 5DK2B 1GZQB 3Q6FA 5F9OH 2QR0A 5MEND 3ZDXE 3SKJL 4C56D 4BFIB 4NQDA 1A6UL 4PRNB 4PYGA 5GGTA 4F7TA 3HZKB 4LLDB 4PJBE 1FVCB 1EV2E 3D39A 3RIAK 2P4AB 4QHNA 1K4CA 4X99A 3WUWG 1EEZB 4ZFOA 4F9PA 1AY1H 2DLFH 4GRWF 5IW1B 3MRBA 5T1MB 4LDOB 2NY4C 4U1LB 4KXZH 1F3JB 1P2CA 4KTEH 4ZSOB 1AKJB 5HPMA 4ZOAA 1JCKA 5TPWH 3IGAA 4KDWA 4KHTH 4IRSB 4AEEA 1X4ZA 4LCYA 1HXMB 1RFDH 3AREB 4WFHD 4HSQA 3SO3C 3V0WH 1NAMH 4KDTC 1I85C 3GJEB 4XVTH 2OMBA 1BVLB 2H1PH 32C2B 1IAII 2APBA 3RWJA 2VR5A 1S8DB 5IHLB 5E9DD 3SKNB 2BRQA 2DQHL 4PJEA 1QBLH 1LEIB 3ZMRA 4L1HA 3EDDA 4FFVD 2IADA 1N7MH 4MS8C 5EWIH 3WSQL 2YPVH 4K94C 4RNRA 3NCYS 1E4XH 3CDCA 3INUL 4FXGA 1H8NA 2HFEA 4HHAB 2XZCH 4JY4A 4JG1H 2Z8VC 3IFNL 4HMCA 3QXTA 2Y5TA 3SGEH 3NA4A 2ATPB 3U6RA 1F4YH 1AGEB 3PWUB 5HDLA 4NKDA 1CE6A 4YHMH 4YFLI 4XPTH 1OY3B 3LDBC 4X6CE 5TQ0L 1N8ZA 2X1PA 4GH7B 4XCNA 3Q5YA 3IKCA 4KI1A 5D7IA 4F2MB 3GSQA 3HE7C 1MH5B 3ULUF 3FN0H 2E7LC 2IC2A 1KPUB 1KUMA 1MWAH 4TTGA 5JR1L 2IGFH 3SBWC 2ARWA 1QBML 4UOW1 3O8XB 2ZOKA 1KACB 5FCUH 3H0TB 4OAWB 5HD8C 2A77H 4KK5D 4ODUA 2ARJQ 2OR9L 4MJ6A 1B3JA 4M6OL 4HKXB 3G5ZB 3RQ3A 1AH1A 1HHHB 2ICWJ 4TUJB 3RIFK 4M6NH 2ADGB 3KPRE 4OCSL 4PLKC 3RUGB 1GPOH 1HZHH 4R4BA 2VLLA 3MV8A 2UVFA 4S1RL 3JTTA 2BVPB 2XV6B 2I9TB 4PJCF 3ARGC 1XH3B 2VDLL 4XNXL 1RHFA 3MA9L 3O4LE 3V4UL 3RVVD 1HCVA 1TVBB 1UG9A 5EU7E 1UWEH 4K94H 1IQWH 1T2XA 3VGHA 3D2UD 2IQAA 4GAJH 1CD8A 4Y5XA 2KPNA 1LK3H 5HDBF 3IDYC 2NQCA 2P5WE 3QUXA 1B6UA 1WCBA 4L8BA 5IJVB 1R3HA 1MY7A 3QG7L 4Y4HC 2Q1EA 5F7HA 1F8TH 1IGYA 1CXFA 2VDQL 1RZFH 1T7XA 4K8RD 4U1SA 3ARWA 3EDJA 5DJDA 1OTUC 5CZKA 2X42A 2ZKHH 1MCOH 5EU7C 4JQXA 5I2IA 2YD1A 4WU5A 4GRMB 2ZUQC 3IVKA 5DUBB 5H37G 3SDAC 2EE2A 5JW4Q 2BK8A 2PW2B 4B7IA 5E2UL 3NCCB 3BQUB 2D31A 1KCRL 3OAYH 3ZSTA 3QIBD 1P4BH 2BVOA 4UDUA 4PG9A 2R23A 5CMAB 3WS3A 1T89C 4LVHC 1JZ5A 4G9DB 5DDHA 2O5YH 1DUZB 4MNHA 3ES6A 4HWZB 4XP1L 5C0IA 2NR6D 5LAXB 4DKFL 3KPTA 1GCFA 3F7VA 4OM1H 3K1DA 3MLYL 3QPXH 1NUGA 1GZPB 2AXGB 4YHKL 3SEPA 7CGTA 4POUB 2E9IA 3MRRA 1Q9KB 1WBYA 4Z7NF 4OFYD 2BNUA 5ANMA 5C0FA 3BGFB 1OAYH 2NY5H 1A9BB 5FYKU 1VEPA 3MJ6A 3OWEA 2OI9B 1OAQH 3X14A 4EI6B 5F3BB 2UYLA 5F96L 4JHAL 1WGOA 1VFAA 1NBVL 1T0NA 1AQKL 4WWKA 1NCNA 3ZLQC 1I4FB 5ALCL 4BFBD 4QLRA 4ESKA 1BJ8A 2VTFA 3MODH 4KRNA 1QEWB 4KY1L 4UT9H 4X7SH 5TQ2H 2DMBA 1AD0A 1S7TB 2P49B 3D0VB 5T33H 2VWEE 4Y1AA 1XGTA 3QYCA 3X17A 1JVKA 1D5ZA 1H3PH 1J12A 4DGYH 1T83C 3SCMC 2JJSA 3O0RH 4HT1H 1OAUH 3ZTJG 1MLBB 1Q9LA 1MQKH 3LKSB 5D7LE 4V1DE 4N0UA 4PJGB 1EAPA 3BSZL 4XPAL 4PP2A 3GSOB 2YD9A 5C7XL 3QAZC 5BQ7A 5D5MA 4PJFF 4Z7VE 4EXPX 3G5YB 3T1FB 1UYWL 1JN6A 1KLGA 1NDGA 2VWEC 1L4IA 1QP1A 3FQNA 4HQQL 1A7NH 2VDMH 5F89A 3DO3A 4BFEA 2DQIH 4EI5C 1NFKA 5CLTA 3VXPB 1FZMB 4M7LL 3LY6A 4ZO6A 1BIIA 1JHLH 1K4DA 4JDTL 3QI9D 4YFEA 4WHYG 4M7JL 5E4IA 1ND0A 2C26A 1AXTL 4HGWA 5DUMH 4U1GB 2EEAA 3U46A 5C6WH 2GAZB 3AY4C 5EZLA 8CGTA 2BC4B 5INDB 3TBWA 2CIKB 4WUUB 4I0PB 1BP3B 5IEKB 2EDHA 1JNJA 1TQBB 2FECL 3ZE2F 2WUCH 1LE5B 3CSPA 5DI8A 4LLYB 1NJ9B 2RJMA 3MBEC 1D5BA 1CCZA 1X9QA 3FFDB 3JV5A 3RDTA 4V2BA 4R4FH 4ZUSA 5JHDD 3TN0B 3JWOL 4YO0A 4HK0B 4WW1A 5T1DL 3VWJD 4C4KO 4Z6AT 5CEXB 4NQEE 4TVPE 4PRPE 1Q9OA 5EOTA 3QDGD 3RVUC 4PJXA 4JO4H 4QRPA 1N0XL 4NHCL 1NFDB 4U1HA 3GUTB 4DGIH 4N8CH 3ARFA 3KJ6H 5BVJA 3BZ4A 1KLFA 1M4KA 2Y6SD 2D0GA 5TDOB 4JZOA 4Y4FC 2NNAB 3MGOA 4WIQA 4XX1G 2YR3A 3DSFH 5B38A 3WV0A 4GOSA 1KJ3H 3DROB 1L0QA 3L3GB 2ZG3A 5KOMC 4XMKL 4DAGL 2XNAA 5JORB 3PV7A 4ZO9A 4LLMB 3P11L 4UU9A 5A16B 3FJTA 2KZWA 1ZHBB 1N5AA 1Z3GL 3V5DB 1BGXH 3SE9L 5HHNA 3QQ3A 3BPOB 1OAXH 4NUGH 1HH9B 2DKSA 1IAIM 3PUCA 4D94A 3IAQA 4QRUB 4WEBL 3W0WB 4JPWL 4MQTB 2OLDA 5E2JA 1D9KA 1IFHL 2WIMA 4Q97A 2RFXA 1U8QA 4M7ZC 4CVXB 3IDNB 1IL1A 4Z7WA 4PR5A 1U8IA 4JFOB 5AZEH 2ZUSA 1UJ3C 5KSBA 2NY1D 3MV01 3T1WA 3CSBA 1ES0B 4PJAB 3OJMB 2ZOLB 5B39A 4N8PA 1H9VA 5IWLC 2R0LH 2WP3O 4HEPG 5I76B 3AROA 2AKRA 4WI3A 5FA4B 1DBAH 5M94B 4FN0A 1VHPA 3ULVL 1N6QH 4PJDF 4Z7UE 3RVTD 4YK4B 3MO1B 1MI5E 1EEUA 2DQDL 3B9KA 1HQ4A 1JWUA 1KIQA 4JY5H 4JG0H 1C08B 3BD4A 4HJGB 1G6VK 5IMMB 4XWOC 7FABL 3GJFH 1ONQB 2DM2A 3WDJA 2ATKA 1ZXQA 4XT1C 1VFBB 4Y19E 3HC3L 1YNLH 3NFNB 3G6JA 2VL5B 1JI1A 1YEIH 4MVBC 1KN4L 2GFBA 4HC1L 1FO0A 4QTIH 4TOYL 5LGHL 2J5LB 5EOCL 3WFZA 2ZUVA 3LN5B 1FBIL 2ICWB 5EBWA 2YUZA 2GT9B 4UQ2A 1K2DA 4LPTA 1ORQA 4LASL 4OT1H 1S7WB 4HF5H 1LO2L 3TO4B 1NCBH 5IB3B 4JQVC 4BSJA 2V17L 1KCKA 4MD0A 3TNNA 4OGAC 3OKLB 4P4RB 2MQ3A 3N1PC 2PYEE 3CSYB 1IRAY 2HLAA 1TVHA 3B8SA 1CFQA 5E99L 1NSNH 3VU2A 3UJJH 3QH3B 5JQHC 1HINL 1U9KA 3TBVA 4QY8A 1CE1H 4WTZG 3HC4L 1S9WB 4OZHA 3VFSA 1NEUA 2APWA 5CCKH 1F4XH 1MFBL 3L3KB 4HH9A 2OL3H 2VXSL 3SDDD 2JLLA 5LBSH 4RGNB 1J1PH 1VFUA 4LVNB 1HNGA 1EHNA 2HLFC 4EOWH 4LPCA 2FWOA 3L3JB 4RZCB 2X5PA 1XIWA 5I1AB 5IESH 3SDYL 4HC1A 4JFFD 1FNEA 2X4PB 3AMKA 3NPZB 3TVMA 4WU7B 4BQ9A 3B9AA 3TEUA 1AO7D 4DFIA 4QRSA 4M9OA 5J1AA 2IALB 4LHUD 2BNRD 1ROWA 2YMXL 1EGJL 3FMGL 2GSIB 3LRSB 4H26B 2R56H 5D6DC 3H7LA 5DJZB 2FJGB 2O93L 2WBKA 4BSVB 3UYPA 3C60D 1YPZA 3JZ7A 1IC7H 2VAJA 4MQSB 4YHNA 3U7AA 1MLCB 4KROB 3ZDYE 1IM9B 2C1PB 1IGJA 2R69H 2B7DT 1RV6X 4PRAB 1U36A 3LEYH 4LAJH 4L1DA 1MWAB 4NRYB 2UWEE 1RIUL 2XN9E 3DXAE 4P59H 1A1NB 2ADIB 5GGSA 2FJHA 4PJBB 4UV4H 1U92A 2EE9A 4UDTB 2G2RB 5DD6A 3F58L 4OD1H 2Z31B 3TJHC 3SJVB 2DQUH 3QXUA 4F7PB 5AD0A 1I7TA 1X3DA 1EGJA 3P9MB 4OF3A 3L3HB 5HGHA 3DRQB 5JUEH 2IF7A 4FFZL 5IW3A 1QBAA 3WS6A 3R8QA 3SGKA 4KKLC 4PJ5E 1S7VB 4M6ML 4P5KB 5IF0B 5IVNA 1ZANH 4LU5L 3KPSD 1W72B 4MXQD 3WFDH 4MXVE 1BQUA 3JVGA 3W2DL 4M62H 3DHMA 3ZE1E 2CKBH 4ODWB 2IH3B 3V6OA 4CN4A 1GYAA 3DETD 3HAEB 2YWZA 4LIQE 4Q0XL 3VWKC 4P5TB 1ZWIB 4GUPB 2H2SC 1XZ0B 2WW8A 1O7VA 3WMSA 5K9KB 1J0HA 8FABB 3CPLB 5IVXE 3LDBB 3LKPB 2K7PA 3TBYA 1FSKC 3FFCD 4PUBL 3ZDXF 3BKJH 3HE7B 3WJJC 4A2LA 1XT5A 4GLRI 1G1YA 4E5XB 1H8OA 4JRXE 3OGCB 1ACYH 1TQCC 2GUOB 4C58B 2VDPH 1NBZA 4CAGA 4I48B 2M26A 1O0VA 1SEBB 1RZIB 3QDJE 4MLIA 1VSCA 3HUJA 1F90H 3TCXA 1BQHA 2IMMA 3I6GA 5KSUA 3AS2A 5C3TA 4RFOL 1KC5L 3IDGA 1I75A 3OHXA 4JDZA 4G3YH 3FONA 3T3PF 3HZYB 3LD8C 2BXYA 1I1AC 3O3AB 4W6XB 2Q87A 1GSMA 1DFBH 3RAJH 3GMLA 1NGYB 4WFGE 2CGRL 5IK3A 2UUDH 3ARGB 3D25B 4IRZL 1XGUB 3PQYE 3LS4L 2GJ6A 2ADFL 3P2TA 5CKAA 3FT4B 3O9WA 3K4DA 2G75A 2DM7A 4LCWD 3VFUB 2V9RA 2I5YH 4J1UA 5GJTL 1S7SA 1A6WL 4N5UA 2KUTA 3U0WL 3ET9F 1TVDA 4Y4HB 4P46B 1MPAH 1A7RH 4NZJA 1OF2B 3SDCD 4ZFGL 4KK8C 3AM8C 4AEHH 2CJUH 4E0RB 2DMKA 1A3LL 2HFFA 2EYRA 4RBPK 3UX9B 2JKXA 1ZK9A 3MLWH 3DMMB 2XACC 1YEKL 2CDEA 1FL6A 1F45A 4Y2DC 4ZO8A 2QKIB 3RGVB 5EN2A 2NY3C 4MA3A 1HHJA 5E95B 5B8CC 4HS3A 5DR5L 2ZUQB 3SDAB 3CH1B 1QFOA 3ECBA 5I0ZA 2B0SH 3FOMA 4ETQB 4H88H 1G0XA 3C5JA 1NCDL 4GKZA 1GC1C 3RIAF 1J5OL 2VDNH 4PGZA 4PREB 5KZCD 5GS0L 3FQWA 4KVCH 1IAIL 1RK1A 4LVHB 4QGTA 4NQCE 2DJUA 1R5WA 3H6JA 1YEEH 1P7QA 3ZHLA 3REVB 4KAQH 1UXWB 1V5JA 4FG6C 4JDVA 5FM8A 4JM2A 1S9YA 2KKQA 4HKBB 3QO0A 2WMPA 4U33A 2EZ0D 2DQFA 1OW0C 2OQJB 3OKMB 2R8SH 2CDFB 1QG3A 1BLNA 4L8CB 2Q7NA 3QO1A 5D70L 2F54A 1KENH 2NX5A 3KYMB 2Q8BL 2FEDC 3DV4B 3ZKXC 1BFTA 2F53A 4ZG1A 3G5VB 4HJ0C 3WNPA 2KBGA 1B2WH 1EFXA 1DEDA 3BT2L 4WUKH 1G7JA 2J88H 4OF5A 2VLKB 5DVLA 3S6CA 2F8OA 4N8VA 4KU1A 4MQ7A 5TGBA 5J13C 1IAKA 3S88L 4HPYL 4O00A 1XCQB 1C7SA 3QHFH 2PW1B 3TIEA 2LU7A 1DBJH 4QRQA 1UB6A 1MRCL 2YPLA 3TJEH 2X70B 4PLJD 3U7YL 4EIZC 3ZL4H 4JFXB 3K4AA 1FAIH 3DX6A 4NKIH 3D18B 2OR7A 1YN7B 5KANG 4MYWB 3O4OB 1MEXL 3C5ZB 4R26L 3RA7L 5D4QA 1K5NB 1GC1H 5CBEA 1RUQH 2XY1A 5FXCH 1OSZA 1KTLA 5EZIH 1LQSR 3JTSB 4F37K 3MLTA 5FOBA 4IIQA 3L6FA 4Q2ZB 5IFJA 1DLFL 2O61B 1NCWL 1BZ9B 4M1GL 2X44D 3ARBD 4WV1B 3DURA 3QAZB 4WCYH 3BUTA 2Y7QB 3IDIA 1FFQA 3VRJA 3C5SA 4OUUB 1T2QH 4GKNB 1WBZA 3H8NA 2DF3A 3RL2B 1KXTB 3PWPE 1IC4H 1KJ2L 1W8NA 2RQ8A 4UT7L 5T3XL 4EBQL 2EDEA 2IBZX 3RIFF 1NC4D 5ESAA 4MAYB 1FZJA 2RB8A 3FOLB 5K9OA 3MBXH 3O6FA 2IAMB 2CUMA 2DTSA 4IM8A 3ILPA 4BH8A 4C57C 4F7MA 4PJHA 3VD4A 3HG1D 5CD3A 3K2MC 2DQEH 1JYVA 2VE6B 3LIZL 4LHQB 2AEQH 2AEPH 1VGEH 4WNQB 2EC9T 4I77H 4KMTH 4GG6E 2DYPB 2VSDA 5CBAB 5EUOB 4PTTB 4YHLH 4ZPVB 4JZJC 4Y16B 2CXKA 4OZGB 2GJZA 3PWLB 2VERN 5DJXA 2YK1H 3CH8A 5E6IB 1XF3B 2P8MB 1NL0L 3QT2A 3X3GH 3BXNA 5ISZE 3UTTE 3HNSH 1GJIA 4QTHA 5HYQB 2FSEA 2EDBA 1A7QL 1Z9MA 5GZOC 4HXAH 5F70A 5DQ9B 5C6TH 4JCMA 4PRIA 1ZT4A 4N90D 4DKAA 4JPIA 4L9LA 4LEXH 1HEZB 3FB5A 1CDIA 1KJ2A 1WFUA 4PV8B 4JB9H 4D9QE 3D87B 3TZVD 5DZNA 3TBTB 4MNGB 3VXQB 4W4NA 5L0QC 1KB5L 3VI3E 1H5BC 2P5EA 2OK0L 1EO7A 3GJFB 1KTDB 4UAOB 4M43L 2OTWA 2VXUH 1HDMB 4HIIB 4MDIB 4U7SA 4ZYKA 3EDEA 2H9GA 3EFFB 3GSRA 5HI4D 4HUXB 5FFLA 4Z0BL 1W0VB 1FG9C 4Z7VF 43CAA 4OUOA 4A6YH 2LABA 4Z7OE 2I9LB 2Z0BA 3GIVB 4RAUA 2JK5B 4R4ND 1LDPH 5KW9L 4W68A 3R06B 1CFTA 1RJLA 5JNYB 1T21A 1NC2A 4U2YA 4YDIL 1C12A 5CJOH 5KG9A 3EOBB 3RHWF 4OZFB 3GI9L 5MI0B 4O4YL 3ZKNC 4J4PA 4S1SH 4AENA 1KG0A 1X6LA 4ISVB 3NGBC 4X6EB 2W0FB 5IFAH 2AJYH 4MCZB 1U8HB 3ARDA 3LV3A 5KN5B 1EEYA 5KVEL 3QIUC 2I07A 1FQ9C 2QQQA 4MJIA 5EIQA 1DR9A 1HWHB 1KB5A 1ZLWH 4B50A 4HEME 4WHTA 5JLZA 1FCCA 4QF1B 4KQ3L 5MHSE 4HCRL 5I73C 2AXHA 3HI1A 4YUEH 5C0BE 1T04A 1AGCA 4PJ9D 3MRNB 5AWNH 4Y4KC 4PJ8A 2BSED 5DK0A 5IMLA 3PDGA 1QRNB 3CZFA 2RCSL 3KHQA 3MRJA 4CVZB 3TYFB 5KVFL 1YY8A 2MQ0A 4NQDE 3GMOB 3PJSB 3D39E 5TDPB 1I7UA 5CIPA 2AJ3B 2VIRA 4PGDA 1I7RA 1CL7H 3W11C 5I18H 4NN7C 2P44B 1YMHA 4JKWA 4KJQC 2A6KA 3U36A 3RL1A 3V7MA 2EDFA 2R1YB 1PBYA 3OPZH 3HAEG 1Z9LA 4TSCH 4DTGH 1EBPA 4U7KA 5CP7A 5SWZB 3L3DB 2R0WH 1EVTC 5MENA 3HPLB 1XGPB 4AEFA 3OBAA 5GRJH 1MHPH 1A47A 4CNIB 3H9SA 3KXFA 4HJJL 3IFPA 4Y19B 4D0DA 5HHMD 3U0TA 3U7WL 2XQYG 4H8WC 1EO8L 1U41A 4HCRA 4F9PC 3WLWD 5E6ZA 3QUYB 3WD5H 1I8IA 4U3XA 4D3CL 4PY8J 4HUUB 1QR1B 5FA3B 3MCLH 5FYLL 1LMKA 1DQLH 4P2RB 1OM3L 2UZIL 2VLMD 4PJEE 3P4LA 4RRPA 4ODVH 2VAAB 4OD2A 4X6DE 1OLZA 5CS7A 5KJRH 1PDKA 5GSRA 2VDRH 4AIZA 4TULH 4DN4L 5FK9A 3P4OA 1RUKH 2A73B 3SOBH 4DEPC 4G6KH 3MLXH 1U3HA 4CU6A 4IMLB 1S9XB 4LSTL 2DQCH 3D3VD 1K6QH 3MV9E 4F15C 2CKBB 3VCLA 3BYTA 3WFBL 2E8ZA 4YDKH 3TA3B 1CT8A 5CGMA 4K3GA 4FS0A 5C0ND 4U4BA 2DBLL 3AAZA 4MCYA 4NYLA 1F4HA 1CVRA 3DARA 3QNXA 5D7IE 4ZQKA 1DEEB 2B4CL 3LZFH 3IDMA 4U6HA 4XI5C 4R2GD 1S5IH 4RMQA 5DRWB 4QT5B 3MRMB 5IQ9A 3SO5A 1IJ9A 4H5SA 3BVNA 5DRNB 3ELAT 4GRLB 5GHWH 4FMFA 4O2EB 1FLTX 4R9HA 5GGTH 3QWOA 2D9QB 5EU6A 3V95A 3W5NA 2IBZY 4NHUA 1WWBX 3LQZA 1Q72L 2C1OA 2X4UA 5CUSL 3CVHL 4H8WH 4NO2B 1K8IB 4TTDC 4XPFH 4NGHL 2WWMC 2AP2A 3C2SA 3M45A 1INQA 4L3EB 4QCIB 3MV8E 4J8RB 3IB4A 3GSVA 5FF6A 2EEBA 1G7MA 4OLUH 5IM7A 3S34L 5MEOA 2VN7A 1GGUA 4P3CL 2VOTA 3B43A 5ICZA 4K8RL 3K46A 4N9OB 5AUMA 2B5IB 3KLAB 4YZFE 2W0PA 1FDLH 3U82B 4WW2F 5I71C 3PGCA 5IGXH 5LG1A 4JM4H 3DXAB 1HYSD 3EO1B 5CEZE 1JNHB 4EN3A 2HG5B 1TTFA 3VGAC 2PCPB 1DDHB 1QLRB 4P2QD 2VSCA 3KYOA 1R24A 3D85A 5E7BA 1IM3B 1A6UH 1ZGLM 3DV6A 1JMZA 3BJ91 2CQVA 4R7DB 4U1IB 2D0FA 3WL9B 4LSVL 1GL4B 4CADB 3CVHA 1H0DA 3QUXC 1SJXA 5CEYB 3DX9A 3M8OL 3DX7A 3K0WA 5IB4B 5T1LD 1B0RB 2ZUTA 5IW6B 5ICXB 1UKTA 3KS0H 1CDBA 3F5WA 1OGAB 3L5WA 3E6HA 4TPRL 1VGKA 4G8EA 4JVUA 3VXMB 3F7PC 4JQXC 1TQCB 4FQLH 1M05A 1UEMA 3LEVL 2FIKB 4CJ1A 1NLDL 5EU5A 1T4KA 1ZA6A 2R29H 4S10A 5DXWA 4P2OD 4YHPA 1EERB 1YDPB 3CMOL 4ZUWA 2X4QA 2FDBP 2JF1A 2E7CA 2X4TA 3MLSH 4ZAKD 2BNQE 1RZJH 4NO0D 5HJ3B 2UWEF 5HYSB 1QRKA 5ANME 3CVIL 3QIBA 1I1AB 5JA8B 3S7GA 3BISA 4ZUUB 5JO5A 3CCHB 3VG9C 4LNRB 3HNVL 2IAND 5DYOA 2YD6A 1FNAA 4Z8FL 1LO5B 3INUH 1OT1A 2CR6A 3IFNH 3RWDA 2A74A 5DUPH 3WYRA 4Z0XB 3LB6D 3BIBX 5D1XD 4YWGL 2Y36L 1SVZA 3VFNB 5D8JL 3UTSD 1NUDA 2CMRL 1MAJA 4XHJC 3ZSSA 3BPLC 4DVRH 5TQ0H 1T1WB 4HFWA 1S5HB 5BV7C 5E5UB 4Y1AE 4P48A 2BY2A 3G6AB 5HI3D 5CEZH 1LO0H 5AYUL 4Y2DB 2D3VA 1A6VL 4HIJB 1JF5A 3Q5OA 5ETUA 4WWKC 2Y9RT 4QHUB 5JR1H 1N59A 5DMGC 2KZ1B 5MEPB 1SYVB 4N0UE 5FCSH 1U6AL 1FAKT 3CU7A 5D71H 3EJYD 1BVKB 4FZ8L 4NBYB 4KRPB 3QEGH 5D5ME 1JGEB 5IVXF 2OR9H 1FE8H 5L2KD 3DUSA 4TUKL 2X2YA 2FBJL 2R1XB 3FQRB 2QSCH 4NBZB 3WUZA 5I8OH 1KYOJ 2QQKL 3NCFB 2H32B 3KS0J 1CGVA 1F6FB 3V6ZA 4YC2B 2EIDA 5HSFA 1ZVSB 2VDLH 2QSTA 1Q94A 3BP4B 3V4UH 4Y5YC 1YEDA 1G6RH 3HE6A 4LL9A 3CFBA 3MGTB 3VFMA 4HGMA 3QFJA 4DUVA 4IRSD 4JFEA 5C08B 3EOYG 3NVQA 4KI5F 1FVEA 2XWBB 4NQCB 4LCIH 5CD5D 1H3TA 5I75C 1MHEA 5ID1A 1Z9OA 5ENWA 3TBSB 3BE1L 4J12A 1R3JA 1EHLL 4Q9BA 5C0DB 3HC0B 3MRDB 4ZS7H 5EZJB 2VXVL 1DLHA 1XGQB 1JE6A 2O5ZH 2NXYB 4XBPB 2QJDA 2ZSWB 4GKSB 1KIPB 3QI9A 5BV7H 1U95A 1MRFL 2GW5A 4QHLA 5J13B 5F6HJ 1BBJA 3S98A 1LD9A 1SM3H 1J1OL 5HYJA 2CUIA 3VRIB 3T0DA 4PJXE 4QRPE 4EXKA 4OZFG 1D5MA 3FRPG 4C55A 1KCRH 5D7KD 2ZNWA 1MFEH 1W0WA 3RDTC 3MRQB 4HIEB 3BEVB 1CD1A 3KPNB 2YRPA 3X12A 1DBML 5E8EA 1WZMA 4KJYB 5JHDA 2VITA 4MLSA 5HGGS 4DKFH 5B3NA 2LAAA 1M6OB 1RVFH 3BW9A 2Q6WA 2HJKB 2Z8WC 1H3GA 3NACH 4RFEB 3MLYH 4KRLB 1MVUA 1S9VA 1PD6A 2IQ9L 2HRPL 2J6EH 3MMEB 1OP3K 1R3KA 1OSPL 1MHCB 3MCKA 1MJ8L 3BESR 1Z2KA 3ARFC 3WHXB 3DO7B 3O8XD 1LP9B 4Q58C 1A5FH 2QL1A 4D2NA 1BD2A 4LBEA 5DURD 1RQ5A 3WLBB 5C2UB 3BDYH 4ZFFB 1UENA 1JYXA 4TRPL 4B5EA 4K7FB 1IGCL 4XAKE 3V6BR 4NN6C 2C4XA 4IRJD 2L4OA 1AQKH 4HV8B 1OD9A 4DCQB 4Z7WE 3RY6A 2JB6B 5ALCH 1KEML 5KSBE 2ZJSL 3EJZC 4KY1H 5HDQL 3JWOC 4JZJB 4OI8A 4PGJA 3VMOA 1A1MB 1NFIB 3KG5A 2HJLB 2HT2D 1FVDB 4OSUH 4X5WB 5C9JA 1TCRB 1KPRA 3UO1H 3VXOB 3AGVA 1P7HL 1MCPL 3MUHL 5DO2C 1J8HA 1QZ1A 2EC9U 1D9KC 1OLLA 2Z93A 4XGZA 2Z92B 1ORSB 2FO4B 3L5HA 4LNVA 5FKPB 3PNWA 1GGYA 4XPAH 3BZEB 3HPJA 1TFHA 2A6IB 2YKLL 4L8SA 5C7XH 3W81A 3KJ4C 1OGTB 2IFFH 2JIXB 4JKMA 3QDHA 1UYWH 2AK4D 1A0QL 1JWMA 4N1CA 3G6JE 1WICA 5DJ2A 1SMAA 3RTQA 1A6TA 2EDJA 3QDMA 1U42A 5ISZB 4M7LH 4R8WL 3UTTB 1H5BB 4I8DA 1C1EH 1JTOA 5FYJH 4OV6F 2X4SB 5IIEB 3B9KC 1OOAA 5ACZA 1Q1JL 4M7JH 1QHPA 3BRDA 1IGMH 2C5DC 1OT2A 3RP1A 5F9DC 3VFVA 3B9EA 1FFOB 4JO2L 4ODHL 5C71A 4JO1L 3VGGA 1DQJA 4OIBA 5EU4A 3WIIL 2ILLA 4M3JA 4P5MA 3ULVE 3BKYL 4L4JA 2BRRL 4PBXA 4BM7A 4OZHE 1O5DT 5I16A 2XZQL 3OAUH 4JFDD 3GSXB 4U6YB 4C56B 4ZNEA 5F1IA 2LFGA 3NAAL 5DS8A 3I75A 4ONFL 1F3DJ 4GG6F 5FGRA 3QIUB 4NZRH 1TITA 1CDUA 1AR1C 2P1YA 3ULVC 4OGXL 4XRCA 5FGCE 1R3LA 4KZEL 5FM5M 1UZ8B 5I73B 3UC0L 4H0HB 25C8L 1KV3A 4ELKB 3QXDB 4HUNB 1WQVT 4JQIL 4F8TA 2GSGA 4RWHA 1J9CT 4ODSL 1XIWC 4OB5L 4S1DC 1LNUB 3CXHJ 4C83B 1YPZE 5JZ7D 1OP5K 3TVMC 4QRRD 4YBQD 4F37F 1IGTA 1A7OL 4G6JL 1XGRB 5L6YH 3MR9A 4OZIB 4NN7B 2XKUA 1CICA 5JPNA 1L7TL 1PG7X 4HKZB 3VI3F 3SPVA 3DVFA 3HMWL 1DN0A 4U3CA 4LHUA 1RSFA 3U9PL 2QR0B 1UT9A 3SE9H 3T77B 5SX5K 4W4OA 1FO0H 4RSVA 3PWVA 1RZ8A 1EXUA 3U0PB 4IHOB 4JPWH 2YS4A 3OX8A 5FB8A 1HILA 2RR3A 4LFHG 1K4CB 3N0PB 2X7LA 2YD5A 1A14L 4I18B 4Z7OF 5DRZB 1CR9L 4X99B 1YMMA 4PJDA 3AVEA 4DZ8A 1A8JH 2ZWLT 1JFQL 4KV5E 4FQCH 4PJAF 2X9XA 2EKJA 3S37X 1BMGA 3SQOL 4IOIA 2AGJL 4KKAC 2R2EA 4FNLL 5KSAA 2APVA 3ZDZE 1DSFL 3ULVH 5IVZA 4UMGA 1I9RL 1E27A 4O2CA 3D0LB 3RWCB 3V6OE 4DEPB 1P5UA 4DOHE 3BYYA 5F93C 4XP4H 3TN0D 2X4RA 1ZTXL 1RUPL 1X6NA 4WHDA 1UM5L 5HYSG 4PRDB 1NCAL 1BQSA 3HC3H 4F58L 4F15B 3WS6C 3SGKC 1KN4H 3VFPA 1UGNA 2VLRA 4HC1H 5LGHH 1HHKA 4X6DB 1NGZA 4H0IA 4OLXL 3MYJB 1IAOB 4P3DA 4E42A 2J4WL 1TJIL 1JF1B 3D6GA 3UTQB 4NM4L 4Q6IB 5HVWA 1I9IH 3V6OC 1YEFL 4U05A 1BJ1H 2HFEB 2XICA 2OXHA 4LASH 3W39B 1KNOA 3H2WA 2ICES 2V17H 2MHAA 3L3OB 4RA3A 2GTZA 3QWQB 3MV9B 4GAGL 1AGDB 3HUJE 4QHKJ 3T4AB 4G43B 4F7EA 3IF1A 3CFJA 4APQA 1N8ZB 4GG8A 1T7VA 2XG4A 3CFCL 3IFOB 3P4MA 3WN5A 5JW5B 1Y6MR 3HC4H 4H1LA 3VGBA 15C8H 1INEL 4YEEA 2HTLD 1AHWA 4AYFA 5CFHA 3T65A 1R5IA 1C8PA 1U8NB 3ARPA 1A4JA 2P45B 4ZS6C 3MLZL 1P7KB 2YPKB 2GJ6E 2C7UA 4XCYA 3SDYH 1T1XA 2AI0L 3SE3C 1QVOB 2AXFA 5A2JH 1MY5A 3W0WD 1UZ6E 1PX4A 3GSNL 2OTUA 4GAYA 3T0EA 2VRAA 1HKFA 1Z5LA 4IEFB 4PJEF 1YQVL 2YMXH 1EGJH 1F4AA 4YHIA 3RWFA 2VLLB 1T6WA 3VGAB 2L7JA 4NNYA 3JTTB 1X7QA 1T1YB 4G5ZL 4QKXB 4JANA 5E5MB 5BCAA 2V7NB 1T7YA 1G9MC 2XPGA 2I26N 4KKCD 4F3FB 2N56A 1G7QB 2F8XC 3O9WC 3K4ZA 1E28A 4CMMB 4UZGA 4D9RE 2R0KL 3I85A 3P73B 5HY9A 4TUOB 1DQQA 4D8PB 4L5FL 2VB5A 5J6HB 3CFEA 4KJWC 4J3WA 1IGYB 3CFKA 4OD3L 4ZUVB 5D7IF 1RIUH 4W81A 5ITFA 1MFNA 2R1WB 3ZKSD 3L7FB 2EIZB 1J05A 3SDCA 1OPGH 3ROLB 3QQ4B 3OKNB 3EZ8A 2BFVH 3GSNA 3C6LA 3F58H 4OV5A 1BFOB 2FATL 3VD5A 4UIMB 1DBKL 4JR9L 5EU3B 5HGBA 3B2UC 3K1KC 5D2NA 5IVOA 1L7IH 5KAQG 4LEOA 4FFZH 4NC0B 4UDUB 1JWSA 1HXYB 5BO1L 5JOPE 2F54E 2NX5E 4XXDB 5FYKE 1NANH 4M6MH 2MMXA 1I3RB 2RIKA 3NCJH 4MNHB 2JJTA 3ES6B 1G6RB 1RZ7L 2F53E 1D5XA 3LS5H 2D03L 3F7VB 3VXNA 1NCCH 1CLZL 5IUSA 1KJVA 2BERA 2NY2C 3BDXA 1RULL 4WEUD 5EBMA 2VLJA 4JM2C 1K3IA 3IT8D 2BNQB 1UWGH 3MCG1 3MA7A 3MZTA 4LF3A 3SE8L 1AGFA 1NAKL 1G9MH 1WBXB 1WBYB 1A6AB 2FYYA 3HLAB 2CRYA 5TH2B 4LKCB 4L4TA 1F13A 3JV4A 4HWNA 2BNUB 1BBDH 2YPLE 2MCG1 1P4IH 5T5FL 4LSRH 4RMVA 1G9NC 3K8LA 5D93C 5BV7B 1GHFL 1QQDA 3X14B 1CFSA 5AEAA 1ODAA 2B1HL 3EOAB 2DD8L 4JFQB 1GGIH 3MRIB 5CZXC 4OFDA 4WWKB 3R0MA 2DQGH 1UKQA 2K9UA 4AH2B 5CHNA 2AJSH 1FNLA 4UINL 3MNZA 2CRMA 2M1KA 4RFOH 2Z9TA 4HIHB 1UKSA 4UTBL 3EDKA 4ODTH 4KROD 3FT3B 5ID0A 4CW1A 4E41A 1EEQA 3AB0C 1VACB 2PXYB 3O2VH 1FFRA 5BOZG 1N64H 1IEAA 1YEHL 3QUZA 4IIQC 3BO8A 1C5DB 3MPCA 4XBGB 5IB1A 1EAPB 4PJHE 3LS4H 3VWJB 4PP2B 4KJPC 4Y5YB 5DC0A 3Q1SH 5D5MB 5BQ7B 5K9JH 4J2XA 3QDGB 1KLGB 1ED3A 5GJTH 2V2XA 3RPKA 1A6WH 2CSPA 4OTXH 4NUJA 3WO4C 2Z8RA 4NRZB 5J57B 1R5VA 2WLYA 2A0LC 2Z31D 4JRYA 3SJVD 3QJHA 4DGVL 1BHGA 5A2LH 2JB5L 4ONHB 2XKSA 1PKQA 3I6KA 2WWKO 5GS1B 5FYKH 1RMFL 3OXSA 3RRQA 3UTZB 1LE9A 1YEKH 1NC4A 2FNBA 5I0DA 1G9NH 1ZS8A 3W9DA 4M5YL 1YNTA 4MS8D 1UXSB 3MC0A 5DR5H 3D69A 4AT6A 5EZLB 4PRIE 4OCYL 1MELA 4XNQA 1M7DA 1I8MA 3UZEA 3GMQB 1J5OH 1PG7L 5T3XE 1WJ3A 1I1FB 3HI5L 5DI8B 3TIDB 2DM3A 4KH2A 3LKOB 1D5BB 2E9BA 4ZUSB 3RDTB 4OIIL 3PE9A 3QXAB 1T6VN 2P5EE 4YO0B 4U1KB 1U58B 5HGDB 5J11C 4NP4H 3WUWA 4P3WA 3HE7D 5CZVL 1GAFH 2X89D 4QRPB 3ZKMC 2NY1B 4U1HB 4LHJB 1L0YA 5FDYA 1FPTL 4K9EL 4NZDA 4FABL 1JRHH 3S37L 3S8WA 3VXUA 3ARFB 5ERWA 2WSKA 3OB8A 2Q8BH 4TSBL 4MNQB 5HD8D 5GGVY 4RFNC 4QHMA 3NIDF 1AC6A 3GMPA 4ZPTA 5FO8B 5B38B 1RIVH 3QEQA 3CFDB 4LLUB 2ADJA 5C8JA 1X5YA 4P9HC 4NN6B 1M71B 4OZ4B 1N2RA 5D2LA 1CXKA 1HSBA 1EHXA 3S88H 4G8FA 4HPYH 4P2CG 5ESVB 3ARGD 5ESQB 4MJIE 1MRCH 5CJ5A 3FB6A 2V5RA 4YAQA 1RK0B 5KANI 5FGBC 3NOIA 5FHBL 1ACZA 4WENB 3BH9B 3QQ3B 3VFWB 4J4PC 1ZT1A 4NO3B 1FZOA 1MEXH 1U8PB 4R26H 1U8OB 3FB8B 5FV2A 3KPRD 1D9KB 4Y4HD 2H8PA 4HS8H 3ARDC 2DICA 3ROOA 4AL8L 2ED7A 1DLFH 1NMAL 4XBEH 1NUFA 3H9HB 3PIQB 5J06A 2LE9A 5DJYA 2PTTA 4PJXF 1OTUD 2IBBA 1CLOL 1GOHA 1PZ5B 1HKLL 5E2WL 4QXTB 1NKRA 4QEGA 4RDQF 3SDAD 3PP3K 1JZ2A 4CMHC 2P5WD 1IKFH 1KJ2H 4PJ8C 2W9DH 2FZ3A 4EBQH 2HMIC 5GGVL 2XQBH 4G7VL 5SWQB 3B9KB 1JWUB 3C9NB 4J3OC 5LVEA 2G9HB 5E00B 1U91B 4LOUC 4LP4A 5MENE 5HVFB 3BKML 3LIZH 1MCIA 4K3DL 2EYSB 4Q9RH 3H9SE 3KXFE 2Q8AL 4M7LT 1ITCA 5INCB 1BZ7A 2GFBB 2J8UB 1FO0B 3ALPA 1JJUA 1AO7B 4P9HH 1JTTA 4NQXA 1ZGLB 2BNRB 4S11A 1MCJA 1UVQA 2WBJA 2XWTA 3OKDA 3QRGH 1JNNL 4NNPL 4KHXL 5A3IC 1NL0H 3JWNC 1ORQB 4KXZI 2N7BA 3OB0K 4NKOB 1IMHC 2ZSVB 3WDHA 3BZFA 4Z7QE 1QA9B 4IOSD 3TWCH 1CGUA 3PF2A 4Z7WF 3BP7A 2LVCA 1V7NL 2W91A 5KSBF 4P4KC 1RHHA 4ACPA 4GMTL 4WFHE 2YD7A 5EFIA 2ITCB 1MCSA 1OL0A 4MSWA 1V3KA 4OGYL 4WJ5B 3VFSB 3B3IA 4L8DB 3EYFA 3IDXH 5DHVB 5EBGA 5EIIA 5I1IH 1KB5H 2YBRB 3MROA 2OK0H 5K93A 1KYOK 5C0CA 3STZA 3NTCL 1I9JL 2FWOB 5EO9A 1RY7B 2DLIA 2VQ1B 1E4XI 4XPHL 1WV7T 4FXKA 5F1OB 3T0VA 3H7BA 1PG7W 4OCWH 1U3HC 3P3YA 4N0YL 1CGSH 2DLHA 4XNYL 3WKMH 4NM8H 3SCMD 1J7VR 3OGOE 5FGCB 5F3HB 4X8JA 12E8L 5FYLE 4XCFL 1I1RA 3T04D 3SGEI 3DVNB 3GO1H 3MQIA 5CJ8A 5EU6E 2CH8A 4HX1B 2YRLA 2BMKA 4EUPH 4POYA 5CIPH 3KPPA 1AC0A 5JDJA 3GI9H 5EA0H 2HT4D 4AQOA 1NDMA 2F5AH 3RPIA 4E9LA 4NJAH 4U1JB 1ETZA 4S2SB 5K59F 5D7LD 4V1DD 4MAYD 2A83B 2J1KA 4KMQA 1IGJB 1ZLVK 3A67L 4GMSL 5IROA 3FQXA 4L4VA 5E8DL 1AIFB 1NGWA 5I8KH 1UM4L 4CDHA 4DKEL 4OZHF 1MIML 3BKCH 4HCRH 2DYPD 3KPLB 4XMLH 4GXVL 3FL7A 3OJDB 5HHOA 3NZ8A 3MACL 3DRTA 3OAZH 4X98B 1MSPA 1KBGL 3GMNA 3FO2A 5DD6B 5FO7A 3MBED 4GRWE 1BX2B 2CO6B 4YIQA 1JV5B 4X7TB 5I6XB 3EYSL 4HAFA 3GK8L 4R6UA 1G7HA 3CU1A 2VZTA 4F33A 4HBCL 1IEBB 5E03A 2B4CC 1T3FB 5IOPA 2PKDA 4R3SB 3PL6B 1DCLA 1D5IL 4EN3C 3PDOA 3RVUD 1F11B 3CK0H 1CXLA 4LK4A 2YUXA 2RGSA 5CP3H 2EDWA 4PTUA 4LARL 1YPZF 3QNYA 3MRFB 4Y4FD 3U7WH 3E2HC 4LCWB 4Y5VA 3PGDA 3BIKA 4PRPD 3IJYB 4D3CH 2PYFA 4DW2L 43C9A 3DHJA 3GZKA 4MAUH 4YNYA 1NEZB 2UZIH 4M7KH 5DK3A 5DJCB 3F7YB 4XNZC 3VMPA 4OLVL 4YQXL 5I1LA 4XPBL 5SX4H 4DN4H 3RWEA 3O41B 4PY7A 4M93C 2F58H 3V6FB 2VDOL 4QOKB 1V3MA 3JV6B 4OLYL 1Y18A 4D9LH 5F7LB 3C6SB 1UWXH 5KZCB 2O5XL 4NT6A 5ACLA 5TE4L 4O2FB 2UZXB 1V7ML 2YEZB 4WFEE 5T1KA 3C08H 3ZDZF 2EYTB 4WO4B 1I8KB 2HH0L 2XTJB 1QKZH 4R97C 2VZ3A 4Q9QL 1RJYA 2C3HA 4GAFB 3DECA 5JW3H 5LGKA 5IB5B 2FB4L 5DHXB 2BCKA 3S36X 3Q6GH 4Y8DC 5BRZB 4NFCA 4POZC 5ICYB 1S7SB 3FB7A 4JFHE 4GRWH 4QXGL 1G7PB 1JGDB 5DRXA 2R2BB 1TPXB 2OYPA 4B53A 4XNUL 3F7RA 4XWOD 3MXVL 4RIRA 4ALAL 3GB7B 2HFFB 4GFTB 3T2NL 4OBSA 3CVHH 4LLQA 1LO4L 3VJ6B 3GFUA 5TE6L 4WW2A 4MVBD 1FL6B 1X5LA 4Y8AA 3MV7A 5ADOH 4OCRH 2OSLB 1MFAL 4UT6L 5IKCA 1VPOL 1MI5D 4TQEH 5IP4A 2Q7YA 2G5BB 1E4WH 1EUUA 4XCCL 3HUJF 4X4ZA 3VD7A 5DK2A 1GZQA 4GKZB 4X5XB 1F97A 5BVPL 1MCEA 5L88L 4KUCD 3QFJE 3UPRA 2NLJB 4LDEB 3BMWA 4OGAD 2R9HC 4BFIA 4XMPL 4Y19D 2DJSA 4ZOEA 3IFLL 4PRNA 4JFEE 5BJTB 3HZKA 4LLDA 1FVCA 4GW1B 2P8PB 4JN2B 1H8SA 2FGWL 1PY4A 3WXVL 1INDL 4P2RD 4OF6A 5E08L 2NY2B 4PRHB 1VKXB 2GHWB 1CXEA 2YXFA 3VG0L 5T1MA 1S9YB 3HE6C 3ARBB 4GQ9H 3HS0A 2DQFB 2QQNL 2AJZB 1GVIA 1F3JA 4U1LA 2HLFD 1PLGL 2FX9L 1AKJA 5HYJE 2PYED 4LAQL 3M8OH 2Y06H 5L2JB 5B38G 5TDNB 1HXMA 3ULUH 3AREA 3C8HA 4BZ2L 2FR4B 1SJHB 5D93B 2LU3A 1EFXB 4XWGL 3GJEA 5DFVC 5FGSA 3TA3D 3DBXA 32C2A 3NN8A 4X4XB 1UB5B 3BWUC 3OXRA 3QI9C 1S8DA 3HG1B 5JHDE 1EAJA 5E4EC 3SKNA 3WIFB 1OAKL 5DA0B 1LEIA 4YBHA 5KOVC 1UB6B 3MXWL 2ZZUT 1QSEA 3DGGB 2X05A 1NQBA 2WZPD 3D48R 4XVSL 2V7HB 3ABZA 4MA1B 4HHAA 2W65B 4YHOL 35C8L 3OKOB 1AE6L 1A6PA 1BD2E 1OSZB 3FO9B 1KTLB 3MTRA 3V9FA 3PWUA 2ZUYA 4Z8FH 4I0CC 1ZVHA 3FHQA 2BSTB 2WAHA 3EO9L 5JQ6L 4WI7A 4JM2F 3W9EB 2E3VA 5E5RB 4YWGH 4WTZA 3WO4B 5F7EL 1MH5A 2FX8H 2APTA 5F44A 1KPUA 5ALBL 3TJHD 1WBZB 3U4EB 3TZVB 3LMJL 4DFHA 3WKNA 1WWCA 3O8XA 4CGTA 4GQPH 5IMKB 3CX5J 5ESAB 4J23A 2Y6SC 3LQAL 5K9OB 3H0TA 1AP2B 4F7MB 4F9LC 2B1AH 3ILPB 4B7LA 2XN9D 1DJSA 1E4KA 5EO1B 3DXAD 1J8HE 3I02B 5AYUH 5I1KH 4JHZA 4WI8A 4HKXA 3G5ZA 1A6VH 4S0SD 1HHHA 4NQSB 3L5XH 4TUJA 5BMFL 2ADGA 1RZKL 4NCDA 3DWTA 1BM3L 3RY6C 4YX2L 3VA2C 1UACH 4JO3H 2A9NL 5KVDH 1CIDA 2UZYB 1Y6NR 3VWKD 4BZ1H 2AJXH 1FNGB 2H2SD 4LVOC 1GGCL 1TVBA 3QDME 4LFHD 1SYSB 1GRWA 1T5XB 3NCBB 5GXBB 3ILQC 4IBLT 4HDIB 4UB0H 3B5GA 1OGAD 5IJVA 3ZE2E 5M7QA 1C5CL 1LK2B 4L8SC 4EDWL 4CKVX 3CUPA 4UILL 4JPIB 3U83A 3F8UB 3FB5B 3KLHC 3DI3B 3RTQC 4YFLF 1UQSB 3GKZA 4R90H 2VABB 5DWUL 3VDCA 2HTKC 2P5EB 3O3EB 4GRMA 5DUBA 3TT1L 4K2UL 5JW4N 5JIKA 1CLYH 1KCVL 4XP6L 1EHLH 1Q0YH 4ZYKB 3BQUA 3QCTL 3UDWA 2H9GB 4ZNEE 5DLML 1I1AD 43CAB 5TF1L 4JRXD 4PGCB 1U3JA 4I9WE 3FN9A 5CMAA 1U0QA 3EOTL 4XPGL 4G9DA 1RAMA 5F7UA 3QDJD 1DUZA 3EHBD 4HWZA 2JCCB 2FLBT 1NC2B 3K7UA 4PS4H 4XZUB 3ARZA 4YXLL 5EUKB 4YJZL 2AXGA 1I3UA 2ITDB 4WVRA 5CJQL 3TT3L 1VFOA 2GKIA 3PWNB 4CVUA 1Q9KA 3G5XA 4KK9C 4KK8D 3HB3C 4MA8H 4DQOH 3PQYD 3HR5B 1S7RB 1A9BA 1WFNA 2HRPH 5EZOL 1T7ZA 1B9ZA 2BY1A 4Y2DD 2NY3D 1OSPH 3CDYA 4EI6A 1JGLL 5I66A 3QXWA 3LRHA 5I30L 2XXMB 1S9KC 1B4RA 3O2WL 1N3NB 1A7PH 1UM6L 5T3ZH 1R3IL 1UA6L 2XZAH 2BHZA 4OFVA 2ZCKL 4TRPH 4FA8A 1FN4A 3SDXB 1S7TA 4I1NB 3D0VA 4FQ2L 3ZYOA 1GIGL 3UPAA 5IBTH 4EUPB 3RU8H 3HI6L 1IGIH 4PGDB 1YMME 4PJDE 1KEMH 2ZJSH 3HA0A 1CICC 3EO0B 3IJHB 1VERA 3NFSL 1KN2H 5FO9B 4TSAH 4FG6D 5TJWK 4U6VL 4ELMF 1CK0L 1VB9A 4PJGA 3TC9A 3GSWB 5J89A 3GSOA 4XAWH 2KH2B 5ILTL 4KKBC 4DZBA 4R2GB 3KPMB 3S36L 5TFSH 2FEDD 4NQCD 2FX7L 3MOBL 3IFPB 2MQCA 3VXPA 4HJ0D 1NGQL 1C16B 4P4KB 1U2HA 2YKLH 3ALXA 4MB5A 4KRMB 1XF5A 1LWRA 1NEZG 2HFGL 5KVGH 3G6DL 2XA3A 1X4XA 2CLZB 3N85H 3G04B 4O58L 2VLRE 5KSAC 1UCBL 4OD2B 5C0JB 4G6ML 1I7ZA 5L7XL 3QULB 4BK4A 5E6YA 1N5YL 2GAZA 5FK9B 3S5LB 2BC4A 3GI8H 5INDA 1VDGA 2CIKA 4U6TA 4WUUA 4I0PA 2DWEA 5IEKA 2QQLL 5I15L 1AI1L 4WWID 4GSDL 4LLYA 1NJ9A 4JO2H 4ODHH 4HWBH 4I2XB 1QFUL 4LCUA 4JO1H 1OVZA 3WIIH 1T0PB 4YPJA 4HK0A 4JKPL 5CEXA 4O5LL 5C2BL 2BRRH 1NBYB 1BFSA 3QNXB 1V05A 4U6HB 4FQJH 4MXQC 2DDQL 2E9WA 1DUYB 1NFDA 3GUTA 4P2QB 3MUGA 2D7NA 1DTUA 1MFDH 3NAAH 5DJAB 5IQ9B 2ZP0T 3VGEA 3O3DB 4ONFH 3QP3A 2KQMA 2CK2A 2YOCA 5TDOA 1YJDC 5EU6B 2NNAA 3REWB 4APQC 3U30B 4OGXH 4BQBA 1FYTA 3QEUB 2MNUA 3WN5C 2HRLA 1Q0XL 3T0EE 2X4UB 3DROA 3UC0H 1AHWC 2PR4H 2P48B 2WK2A 25C8H 5J7CC 3L3GA 3N1MC 1D6EB 4Z7QF 4GW5B 3WIHL 5JORA 3RX8A 3PWPD 3GSVB 1LILA 5FF6B 4LLMA 5IM7B 1LVEA 3WNLA 4R0LA 5A16A 4OB5H 5D7JA 1ZHBA 3V5DA 4NRXB 4G6JH 3PGCB 1HH9A 3T0EC 4RGMC 1BQLL 4QRUA 1TCMA 4NO0B 5GZOD 2MPAH 3TH4T 1L7TH 4D0CB 1F4WH 1R0AL 4YDLC 4CVXA 1QUNA 1CU4L 4JFOA 3U9PH 3UYRL 4B0MM 4G42B 1ES0A 1G7IB 2GQHA 5BOPA 4PJAA 3R8BB 2IANB 3D85B 2DLFL 4Q74A 3DV6B 5ISZD 4JKKA 3UTTD 5I76A 4ENEC 4EZMA 1A14H 5FA4A 1CR9H 2GCYA 4ERSL 3BPCB 3CMGA 5E8OB 5IB2B 3GNML 3CVHB 4LDLB 5D1XB 2ZCLH 5TPWL 4BELD 3DX9B 4LSDA 4YGVB 5D1QC 4LPWA 5JA9A 3CDGB 5D2NE 3MO1A 4KHTL 4PG2A 3UTSB 4FQHB 3BPNC 1J86A 3F5WB 3BP5B 3V0WL 1C08A 4HJGA 1OB1B 1QOKA 5F6IC 4D9QD 4XVTL 2AGJH 3SDCC 1MF2H 1YJDH 1DSFH 1JHKH 1VFBA 4FZEH 1MIEL 3NFNA 1I9RH 2VL5A 4H1LH 1QBLL 3C6LC 5EU5B 4JVWA 4ZTPH 4PIRF 4DVBA 3N9GL 3CC5A 1N7ML 4I0KA 4WGVB 3LPGA 4YHYB 3LN5A 2YC1B 1AD9A 2FRGP 1DZBA 5EWIL 1IILE 5D2NC 2VLJE 1ZTXH 2ICWA 1E4XL 3OF6D 3PGFL 4NWTL 2OJZL 2GT9A 4CUCA 4PJ7B 1FCGA 1NCAH 5L2KB 2XZCL 1S7WA 4L4TE 3TO4A 5IB3A 4JG1L 3QIUD 2Q86B 4OLXH 2XRAL 2JJTC 3OKLA 2J4WH 4P4RA 4NM4H 1HHGA 3FQTB 3G08B 4NDMB 2W38A 3IDJB 2LTQC 3QH3A 3RWDB 3T3PE 2CK0L 1RUAH 1S9WA 4Y4KD 5K33A 4U3HA 3TM6A 5L8JB 2H6PA 2E9JA 2UY6A 1ZA3B 2IGFL 4ETYA 3NPSC 3W5MA 4RZCA 3L3JA 4HFWB 3CFCH 2XY2A 3MNVB 5FCUL 5I1AA 3H3BC 1INEH 1KLUB 1DE4B 4YPGA 1EUTA 2X4PA 4E41E 5MHSD 3W11D 1S7QB 1RPQA 2YHGA 4HZLB 4WU7A 4KJQD 3S3JA 1OARL 2CDGA 3L9RB 4M6NL 4KVNH 2OM5A 2IALA 5KS9B 1TETL 1TXKA 1GPOL 3MLZH 1HZHL 1PGRB 2GSIA 3QHTC 3LRSA 2AI0H 1LGVA 2HWZL 4PJCB 3BHBA 4NQDD 5DJZA 5DD0H 3M07A 1QLFB 2AK1L 3BDBA 3GSNH 3D39D 2ED8A 2IBGA 2GK0A 4YR6A 4GBXA 5IHUL 4JRYE 4KPHH 1W72L 1XCTB 5FUZH 3I9GH 3DSNA 1IQWL 4U0RB 1WWWX 2I60H 1PKQE 4GAJL 3QUZC 1LK3L 1IM9A 1SJVA 2C1PA 3V6ZB 3KDMB 1MAML 1JPGB 4BH7B 4I4WA 5DJ6B 1F8TL 5I9QB 3HE6B 4RX4A 3CFBB 4NRYA 1KJMB 5BS0A 1EK3A 3QFJB 3LVEA 1QSFB 4IDLA 1A1NA 3L95B 1MCOL 5ABDE 1IGFH 2DI9A 2SEBB 2JELL 1QFWL 2G2RA 3GGWB 1MHEB 3OMZA 2Z31A 3VH8B 3SJVA 5JXEA 2NTSP 4G9FB 1R3JB 5DURB 3TFKC 3B9DA 3GBLA 2C3VB 4ZO7A 3P9MA 1E4JA 1WEJL 3QFDA 4JFPB 4NQTA 3DRQA 4Y89A 5JMRA 1RD6A 4GXUM 1PQZA 3CZJA 4J3TA 4QHLB 4ZOCA 1BBJB 3P0YL 4IRJB 3SHSA 1S7VA 5AAWA 1CDJA 3C8DA 5IF0A 2GTWB 4XI5D 5CSZA 1W72A 3FO1A 4Z95L 4ODWA 2IH3A 4N90E 3Q3GB 3VXUE 3SKMB 1MRDH 3HAEA 5GGRB 3MV9D 5BO1H 3GBNH 4P5TA 3IXAB 1ZWIA 3RKDC 4MGXA 4ZXBC 1MREL 2VITB 1XZ0A 5K9KA 1DBBH 3MFGB 2E27H 1VENA 1SJEA 3QEQE 2C4FT 3SY0A 8FABA 3CPLA 3LKPA 2BSSB 2NY5L 4LPVA 1RULH 4TTDD 1MVUB 5D2LE 2WWMD 4J3VA 4YHZH 4PY8I 3IXTB 1OAQL 3WFEH 3MCKB 3DYMA 1NAKH 1S7XA 1B6DA 1Z0MA 2X89A 2CLRB 1U8JB 2AK4B 3IRPX 4L3CB 4PJIF 4E5XA 4N9GB 4N1HB 4XVJH 1T2JA 3OGCA 2GUOA 4M1DH 1YYMH 1BAFH 4I48A 1KIRB 1SEBA 1RZIA 4ODXB 4LSUH 3MODL 1GHFH 4UT9L 4X7SL 4EUPG 2B1HH 1YUHB 2DD8H 5T33L 4D0BA 1NLBH 1OD7A 3BMVA 2R2HA 3MV8D 1NMCB 3QCUL 4DGYL 1MUJB 3O3AA 1OAUL 1JGVH 4G8IB 5C0AB 1MQKL 1E6OH 1NGYA 3O3BB 4BZYA 4R4NC 3D25A 4AY0A 1XGUA 5I1DA 5IJKA 4UTBH 4NPYB 3E0GA 4PJFB 2ARJA 3FT4A 3QUXD 3QWRA 3WNNA 1KELL 4JFDB 5F9WC 5CEZD 3NH7H 1KTRL 1J0IA 1A7NL 2VDML 4R96B 5GRYA 5EBLB 4K9EC 5IQ7L 3DVGB 3RWIA 4PGEB 5JDSA 3OG6B 4P46A 3PXJA 3T8XB 1OF2A 1U8KB 1JHLL 1M7IB 4K71C 5MERB 4UV7H 5B3JF 3MNWA 4E0RA 1QO3B 3RTQB 3DMMA 1A6TB 1Q8MA 1FFNB 1CL7I 3WE6B 3TV3H 3RGVA 5DUML 2XWJB 3S5LG 3KNBB 2E6QA 3SDAA 2IJ0C 3CH1A 3QBTB 4OFIA 5DMJB 1J0JA 3LH2H 3BD3A 4Q6YA 4ETQA 3V0VB 5FUOH 1RMFH 1BZQK 4LSQH 1G7LA 1KCSH 4JJ5B 1BFVL 1FIGH 1WK0A 1MHHB 4R4FL 4QRRB 2P42B 5C0EB 3OAZK 4Z77B 4OCYH 4KQ4H 4Z5RB 4KK6C 1HYRC 3B6SB 2MTPA 4GKOA 3C8KB 3BUYA 3VD9A 1PG7H 2WBJC 3V8CA 3EYQC 4NFBA 2BNQD 3UBXB 2ESVB 2V9TA 4M02A 5D9SA 3REVA 4YDVB 4JY6A 1MJUL 1UXWA 2X4NA 4NSKB 3UJTL 6CGTA 4MMZC 2CUHA 4OIIH 5E8PB 5LCVH 5F1IB 5H35A 2JJUA 2VLME 5C0CE 5DS8B 2OQJA 3OKMA 4DGIL 2CDFA 4XHJD 4Y2OA 3CLEL 1CZ8H 4L8CA 4N8CL 1CDHA 3KJ6L 4RCAA 2XA8L 1OP9A 3KYMA 1MCWW 1CFNB 2FO1A 3DV4A 4I5BA 2FEEL 2R4RH 3G5VA 2DIAA 5HI5C 4K9EH 4WWKD 1I3VA 1KB9J 1KJ3L 3S37H 1R3LB 3WLWC 5DMGD 2AVGA 5D7SH 2VLKA 4TSBH 3O45A 3TP4A 3RZWA 5J1SC 1T5WA 2GSGB 4LLWB 1K9TA 4Y1AD 1U93B 2X70A 4JPKH 1BGXL 2V2WA 1HOCB 2WINB 3ULSA 2PXYD 3D18A 1OAXL 3NIFF 3GBML 3WXWL 4OLZL 3VXSA 4GW4B 4P23A 3C5ZA 1ZT7B 4AIXA 3PDDA 3S3SA 5JPNB 4L4VE 3SPVB 3JTSA 4O51A 3PHOB 1CWVA 5FHBH 4Q2ZA 5AZEL 2O61A 5GJSH 1BZ9A 3RZCC 4QYOB 4NN5B 4WV1A 1Z0NA 5H94B 3PWVB 1LO3H 5DQDL 4HFUH 2Y7QA 3V52H 5HHOE 2NYYD 2PN5A 2BSRB 2Y07L 4AL8H 1XF2B 1DBAL 4GKNA 5DD3L 5B21A 4TN9A 5IROC 3VA6A 2BDNH 5GRVK 1NGPH 4MAYA 4OF0A 3FOLA 3V8OA 4XXCC 2IAMA 1HKLH 5E2WH 3RGHA 2XI9A 4AG4L 5EIVA 1TJHL 2K1MA 2IWGA 4WNQA 4YDJB 3N1GC 5GGVH 4G7VH 1YEIL 3UTPE 4PB9L 5EUOA 4PTTA 1A9EB 3T4YB 4ZPVA 3RDTD 4Y16A 1JBJA 4OZGA 4MXWL 3TCLA 3PWLA 2X4RB 3BKMH 4K3DH 1F5WA 5E6IA 2Q8AH 5H37H 1XF3A 2OZ4H 2NXZC 2NY6C 1NCBL 4NWUL 5BZWB 3BRGC 4EDXA 1QLEL 2J8UF 4W70A 3EJJX 1A3RH 5GISL 4E42B 4QRPD 1HYSC 2ERJB 1DVFA 5DQ9A 3TPUB 5FYJD 1JNNH 4NNPH 1CDYA 3ARFD 3UJJL 1KNOB 3S35X 1HEZA 1PY9A 4MX7B 5BXFB 4MNQD 5CCKL 1F4XL 1HSAB 1YN6B 3TBTA 4V2CB 4MNGA 3E6FB 2PO6A 3A6BH 4Y5VC 3VXQA 5KSVA 3GJFA 4WTWA 3IF1B 1KTDA 3CFJB 1AQDB 4W6YB 5GGSY 4EOWL 2CR3A 5IMOA 1HDMA 3FZUC 1HK6A 2E7BA 3P4MB 4X7DC 1F58H 4MDIA 2IFGA 1FZKB 3EFFA 2H26B 5F88B 4HUXA 1W0VA 2XFXB 3EJZD 3P9LB 4TVPH 2VXQL 5C09A 5C86A 3C2AL 2E5EA 4U7MA 2I9LA 1ZLUK 1OQXA 5FKAB 1I9JH 2JK5A 3IRZA 3K8MA 5F6HI 3R06A 2GITA 2C7UB 3IJSB 5F9JB 5JNYA 2YA2A 1T1XB 2R56L 3C09C 5DO2D 1N4XH 2AXFB 3EOBA 4XNYH 4OZFA 1CG9A 3UAJC 3FRPA 4UNVA 1D9KD 12E8H 1IZKA 1BOGB 1NKOA 4XCFH 5DMIL 3T0EB 2DWDB 1IC7L 2QHLA 1H15B 1IC1A 4MCZA 1U8HA 4YHIB 3RWFB 2CKNA 4XX1E 3MFFB 5CJXC 4N0FB 4NQVA 1HHIA 3RNKA 2BVUA 4NC2B 2DIJA 3I6LD 3MV7E 1E28B 3ZTJH 4P9ML 1A02N 2N1KA 4QF1A 1MCLA 1UH3A 4AJ0A 4P59L 2IPTL 1NAMB 3H42L 3O11B 5L8KB 3B9KD 3FN3A 3BP6A 5E2TL 1MNUL 1RZGA 4OCLC 5D1QB 1ZV5A 3VH8G 5E8DH 2CXGA 1QRNA 3T3ME 3CFKB 3Q2CA 3HHRB 4CVZA 1OCWH 5IR1A 3H3PL 1UM4H 2DQUL 1MIMH 5ITFB 5F6IB 3GMOA 3PJSA 3U2SB 5C07A 1J05B 2WIIB 4WW2C 2MKWA 3QJFB 5GGUB 2NY0C 3MACH 2AQ1A 3MREB 4LMQI 4UTAH 2O26U 3T2OA 4KC3B 4P2YA 4ZOBA 3VW3H 4WHYH 1DQMH 3DUHA 3MRLA 5DEFA 5HGBB 3WFDL 3Q48A 4XNMB 4M62L 3EYSH 2CKBL 1YNKH 4LEOB 1F3RB 2P8LB 3GK8H 1JWSB 4HBCH 5DD5H 5SWZA 3L3DA 1A1OA 3HPLA 3RBSA 1XGPA 4RISH 4S0TD 5SWSB 2QHRL 3JV0A 3VXRA 3ULVD 1D5XB 3BGAA 5CLWA 3QIWA 3QUYA 5H2BB 2NY4B 2NZIA 4HUUA 1QR1A 3JUZA 2L0DA 2P7TB 4P2RA 1AGFB 1QHOA 2W60A 2VAAA 3FT2B 1FL3B 3I2CL 1XIWD 4S1DD 3UMTA 1CI5A 1ACYL 1QSEE 1HN1A 4A2MA 4HXBL 2VDPL 3NPSB 3SO3B 3AREC 3TVMD 4IMLA 4FHBD 4UOJA 2AS5M 3O6KL 1S9XA 2EIEA 4OLVH 4YQXH 5J12C 3CFIC 2CKBA 2IPKB 2EDXA 3V5KB 3TA3A 1EIBA 5D1ZC 4MD5B 4LSPH 1DEEA 3LN4B 3WJLA 2G60H 3MRMA 5TE4H 1V7MH 4PRBA 4XHQA 3MLPA 2I5YL 5DRNA 4GRLA 5J6GB 4O2EA 1ITBB 1TZGH 4Q9QH 1H3WM 3CXDL 2FL5B 1MPAL 1A7RL 3P0VL 2FB4H 1Y0LB 3DTXB 3VE0B 5D6CB 1AJ7H 1ERNA 4KKAD 2CJUL 3SE4A 4I13B 3IETA 4G8GA 4NO2A 1K8IA 2D7TL 2UV3A 2ZPKH 1R5VB 4QXGH 5DTFA 4JJHA 3QJHB 4L3EA 4QCIA 2FJFB 5M95B 2MCPL 5EC2A 4XNUH 3MXVH 4MZ2A 1PKQB 4ALAH 2B0SL 3N06B 3T2NH 2IEPA 4X6CB 1FORH 1E4KC 3WCYA 5DGQA 3GMMA 3OR6A 3PL6D 3KLAA 4CBPA 1YNTB 1ZGLP 4PB0H 1MFAH 5AAMA 1L9NA 2HFTA 2LVEA 3KYAA 4KI5E 1VPOH 2CPCA 3PV6A 3EO1A 1JGUL 2Y23A 1JNHA 1NMBL 3ME0A 2HG5A 4XNQB 1M7DB 3P30H 3UBXG 1I8MB 2PCPA 1DDHA 1QLRA 3OZ9L 1YEEL 5EOQH 1F02I 4KAQL 1JPSL 5IBLC 4XMPH 4FFWC 4NKQB 3IFLH 3VFOB 4U1NB 4HUKB 4R7DA 3FRUB 4U1IA 3LN9A 4ZXBB 3IDYB 2R8SL 3KPRB 2FGWH 4KI5C 1T0MB 1FRGH 5CEYA 3WUWB 4HG4K 1KENL 4RMSA 1B0RA 5ICXA 3GSUB 3VG0H 4F57H 2CLVB 1AGBB 1OGAA 4G80B 4X6FB 4P57B 2OJEB 1MOEA 1B2WL 3O4LB 1RU9L 3LQAC 4WUKL 1PLGH 4ZS6D 2Q20A 4F7CB 2J88L 5F97E 3VXMA 4HPOH 3VI4F 2H41A 4QOKD 2FIKA 2C4FU 1IBGL 4ZPTB 2P5WB 3QHFL 1RZKC 4LIQH 4NOBA 2Z35B 3QEQB 4FTVE 1YDPA 1XR8B 4OBRA 3BQUC 4NO5A 5DD1H 2VQTA 4ONOA 3UDWC 3WFHA 3GMRB 1YECH 4HS6B 1F6AB 2VKWA 4KGJA 3UJIL 1OAKH 1F2QA 4WO4D 5HYSA 3ESUF 2XTJD 5I1JL 1BECA 5HDOA 3LQMA 1K85A 3KYKH 1RUQL 3CCHA 3VFGH 2GJ6D 3CLFH 4LNRA 4KTDL 3O9WD 4AM0B 4XVSH 3TYGH 1LO5A 4HGKC 5CJBA 2N7AA 5BRZD 4HUMB 4AEIH 1MCDA 4WCYL 4K23H 2DTMH 3S35L 1JIBA 2OMNA 3T2PA 4KJWD 1T2QL 3QA3A 4UBDC 3ROOB 3T09A 3MRCB 1TTGA 3VFNA 4HULB 4M6AA 1CF8H 3L5JA 4QRTB 4UIKH 4QHKI 3BGFC 1ZEAH 1IC4L 3EO9H 1JZ8A 1DQDH 1T1WA 2ICEA 1JPTH 1S5HA 1J11A 3MBXL 5E1AB 3HCVA 4D9RD 2HKFH 4UQ3B 3G6AA 1XFPA 1XR9B 2DQEL 4JREC 5ALBH 4HIJA 1VGEL 4QHUA 3LMJH 1CQYA 2J3SA 3B2UD 5MEPA 1PSKL 1SYVA 4PJGE 1PEZA 4NZTL 2WQ8A 3LQAH 1S3KL 2FHCA 1ADQH 1BVKA 1EX0A 4K3JH 1JUFB 2BJML 4QWWC 5DSCB 1JGEA 3BJLA 5C0GB 2A6JB 1FNSH 2XKNB 4NKMB 5D2LF 2YK1L 2R1XA 5I19H 5BMFH 2GY5A 3FQRA 1RZKH 4RQQA 3P4NB 3L7EB 3SCMB 1BZ7B 3BGMB 3D9AL 3HNSL 4XTRC 1P7QD 3L3IB 2OXGA 5LGJB 4Z78B 2NY2D 4PRHD 2H32A 1I3GL 4XC3H 1UVQB 4JM2D 3OKDB 2VZ1A 1ZVSA 4HXAL 4IDJL 3KYNB 2PETA 4H25A 1GGCH 2FIRT 1BIHA 5HHPA 2Q3AA 1VADB 1MCBA 4KGLA 4LEXL 5JOPD 1HQRA 2F54D 4PFEA 3MGTA 3MLUH 5FYKD 1OW0A 4JB9L 2ENYA 1KCUL 4EI5B 3DUUB 4LRIA 1AXSB 5D96C 1CTOA 3QCVL 4WUUE 5C08A 2BXZA 5EC1B 2XWBA 1EFXD 4JHWH 5F1NA 3DYPA 5D7LB 4V1DB 2VUYA 4UILH 2VXUL 3TBSA 3WFCH 5CZXD 2YSSB 4MSWB 4M8QB 5C0DA 3HC0A 3MRDA 5EZJA 1XGQA 4Z7VB 1J0ZA 1LEKB 3EYFB 2ZSWA 4YH6A 4GKSA 3THMH 1XGYH 4U1GC 5C0CB 3MX0A 4K2UH 2CO7B 4FMKA 4FQQA 5I1HL 3F6IA 1LDPL 1BWWA 5I1CL 3VRIA 4I0PC 4N1EA 3TNMA 3MLRH 1IC5H 3SKUD 4BSWB 1NFDE 5DC4B 3EGSB 2P46B 1DN2A 3MBEB 5CJOL 5DLMH 4MQXC 4OJFL 5TF1H 4S1SL 3MRQA 5C0RH 3BEVA 3EOTH 3ZO0A 4LSSH 5FV1L 3GHEH 1RUML 5IFAL 2AJYL 2ORBH 3V4PL 4KJYA 4KJPD 4PLOB 3DIFB 1GXEA 2YA1A 1FYTE 1T1ZA 1M6OA 4LQ1A 4WY7H 2HJKA 3KPPB 4H20L 4XH2B 2VISB 3SKOB 5GIRB 4MD4B 3RZCB 5MEQB 3FCTA 4LKXA 4YXLH 2OP4H 3RPIB 4UNUA 1A2YB 1B4JL 2PTVA 3GIZH 4ZTOH 3MRKB 2A0LD 3MMEA 4RBPH 5AZ2H 3TT3H 1UH2A 1ETZB 3VFTB 2FBOJ 1MQ8A 3DO7A 1LP9A 1N26A 3HNTH 1JK8B 4Y4FB 3FQXB 4L4VB 2VH5H 3RVXC 4NQEB 3U9UB 5IV2B 2WM0A 4PRPB 4ZFFA 4NCC2 1JGLH 1FGVH 1WLHA 5CGTA 2GY7B 4K7FA 4MZ3A 1SMOA 1Q9WA 5I30H 1RURH 3WNMA 3NZ8B 1D3CA 4DCQA 3DRTB 3KHOA 1CL7L 2JB6A 4R0LC 5DJ8B 1SHMA 2CIIB 1K8DA 9CGTA 5D7JC 2X10A 4PJAE 2ZCKH 4LLAA 3X11A 4ELMA 3ARUA 1ZE3C 4YIQB 1CGYA 4OM0H 1A1MA 2HJLA 5I1GH 1FVDA 4X5WA 1TCRA 3BAEH 1XF1A 1G7HB 3NABH 2NXZB 1YY9C 1YYLH 4DN3L 2R0WL 3OJVC 4M7ZB 4PRID 3ZHKA 5GRJL 2Z92A 1U8MA 3UXFA 1ORSA 2LU4A 1V3JA 3ZKMD 2FO4A 5JPMB 1UJ3B 5FKPA 5T3XD 2OL3B 3HZVB 3I50H 4FQXA 1OGTA 3WD5L 2NTFB 1ZHNB 2JIXA 3P9WB 5F7FA 1QNZH 3S36H 1DQLL 2P5ED 4KKCC 3PABA 2FX7H 3MOBH 5JOFA 1ZKAA 4ODVL 3U1SH 3CAFA 4Y5VB 3UTTA 3KR3H 5KJRL 4WI5A 1H5BA 1U2CA 2VDRL 4OKVB 4TULL 2DQTH 3MRGB 3PP4H 4XCEB 4PG2C 2EH8H 2VYRE 2X4SA 1RUKL 2HFGH 3SOBL 4GO6B 4YNYB 5HHQB 4G6KL 3MLXL 4I3SH 4LGPB 1FLRH 2DQCL 3ARTA 1FFOA 1NANI 1N5YH 4XP9H 1NC2D 3AXLB 3RWEB 2ZNXA 1MCKA 2ZUWA 3VD3A 5IEHB 4Z7UB 2Y72A 4J4PD 1QD0A 1MI5B 4PP1C 4YGAB 3K2UH 4NZUL 3QEHA 1TTUA 3LZFL 3MUJA 2WUBL 3ARDD 3QZWB 3TO4C 3GSXA 3OV6A 4U6YA 2HJFB 2Q3ZA 4C56A 2DIBA 5J9PB 4RGNE 3DX8A 1I8LA 4MJID 4JKPH 3STLA 2F19L 4HWEL 3P77B 5GHWL 4O5LH 1IQDB 3QIUA 3OKEB 3F12B 2DDQH 4UOW0 3TF7C 1WT5A 3ZTNL 1OTTC 5K9QI 2LQRA 4PJ8D 4RMTA 2HMID 4JHBA 4ELKA 2DQJH 3QXDA 4RGNC 5DRXB 1WUNT 4LOUD 2PYEB 4N0CC 4OLUL 1DQTA 1LNUA 1EA9C 4C83A 1OQOA 5IT2L 2EXWC 1P1ZA 1JZ6A 2XQYK 5EB9A 4P99A 3EYOA 5EO0B 1PEWA 3MV7B 4KZDL 2DMCA 2NY0B 1XGRA 4NJ9L 4OZIA 5L8LB 2W0LA 2B20A 1IT9L 5E9DA 2BVTA 4HKZA 1EVUA 2Y25A 5A3ID 5CAYB 2AV1B 3T77A 3OAYK 5BS0E 3I3DA 3UPRB 2HVJB 3KXFD 3H9SD 1BQLH 4N0RA 4QNPE 2DKMA 3U0PA 2H2PC 3IU3B 4GBXC 1IAMA 1KB9K 2X4OB 4Y7MA 3O6LH 4IHOA 5DZLA 5I1EL 2F5BH 4M61B 4P4KD 4YE4H 1R0AH 4KROC 2VL4A 1G1CA 1A6ZB 3L1OH 1IKNA 1CU4H 4I18A 4UUJB 4HK3J 5DRZA 3SJVE 3UYRH 1KF9B 3QNZB 2NMSA 4ZD3L 2R0ZL 3LKNB 1PYWB 4Y0GA 3HS0B 1BOYA 5F72S 4ERSH 3DVIA 4HW6A 3GNMH 4FQLL 1U3HD 3MYZA 3D0LA 3RWCA 2Z31C 3LKRB 2R29L 3BN9C 5JXEC 3MRHA 5E2VL 1QYGH 3S4SB 3MLSL 1JNLL 3DBXB 1RZJL 3NN8B 5J12B 2UWEB 1MIEH 2XN9B 2NY7H 3OXRB 4PRDA 1HWGB 1CGTA 2QTEA 3N9GH 1IZJA 4X6DA 5F7DB 3MYJA 3SGDI 1IAOA 3A6OA 5D1ZB 1QSEB 5C9KA 1JF1A 3UTQA 3SKJH 3AU1A 3PGFH 4Q6IA 4NWTH 3S96B 2V2TB 3T3MF 2OJZH 5C3LD 3W39A 2VMFA 4IJ3C 4PJ7F 1JRHI 5FYLD 3VWKB 4J3XA 3L3OA 4P5TC 5DUPL 4Y5XC 1YEGL 2XRAH 5EU6D 3MV9A 1XF4A 1UC6A 4HAGA 4PJ5B 5B22A 1AGDA 2P24A 1WSST 3T4AA 3D2UA 4G43A 1MJJB 4LLVB 4DVRL 1FSKB 3IFOA 5EG6C 5JW5A 2CK0H 2Q76B 5CEZL 1LO0L 3B5HA 3TH2T 2BOCB 3S97C 4O02L 1WC7A 3QG6B 4RAVB 1U8NA 4IMKA 3IKKA 3HRZA 1BREA 5D71L 1P7KA 2YPKA 5IVXB 5DHYA 3QEGL 1CXIA 1QVOA 1FE8L 1ZSDB 1A22B 2JE8A 5ECJE 2DQHH 4AK1A 1OARH 4EN3D 3LD8B 4OIAA 4WI2A 2QSCL 1TETH 3O6ML 5I8OL 1EJOL 5KS9F 4JRXB 3WSQH 2HWZH 3ARQA 3D85D 4X9GA 3B9VA 2AK1H 3QDJB 1T1YA 5E5MA 2V7NA 2BOBB 2EDDA 5IJKC 1FJ1B 4X6BA 3JSSA 1ZHLB 4F3FA 1G7QA 4YFDB 5IHUH 5DMYA 4DJMA 1G6RL 1W72H 1KGCD 4CMMA 5DF0A 2NY5C 3P73A 5GSVB 4TUOA 4D8PA 2OR8A 2NW3B 3HAEH 3NCMA 1MAMH 1WIPA 5J6HA 4P46C 4OFYA 2DLGA 4LCIL 3CUPB 4ZUVA 2HYMA 3PQYB 1EJ6A 2R1WA 2W92A 3DMMC 2EIZA 3L7FA 4ZS7L 2NY3B 2O5ZL 5B8CB 1KT2A 3RGVC 2C3XA 3ROLA 4ZUTB 3BH8B 4M00A 3BEWB 3QQ4A 1QBMH 3OKNA 4RAHA 5BV7L 2JELH 4KWUA 1QFWH 2HN7A 3R1GL 1E0OB 1SM3L 1BFOA 4UIMA 3VFRA 5EU3A 2AQ3A 4M6OH 1WEJH 2F74B 3QB7C 1MFEL 4NNXA 1J8KA 2EDQA 1HXYA 4OCSH 2DL9A 3P0YH 2HKHL 2JJSC 3UTOA 4XXDA 4Q7DA 5J3HC 3RUGF 3NIDE 4CRPA 4OGZA 1I3RA 4S1RH 3MJ9L 1G6RA 1FNHA 1OAZL 3FQUB 3G9AB 1NH6A 1YC8A 4XNXH 1RVFL 4Z95H 2VUOA 3MA9H 3ULUD 3NACL 4POZD 4FTVB 4K3EL 1KPVB 2VLKE 3IYLW 2J6EL 3PHSA 2BNQA 1UH4A 4WFED 3RHWK 1MREH 3B83A 1WBXA 3HLAA 1A6AA 3G5XB 4PJIA 5TH2A 3HMXL 4LKCA 1KEGL