4NQUA

Anti-parallel fc-knob (t366w) homodimer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
208
structure length
208
Chain Sequence
b'GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
molecule tags Immune system
source organism Homo sapiens
publication title Antiparallel Conformation of Knob and Hole Aglycosylated Half-Antibody Homodimers Is Mediated by a CH2-CH3 Hydrophobic Interaction.
pubmed doi rcsb
total genus 33
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nquA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nquA01
1U58A 3MOBL 3CC5B 4RRPA 2FNBA 3VXSB 3HE6B 2R0KL 1SBSH 1A6PA 4JQXC 1IKNC 2IAND 2O5ZH 1Z5LB 3QDMB 5JR1L 2NR6C 4LPYA 1XR8A 5BMFH 4R4FL 3DRQB 1P7KA 4KI5F 5HI5C 1BZ7B 3BKCL 1OCWH 2KKQA 2Z8WC 3HE7A 3SPVA 4JE4B 4R8WL 4KV5E 3ZKMC 3SE8H 1N6QL 1K8DA 3P9LB 3O2WL 3SQBA 2XTJD 3B83A 2BJML 3DMMD 3W9EA 4EUPG 1ZE3C 5ID0B 4PRNB 3LRHA 3U4BH 2HWZL 3FB5B 3VGBA 2EE9A 4JPWH 5L8JB 2F74A 2H41A 3HZMA 2C7UB 4LHJB 3N1FC 1G6RH 4LSUH 4JR9H 2Y7QA 3MGTB 1U8JA 2XWJA 3G6JF 3QAZC 3H2WA 5EBLB 4B5EA 3BPCB 5DUPH 5HGBB 5C6PB 5BXFB 2DI7A 3NCMA 1PKQA 4W81A 2YBRB 3QDJE 2NTSP 2YUVA 4PJXA 5J6GA 4DUXA 1YNTB 3LOWA 3QIBC 4X9HA 4DVBB 2J8UF 2B1AL 1UJTA 3FRUB 5JA8B 1CG9B 2BRRH 3NCEB 4R26L 3TN0B 1ZEAL 3MJ6A 4JFXB 1Q9WA 2X1OA 5TDNB 1DEEB 2MSPA 1H15B 4CAGA 1N2RB 1RUAL 4XPAH 3EO1A 1S9YA 4OZIF 2DQUH 1OCWL 3FQUA 4YFEA 5DEFB 5I18H 1J8HA 4MAUH 1U8MB 3UAJD 2VWEE 4BH7B 3BZ4A 5CS7A 3ES6B 1IZKA 5K9JL 3VXPA 1B0WA 5HYJD 5BS0A 5I17B 3OMZA 3N85L 2W38A 4PREA 1UA6L 3K2UH 2G2RB 2WANA 4QRTB 4BQBA 3BP4B 3BWUC 3GSOB 4OQ1A 1NEZA 2SEBA 3GRWA 4K8RD 3V6ZA 2V7HA 2HFGL 2AXFA 2ZOKA 1RZ7L 1MFAL 4Z7OF 1L0QA 2JIXD 1YEDB 4LKXB 1KENH 4JDVA 5D5MA 3GMQB 2NPLX 4Y1AE 2VABA 2A1WL 4U1JA 3GI8L 3IF1B 2EEBA 5AD0A 1KENL 1FC2D 3N0PB 3MUZ1 2M2DA 4X9FA 3S3JA 2W9EL 1MFCH 4QXGL 4M62L 1MRCH 2ATPB 1UVQB 2W0KA 1OPGL 2AKRA 3ARFD 4F58L 2JELH 2R0LL 1XF1A 1CD0A 3UZEA 1D9KB 2EDXA 4Z7VA 2R2CA 4YHOH 2OR8A 2QR0A 3O2DH 5BRZD 3IDMB 3WXWH 1UACH 3N85H 4UOJA 2IH1A 4GAYB 3GK8H 4HV8A 4M1CC 3WEXB 3TIEB 2CRIA 2DLHA 5I18L 3U36B 3KPOA 2DQFA 4RBPK 2FB4L 4NQCE 2ICEA 1IBGL 2RAMA 1GIGH 4YX2L 3WE6B 3ZYZA 2AS5M 1IGCL 1CFTB 5F7MC 1KBGH 5GISL 4XI5D 2IJ0C 3CLEH 4M7LT 4XPTH 3PIQB 4JRYD 2DJSA 2CKBH 1FO0L 1TITA 1QFUH 4MMZC 2APWA 1CICB 3KPQA 4MA1B 1HWHB 1MWAH 4HFWA 2P45B 4OF6A 1JGUL 4KAQH 4DW2L 3P4NA 5C9KA 1S5HB 3GSNL 3K4AA 1QFWI 5ALBH 1CK0L 1G7JB 2B5IC 5E94B 1HQ4A 4NUGH 4XXCA 1A4KB 4Q74A 1F3DH 5DD6B 1PZUB 4HF5L 3WXWL 4I3SH 3RWDA 5F71A 4OZIA 3L9RA 5ISZA 5LBSL 5IBLC 5GZOD 1EERB 2X42A 5CFHA 2XG5A 5E5MA 5IR1B 3ROLB 1SEBA 3REWA 2DQEL 5DS8A 3I6GA 4LPXA 4P9ML 3DV4A 1RZKH 5JLZB 2APTA 1VEMA 2VZTA 2WW8A 3IS0X 4YO0B 3KGRA 4NNXA 1OGAE 4TUKL 4QRPB 4R90H 2VR5A 3RJDA 3PV6A 4LPCA 3WIHL 4HC1L 5HDBE 4Z9KB 2DQTH 3JWOC 3C5ZA 4M93C 4C59B 5I76A 1S7QA 1CN4A 1XIWB 3VFRB 3G6JA 1EHXA 1E28A 4IHOA 4XX1E 5IB2B 4PY7A 4K8RH 2IGFL 1ROWA 4IRSA 1KCVH 4MQTB 3NPSC 2Y07H 2VH5L 2YPLB 1EVUA 2R9HC 4N0YH 1UZ8B 3P0YH 1EHNA 1A6UH 1XGQA 5FUCE 1U9KA 4YXLH 2ZG3A 4GAGH 1T6WA 2MHAA 3D9AL 5IW1B 1IQWL 5GJTL 3ZE0E 1MJUH 4DCQA 2JIXA 4LNRB 5IM7B 1CGTA 4G9FD 1AO7D 2D4FA 2GTWB 2NY3B 2IQAB 5E5UB 4LOUC 2DKUA 1INQB 5JMRA 4HMEA 4X6DA 2NY4B 3KJ4B 4LLMA 3RL1A 5KVDL 2ZZUT 4AQ1B 3G04B 3WNPA 3WHE1 3PNWB 4JFDA 4K7PH 1NAML 4Z7QE 1CU4H 3U9PH 1FPTL 1QKZH 3CGTA 4PY7B 3U7AA 2VZOA 2ID5A 4A2MA 3P4MB 4OCXL 1HHIB 2OZ4A 1OGAB 3FT4A 4HT1L 3HE6C 4NNYB 3FAXA 4ZAKA 3O3EA 1OAUH 2EEDA 3QJFA 2X41A 3JBG7 4XP9L 5GGSB 2AABH 4E41A 5TF1L 1BEYL 4LFHG 2IANE 3GSXA 1HQRB 1X5GA 5GGQL 4ONGH 5JW4Q 1FFNB 4XPGL 4J3SA 3IDIB 1VEPA 3UTOA 5T3ZL 2PW1B 2DLFL 2HKHL 3SE4A 5HYSG 2IFFL 2NY1D 3DV4B 2J8OA 4K2UH 2OXHA 4YWGH 1CLOH 4AT6B 2VDKL 4J4PA 1OAZH 4OLYL 4QHKI 1IAKA 1FL5B 1T1ZB 1HCFX 1CD1A 2Z35A 1KULA 2XV6B 5FGRA 3MTRA 3DMMA 4KGLA 5E6IC 1KN4H 1ZLSH 2IAMB 5F70A 1WAAE 2P5WE 4PBXA 3L9RB 4PB9L 1CGXA 2UVEA 2CLRA 1MRDL 1OGTB 4Y5XC 4HUUB 5T5NF 1IQDA 4KTDH 3MLWL 3QG6B 5KSVB 3OAZK 2I26N 5GPRA 2J8HA 1EK3A 3ZDXE 3QEHB 1IL1B 4F7PA 4HJ0D 2OL3H 5DFWH 4OJFL 5LGHH 3L3JB 5EULV 2GJ6B 4C4KT 4N0UA 4KK9D 4Q7DA 4N8VG 3L3OA 5DVLA 1VPOH 4MLIA 4NQEB 1WJ3A 1EFQA 1X5HA 3T0EE 4FQCL 1XAUA 1CL7I 3NFPB 4RGMC 5AG9A 2XN9B 3AU1B 1VPOL 5FYKE 2VDNL 1PSKL 1LE9B 3SKMB 2R29L 4KUCF 3RDTC 1CFTA 4P5MA 1K6QH 3HRZB 4IJ3C 2UWEB 1JHLL 1CDHA 1T5XA 4JRWA 1XR9A 3QYCA 2EC9T 1EEQA 4WHCA 4O2EA 4RWYH 3GRWL 2BXYA 4MQXD 4UB0H 4PGBA 1AR1C 2X44D 4G6FB 4FQXA 2EH8L 3KPLB 3DYMA 5D2LA 5D9SB 1GZPA 1D9KA 1DZBA 2FJHA 3IDXH 3NGBC 4KI5D 4LCIL 3EAKA 3V5HA 5FGCE 2AKRB 2EDQA 1T4KB 4HPOH 2ATPA 2J5LC 4L1HA 5E2TL 3CAFA 5AUMA 1HXYA 2NR6D 3K74B 1KXTB 1P2CA 1KIRB 5IUSA 3MRCA 4PG9B 4WUUD 4Z5RB 2KQMA 1PEZA 5FHBL 3IKKA 1EVTC 1XH3A 2Y6SD 5GHWH 1LO0L 4KRPC 1QSEE 3P30H 4OLWH 2YMXH 4GXVL 5C0IA 5BV7C 4YDJA 4PGEB 5FYKD 3TH4T 3QRGL 5IJKC 1KJ2A 4LVNB 3MLUH 1L7IH 1XGYL 5E8PB 2P1YA 4NO0A 2C1PB 2H26B 4UT7L 3RGVB 5JXEC 4YE4L 3S35H 3NBNA 4FQJH 2FIKA 1FN4B 4N8VA 5E99L 4MXQC 1IEAA 4ERSL 1B90A 4X99A 2UVFA 3TNNB 1IC5L 4AH2B 4I48B 3FQUB 4OFIA 2OZ4H 4HKXA 1GOHA 5DJCB 1G0XA 4M9OA 5F7UA 3RWCA 4R96B 1T2QL 2DDQL 3G5YB 4I0PD 2VIRA 2XQBL 4KK8D 4UOW1 3ULUD 1TQCB 3ULVC 1H5BB 4IMLA 2FH8A 1VGKA 1MUJA 5E1AA 2JCCB 1AHWB 3SGKA 5IWLA 2CIKB 1KACB 4JGJA 4O51B 5C0JB 3VFOB 3F5WA 1M7DB 2H32B 3QUMA 1BJ8A 2DB8A 4POZD 1T22B 5TH2A 3C2SA 4JM2F 3MRKA 5EU5B 2EICA 3LPFA 4AYFA 3BGFC 3TVMC 4PD4K 4MLSA 5IF0A 2KH2B 3RNKB 2J2ZA 1MCQA 2VDOL 2YPKB 1JNNH 3BP7B 4H26A 4MJ6B 3VMNA 1BPVA 3W39A 3WIHA 4DGIL 4JAMB 3ARBA 1GOGA 4QT5B 1NGQL 3HHRB 5DRWB 1K8DB 4PJ9A 4GKOA 5T3XD 3ZKND 43C9A 1LILA 1KJVA 1I3GH 5JPNB 2AEIT 1FVEA 3IJHB 3ZKNC 2WINB 3CH8A 2DQCL 1FHGA 3B3IB 3SJVB 3IVKB 1MFEL 4ODVH 1A3RH 3L5HA 5KW9L 1U93B 5F1SA 4GRMB 2HFGH 1MREH 5E70A 5IVNA 1OTTD 5DF0A 1XZ0A 2XN9D 3HFML 3VGGA 4BFGA 4QRSB 1I9IH 4JFHD 2NTFA 3GMMA 4YBQC 1HNFA 3O6LH 4I2XA 5D6CA 2YSSB 1F5WA 4U7SA 3T4YB 4MJ5A 2D3VA 2JJSC 3WO4B 4G43A 4F7TA 1X44A 2Z0BA 1UC6A 4A6YH 3ILPA 1TVHB 2QQLH 5DR5H 3ZKSD 2FEDD 3D18B 1B88A 1VA9A 1YJDC 4JFOB 3RVVC 1PEWA 4NC1E 3NH7H 1EAJA 2HAZA 4GRWE 3V5KA 5JQ6H 2Q8AL 4XVUD 3VFVB 3QCTH 1FH5H 4F7EB 4OM0H 4GMSL 1IGJA 3O2VH 1S5IH 1ACYL 5TE4H 4JFED 1UYWH 3INUL 5C6WH 2W60B 4GRLC 5MERB 1Y0LA 3QQ9D 1CR9L 3S6CA 5HPMA 3VRJB 2I27N 4DVRL 1YZZA 4XB7A 2NY4C 2OZ4L 1OAKH 4FTVD 4OD1H 3SGEH 3OSKA 5IEKB 4EDXB 3QUZB 1G6RA 3U9UA 1JPTL 4ODSH 3WD5H 2OMNA 2ZUQC 1I1FA 3BYYA 3N1GC 1N5YL 4QLRA 4ZQKB 3CVHH 1JHKH 1FNGA 4Y1AA 3VXRE 3A6BH 3BAEH 1HEZB 5KZCD 1A7BA 5D6CB 4Y7MA 3OKDB 5JDSA 2V2XA 5D1QA 3MMEB 3MODH 1NFDE 4LSDA 2QQNH 1NC2A 4K9EH 5F9OH 1LE5B 4DZBA 1MQ8A 1G7PB 3PDOA 4NWUH 1Z3GL 2FBOJ 4Y5VC 4HC1H 1YQVL 4IS6A 3HE7C 4J4PC 1FZOA 3LVEA 3GHEH 1K4CB 1FG2A 1EEYA 4QRPE 43C9B 1BBJA 1MEXL 3C87A 4O58H 1Y6NR 4LP4A 1IGTB 1RIVH 4LVHB 1N8ZB 2BSRA 3S4SB 1TZIB 4NHUA 5CEXB 4Z8FL 1AO7B 2IAMC 3PWVA 1SMAA 4MJ6A 5JHDA 4L4VA 4QGYA 4R97B 3MRNA 1J0ZA 1MPAL 3QNZA 4PJGA 5HGDB 4K23L 3MREA 4X80L 4P5TC 1FVCB 3QDAA 5B22A 1YMME 2RQ8A 5I8OL 4JO4H 4M1DL 4M5YL 2VITA 3KR3L 1Q9OA 1BBDH 1UQSA 3BEVA 5HSFA 1YY9D 3HPLA 1D6EA 1I1AD 2AK4D 3ET9F 2J1KA 1MWAL 3UJJL 4HUKB 1M6OA 5EOTA 1LO3L 4M00A 3EYFB 2A6KB 2OL3A 1F4WL 5L88L 4IMLB 1OPGH 2XQYK 4C83B 4DTGL 5JNYA 2CO7B 2CDGB 4LCYA 4GKZB 3R06B 4M6NH 1P9MA 3SDDC 2IADA 3RWEB 4FNLH 1AGEB 3KPRA 4G6KL 4DOHE 4M7LL 3GK8L 4D8PA 2DKMA 1Q9KA 3TT3H 3MA7A 5EBMB 3QCVH 3C6SA 1DSFH 1NL0H 1A4JB 4LFHD 1ODAA 4PP1D 2HVKB 5FEBA 5ESQA 4XCEB 2R2BB 3FTGB 4P23D 1KJ2B 2EH7H 4JG0H 1OT1A 3ZLQC 3SDCD 3U83A 3CXHK 4LSSL 3KPPB 2A0LC 3TVMA 1R24B 3W81A 5J9PA 3KYOA 4HWBL 1CTNA 3UYPA 4U6XA 2ESVD 5BVPH 1CXFA 5DMGD 4CU6A 4PJEF 5FIEA 4UQ2A 5EZOH 1W8OA 4KJYB 3H0TA 1CICD 1RJLA 2EXYC 1TJHH 4PV9B 5GISH 3SKOB 3MODL 1IGIL 5HHOD 1N3NB 4X5WA 5CBEA 1A3LL 1FAKT 3WMSA 1INDL 4JPKH 4GMTH 5L88H 4U1LA 3R4DA 3FT3B 4JREB 4L8DA 4GBXD 1YMMD 4FQXB 1T5WB 2XY1A 1XCTA 1SYVB 1IM3B 4XVJH 4P2QE 4JHAL 4ESKA 1ZXQA 2CO6B 2ORBL 2GI7A 1OL0A 1T5XB 5I1LB 1BQUA 4D9QD 5BCAA 4EN3A 4MJIE 2DIJA 4WNQB 4LIQL 4UDTA 4ZUSB 3LRGA 4XPHH 5JZ7C 5KG9A 1CL7H 5MEOB 1CWVA 3BUTA 3KLAA 2Q86B 5L2KA 4IDLA 4U6XB 3KYOB 5CEZE 3V6OC 3GSWA 2R1YA 4XPHL 4OJFH 4N5EC 5LGHL 3DXAD 5HGAB 1ND0B 4MDJB 3OR7B 5F3BB 5TF0A 4LDLB 4ORGA 1YPZA 5AG8A 2VUOA 3FFCE 1A02N 6FABL 3IFNL 5DJ6A 3FAWA 5CINL 2X70B 1L6ZA 4NQUA 5HHOE 1U95B 4Q9QH 3NCCB 1DN0B 4G8IA 2ITCB 4X7SL 1TPXB 3BP5A 1FGVL 1LP9A 3MRPA 3U0WL 5B39G 4LVOC 3V5DA 3KWWA 3QWOA 1FGVH 5KSBF 2IAMA 3QB7C 5HJ3A 3VGEA 4NYLA 3VFSB 4KRPB 3TO4C 1SHMA 1OVZA 1QSZA 3GJFB 3MRLA 4JRYB 3UC0H 5DJ0B 1LHZA 3WFZA 5FOBB 2H45A 4G3YL 3I85A 1KTLB 1OW0A 1HHHA 3CU7A 3QZWG 2HA1A 2EDOA 3T0BA 4KDVA 1QSEB 4PTTB 4LRNH 2ERJC 3VE0A 1LO5A 1U6AL 3CK0L 1JPGB 1M6OB 5EOTB 2G5BB 1HQRA 1KB5A 2NY0B 5FUOH 1D6VL 5D7JC 4PJ5E 3BKYL 3QIBA 4YUEH 4TVPD 4EDWH 4BUGA 4APQB 1WK0A 4Z76A 4PRIB 2R1WA 3UTPD 4OSUH 5F8QC 1BFVH 1T80A 4C57C 3D6GA 5C07E 3ARFB 5FYLD 1OD9A 3QRFM 1T7YA 2AJSH 4GO6B 3TBWB 2AERT 3MRNB 4NDMA 3G6JE 3PHSA 4X83A 1IKFH 2CRZA 5CJOH 4OLVH 1MCHA 3K80A 2PN5A 1TTFA 4U1KB 3TFKC 1Y18A 2CH8A 3SY0B 2OP4L 2X1XR 4A6YA 4QHKJ 1XMWA 2Z92B 1K4CA 4JFEA 5HTSA 4S1DD 1A6VH 3MPCA 3GGWA 3QUYB 5F1OB 1U91B 4R3SA 2E9BA 3W5MA 1LE5A 2FHBA 1BFSA 3D39B 2BHZA 3RTQB 1WWCA 1Q94B 4MQ7A 4KJQC 4ZFOB 2BVQA 3BHBA 3G5VA 5E2TH 3VFWB 1FORH 5IQ9A 2ZPKL 2FIRT 3TIDB 5CWSA 4OFYD 4HS6B 1BFVL 1V8HA 4OCLC 4HKZA 3UZQA 1YYMH 4ELMA 2K9UA 3KYMB 3WLBA 1MCKA 2FSEA 4XAWH 1E6OH 3ABZA 3FRPA 4NKOB 4JR9L 4EDWL 4Y5YA 3WLBB 4L3EA 4PJAE 3MBEA 4PJAA 1DN2A 2RR3A 2NYYC 1F8TH 3LQZA 1MWAB 2Q6WA 3B2VH 4BQCA 1F4XL 2O61A 2CK2A 3CDCA 4I9WE 2IANA 3MLTB 4HGMA 1BP3B 2X4SB 4ZFOA 5I19H 4M1GH 4MWFB 1MQKH 2YRZA 3VW3L 2YN5A 4P2RA 2QV2A 3BSZH 1A6VL 2MNUA 1BD2A 2VDMH 4XGZA 3SE4C 5MHSD 1AY1H 2ZUUA 4YDKH 5EPMB 3F58L 3LN5B 3V6OE 1AKJD 2IPUG 5BMFL 5DLML 5K9KA 3VFVA 4OCNC 2HT4D 1MJ7H 4JFOA 2ICES 1J8KA 2R0KH 2VXTH 1A1NA 3BVNA 4OV5A 3MJ9H 3MR9B 2D7TH 3DYPA 1BWWA 2UZIL 4HUXA 4OZGE 4HXBL 4MDIB 4P46C 3CMGA 5E4EB 5FA4A 3WNLA 4NDMB 4Z7QF 3L3HB 4M02A 5E94A 3OJDA 3ULVH 3GMMB 2OL3L 4X7FC 5J06A 4HXBH 3VGHA 1AKJB 3U79A 1ZT7A 4DK6A 4HFWB 1NCDL 1UCTA 3L5XL 5INDA 3RKDC 1I4FB 2QQQA 1I1AA 1VFOA 5FUZH 1E4KA 4I77L 2B2XH 1A0QH 3ARXA 4D3CL 4XVSL 1OP3H 1HSBB 3CMOL 5JPNA 4WRLA 1HYSD 4N68A 4RGOH 1T66D 1KJVB 4M7JL 1LO5B 3RWIB 3VXRA 3WE6A 1S9WB 3TZVD 5EIIA 2CXKA 1IMHC 4CUCA 4OM0L 5L2JB 2BZDA 2ED8A 1C5BH 3I2CH 3OKNB 4KQ4H 4Z7NE 5CD3A 1RD6A 4PJHB 4NZUL 3QDME 4J12A 1VACA 3RNKA 2IH1B 3PWPA 2BVPA 3IETB 1MFBL 2AEPH 4OZFA 3CFEB 3U82B 4HMCA 4OZGB 4OCWH 4K3GA 4Z77B 3IAPA 2Y36L 3B43A 5FDWB 2J8UE 4GXVH 4RMWA 5IHBA 1N6UA 1QZ1A 4MNQB 1MHPH 5EUOB 5K9QG 3CFCL 3OGCB 1X5FA 4RFEA 5DQDH 5DJ6B 2X4OB 2QQKL 3E6HB 4HS3B 5I75C 3IF1A 1DBKH 3P77A 4QHLA 5D7LA 3QNXA 1A9EB 4OCRH 5IV2B 4WVRA 1S78C 1H3GA 2VL4A 4UV7H 4QNPE 4R96A 5DJCA 4XWOD 4TTDC 3WFBL 1SM3L 1OF2B 1V7ML 1L7TL 4ZO6A 5ID1A 4DQOL 4I3GA 1R3KA 3ZKXB 1CGVA 2E6QA 4FQXC 1Q0YH 1G9NL 4D0DB 3TZVC 1NEUA 1CFQB 4NQXB 4X9GA 5INCB 4H5SB 3QWRD 5A16A 1QSFB 1K9TA 4QGTA 2HTKD 4UIKL 4QRUA 1DUYB 2OTPA 4JY5H 4NOFA 3RGVA 1RFDH 2C1PA 2H26A 3JXAA 1JHTA 1GC1H 1T5WA 5BV7L 1U3HA 1QBMH 1V7NH 5CMAB 2DBJA 4JVWA 4KY1H 1A7QH 1YY9C 2GJ6D 4G6AD 4NC2B 3ARDD 1P53A 4NUJB 4QXGH 5L6YL 2YD3A 4JFXA 3RI5F 2AXGA 4RX4D 5DDHA 5EU3A 2EZ0D 1J1XH 1V5JA 4OCSH 3QFJE 2IG2L 4KRPD 2XTJC 3OTTA 4YHMH 2I9TB 4OZFG 5AUMB 4WI2A 5HDLA 4R90L 4YGVA 1BGXL 4WI4A 5J6GB 5KSBA 5IFJA 3BQUB 1R24A 1JNLL 1PKQB 4K9EC 2FJHB 5HGBA 5J1AB 1ED3A 1P84K 3J8F7 1Z3GH 1SEQL 1DLFH 1WFTA 3MRMA 2E6PA 1CFNB 1QVOB 3IT8D 2DMCA 3VFTA 3HZYB 1TVDA 2BVPB 2G9HB 2YPVL 4FMFA 4EOWL 4KROD 2FD6H 1UB5A 4JHZA 3FO2A 2HVKA 1BLNB 1A4JA 4PRIE 2EE6A 3VA6A 3TT3L 1J1PH 1IGFL 4TUJA 5D2NE 3C8KA 3Q6GL 1LO2H 3BD3A 1RIUH 1F90H 4ZFGH 3VFUB 5MENA 5IMMA 3T65A 2VISB 4NQDB 4Y0GA 4DW2H 3P11H 3FMGL 3BPOC 3ZKXC 3UCRA 4PJ8B 4PRPB 3BUYB 3B8SA 1SJHA 2ZUVA 4XCNB 3QT2A 1LDPH 1HYSC 3C6LD 3HC3L 2BOBB 2ZNXA 4CMHC 2XKNB 4YHLL 4HW6A 3F12A 4NJAH 2EYSA 4FQIL 5HHME 5K9QI 4OKDA 1XIWD 5JHLH 1B2WL 2EO1A 2MCG1 4J8RA 3ZT5A 4EVNB 3CC5A 5DGRA 1KBGL 4KKBC 2AJUL 2PO6D 4H0HB 1F11B 3MGOB 4QRPD 1T7XA 5GSRB 4MA8L 4PV8A 4CJ0A 1YEEH 4WO4D 4HH9A 1KELH 4IRSD 3OXRB 2R8SH 3ULSA 2E27H 5T1MA 1FNHA 1YEEL 1NDMB 2DICA 3MREB 4BSWB 4DVRH 5HGDA 3GIVB 4M7LH 1DCLA 4Y2DD 3HC4H 5DJXA 5EPMA 2X40A 3WKNA 1MJJA 2VXSL 2NY3D 5EZIL 4M6OH 3PJSA 5F7FA 3GI8H 4G7YL 4LQFL 2YD8A 4RMQA 2AK1L 1CDJA 1ZVHA 2OYPA 1YQVH 5BJTA 4OD2B 4UBDD 2VDLH 1OHQA 3SHSA 5FA3A 4A6YL 3PF2A 4WGVB 5BS0E 3FT4B 1QR4A 2FRGP 3C6LC 1NAKH 3PDGA 3WIIH 5E8DL 2DQJH 2AXJA 4ELMB 4XVJL 5EU6A 4JY4A 4ZAKC 2N4IA 3KPSA 5C6TH 5AEAA 1U8PB 4PJDE 1WTGT 2YK1L 1X6NA 3T4AA 1U41A 2F53E 3G04A 3OL2A 1XF4A 2FX7H 4BKLA 3TO4D 1NAMA 3ZE1F 4ZQKA 1S7XA 3AY4C 4PJ7E 4GLRI 4NRXB 2AV7B 4PJ5B 1KIQB 4X5XA 4O58L 3DLQR 3DXAA 1WLHA 3T3MF 3K1KC 4KDWA 4JDZA 3SY0A 4KRNA 4PGZA 4TPRL 3GSRB 5MHSE 4XVTL 1BD2D 1J87A 4WGWB 5IBUB 4PGJA 3UTSA 2C5DC 4N90E 5GRUL 1S7VB 2C1OB 5TGBB 2EDKA 5FYLH 3C9NB 1IGJB 4HKBB 1ZVYA 3D3VE 3TJEH 1TCRB 4D94A 5I6XB 2NY5C 3AB0B 1CYGA 3LN9A 5JORB 3DX6B 3CCHB 3O6FC 3LB6D 3ULSB 1M7IA 3OXRA 4HX1B 3QI9D 2HJKA 4OUOA 1E28B 4MZ3A 3T09A 2DWEA 1HINH 5LQBH 1MRDH 4BQ9A 1F11A 1DBAH 5I74B 4XNQA 3GSVB 1IAMA 4J8RB 1GGUA 1WTLA 1OLLA 3RVWC 3DUHA 3FQTB 1TZHA 3QIWB 3TO2B 3TN0C 1UZ6F 3FCTB 4M48L 2FL5B 4YC2C 4YO0A 4GMTL 4OZ4B 3TT1L 1V3KA 4GUPA 1J18A 3AMKA 4OB5H 3VXOB 4HGWB 4DWHA 1YUHB 5CGYD 2HFEB 4ISVA 2R8SL 4J3OC 5JA9A 1A64A 4HJ0C 4H1LA 1QRND 1Z0MA 3HAEG 1RSFA 1QR1B 4KKLC 3T65B 4JHAH 2KUTA 1I3VA 4M8QB 3ARQA 2OJZL 1AXTL 2HT2D 4HH8A 1I9EA 4Z95L 3OX8B 1D9KC 4ZPVA 5GS3A 2HRLA 3FZUC 2AJSL 5AZEH 5DD3L 1FL6A 4JG0L 5F7EL 4X6CE 3HI1A 3VFTB 1QVOA 4CRPA 5ITFB 3H3PH 1DFBL 1U3JA 1RVFL 1QEWB 4HS8L 5DQJA 1NPUA 3H9SE 3KG5A 1QLEL 1T22A 2P7TB 4LIQE 4BH8A 5IT2H 4K3DH 3NPSB 4N8CH 2DI8A 4YK4C 3SE9L 2FJFA 5BO1H 1H8SA 1K5NA 2J3SA 1AHWC 1MUJB 4PLKD 4WFHD 3O6FB 3HG1A 3IDUA 2Y06H 3ZKQD 1AXIB 3QWQB 4RFOL 4AIZB 2RCSL 3ARTA 4LAJH 4M48H 1A6ZB 1BJMA 4FQPA 4D9LH 2F58H 4WV1C 1FQ9C 1WZKA 4GAYA 3BW9B 3SQOL 1E6OL 1KFAL 1ZHNA 1YECH 1AGFA 1F02I 1RZ8B 1B0RA 2UUDH 3D69B 3LKPB 2DQGL 1K6QL 4JO2L 2LAAA 3KAAA 4UTBH 3TBVB 3NCYP 4BELD 4LCWD 2XICA 3DOSA 5D1XD 3OG6B 1NUGA 3BWAA 1PX3A 4YHIA 1JGEA 3R1GH 3EHBC 3U30B 4X6CB 1ZMYA 4NPYA 5C0GB 4TQEH 4I18B 3NIFF 4UZGA 3JSSA 2VABB 3C5JA 1J0KA 3R1GL 2PNDA 2LU7A 2CSPA 1RJYB 3SKUD 2H8PB 1A3QA 4OLYH 5E0QA 4BZYA 1RZJC 4G3YH 4PJEA 5LQBL 2AAVA 5DT1H 4HJJH 3QEQA 1Z2KA 2UZXB 3GBMH 3TGXA 1TVBB 1P2CB 4I3RH 5CUSH 4LRIA 2H2SC 3B9AA 3WNOA 4JY5L 3B2UD 3U6RA 4YDIL 4U33A 5KTEH 5D70L 3PWLB 3KNBA 1XF2A 4PB0L 5A40E 4QCIA 4XPFL 3ARFC 3MA7B 4YDLC 2H3NB 3HZKA 4ZXBD 3STZB 4ELME 3T2QA 1ORSB 4Y4HB 3GKWL 3PWPB 4XP6L 2UY7A 3RWEA 1S8DA 1EFXD 3SDYH 4O5LL 2UWEA 3EZJB 5C0BE 3VXSD 4DGVL 4L4TB 1R5IA 2WMPA 2BX5A 4JLRA 1IAOA 1X4YA 3ZE0F 3RY6C 2QHLA 5C09A 2A6KA 5SWZB 3EYUL 3IKCA 2CUMA 2HG5A 3WUZA 1D6EB 3MRDA 4KI1A 1WFOA 5EUKA 4E41E 35C8L 2D0HA 4P57B 1S9KC 3CIQA 4HPOL 3R0NA 1Q9OB 2EDWA 1RZFH 1JTTA 1H3VA 1UWEH 4U6HB 2FD6L 3SDDB 5I1JH 3QJHA 3CVHL 5IHLB 3TYFB 4F7PB 5SWSB 4YDVB 2NY6B 1A14H 3ZL4L 2F74B 3QNZB 4P9HL 2VLJD 3O3AB 4PJGB 4FZ8H 1FAIL 2ZKHL 5JHDB 5IKCB 4L9LA 4LDOB 3EYOA 1X5ZA 1FDLH 5CD5C 3AY4A 3HLAA 4WDIA 3DMMB 3VD5A 5F7KC 4X7EC 2E3VA 2ATKA 1CD1B 1KEGL 4WUUB 3LV3A 1FL5A 1T1ZA 3HFMH 1NANI 3DHMA 4MCYA 4WFFD 3N06B 3LV3B 4IRJD 4X4YB 2YD1A 5C0BB 1IAIL 2NY2B 1G7LA 2PXYD 4RZCB 5D7IE 5I1EL 3SGDI 2WIIB 1MFAH 4EI6A 4MWFA 3V4UH 3PABB 3FKUS 5IOPA 1FFNA 1JFQL 1I7RA 3PG2A 4M4PA 5L0QB 3D85A 4DUVA 1UWEL 2V5TA 4F15C 1QD0A 1K4DA 1YJDH 4HWZB 5FYJH 4NNYA 1TTUA 3QDJD 1P9MC 3SDDA 3LKOA 5IGXH 3MC0A 1UA6H 3QCUH 2I5YL 1P7QD 4WW1B 4ZUUA 1G6RL 4LVNC 4HAFA 2D7TL 3ARSA 4M5ZL 4CU7A 1HXMA 3QCUL 2D7NA 3TWCH 2CDEB 1L7TH 4L29B 4DKDC 3MV8A 5IQ9B 4NZRH 3G5VB 1K2DA 4L8SB 1AQKL 5TE7L 2X4TB 1B4JH 3QUYD 5CJQL 2W60A 1IAOB 4C56E 15C8H 5GGVH 4JB9H 3VWKC 4NN6B 1OM3L 1LNUA 5IM7A 3VXTB 4KHXL 3NIDE 1IC7L 2AJ3B 3S34L 3W0WD 5HHMB 1FCGA 2NXYC 2GW5A 3RL2A 3QEQD 2X1PA 4EUPB 1G9MC 3RVXC 4OM1L 2YOCA 3U46A 4XNZB 3OAUL 5DWUH 1NGPL 1MCEA 1U8IB 3J7HA 4M8VA 4Y88A 2E6JA 1NEZG 1HOCA 3QHTC 2RGSA 5EOCJ 5MEND 5GS0D 3DVGB 3FO0H 2MQCA 3ELAT 2FO1A 1PG7L 3H42H 1CD9B 1T89A 2Y23A 4JANA 2FWOB 2H8PA 1EDQA 1IC4L 3CH1A 1F13A 5GGVL 4PJ9D 1JGVL 3QIUC 1JGEB 3ZTJG 4QHNA 4OIAA 4C56D 2BOCA 5JR1H 4KU1A 3BP7A 4A2LA 2PR4H 2EDTA 3MJ8B 3REVA 1CI5A 4K94H 1CLCA 2NY7H 3V0WL 4R4BA 4OF8A 4NYLB 5DO2C 1IGML 1ZS8A 5F89A 2XNAA 3QFJB 4JZNA 2BNRD 2VC2H 3GHBH 3MV9E 2PXYC 5CLTA 3LS4L 1Y6KR 1MCBA 2ICWJ 5DD6A 5D6DC 5B3JF 1A4KA 3F6IA 4L8CA 2ITCA 3HNVH 4XHJD 3F5WB 1RURL 4XNUL 1DUZB 1JRHI 3X13B 5C0AB 2CIKA 2XXMB 4JM2A 3LSOA 4MD0A 4N1CA 5CZXC 5E2UH 3B4NA 3ULUH 1DQLL 2V17H 3KPQB 2ITDB 3GFUA 3UXFA 3SO3B 1AGDA 3RNQB 4XBGB 1VB9A 3VWJB 2VLKA 4KXZI 1I3GL 4P3WA 5I1AA 3NN8A 1E6JH 1QYGH 2JLLA 3JZ7A 1A9BB 5ACZB 3FFCB 2C3VA 1LGVA 3D9AH 4MMXC 1AGBA 4L4VE 3GJFH 1HHGA 2EXWD 2E8YA 2QQNL 1OSPH 2V2WA 4CVUA 1X5AA 3NCYS 4GQ9L 2EXWC 2LE9A 1JYWA 2QLVB 3IDJA 2NW3B 4X4ZA 5I1LA 4PJFF 3TIEA 3G08B 5F7HA 3HKFA 3OX8A 1UACL 1BZ9A 3QQ9C 4B7IA 2DWDB 4KKAC 4Y8AA 4FNLL 1F2XK 3X12A 5I1IL 1WGOA 5JOPD 1UEYA 5MEQB 2AEQH 3FT3A 4OFPA 2APXA 4LCWA 4YDJB 4LSUL 5F93C 5E6ID 2F53D 3FB6A 5EUOE 5EOQL 1J0JA 1JIBA 4KJWD 1NC2D 3MCLH 2JK5B 1U8QA 4QHNB 3L3DB 5IB1A 1TZHB 4BJLA 5AD0B 3INUH 4F7CA 5EA0L 3VH8G 3ROOB 3VWKD 3RU8L 4Y16B 3DGCR 3QDGB 2Z4QB 1OSZA 1TZGH 4P2OB 5D1ZA 1SMOA 4DUWA 1XF5A 5ENWB 5D2LB 1I9RL 4X80H 1S7WA 2BNRE 1JNJA 4LLAA 1UKTA 3KHQA 3FFDA 2NX5A 4XMKL 1WWBX 1T1YA 4PREB 4PY8I 1I1AC 5BS0B 4WY7H 5F9AC 5F7LB 4Q9QL 1CK0H 4OZHB 4X8XA 4XXDB 4ODXA 4GJTB 3HRZA 5BO1L 1YEJH 5LGJA 1CICC 2EXYD 4K94L 4ZPTB 3WFEL 1AGEA 2F53B 4GW1A 4NC1C 3VFPA 3BKJL 2QADB 3MLSH 3U7WL 3KXFD 1EEZA 2AV7A 4GKZA 4PJ5A 1EHLH 4CDGC 2XKSA 3WFHB 1C08B 4P4KC 4NZDA 4UIMA 4BKLB 5FM8A 4P4KA 3KJ4C 1NFDB 4PR5B 5HI3C 3BGAA 3HAEB 4GG6B 4C56A 5IJKA 3HC4L 4PJBF 5SV3A 2W0FB 2YBRA 4C4KO 2WWKT 1Q9LB 1OGTA 3EZ8A 1EBAA 3VU2A 1IARB 5IFAH 1U8JB 1FIGL 2Y07L 4U6TA 1FVCA 4M1DH 1WV7T 2AJZB 3RWHA 4OD2A 1SYSA 3GSQA 5B38G 1LP9F 1QTYT 4DKEL 4UINH 4R4NC 5DJYA 3EJYD 1J11A 2W1NA 1WZMA 1CF8L 1LO3H 1IGTA 1PSKH 2YN3A 3QA3A 5JMOC 5DJYB 3U7WH 1F4WH 4YIQB 5DJXB 4LPTA 2GAZA 1YNKH 1TJGL 4NKMB 4X4XA 3MV7E 2P24A 3W82A 3RVXD 1IBGH 2P5WB 1GGYA 3OJ2C 4XRCA 4JQIH 4FFYH 1UM5L 1JN6A 2MQ3A 1H9VA 4Q6YA 5HHOA 4PJFE 3WJLC 4EXPX 4YHNB 1S7UB 2MOVA 4M43L 1DQMH 1KB5H 4U3XA 1EO8L 1FYTD 2W0FA 5A3IC 4GBXA 3EO0B 3HAEA 4RDQF 3GBNH 3HG1E 5DEZA 4EKXA 1OY3B 2Z91A 2DQTL 3L1OL 3RZWA 2H9GA 4JCMA 4GXUN 2FATH 3RZCA 2YKLL 2HMIC 4YQXH 3T0ED 2R1XA 3MBXL 4QEGA 1C12A 4KTYA 3SN6N 4WU5A 5HHVH 3P9WB 4CMHB 5C08A 3FQWB 3CDFA 1EEZB 5CJ5A 1QFWM 3CZJA 3TLRA 3ARED 3OHXB 3DPBA 1LO0H 4YC2B 1XGUA 1CTOA 4NBYB 3T0XA 2VB5A 5IMMB 5MENB 3V6FA 5BQ7B 1LEIA 1PQZA 4DKFL 4WI3A 3OXSA 1A22B 4PD4J 1YEHL 4KMLB 5H35B 4XWOC 5FHAL 3K1DA 1OTUC 1UKSA 3KJ6H 4JFQB 1ZLVH 5D7JA 5LCVL 2NYYD 1H5BC 4QOKB 5C6TL 5EZJA 1DBAL 1FRGL 1KPUB 2MWCA 1JV5B 1HSAB 4Y2OA 4ZS7H 5B38A 3K8KA 5J11C 2D0GA 1OW0C 5ALCH 1NFDF 3CXDH 1IAIM 1KPRB 3NIGF 3U9PL 4JPVL 1EV2E 5HHXL 5BZDB 3BQUA 5I8KL 3VXMD 2X89A 4XMLH 3CLFH 4KTEH 4NWTL 4RISL 2GTZB 1WQVT 1WITA 1MJ8L 1VFAB 1B3JA 4JG1H 5CD5D 5I73C 5ADOL 3F7RA 1NKOA 2RFXB 3UPCA 1FE8H 3L3DA 2F54D 3D48R 5IW6A 3BD5A 4XCYA 3JV6A 1YEIH 3HE6D 3B3IA 3SJVA 3I6GB 4ZS6D 1QBBA 4G7VH 5JXED 2B2XL 4JEGB 4I18A 2JKXA 4QRRD 2KL6A 4IRZL 4HCRA 2XZQH 3VGFA 3ARGA 3RWJA 1SQ2N 3FN0H 2EDHA 3L5XH 1H3WM 3CFJB 5I1HL 4LF3A 4RGND 1I7ZB 4H25A 2JB6B 1T83A 1NLDH 4GKNB 5DD0L 1JVKA 4JKLA 5L2KE 4UNUA 1CFQA 4NQXA 3IDYC 5I1GL 2XIDA 1B0RB 1G7JA 1F58H 1FZJB 3MRFA 4R6UA 3SDAD 3WUWB 1R3KB 4CKVX 1PD6A 43CAA 1S9VA 2CIIB 4HC1A 2X4QA 1IFHL 2Q7YA 4FQ2L 2WWMC 3NFSL 1IZJA 3HMXH 5DEGA 3PP3K 3QUKB 4NZUH 4XBGA 4ZXBC 2DL2A 2DQUL 1KCUL 4TRPL 2VL5B 3MRRB 3S37H 2AJVL 2X4OA 1R5WA 2XTJB 3E6HA 3QISA 5HXMA 5IBLD 4ODHL 4S2SB 4MD4B 4ONGL 1WAAF 4U1HA 1N4XH 2NNAB 5FECB 5JW3L 5DQJB 3LKNA 3L3IB 1A6TA 5DJDA 2XNAB 3QFJA 4JZNB 2WLYA 4TTDD 5T33H 3GBML 5BRZA 3NCJH 3OKLB 4X99B 4HWEH 3MV8D 2DBLH 2IH3B 2VQ1A 5CD3B 4O4YL 1I8IA 3QDJB 2EIZB 2EE2A 1S9WA 5EIIB 1ZAGA 4ZAKD 2BRRL 4L4TD 3UJTL 1AR1D 2IQ9L 3HN3A 1JYXA 4ZTPL 5BOZG 2HFTA 1I1RA 2DLGA 3PHQB 2B20A 1V3LA 2FWOA 4JANB 4KY1L 4DZ8B 4MJIA 4PP2B 1KOAA 1AH1A 2EDJA 5IW6B 3ARDC 5ECJE 1I3UA 1NEZB 1OTTC 2FCBA 1RFDL 4IRJB 4W4NA 5JQ6L 4FQQA 1VKXA 1AKJA 2D7OA 1JNHB 3V0AC 2P5EB 3AXLB 3FB7A 4PJDF 1T21A 3RI5K 4P3DA 2BCKA 5HYSB 1A7NH 1XGYH 3S7GA 3ES6A 1ULVA 3SE3C 1KPRA 4BH7A 3DTXA 4YK4B 1RZFL 4ZXBB 2E5EA 1UXWA 4TSCL 5B38B 1S9YB 4KMQA 3DV6A 1JV5A 1CLYL 1JRHH 1TCRA 1XT5A 1NMAH 4XHJC 3N9GH 1J5OH 1YEFH 4KROC 4J23A 1UG9A 4E42B 1D5BB 2ADGA 2CUHA 2ZCHH 5CHNB 3G6AA 1LDSA 4I0KA 2EYTA 1QSFE 3RVUC 3OHXA 3HR5A 1CR9H 1UH3A 1E4XH 4UI2A 2O5XH 2X2YA 3SDCC 4WWKD 2IALA 4L3EB 4WU5B 1NKRA 2GCYB 4M5ZH 4MNHA 2Y5TB 1A1MB 3L5JA 4UAOB 4H88L 3JWOL 1YEKL 1KLGB 5CGYC 4HWZA 1IL1A 2YC1A 4AIXA 3VDAA 5B3JE 3O8XB 3HZMB 3PWPD 1I7RB 1RUQL 3BHBB 2XACC 4HJGA 2WIIA 5IJVB 4S11A 4D0CA 4X7TB 1U91A 1AE6H 2D4DA 1T83C 4R3SB 4CN4A 5KVEH 4KC3B 1P1ZB 4MNGE 3X3FH 5BJTB 5FK9A 2EDBA 1ZHBB 5EDXA 1BZ7A 3SPVB 4ZFZB 3BDYL 4Y5YC 2FO4A 2OS7A 2X4PA 3HB3C 1EZVX 4GG8B 5F9WC 3CNKA 2DBLL 3QDMA 3GKZA 1A2YA 1MJJB 4MSWA 5FGBA 4PJHF 3MOQA 5A2FA 4ZNEA 1N59A 2WUBL 4U1NB 1GZQA 2YZ1A 4OZHE 4WY7L 4NZRL 5IEHB 3DGGB 5ICYB 2P8MB 3Q5OA 1FJ1A 4ACPA 4ODUA 3L3GB 2FYYA 1FYTA 1ZA6B 1URLA 4JKWA 4URTB 3MRDB 4K55A 4N1EA 3QIBB 5D2NB 4YEFA 3RIFF 1Q1JH 5I74C 1YNLL 3QIWD 1B9ZA 4P4KB 3Q1SH 1B0GA 3UTZB 4G9FB 1GGBL 3QSKB 4TN9A 1QSED 4QNPF 3VWKA 3MV9B 4I2XE 1JJUA 1R0AL 1FNSH 2BRQA 4X6BB 2V5YA 3VFPB 5C0RL 5D1ZD 3O6ML 2MKLC 4LLUA 4NRYB 4X8JA 4Y4HA 1CL7L 3STZA 1RULH 3MRIB 1RZKC 3QWOB 3C8KB 5HI3D 3PWLA 1CDBA 2DTMH 2VUYA 2BY3A 4OI8A 3LAFA 4F7MB 1MI5B 3PHOB 3RWGB 1UB5B 3MYZA 2DTSA 2A0LD 3FFDB 1IEBA 5HVWA 2NY7L 4L4VD 5EBGA 1KCRH 1TZGL 4AMKH 1L9MA 1WZLA 4KDTA 2X89D 2Y1VA 4G7YH 2EDNA 5IVZA 5DZNA 4WFED 2R1YB 3A67H 4HZAA 3OKKA 5IFJB 3EJYC 1ZLUH 5J4MA 1BQHB 3B9VA 2YZ8A 3QO1B 4RFNB 4QF1A 4UDTB 4X6CA 3BD4A 5CHNA 5IVXE 3SDXB 4H0GA 5EZOL 1TQBC 3O4OC 1NSNH 4M61B 2W9DL 3I50L 2EH7L 1E27A 1U92B 2A6JB 2DMBA 3GO1H 1XCTB 1MCOL 5E4IA 4YHKL 5IWLC 1QFOA 4KK9C 3S36L 4K7FB 2R15A 4E5XB 5T5FL 1A6ZA 5HYSA 2L7JA 5J6HB 3THMH 1KLUA 1ONQB 2V2WB 1RJLB 1CFVH 4UT6H 4J3TA 1P5UA 1ITBB 4JVUA 4UQ2B 3LEXA 4F8QA 1K3ZA 4LQFH 3D0VB 1AR2A 4GW5B 2VAJA 4XTRD 1WSST 4DZ8A 5TDOB 5DJAA 2YKLH 3RUGE 4ZFFB 4L3EE 2EDRA 2CKBL 4DTGH 2DD8L 5GZOC 3IAQA 3D3VB 2HLFC 2R4SH 3QPQC 4MNQA 1NGWB 2AI0L 5E00A 3H9HB 5KANG 3DX9B 5MP6L 4G42A 2IWGA 3M1BA 5ALBL 3WEXA 4HSQA 4MQSB 5GRZA 3KXFB 4OZGF 4Z77A 5KSAB 5DRNA 5GS1C 2ORBH 3IDMA 3ESVF 1NMCB 4UV4L 2W9DH 3C6LB 5EA0H 1YPZE 2QR0B 4G8EB 3REVB 3IGAA 5D1XA 3C5ZD 4KVCL 3VXOA 4U1HB 4G7VL 4LCYB 3WO3B 4K3EH 1HILA 2H1PH 5E8NB 5L2JA 4YXHH 3T8XB 4NCC1 1LP9E 1MCWM 1CF8H 3VXUD 2BDNH 2VL5A 3MRRA 9CGTA 1T3FB 5LVEA 4NP4H 1BX2B 2YD4A 3I3BA 3KPTA 1KJMB 2X4UB 3LDBC 4NKDA 1NMBH 3O9WD 1MJ8H 4KZEL 1MVFA 5DMYA 2JJUA 5D8JL 5DEGB 5CJOL 3BEVB 4PRPD 4YQXL 3FFCD 3TCXA 1U3HC 4K3DL 4PRHB 1RZIB 1MFNA 5CAYB 4Y2DB 1FZJA 1M4KA 3TJHD 3VWJD 5DI8A 2PYFA 2G2RA 3LY6A 1UGNA 2V9QA 2YWYA 3OJDB 4ZSOA 2J4WL 4G80B 4R97C 4ZSOE 3SO3C 5TGBA 5CINH 4HUXB 5T1KD 3IFPB 4OCYL 2JB6A 2XZAH 4YXKH 1BOGA 5DK0A 4HWUA 4RQQB 2A83A 2JJSA 5DD0H 4WFGE 1JZ8A 1JWUA 5CEZD 3GSRA 3RWJB 3QH3A 5A2IH 5K9KB 5K93A 4X5XB 1U42A 1NDGB 3O45A 5ESVB 4XGZB 4Y4KC 1G7PA 3PDOB 2PETA 4LHQB 1OAXL 4HPYL 2G75A 4HT1H 2CRMA 1JWSB 3BIAX 2RFXA 5HDBF 4HKJB 3GMRA 5ADOH 1MWAA 3KPSB 2Q6WB 4AENB 3UYRH 4XP1H 1W2KT 3E8UH 1QFPA 1KIPA 4PJAB 4ODTL 1ZHKA 4K7PL 1L4IA 1WBZA 4YNYA 4ETYA 4U1SA 2Z31D 2J6EA 5F1IB 3LKOB 2Z9TA 3JTTB 3OKMB 3BT2H 5JQHC 4L9DA 4KTDL 4ZG1A 5DRXB 3WHE0 5EZJB 2ZUWA 3MZGB 2R69H 2GFBA 1CGUA 2NY2D 5DC9B 4JFPB 3BXNA 1BVZA 4HCRH 3LQMA 5EC1B 4PY8J 2Z93B 3P9LA 2MJWA 4M6MH 3MLXH 5C2BH 4TULL 5GHWL 4LLVA 3O2WH 1PGRB 1C5CH 2ESVA 4JFEB 3PL6B 5CGMA 2ZSWA 5FCSH 2WBJB 1AFVL 3GSNB 1NCBL 4ODWA 4Y19A 1T7WA 1XR8B 3SGJC 5I1CL 4ORZC 1HN1A 3HLAB 1B6DA 5DMKB 1H3PL 1FIGH 1Z5LA 3NFSH 1RHHA 2X7LB 2AABL 5GRVL 3SDDD 1FZMA 3L6FB 3NOIA 4EQ3A 1JMZA 3TZVB 5DHYB 3MLUL 1YY8B 4JFDD 1XGPA 2VTFA 3EOYG 1DQQB 5IG7A 3NFNA 1FSKC 4M9PA 3UX9B 3R0MA 4ODWB 1A6AA 4Y4FB 4MJID 3K46A 5I19L 2FJGB 1TJIH 3HMXL 3SEPA 1C16A 1JPGA 4OCRL 3HNTL 4LLVB 5I8CB 3VRLF 5CKAA 4HDIB 4XNXL 3RY4A 3S96B 5EU7E 2R23A 3AROA 3PWUA 4UU9B 2P43B 3DIFB 4NT6B 3VRLE 1F6AA 1QACA 1MLCB 5L6YH 1EJOL 1Z9LA 2DDQH 2FEEL 3MJGX 3RBGA 3HR6A 3BGMA 3GKWH 3AB0C 1S8DB 4Y4HD 1CE6A 1RUQH 4HHAB 4TYUA 2LTQB 3BKML 1R3JB 5FO7B 1WAAA 1CFNA 1FORL 1LK2A 1QHPA 4HZLB 5I8KH 1IGMH 4U1SB 4HIEB 5TH2B 1KIPB 3MJ9L 2WAHA 1G7MB 1KN2L 1NGPH 1BIHA 3WL9B 5I73B 4LHUG 1TVBA 3SOBH 2GUOB 3VDBA 1CDCA 3WFCH 2JCCA 4UT7H 2G75B 5LXGH 2A9NL 5ISZD 3RP1A 1KJ3L 2DS4A 4MDJA 1TQCC 1RK0B 3WFHA 3X14B 4WO4C 2AXGB 3FO1B 3IXTA 4H8WC 4WHTA 3G5YA 3C5JB 5GRJL 1D5ZB 3M17A 2PTTA 4IOSD 3O2DA 3P30L 1SBBA 1QO3A 5EORL 1FC1A 3OQ3B 3UPRA 3QH3B 2ZCKL 5HD8D 1TJIL 3KDMA 3P11L 3VG9B 1JF1B 2OBGA 1MCFA 1AQKH 4PJIB 3JWOH 3N9GL 1BQSA 1JTOA 1U8HB 4HFUH 3D2UD 1HCVA 3VXRD 4NHCL 2ZG1A 2FIKB 1QUNA 2AEPL 1DDHA 4NJAL 2QKIB 3Q48A 1A21A 4FQLH 4QOKE 2FX9L 3K2UL 4L8DB 1MJ7L 1EXUA 1CXKA 15C8L 2BJMH 1MIEL 1H3PH 5MEPA 3HI6H 2ZUSA 4PGDB 3O4LA 1KCSH 3P77B 4QHLB 2AJXL 3EGSA 4PG9A 1XGTA 1DEDA 1HXYB 4N90D 4NZTL 4PRAA 2IG2H 1ETZA 1J7VR 32C2B 4WCYL 4WI5A 4JFZH 1AXSB 4Z7UE 2Q8BH 5AAWA 5H94A 3FT2B 3C60A 1EUUA 3H9YA 5HY9A 5KOVC 1H3TA 5C8JB 4I8DA 3HI1B 3UPAA 1AI1L 1OARH 1JZ7A 4F57H 5ESQB 2VZUA 5HD8C 2ZOLA 5EH1A 1WIOA 1EFXB 5EBMA 4WI6A 1QRNB 2NZIA 4EN3D 5IVXB 3MLZL 4TUOA 4YR6A 1AGBB 5J57B 4PGCA 1MH5B 4CL7A 2YEZB 3LKRA 3QPXH 4ISVB 1EBPA 1INDH 4JPKL 2HFEA 4JB9L 4M62H 4NQEA 4GW5A 5E56A 5EU6E 4OGYL 4C83A 5I8EA 4OTXH 5EC2B 2X09A 4TTGA 2OL3B 1NGXB 3QUXD 4MCZB 4U6VL 2Y72A 2ZCHL 2BSED 2YD7A 1KN2H 3QUZC 1YC8A 4JM2B 4MD0B 1Q1JL 5CIPA 3X13A 3IRPX 4LK4A 3IJYB 3ZYIA 4XNQB 4KRMB 1BF2A 3ARPA 1FLRL 5L8KB 4IOIA 5A3ID 2XYCA 1A1NB 4NUGL 2DF3A 1HHJA 1UWXK 2CJUH 2A6JA 3WYRA 2UYLB 1JGUH 2HYMA 2ZCKH 4X7CC 5LGKA 1DE4A 3S36X 4CNIB 3PWVB 3B8YA 1BD2B 1D3CA 1QFUL 1GAFL 3UTSB 1YN6B 3CUPA 4P2RB 5DK3A 2VDQL 2NZ9D 3QO1A 4QRQB 5E6YA 4XPBL 1FZOB 5EWIH 1JTPA 2QEJA 2H6PA 2OR7A 3ALWA 4I0PA 1QNZH 2PYEE 3BO8A 4NKIH 4S1SH 4V1DB 5ETUB 3O8XC 4PIRF 4PLOB 2B4CH 2EIDA 1ES0B 2BFVH 4OUUB 1JUFA 1HEZA 3BPOB 3RWGA 4F3FA 4F7MA 3SO5A 4OQTH 2AV1B 3WKML 4P0DA 4K71C 5C0CD 5GS2D 4OKVA 3HUJE 4TOYL 3X3GL 2ZUYA 3EIFA 4C55A 5SWQA 1JZ6A 3DURB 4LLDA 2AJ3A 3Q3GB 1LDPL 3H42L 4AM0B 3L5WB 3RUGF 3VXTA 1U8KB 1AC6A 1Y18B 3B9DA 4WW2A 4U1KA 4KPHL 4KXZH 5CJBA 1A6WH 1BHGA 3VWKB 4N9GA 3Q1SL 2VQTA 5E95B 5F1KC 4PJCB 3O9WC 3UTZA 3E6FB 4JJHA 3ARBD 2ZSVA 2OQJB 1UZ8A 4D9RE 5IROC 1AP2A 4K8RL 4CVXB 3BI9X 3GIZH 5IROA 3GMNB 4Y19D 5FB8A 3MUY1 5T1MB 1YDPA 4ZTOH 4BSWA 4L1DA 4XI5C 4DJMA 3LRSA 3BN9D 4NCC2 2FYYB 3OG4B 3EFDL 3ILPB 1YPZF 3QZWA 4RFOH 1MCPL 1Q0XL 5KS9F 4LSTH 1KB9K 3G5XB 4X7SH 1NL0L 3VFRA 5IEHA 1DQJA 3NACL 2VNCA 1UXSA 1G1YA 3D85B 4XBEH 4WW2C 3MV11 4TPRH 4JDTH 4L8BB 4RAVA 1RMFH 2DQIH 3U0PB 3PV6B 3QHZH 2J8UA 1NAMH 2ARJB 4MSWB 1VENA 3LN4A 4JQVC 4UT6L 5CP7A 1NSNL 4WO4A 4HIIA 1G7LB 2BOBA 2R29H 4FFVC 3P9MA 3MBXH 2FBJH 4JRXA 4IRSC 2HMID 1QP1A 4UAOC 3AC0A 4PRPA 4AIOA 3MZTA 5FV2A 5LBSH 3ZDZE 4P49A 4J1UB 4GQPH 1R6VA 3EBAA 2XA3A 5JOPE 1U8OA 5HJ3B 4XAWL 5JZ7D 4X7TA 3WFDH 3QUXA 3ARBB 3H3KA 4KK5C 4X6DF 3RDTD 1ZGLA 1PDKA 5B4MD 2P8LB 2EH8H 5LKNA 5EO1B 1DN0A 1G1CA 2BY1A 4G8IB 4F2MA 3E2HC 4N0YL 5SWSA 1OTSC 3HZYA 4PRBA 4XC1L 3SBWA 3QQNA 4I3RL 6FABH 1ZHLB 2MPAH 2X05A 4KWUA 3MRKB 2VDPL 4EUPH 1AIFB 1EGJH 2E8ZA 1OAZL 3CLEL 4LLWB 3SJVE 1S9XB 1WCQA 4I13B 3PIQA 1HDMB 2BP3A 2E7MA 3RX7A 2GITB 4ZUSA 3MCLL 4V1DD 5I0ZA 3U2SB 5DZLA 1D5IH 3TM6A 2AK4A 2B1HH 2ESVE 4UILH 3JV5A 4G8GD 1R5IB 3KPOB 5HDQL 1CE1H 3HCVA 4PJ8C 4Y19E 1GJIA 1BJ1H 2FLBT 1KGCE 2XA8L 4KMTL 2WLZA 5FKAA 4EBQL 3VI3E 5DD3H 3E3QE 2WM0A 5FB8B 3BKYH 1BM3L 5FHAH 1NGYB 3KLHD 1UVQA 5A16B 2XRAL 3T0VA 1NMCC 2P5EA 3DUSB 2ICCA 2MCPH 4OLUL 4XNMB 4NO0B 1VKXB 4IRZH 2QSTA 1NMBL 3T0AA 4DGVH 1RZKL 2IC2A 2VAAA 3QEQB 4AM0A 2VDML 3BN9C 3NABL 3IU3A 5J9PB 3U1SL 3O4LD 3Q6FB 2X1QA 1IM9A 2HTLC 5EIVA 1BWMA 2XWBA 3QNXB 1XF3A 2P48B 2J88L 4YHIB 3DXAE 4KI5C 2K1MA 2K7QA 5T5FH 5EO0B 5B39A 1T2QH 5L9DH 4U6YA 1VFMA 2X4NB 5C0DA 4LHUD 2IGFH 3LHPL 4U1IB 2P42B 1F3JA 4PJ8D 1GGIL 3V4UL 4Z95H 1AGFB 1YA5A 1DVFD 3L95B 1KPVB 3STBA 3FRPG 5DJDB 4KKLD 2Y6SC 3KPRB 4LCWE 4O2EB 1NGZA 3ZE2F 4NO3B 3DO7A 1DEEA 1KCLA 4QRQA 3R06A 3CJJA 1PLGL 5CKGA 4Y4KA 4QWWC 5I71C 1OT2A 2VDKH 2BDNL 3CUPB 3T1FB 4RX4A 1E4KC 3I6KA 3TN0D 4GRLB 2GITA 3OPZL 3LDBB 1I8LC 4FTVB 2D7QA 4JZJB 2FZ3A 4P2YA 1OD7A 1CXHA 1FAIH 3SOBL 1FGNL 1L0XA 3SE9H 3RPIA 3DNKA 4FQ2H 2BNUB 1UM6L 1P84J 4L4JA 4H8WL 4N0FA 3GDBA 5KVFL 3H7BB 3W9DB 5A1AA 3MOBH 4XP6H 1G7QB 2W9LA 3GJEB 3ZSTA 1WBYB 3H9SA 2DLEA 3V52L 1ZLVK 2EYRB 4F2MB 5CBAA 5JW5A 3AS1A 3BX7C 5EO1A 4G6MH 1KC5L 1RI8A 4H20L 2OSLB 2BK8A 4Y8DC 2P8PA 5CGTA 3LEYH 3EYVA 4X6CF 2CLRB 2XFXA 1R3IH 3CFJA 4QXUH 3WJLA 4KDTC 3VXMA 4Q0XL 3ARGB 1QR1A 1IAKB 5B8CB 3HE7B 3ESUF 4CW1B 4H0IA 5D8JH 1P7KB 2CK0H 4HGWA 3U4EB 1X5YA 4JRXB 2BNQD 5DT1L 1L9NA 2OJEB 3AS2A 3HS0A 4OZIE 5CP7B 4R4ND 5ISZE 1P4IH 1H3XA 3FONA 1ZT4B 4ALAL 3MMEA 1IC4H 1I9JL 4HEME 4G8GA 3GSXB 2WZPD 1U58B 1O0VA 4FFWD 1P6FA 5C09D 3NAAH 1CGSL 4ZAKB 3OB8A 3PE9A 2DQDL 4WUKH 3PGDB 4Y1AB 3QZWB 1NBVL 4N0CD 3B9KA 4I4WB 3ARUA 2HJKB 3FT2A 4BA8A 5H94B 4LCUB 3KYMA 5JOFB 3UAJC 3T3PF 3ARBC 1I1FB 4HKZB 3U9UB 1EPFA 2HLAB 3I75A 4QXWA 4F8TA 1FL3A 5CWSB 4IBLT 1BAFH 3GMNA 2WUCL 3OGOE 1E4XL 5C0CA 3NZ8A 1NCWH 4GS7C 4JFQA 3WCYA 2VXTL 4LLMB 3T0DA 2VMFA 2IQAA 1PQZB 1TIUA 1LEIB 2CR3A 1NH6A 2VRAA 4YFLF 5EWIL 3IS1X 1GGBH 2FR4A 4PG2C 4LPVA 1E4WH 2JB5L 4Z7UF 3QBTB 1EXUB 2Z92A 5J8OA 1GIGL 4YX2H 2OCFD 1KIQA 4NRXA 5IVXF 5C08B 3T0WA 3IU4H 3CFBB 5FCUL 3ULVF 3H9ZA 1DDHB 1T1XB 3GUTA 2QQLL 4DN4H 4K23H 1IC5H 2Z31B 1F4XH 2YPLA 2YSSA 1PBYA 4PJIA 3ARFA 1JF1A 1SM3H 3MLRL 4JY4B 5CJXC 5SWZD 2VLKE 4PRID 1IRAY 5CUSL 4GRLD 3LMJH 1MRCL 1VFBA 1WCBB 4OFYA 2E9WA 1WVZA 1CGYA 4XRCB 4CN1A 4XPBH 1AO7E 3IVKA 2R2EA 5GGUA 1MIEH 4YIQA 5KN5A 3VE0B 1GHFH 1J1XL 4OI7A 4N5ED 4AG4H 4QRRB 3WL9A 1HHHB 2JJTA 2IF7A 5E03A 4GT7A 5D71H 4CGTA 2PTUA 2HP4A 4OGXL 1KJ3H 4LHUB 3WHXA 4H26B 2F54B 4Q2ZB 2WBJD 5DUBA 5E5MB 3DUUB 2HJFB 4PTUB 5KSUB 1NBYB 1ZVSA 4PJBB 2AJZA 5IP4A 1FH5L 3HC0B 3RKDD 3FO0L 2JF1A 1JFQH 4Z7WF 3DSFH 3MRBA 4HH9B 4X4MA 4K94C 3IDNB 2UV3A 4ODSL 4KUZL 2B0SL 2WK2A 1OB1A 3ECBA 5HPOA 5CP3H 1NC4B 2J7LA 4OTXL 1JI2A 2H32A 1KTDA 1KUMA 1M7DA 3V6BR 1E4JA 4APQD 5M94B 4U6VH 3OAUH 3HUJB 4M7JH 3D87B 5ELIA 4EVNA 3P4OB 4GAJL 5IFHL 4NM8H 1R3LB 4MNGA 1YPZB 1UYWL 3HPJB 2NXYB 2IAMD 2FECI 3QPXL 3F7VB 4KHXH 3QWRA 4XCNA 2V17L 3KLAB 4L5FL 3G5ZA 1MH5A 3CX2A 3IYLW 5DMGC 1Q8MA 4AJ0A 2VISA 1CVRA 1RZGA 1FV1B 4PJCF 3RZCC 1V7NL 1QRNA 4PJ9C 4EZMA 5DWUL 1U3HD 3ISWA 5F8RC 5BVJA 4TUJB 5AAMA 4GKSA 4OZHA 3MV8E 3HRPA 3RUGB 1EO7A 3MRGA 5MENE 2N7BA 4N9OB 4OGXH 5DMKA 4DAGH 1ZT1B 2G9HA 3QIWC 5E7BA 1SYVA 3LD8B 3RVTD 3SKNA 1A7OH 3QULB 5IB5A 3GSNA 3CXHJ 5IQ7H 3AS0A 1JPFB 4MYWB 4CJ1A 3PL6A 3DX8B 2O5YH 2FECL 2ZP0T 4NOBA 4U1LB 4ZTOL 2A38A 5C0IB 5DJZA 4Y89A 2FR4B 1MFDL 4WTWA 3HZVB 4BYHA 5J12B 1OSZB 3TH3T 4HUWA 5FFLA 5FYKU 4WI7A 4F7CB 4BSJA 3MRCB 5C1MB 2LTQC 1FO0H 5DRXA 5E2UL 5A2JH 4XPGH 1C7SA 1HZHH 4LSSH 3MRQB 4OBRA 4TSBH 4WU7B 4NGHL 3JTTA 3V5HB 3TEUA 1T0PB 3TVMB 1JPFA 5I1IH 3X3GH 3GSOA 1ZGLM 3AREC 4LVHC 3AS3A 5L7XL 5IK3B 1JHTB 1P4LA 4JO4L 4JQVA 2R0ZL 3G08A 2YPLD 1QSFA 1DR9A 4NQDE 5INCA 2EIEA 4XCCL 5KVDH 1QHOA 1X5LA 4YPJA 3SKMA 2C3VB 5E7FA 1ZLWH 3B5TA 5B8CA 4MD5A 4UOW0 2RCSH 3NN8B 5TDNA 1Q9WB 1S7RB 1X4XA 1I8MA 4DKAA 1F6FB 2CPCA 5IV2A 3TN0A 2VLME 5C0CE 1KELL 4M03A 2GJ6E 2JE8A 4APQC 3IFPA 3KLDA 4GG6E 4HS3A 2VXVH 3B6SA 1RURH 3QO0B 5BVPL 5TF1H 1INEH 2ZUQB 4RGNE 5F9JB 4NJ9H 1RIHH 1G7MA 3PWPE 3O41B 3QG6A 2B39A 3WIFA 1G7QA 1IQDB 1OP5K 2NY6C 4UDUB 4V2CB 1NCAL 5BXFA 4HXAH 1RV6X 3BPCA 3ZHKA 3MRBB 4N0FB 2F5BH 4E0RB 3GMLB 5KVMC 3EFDH 4Q6IB 3IETA 1ZVSB 5D1ZC 5CSZB 1JZ5A 1QPXA 2WBWB 4L4VB 3PP4H 2YPLE 4M93B 2EO9A 5GZNC 4HK0A 1T0NA 3VD4A 4NHUB 5CEXA 2E7CA 1LD9B 4JY6B 1MCWW 1RVFH 3RWIA 3KXFE 1JGLH 2VQUA 3BDXA 1KSRA 1I85C 4NN5B 3QNYA 4LKCB 4KK6D 1A6AB 3O3EB 3BZFB 1ZLUK 1I1AB 4NO2A 5DRNB 4I0PC 4NBXB 4Y4HC 2YS4A 1MNUL 4RFNC 4FXGB 1XGPB 4P2QA 1NC2B 3UO1L 1RUKH 3O0RL 5J89A 3M1BB 1NJ9B 2APFA 2UZYB 4XH2A 5B39B 3BIKB 1F3DJ 1CBVL 4LLQA 3S97C 3O4OB 5F7DB 1U8IA 2DQJL 4WEUD 5FA4B 3G6DL 1H0DB 3QXWA 3QDHA 1JP5A 3TBYA 3U46B 3RL1B 1XGRB 4XAKE 1T1XA 2XWBB 5HDQH 4TSBL 1YN7B 5LCVH 5L9DL 4ZFFA 3UTSD 2GTWA 5F1NA 5DJAB 4ONHA 1G6RB 3TJEL 4EDXA 2R4SL 2ZSWB 2J6EL 4XXCC 2VAAB 3QP3A 1KEMH 4NQVB 1VSCA 2WBJC 2DQHH 5GS0C 3BMWA 2X4TA 2GFBB 2BVOA 3LEVL 1REIA 3MFFB 2X4SA 4KTEL 2IPKB 4RISH 5BW7C 4E5XA 1RUML 3DETC 3K8MA 1FL3B 1HH6B 4MJ4A 3V5KB 3LQZB 2X5PA 2XPGA 2F58L 5IB2A 1W8NA 1X7QB 4XPFH 3O8XD 1MY7A 3VXME 2XZAL 25C8H 2XY2A 1RPQA 3BKMH 3Q5TA 3T77B 5J13C 4KGJA 4ZS7L 1F4YH 1GPOH 4IDJH 4ZD3L 4HLZG 1F58L 1B6UA 5HI5D 4P4KD 1IILE 2VLRB 3AAZA 5ICXA 3VH8B 2YWZA 2B4CC 1WEJL 3D0LB 1HYRC 2GQHA 2J5LB 3GMRB 4HKJA 3VFWA 5HGHA 4NQDD 2Y4SA 3AM8C 3QIUA 4GRMA 1C1EH 3S88H 1BQHG 2NLJB 4OLZH 1NDGA 3O45B 1JL8A 5ESVA 3BISA 3PWJA 1N64L 3VD3A 2HKFL 1LK3L 3ULVD 5I16B 4WDIB 5ISZB 1IEBB 1K8IB 4Z7VE 2IPUK 3SDCA 2XFXB 2A83B 4CMMA 4RQQA 4JZOB 2VDPH 4LCCA 4LSPL 1AXTH 1A14L 5JW4N 3L5IA 4G80A 1J0YA 4P5KA 2YPKA 4JN2A 3MLYL 2HTLD 2XG4A 1WIPA 3S35X 5GXBB 3H9SB 3QJHB 5H2BA 1WBXA 3NTCH 2VLRE 4K7PY 3S3SA 4FOMA 4HBCH 2FH6A 2MMXA 3QXUA 4APQA 2ZNWA 4NRZB 4B41A 2DRUA 1TFHA 5SWSE 5C0JA 3C08L 4JZJA 4FHBD 1JMXA 4O2CA 7FABL 5IIEB 1AHWA 3V4PH 3BRFA 2VXUH 4M7KH 3I84A 5C09B 5E1AB 3ZTNH 2AJYL 3LIZL 2X10A 3T8XA 2WUCH 5HHNB 1NMAL 2YRLA 5E9DA 1KT2B 3QFDA 4TVSa 4HD9A 1I1YA 4XC3H 5DJ2A 1DBML 4UUJB 1FZKA 4CADA 2AVGA 1G9EA 3C6LA 2ICWA 2BNQB 2DM7A 3CSBA 4UIKH 1T6VN 1ORQA 2HLFD 2WWKO 2F8VA 4LVOB 5HDOA 4KQ3H 3FQXA 2CLVA 2P49B 3U6RB 4U6YB 4N8VB 2HN7A 2NX5E 3RX8A 3ZDXF 3RHWK 4ODBD 1EAPB 1QSVA 4N9GB 4M43H 1X6LA 5GGTL 4G5ZH 5CJQH 2D9QB 4HK3N 3S4SG 4U1JB 3ZDYF 3ZSSA 1PFCA 1ZHBA 1AD9B 5FK9B 2RHEA 5GGTH 1WZ1H 5HGAA 1DANT 1SVCP 4XWGL 3BKCH 4OFKA 4XBPB 2FATL 1HHKB 5C71A 1PLGH 2XZZA 5H37G 4I77H 3CFIC 1V3JA 1GCFA 3CFCH 5JDJA 2BXZA 5D7IF 1JUFB 5EU4A 1QBML 5DYOB 4QRTA 3QUMH 1CDIA 4JO2H 5DO2D 4BM7A 1P4BH 5I17A 1GGIH 1RAMA 1A47A 1RHFA 3QXDB 1GZPB 1A1MA 4Z78A 4D2NA 1KLFA 3BPNB 5T1LA 1J8HB 3WS3B 4I0PB 4OM1H 1M1SA 3EYQC 3BW9A 3P73A 3JVGA 3OAZH 3CU1A 4PJ7B 4Z7OE 2V5MA 2XZQL 3HR5B 1JPTH 4QXTA 3UROR 3U7YL 3NPZB 5D7SL 4TNVK 1Q0YL 4DGYH 1CLZH 5SWZE 4MVBC 4U1GC 3X3FL 4X5WB 5CBEB 2GEEA 3F58H 2C3WA 2XWTA 1V7MH 2VWEC 3C5SB 4PJXE 2BVUA 4N0RA 4F33A 5DRZA 4WTXA 2GSIB 3AU1A 1IAII 1I8LA 3SGJA 1FSKB 5C0NC 1S9XA 2BVYA 4X6FB 5FF6B 1F4AA 2VLMD 8CGTA 4YHZH 4QTIH 2A1WH 2P7TA 4BH8B 4RA0C 3RTQC 4ZOEA 1IFHH 1QEWA 2IBZY 1HI6B 2EC8A 1F90L 3ARRA 1CLYH 1JRHL 4OCWL 3QEHA 3BDBA 1SY6A 2NY5H 3OKEB 5DTFB 5DYOA 1H3UA 3E3QC 3IJYA 4DFIA 5LWYL 3UTTB 3DI2B 4YPGA 1RULL 4M7ZB 4EOWH 5I1HH 5DGQA 2NXZD 4JFZL 1NGXA 2RB8A 5EC2A 4M8QA 1T0MB 1UENA 3BIBX 4XBPA 3WBDA 1OAKL 4OD1L 1BF8A 3GMOB 3PDDA 3PHQA 4J1UA 1YEFL 5D7IB 1AD9A 4ZFGL 1HE7A 1NGQH 3DRQA 4EI5B 1CCZA 1FFPB 1PZ5B 3AVEA 1EFXA 3LN4B 3EYFA 3EFFB 5DD1L 3VXSA 2V2TA 1OP5H 2LU4A 4FQLL 4RAVB 2C9AA 5HI4D 2A73A 1JNNL 5CSBA 2HVJB 5HYQB 3CX5J 3UYOD 4G8FB 1ZA6A 3IU4L 1S7SA 1FYTB 1OGAA 4J2XA 3L3GA 3MCKA 5DJ2B 2H2PC 2FHFA 3D2UA 5T3XL 1M7IB 3MXVH 1T20B 5F7WC 3CCHA 4K71B 5GRYA 5EUOF 5IBTL 3KYNB 4PRAB 3QPQD 5DHVH 4H88H 1QRNE 4YZFF 1AP2B 1MCDA 1EA9C 1DL7H 2V5SA 4OD3H 1J10A 4D3CH 2QHRH 3I9GH 1WFNA 4JFFB 4W70A 4PJCA 4OI9A 1KNOB 1W0VA 1EUTA 2D03L 1MCSA 4R7DA 1AGCB 3WFBH 1Z6JT 3EOAB 4XPTL 4IMKA 1EEYB 5ICZB 5TE4L 4IOFC 2Q7YB 2FX8L 4EIZC 3JWDL 1WBXB 3CFDB 5SWQB 1F6LL 1NCCH 4M5YH 1S7XB 2K3TA 2ZUTA 2IEPA 1J5OL 5GRWA 5IJVA 1G6VK 1UM4H 4XP4L 1XF4B 4O2FB 2M8XA 4LCCB 2UY6A 2V2XB 1U8LA 5D1QB 5DURB 4GKNA 3K81A 4OIBA 3TV3H 1ES0A 5GS0H 2BNQE 5HVGB 4WFEE 1TJHL 4O9HL 4MNHB 4UTAL 4FG6C 3D85D 3VFMA 3BRGC 4GAFB 5D71L 3N50A 2WP3O 5F9WB 5FA3B 3EYSH 1MF2H 3BH9B 1TJGH 3WIHH 2JB5H 5IEKA 3SDXE 4PBVC 1MOEA 3C5ZB 4PFEA 1EHLL 2VLLB 2LU3A 4PJGE 3QIUB 1BVKA 3VWJC 2PYEB 3NIFE 3G6AB 2EDLA 3GZKA 2ADGB 3OJMB 5SX4I 2UUDK 4LSRL 2VERN 2VE6A 2KBGA 2HH0H 3K4ZA 1A7OL 1PYWB 1LEGA 1LK2B 4PPTA 1DSFL 2QL1A 4LGRB 4JREC 5DK2B 1KCRL 3D18A 5E8EA 1A6UL 4LASH 5FV1L 1DANU 3DTXB 4AL8L 3VRIB 2I60L 4F7TB 3RY6A 1DQTA 4MJ5B 3GM8A 1KCVL 4F57L 3AXLA 3FB7B 3IDGB 2V7NB 4POZC 3QEUA 1RJCA 2HT3C 4MXWL 4KKCC 3L7FB 2E7LA 1A6WL 5I8CA 4NQSB 1WIUA 3B5GA 3HC3H 5J12C 2UWEF 4F37K 5I8EB 5GRUH 3NA9H 1FYHB 1DBJH 1U2HA 5D96B 5CEZL 3Q0HA 1BFOA 2XN9E 3P0YL 4DKEH 1YEGL 3P0VH 5DD5H 3MXVL 3LKRB 2PYED 4X7DC 2A6IA 5DHYA 3ARZA 3P0GB 5I8OH 5E9DD 2ED9A 2PW2B 4KJPC 1I8IB 2DQFB 1DBBH 3RVUD 3O81A 1ZGLP 4V2BA 2VJXA 4XP9H 1ZLSL 4PJBE 4NGHH 1U3ZA 3D1MC 4YHNA 4JPIB 1NUFA 5BRZB 4P3CL 4JHWH 3BZFA 2HH0L 4LMQI 1MVUA 4I3SL 2ARWA 4X4XB 1KGCD 1UJ3B 5BV7B 2E7HA 5HHQB 3ULUF 3QUMB 1JWMB 4MAYB 3QA3B 5SX5K 3BXNB 3C8DA 2I9TA 4Z6AT 5F21B 4OLUH 4D0BB 1Z0NA 2BSSA 1F4HA 3CVHA 4YXHL 5AZ2H 3QUKA 5GGTA 5GGQH 4JM2D 2VIRB 4HG4J 1I3RB 3TPUB 3FQRB 5E5RB 1J0HA 2SEBB 4TNWF 3V6ZB 3A67L 4UV4H 1U3HB 5CMAA 5KBNC 43CAB 5FKPB 5KTEL 1C5DB 2QKIA 1I7TA 2W0LA 4LQ1A 3BN3B 1W72L 4KZDL 2OJZH 2JCCF 5LJYH 4UIMB 4ZOBA 5C7XL 1I7ZA 4LF3B 4P46B 7FABH 1R5VA 1ADQA 2AK4E 2DTML 4OAWA 3KDMB 5I66B 5IB3B 4ZDHB 4NZJA 3RPKA 5ESAB 3TBSA 5ID1B 4ODHH 2Q87A 2LABA 2IPTH 4MD5B 3BYTA 5CZVL 5FXCH 1D5ZA 3M17B 4L3ED 4Y4KD 4RDQG 4I5BA 4FQCH 1GC1C 5TQ2L 5AZ2L 5LGJB 1U6AH 3MGAA 1CVSC 2EKSA 3KPSE 5ADPH 1MCIA 3NIDF 4HWBH 3EOTH 4X6EB 4DVBA 1FLTX 2MQ0A 3P2TA 4HK3J 2W0PA 2YXMA 5JXAH 5E2WL 1C5DA 5FDWA 1T4KA 3KPMA 3ULVE 1BECA 4GFTB 5KVGH 4D9QE 3S8WA 1HKLL 4PRHA 3JV4A 4IM8A 5EBLA 2MTPA 1G9MH 1EJOH 4LDEB 1UB6B 1OOAA 2VR4A 2VZSA 2G5RA 3MRQA 4NSKA 4PB0H 3CK0H 5J1TC 2FHCA 2Z4QA 2R2HB 1HSAA 4FXKA 3W0WE 5HHMD 3FB5A 4UB0L 3WDJA 3SDAC 1CFBA 4JFFD 3M07A 3OKNA 5D7JB 1F6AB 2OK0L 4YDKL 4GS7B 5E8NA 3VXRB 2OK0H 1LVEA 2H2SD 1TNMA 3MACH 4Q0XH 3MLXL 1YYLL 3CVIH 3BJ91 3U0WH 1PG7X 1C12B 2XRAH 4H1LG 1AQDB 1DQQA 1YY8A 5MI0B 3SCMC 3T0EA 3KXFA 3TZVA 3T2NL 3VD7A 1A5FH 3VXUA 4EBQH 2V6HA 3EDFA 3PWNA 4WWKB 5IGXL 3H9HA 1JHLH 1DQML 4JHBA 4WFGD 2JJWA 5K9OB 3DYOA 2GSGA 2DIAA 4LL9A 5D93C 1S7UA 1X5XA 3FFCA 1ZOXA 4TULH 1A9BA 1KYOJ 5LAXA 1T66C 3VGAB 2J6EH 3FB8B 3G9VA 4D9LL 4TQEL 3VDCA 4YAQA 2O5XL 2BC4A 3TT1H 3QEGH 4AT6A 1MSPA 5KAQG 3SE3A 2WQ8A 3NCFB 5EC1A 1EJ6A 3HUJA 4KHTH 4OT1L 5I30H 5CILH 2V7NA 3UC0L 3BEWB 1LEKA 3TNMA 1NC4A 1VGEL 3IDIA 3QDMD 1TENA 4P4RB 1OP9A 1OB1B 1CBVH 2IANB 3B2VL 3MLTA 1YECL 1JGDA 3UJIL 2OTWB 1FVDB 1MLBB 2DKSA 4HMDA 5DK2A 4JPWL 5F1IA 4M6AA 4NKOA 3CVIL 2YUZA 1YJDL 1XEDA 2F54A 3OB0K 4Q2ZA 2D0FA 3P4LA 3WHXB 4DN3L 4GSDL 5JW4R 1N64H 1CLOL 4GG6A 5ABDE 1T04B 1NFDA 4PR5A 4RAUB 2BVQB 4DKFH 3ARGD 3HNSL 4ONFL 3RGVD 3ZO0A 5GS1B 4JKPL 3LPWA 3BPLB 4JRXE 3GGWB 3QUYA 3MNZB 4RIRA 1FP5A 2BHUA 5IVZB 4JRYE 2F53A 4GW1B 3BOVA 4DCQB 3F6LA 2HT3D 5I9QB 25C8L 5B3NA 4JM4H 3W0WA 1KYOK 4FQHA 5K59F 4PRDB 3RAJL 3PHOA 3IDYB 4NWTH 3A6CL 1OWWA 3EDKA 1UKQA 4CDHA 1QFWH 2DI9A 1CS6A 5DI8B 3MRIA 2GYSA 2PCPA 3H9SD 3LHPH 3O11B 3V8CA 4IHOB 3L3KB 3O6KH 2PKDA 5ENWA 3OR6B 1XF5B 3HG1D 3G6JB 2I07B 4YJZL 1WICA 1IVLA 5DJ8A 3QDGA 3U4BL 4DGYL 4XNXH 3O2VL 1KJMA 1KV3A 1R3HB 5EG6C 4JFFE 1XCQB 3N1PC 4NNXB 3NH7L 3MUGB 3EYQD 2CDEA 2B1AH 2JK5A 2AJXH 2HLAA 3I75B 4Z0XB 1BBDL 5FOBA 4ZUTA 5JIHA 4YLQT 3ULVL 5JOFA 1W0WA 5D1XB 2OTUB 4ZUUB 1GC1L 3KPRE 4LCWB 5EB9A 3P40A 7CGTA 1OAQL 1O7SA 1VADB 1TETH 4BFEA 5IMOB 5ICYA 1Z9OA 2BSTB 1MLBA 3A6CH 2OTWA 1FLRH 2ENYA 4U1NA 5I75B 2R4RH 4U0QB 1LP9B 3KYKL 5IOPB 1GGTA 5D7JD 3LZFH 3DX9A 4J3WA 3FONB 4PUBH 5KSBE 1L0YA 4MA3B 5GGSY 4FQIH 1VGEH 1S5HA 5E8DH 3QI9C 3P4NB 3HS0B 4S1RL 1GYAA 3PL6D 4OF0A 3U4EA 4EI5A 3O6FD 5IHUH 2WP3T 1DLHB 3VXNB 2VDQH 3EDEA 3NCBB 3WXVL 3GMOA 3VXMB 5FOJA 1DBKL 4FZEL 3TYGH 5LAXB 4Y5VB 2NY3C 5MEOA 3LEXB 4RMVA 3WV0A 5FUZL 4DAGL 4WV1A 4YPGB 1I7UA 3DROB 4YHKH 3RRQA 2ICEB 4XT1C 3WNMA 5E6ZA 3GMPB 1BFTA 2M26A 3A6BL 1BVLA 4HWEL 4QTHA 1ONQA 1WBYA 2WUBH 1RIHL 3GSNH 5FYJU 2Y5TA 1MHEA 5HVHB 2JCCE 1AQDA 1IC1A 4NCDA 1IM3A 5DHVA 3RY5A 5DVOA 1OQOA 4YHYC 5HI4C 3PUCA 3ZT7A 5DFVC 1JGVH 3B9EA 2HG5B 1DBJL 4BQ8A 3F65A 3F8UB 4WWKC 1A3LH 5SWZA 4F9LC 2A9MH 2KPNA 4GRLA 5BZWB 1N3NA 1G7IB 4F58H 4AEHH 3IJSB 1CDYA 4Y4KB 3U0TB 1UH4A 4QF1B 4XCCH 1FNEB 1ADQL 2QQKH 2R0ZH 3Q5YA 4KUZH 4JO1H 1MCNA 3PQYB 5KSAC 3L95A 4UTAH 5FYJD 3HZKB 1N7MH 5EO9A 12E8L 4HUNB 4R0LB 3FOMB 1MAKA 4S0SD 3FTGA 3QI9B 1MHHB 2W65A 2R0LH 2JELL 4OCXH 3TA3C 5CJXA 5CP3A 4WTZA 4X0KB 1JNHA 3CSPA 3CDGB 3S9DB 4PRHD 5GS0L 2YPVH 5DC4B 1N5YH 4WCYH 5ACMA 4WENB 1Q9KB 1QA9A 2FX8H 1RJYA 1B4JL 5IVOA 3IFNH 5KOMC 3VA2C 4ENEC 1T89C 3EYSL 3SGDH 2A74A 3B5HA 4BK5A 1H15A 1QQDB 4RGMB 5DVNA 1JPST 4L4TE 3QDGD 4NO5B 4WEMB 3QDJA 4ZO9A 4P46A 2XZCH 2X9WA 1B0GB 3FRUA 3D3VD 1FFOA 5EFIB 5GGVY 2CLVB 3TV3L 4YXLL 3FQXB 3UTPE 1F45A 4Z7UA 4L29A 1D5XA 4GRWH 1IGCH 2J12B 1QLRB 5FUCC 1J05B 4BFBD 2KDGA 3LS4H 4H1LH 5I6XC 4PJXB