4NQUA

Anti-parallel fc-knob (t366w) homodimer
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
208
structure length
208
Chain Sequence
GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLWCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Antiparallel Conformation of Knob and Hole Aglycosylated Half-Antibody Homodimers Is Mediated by a CH2-CH3 Hydrophobic Interaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 33
structure length 208
sequence length 208
ec nomenclature
pdb deposition date 2013-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nquA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nquA01
2QSQA 4TSBL 1XGRA 4XMKH 5HPMA 4P57B 1EEYA 4WWKA 4BFGA 3TNMA 4AENA 2EXWC 4EEEA 3LEYL 3UJIH 4E41D 3NIDF 3VXQA 4P5TD 3MBED 3J8F7 3KYOB 5DTFB 4QOKD 5FCSH 1AC6A 4Y2DA 2P5EB 5CD3A 5IEHA 3K2MC 2J4WH 1BWWA 4WTXA 3RWIB 2OL3H 2VLKD 5ESAA 5LAXB 1MCSA 1RZJC 4Y1AD 4JO1H 4LVEA 4PRHA 5FYLD 5L88L 4Z7UE 1MCKA 3I6KA 1XF2B 5D7KD 1K4DA 3Q3GB 3F6IA 4J3XA 1A47A 4MA3A 4LQ1A 1MHPH 3LPFA 3MNZB 1DQJB 2BVEA 4HF5H 4NQVB 1KB5A 5AEAA 3X11A 4HH9B 3NFSH 2F74A 3PABA 4KXZH 3V52L 2HKHL 1T2XA 2YSSA 3HZVB 5IIEA 5JIPA 4Z7QF 4H8WC 4U2YA 1F11B 4OIIL 1WISA 5DRXB 3MC0A 3TGXA 5EBGA 4WWID 2VOTA 3HFML 1SYSB 5D9SA 4G6KL 5BRZE 1RUAH 2BVUA 1YY8B 3TV3H 4ODUB 3HAEG 1ZGLA 3L7FA 3MRPB 4IRSA 1MELA 3I50H 3V5DA 4OIBA 3GSNH 3V4UL 1OTTD 3BAEL 2P5EE 1CZ8L 4MS8D 4Q58C 1RUMH 4JJHA 3B9KD 5E6YA 1JF1A 4M62L 4UTBL 2Z4QB 3K2UL 3VU2A 3OHXA 4O2EA 3MX0A 3WEXB 3ARDA 2W07A 4DOHB 4G8IA 1H3VA 1KXQE 3O6KH 4UB0H 4U1IA 3IYLW 3NIGF 1S7QB 4M3JA 1JVKA 4MJ5A 4X4YB 3WN5A 2IG2L 3G5XB 4ORGB 3QQ3A 5E8DL 1FIGL 3BPLC 4QWWC 4PJEF 4RFNC 3FN0L 3SKNB 4MXWH 3TYFB 1M7IB 4N0UB 1EVUA 3LQZA 2IPTL 3BHBB 3HE7D 3OKMA 4R0LC 3OKKB 4OT1H 5A2LH 4I48B 1ONQB 2H6PB 2DQFA 3FT3B 1BIIA 2FR4A 5L7XH 4RMTA 3ZDZF 4MAYA 2A9MH 2Q8BL 1GZQB 3JV4A 2VZTA 1NBQA 2C3HA 4Y16A 3DYMA 1FVCA 3QUZC 4NKQB 3S37L 3QUML 2APVA 1B2WH 2JIXA 4L8SC 4LHUD 2PF6A 3OXSA 4NN7C 3S37X 3T2NH 1TVBA 5SWQA 4R97B 5I6XC 1UB5A 4E41B 5C0CD 3G9AB 4P5TB 3MBEB 4R7NA 5F72S 1ZTXL 1U8MB 2BCKB 4KKBD 4KUCD 3EDFA 1EBPA 2VLKB 3U46B 2VDQH 2IGFL 3SDCC 1K6QL 4PJDA 4XXDA 4G8FA 1LO4L 2IPUK 4PG2C 4L5FL 4LMQI 1ZHKA 4P2OC 1DEEA 4GXUN 2WBJC 2OK0L 4XBEL 4QHNA 2E9IA 3HAEH 3RFZC 1JZ8A 2CDGA 3KPMB 1ADQL 3T0EB 3RP1A 2H1PL 4UIKL 4BFIB 2IFFL 4CJ1A 3G5VB 2UZXB 1Z3GL 4N0UE 2D03L 1WZLA 3C8DA 1T1WA 4P23C 5J1AA 1UQSB 3KYAA 1F6LL 1FSKC 3VCLB 3STZA 4HMEA 4N9OB 4WFGE 1F97A 4PGBA 4LQFH 1HHGB 2WAHA 4P2QA 5HBBA 3ZKMD 1JV5B 2A6KA 4MHHI 3ES6A 3QXVA 4PYGA 5K59F 4MB3A 3VI3E 1PG7W 1CI5A 4ODVL 3O6MH 1KB5L 1MCPL 3H42H 4NNYA 1P6FA 4KVNH 3QT2A 3IRPX 1KLUB 3MLTB 1L7IL 4JM2B 2VLKE 2GJZA 2HJLB 4KDTC 4XVSH 3BD5A 2E5EA 4AM0A 4JFYB 1FAIH 4Y5VA 1B3JA 5IOPB 3BH9B 2DQDL 5D7KE 5IT2H 3WUWA 1D5IH 1MHHB 4FQJL 3VXRD 4JDTL 1P84J 3VFVB 2HLAA 5B39B 2NY3C 4PGDB 5EOTB 4Y4HB 3T0EE 5C7XH 4HPYL 3L95B 1AO7E 1VPOL 3BH8B 3BGMB 3WL9A 4M1CD 2HRLA 3FO9B 3QXUA 1IARB 1JTPA 3SGEI 4OCLC 3DI2B 3UO1L 1HYSD 4YHNB 4KV5E 5CSZA 2H45A 2BSRA 2UV3A 4I3SL 3BKCL 4YO0A 3ALPA 5FDWA 1RY7B 3FHQA 2OTUA 1WUNT 4LCWE 2B1AL 3GJFA 3PWNA 1BQLL 3WFDL 4F3FB 4GO6B 3MRMA 1ZAGA 2WSKA 2IANA 3CC5B 4WEBH 2V6HA 2ERJC 5JHLL 1ED3B 5KAQF 3HI1A 1AQKL 1J05B 1BBDL 4Z77A 3NCEB 2XQYG 2WP3O 3CXDL 1NCTA 3M17B 1FJ1A 5GRYA 4KK5C 4G3YL 3MGOB 3DYOA 5A16A 5KSBE 3N85H 4E42A 4W6YB 1IAIM 5I1HL 2R0LL 5CMAB 3BE1H 3BUTA 32C2B 5ELIA 1EHLH 4HWZB 4NQSB 2G5RA 1HK6A 1BAFH 3ARFD 3H7LA 4R4ND 4K71B 5D5MA 1CK0L 4YXKH 5TE7H 3EW3B 5C70A 3C6LC 3O4LD 4NIKB 3TO4D 4HH8A 1LEKB 4YFLF 5C0AD 5DLMH 1U91B 4MJ6A 5HVGB 3EYSH 4LLQB 1YEJH 3R1GH 1X4ZA 4N0FA 2Q76B 2JJSA 4M4RA 4Y5YB 4U6XA 1ZV5A 3ZTNH 1BBJB 4WW1A 2AP2A 3O2DL 4FQJH 4HHAA 4ZFFB 3NIDE 4JFZH 3IDJA 3IDGA 5FK9A 5T1DL 4GW1B 4R2GD 3ZKXC 1P5VA 5CEZH 5I2IB 3U9PH 2H9GA 3PXJA 3MRFA 1UH2A 3KVQA 3SQBA 2F53A 1KN4L 4KY1L 4X9GA 4QRPE 4JFHE 2BFVH 3WNOA 4XMLH 4OZIA 5CCKH 3TNNA 1AD9A 2FX7L 5IB3A 5C08D 2EH7L 4X8JA 1NEZB 3AS3A 5DWUL 3LQAH 5BS0A 1F4AA 3MRIB 4KXZI 5E9DA 2BVQA 4UV4H 4JLRB 4JZNA 1RK1B 4Z7QE 5DR5L 3RL1B 3D69A 5C2BH 4C56D 3CFBA 1P2CB 4X6EA 3DXAB 1R5WB 4HUUA 4Q9QH 3G6DL 1V3JA 3T0VA 3ZSSA 1MWAL 1UACH 5DQJB 3EJZC 4PB9L 3KHQA 1QRKA 3BMVA 5K33A 4I1NB 3C5ZC 2BSSA 2XA8L 2YPLB 4OGYH 5DJ8B 3RRQA 3VXPA 3JTTA 3INUL 2FX8L 4LLMA 1J1XH 3UTZA 1MOEA 3KXFD 3TWCH 3W11D 1NLDL 3X3FH 5JA8B 1IMHC 3I3DA 3PIQB 1D9KA 4Y4FD 4XNQA 3LQMA 1DQMH 2PO6B 2R1XA 3FB8A 4O5LL 3MUGA 1A2YB 1UWEH 5B3JF 3S5LA 3PL6B 3DO7B 4DAGL 3EUUA 3U48A 4YDKL 1MCFA 5E5UB 4HKZB 5CKAA 2LTQB 2IAMB 2Y6SD 1KELH 2AJSL 5I16B 3ESVF 3MRQA 4PP1D 3DX7A 1OAQH 1U42A 3RKDD 3BPNB 3DXAE 1KCRL 1A6WL 4LCYB 3RUGF 5D96B 4G42B 5DMGC 4JPVL 5A3ID 4J3UA 5DMIH 2R15A 5DVOA 4XB7A 3F7RA 5TE6L 4HUWA 3IDXH 2EE9A 1MJUH 2DLHA 5DFWH 2YPLE 3P9MB 3E0GA 3EYVB 4R6UA 4Y8DC 2JB5H 2BVTA 3D3VD 2EEBA 1IGFL 5EUOA 5EU4B 3NAAL 4QO1A 3QP3A 5ENWB 3TA3A 3MJGX 5CJXC 3C8KB 2IBGA 1XGUB 4S1QL 3MRRB 4BZ1H 4Y88A 5F7UA 4P2RA 5CHNA 2R4RL 3SKMB 1U8KB 4Y2OA 2QQNH 5D2NB 1U8LA 1RULH 4ODXA 2ADFH 1NEUA 3DX8B 2P1YA 4N8CH 5DMYA 1K3ZA 2A74A 4XBGA 1AKJB 1KEMH 5KVGH 2ZSWA 5I8CA 4X7SH 2YD8A 2FD6L 5KW9H 5DD1H 5J1TC 3EKCA 4IRZL 5IESH 1RSFA 5ANME 3OKDA 1FORL 4DN4L 1KIUA 3D2UA 5L8KB 4BELD 5IVOA 4PJBF 3E6FA 3T2PA 1LE5A 5KVFL 2HKFH 1AC0A 4JZJB 4MNGB 5IB4B 1ZT4A 4C56B 1LP9F 2FEDD 1NGWB 3ARQA 2AJXH 1SY6A 5EU7E 2A1WH 5B3NA 2X5PA 2R9HC 3F58H 3G08B 1TJIH 4NNXA 4OLWH 2WNGA 1JRHH 5M94B 1A6WH 2NY2D 3QDJB 4R4BA 5EFIB 2AJYL 3X14B 1UWXK 3BP4A 4NO2B 5EZLB 1QA9A 4WFHD 1NKRA 4EQ2A 2OQJB 1K4CA 5I9QB 1FFRA 1U41A 2VDMH 4X5XB 5SWSA 1ZHLB 3WD5L 3RTQA 4Y4FB 3ULUF 4XI5C 1D5XA 2X4UB 5ICYA 1IGTB 1XR8A 4X4XA 4MZ3A 3EOBB 4NQXB 1P4LB 1T89C 2CJUL 4AYFA 3QWRD 2MPAL 1U6AL 4OLXH 3NA4A 1CICA 4CN4A 2PETA 3O8XD 3MNVB 4ETQA 4U1JB 3L3HB 4JDVB 5I1JH 1JPTL 4N8VG 1E6JH 4MNGE 2IQ9L 5FO9A 1G6RH 5HD8D 3SDAA 2YR3A 3IF1A 2P8PA 4GS7B 4FQLL 4XWGH 5D8JL 5HHMD 1P4IH 4ZSOA 3TH4T 1KCVL 5BZWA 2SEBA 3VXOB 4FHBD 4UDUB 4M02A 2EXYC 1NL0H 2NTSP 4FQCH 5F1KC 1U8HA 4OFKA 3TFKD 1MAMH 3QFJA 2GUOB 4P4KA 3B43A 3ULVH 4HXBH 3QDJE 1OP3H 5JDJA 2X4TA 5JHDA 1QRNB 3VFRA 4EXPX 3GNMH 1AJ7L 3ALXA 4YC2C 1IQWL 1D5BA 4Z8FL 5KN5B 5H94A 5HGGS 4FQ2L 3TO2B 3MRLB 1I7TA 4M5ZL 3H9HB 4POZC 5CZKA 5GGRY 1LDPH 1YJDL 3UTSD 4JGMA 1JHKH 4OZHA 5SX5H 1I8MB 5F3BB 3I3BA 4FTVD 5EZJB 1IRAY 1MLBA 3VDAA 4PRAB 3V95A 3VXUA 1LHZA 4X6CB 3NN8A 4WU5A 1HHHA 5IHUL 3MR9B 4IM8A 4QY8B 4S0TD 2GCYA 3KPTA 1U8PA 3UYRL 3LOWA 5I73B 3NZHH 4JVPA 2NX5D 2X70B 5EO0B 2VLJD 5EDXA 5J13B 3W0WD 3DHJA 3FQTB 3FQRB 2AQ1A 1Z5LA 4Z7WF 4S1RH 3QNXA 1I3VA 2I60H 3UZEA 3VRIA 5DFTA 4AQ1B 3RPKA 3QDME 5B8CC 2VDKH 3FT2B 2GTWB 2DBJA 1QRNE 1G9EA 5IVZB 4FQHA 4K8RC 3QQ4A 2AEQH 3VRLF 4CMMB 2G5BB 1DCLA 3DNKA 2J5LB 4BQCA 2XG5A 5EC1A 3LEXB 4L8DB 3TLRA 1KIQB 3K0WA 4OGAC 1FFPA 3CFJA 1SEBB 4PLKC 4KJPC 5EA0H 3JV0A 2Q3ZA 4Y7MA 2Y07H 1GOFA 1I3RA 3RA7L 4RA0C 4HC1H 1CFVH 1N0LA 3LN5B 3RUGB 2DQEL 4M48L 2GITB 1BZ7A 1XIWC 3PV6A 3QAZB 2XTJD 3CFKB 7FABH 3O8XB 1GIGL 5ACMA 2IH1B 1JUFA 2F9BT 5CWSA 1ZHBA 1A4JA 3P0VH 3O3DB 2V2TB 4ZO8A 2EC8A 3WJLA 3BZDA 1AFVH 1PYWA 4K3EL 4HJGB 4OCRL 5EPMB 1BGXL 3SO3C 1SYVA 5KVDL 4YXHL 3BQUA 4LCIH 3U82B 4BKLB 3VFNA 4KQ4H 5C6TL 4QGTA 1Z9SA 3OPZL 5E99L 4XCNB 4G6MH 4GW5A 4ZO7A 5FKAA 3KDMA 4YHPB 3SDDC 1E4WL 15C8L 4WUUD 4OKVA 2R0WL 5B3JE 4FABH 3BZFA 3FCTB 1NCCL 3QISA 5CZVL 4EDWL 3NMEA 1C5CH 4X0KA 3OZ9L 3QXAA 4HJ0C 1KIRB 1CLZL 5F7HA 4MA8H 3QUKB 4PYHA 3K8KA 5CEXB 1F00I 4FTVB 1AGBA 5HI4D 4JO4H 3KPPB 3RUGE 1R5VA 1LP9B 1RUKL 2PTTB 5F3HA 5IQ7L 1Y18A 5IVXF 3HMXL 4LVNB 2FBOJ 4IIQA 4PJCB 1ETZA 2V5RA 4B7LA 1A9EA 1QD0A 1DJSA 3PDGA 3FQUA 4U1HA 2ITCB 5CILL 2NX5B 5DZNA 5HHNB 2O26U 5KSAA 3O3AA 3IXTA 1VKXB 3SJVD 3QIUB 2J8OA 5DA0B 2D7TL 3V9FA 1QFOA 1RK0B 2E9WA 1DLHB 4FQIL 4N1CA 1EJOH 4LFHD 1EUUA 4AEHH 5FYJH 2DAVA 1A1MB 5GGSY 5JLZB 4QRTB 4MNQB 2HTLC 1HWGB 2VISA 4ZS7L 2ESVB 2B1HL 3GIZH 1QKZL 4GKZA 4NOFA 5M95B 1LK2B 2HTKD 4PJBE 4PTUA 2W60A 3VI4F 1RIHH 5MHSD 3VA2C 2YXMA 4MX7B 1RJYB 1EUTA 3A6CH 5GRXG 3SOBL 1LP9E 3MMEB 5EOQH 1CXHA 1BFOA 3S8WA 2OJEA 1DBKL 3QEUA 4F57H 4HEPG 5ITBH 3RIFK 2DQUL 4Q2ZB 3GBML 1FL3B 2DQGL 3BESR 1HE7A 4N8PA 4Z0BH 1FLRH 1JRHI 1VERA 4K9EC 4GMSH 1CT8A 3MREA 5JR1H 2NX5E 4U1MB 5TFSL 1MY7A 5FOBA 5ESVB 1T6VN 3F7QA 1CVSC 3O41A 3VWJA 1JJUA 1LO5B 4TTDD 1V3LA 5DI8A 1EA9C 1B0RB 4X6FA 1AHWB 3UTPD 1RZKH 5CINH 5CILH 4CW1A 2FGZA 3ULUE 2JCCB 1XF3B 3HS0B 4EI5B 4ODWA 4KMTH 5IEKB 3TPUB 1T5WB 2FNBA 4MNQE 3P40A 1ZLVK 2DQCL 2ESVE 2GSGA 4PV9A 5HDBE 3HR5A 4XP5L 3S88H 4W6WB 4PG9A 4YUEH 5F6HI 3RDTD 4WJ5A 1MFAH 2NY5L 5EN2A 5KANG 3CAFA 1AI1H 2X4QB 3MLXL 1AIFB 3I75B 3BZ4B 1QR1A 1NBZA 2OL3A 5DSCB 4W6XB 12E8H 1HILB 2OP4L 2LFGA 3SBWA 5GRWA 3LKSA 3CH8A 5BV7B 2AW2A 4WFEE 2A83A 5I17B 4G7YH 4XPFH 2WINB 1F3RB 3QCVL 4P5TC 3MBEC 3BVNA 3QCUH 1EEQA 2QEJA 1U8OA 2Z8SA 4XX1E 2VH5H 4P46D 1VGEH 4L9LB 3IETB 3RWFB 4A6YL 5EORH 1KYOJ 1X5JA 2A73B 4Q9CA 2XQBH 3IDYB 1RZJL 3U0TA 3SDYL 1QLFB 3MRNB 3L6FA 1MIMH 5EIVA 4CADB 5EZOH 3EYUL 3HUJA 4KGLA 2GJ6D 2FHBA 3UC0H 3U36A 4UILH 3KG5A 3SGJC 2VSCA 3S4SB 3X3GH 1T7ZA 3DVGA 3QI9D 3FFCA 3WFBH 5INDB 4XNYL 1VHPA 4NFBA 3B3IB 1SEQH 2QQLL 4ORZC 3GSNA 1G7QB 5DUPH 1OAKL 2FX9L 1A6AB 5C0DA 5D71H 4PRPA 4X4ME 1XGQA 1LNUA 4OB5L 4AIXA 4HIEB 4JG1L 5I15L 3HLAB 4LKCA 3ARGA 5T3ZE 4UTAL 2PCPB 3I6GA 4U6HB 3VXMD 3EDEA 5CJQH 4FFVC 1IEHA 1RJLA 1W72B 2E8ZA 4JQXA 1AGEA 5F71A 4Z7WE 1PZUB 2FDBP 4BK4A 1N8ZB 3L3KB 5JOPD 4UU9A 4G6AD 5EBLB 5EOCH 3N9GL 5DQ9B 3ZL4L 2RR3A 1GGYA 4IMLB 5D7LA 5FHAL 5DT1L 3SKJL 3MV01 3R8BB 3VRLE 1DQLH 4LL9A 2Y5EA 4G9DA 2Q86B 1LEIA 1FH5H 4NQUA 1BX2B 4DZ8B 1ZVHA 4NKIH 4HDIA 5DD3H 1U36A 2YA0A 2UWEF 3BRFA 1NFDB 3IJYA 3KPLA 1CFTA 2E7LA 1PKQA 4RQQB 1A6VH 3SEPA 1HSBA 3HE7C 4TPRH 4XCCL 1W0VB 4S2SA 3VXNA 3T8XA 4MGXA 2ZSVB 4HSQA 1OW0C 3N0PB 5E2VH 2YPVL 1CR9H 3A6BH 4C4KO 3V0VB 3DMMA 4ELMF 4EQ3A 2Z8RA 3PXHA 1MI5E 3D85A 4BZ2H 2VLME 2AEWA 4H8WH 3DECA 2VWEE 2KKQA 1P7QD 2P8MA 3QUYB 2I25N 2C3VB 4KKBC 5HGHB 4TOYL 3OQ3B 1MJ8L 4PGEB 4K71C 4UTAH 2ZJSH 3BISA 2NXYD 2VXTL 5DFVD 1Q9WA 5FUCE 5AYUL 1G7LA 2CH8A 1IFHL 1OLZA 1NH6A 2F5BH 5I1LA 2O61B 2EDHA 3BXNA 1XGYH 1F90L 3EDKA 4F9LA 1MUJB 2GJ6B 5TDNB 2VL5B 3BKML 4HMDA 1SBSH 2VC2H 3S34L 5EU6A 3MZTA 4Y5YC 1J87A 5JOFA 3RHWK 1T2JA 5IWLC 1FHGA 4JDZB 3C9NA 4DQOH 3TBSB 2Y5TA 4CU6A 1QLRB 3KWWB 2VR9A 5DEGB 5GSRA 1I85C 2EDKA 4YXLH 3ZKMC 5J6HB 4YR6A 1P4BH 4PBVC 3VW3H 4GW4B 1HXMB 5TF0A 3RWGA 1MJ7H 3FFDA 3VXMB 3HI5L 1FVEA 2XPGA 4FQXD 1ZA6B 3GJFK 3Q5OA 3TC9A 1PX4A 5DURD 1QSFD 3C8HA 2AABL 4NOBA 4ZS6C 5KG9A 2C4FT 3MLRH 4RGND 4XRCA 3ARPA 3MFFA 1TZGL 4XC3H 3QHTC 3OXRA 3S3JA 3MV7D 1BD2D 2KPNA 5DS8B 4BUHA 5GIRA 3RQ3A 4M1GL 5TE4H 3PDDA 1YPZA 4XWOD 4XHJD 3NACH 4LKXB 4OF7A 1FZJA 4BYHA 1ZT7A 2WV3A 1AD0A 5DGQA 2ICWB 4OFPA 3RL2A 1UM5L 1F4HA 2X10A 4JFPA 2P49B 1KCUL 2EO9A 4M1CC 4K07A 1HYSC 2HN7B 5LGJA 3QNZB 5K9OA 2EH8L 2EE3A 2XN9E 2HH0L 1TZHB 4OF5A 5CJOH 2JTDA 2NY6D 1D6VL 1T0MB 4R90H 1RMFL 3L3IA 3GMOA 4KZDH 3ILPA 4K7FB 4FFZL 5FV2A 2PO6C 3EFDH 2DMBA 2IJ0C 2OMBA 4F33B 1TCRA 1SM3L 4TNVF 3PL6C 2YC1A 1IC1A 3PDOA 3DX9B 1T22B 3OF6D 4O58L 5DRNB 2LTQC 2IAMC 3LKRB 3HPLA 4LEXH 2O5YH 4RA3A 4XNXH 2AS5M 1ZANL 3MOAH 1ZLWH 1H8SA 3LSOA 3O0RH 2NXYB 5FB8B 1S7UB 5C0RH 4KQ3H 5F9JA 3QPXH 5EC2A 3PWLA 3WNPA 4XAWL 3BPNC 3B9VA 4LP5A 4QRUB 3QSKB 5D96C 2R2EA 3MV8A 2WBWB 1FFOB 4D0BB 3P9LA 5EH1A 3ME0A 4LLUB 5EU7C 4OCYL 5DK3A 5ICZB 4RWYL 3GUTA 1J5OL 5L8LB 4YFEA 5DHVH 4AMKH 1T2QH 4LLDA 3PHQA 2F54A 3GSXB 3DOSA 3ILQD 4X7TB 5BMFH 4E5XA 1YEKH 4NRYA 3CFCH 1RZFL 1CXLA 5JQHC 5K9JH 5F88A 5EUKB 3QJHA 4TSAL 2X4OA 3TN0A 4R2GC 3T1WA 3QZWA 5HHPA 1FL5B 3KNBB 5D2NC 1OAZL 1YECH 4F2MB 3JUYA 2VXVH 3GJEA 3NOIA 3CCHA 2CDFA 1ES0A 2PXYD 4U1GB 2NZ9D 1ZSDB 4LSUL 1JBJA 1DTUA 2Y06H 3KYNA 4GJTB 3DROA 3W39B 1CGUA 2B2XL 5I76A 1A64A 3VRJA 1QSFB 2GSIB 2FBJL 5F1IA 4RGNB 4FZ8H 3B2UC 2UWEB 3IT8D 3VH8G 5EBMA 5F1NB 2R0KL 5MEOB 4PUBH 1E6OH 2JJUA 1BD2B 4Q9RL 4XC1H 2XT1B 2BNQD 3D25B 3QRGL 3SE3A 4DTGH 4GG6A 3BPCA 4ELKA 5SWZD 5GRJL 3KPSE 2CLVB 2DJSA 5IMOA 3KPQA 2A6IB 1FIEA 1NJ9A 4G6FD 4ELMB 2AXGB 3MLVL 5B4MD 3FONA 3JV5A 3SE4A 4IHOB 1I1AD 4L4TA 3VFUB 3VD9A 4PREA 5DK0B 1J10A 3W11C 1DQDL 5KS9B 3IJSA 2DQHL 1EGJH 2YA2A 4OAWB 5DJ6B 5I9QC 3PWUA 4LU5L 5KANI 2WANA 1F2XK 2ZOKA 2RFXB 3GDBA 3PGCA 4HKBA 4KTDL 5DJ0A 3L5WA 3OKEA 4H20L 1NC2D 2M1KA 3SKUD 4Y4FC 3MCG1 1N59B 3DUSA 3AREA 5TDOB 2JJTC 4QXTB 2OJZL 3NGBB 3VE0B 4EN3A 3L9RA 3N1FC 5ERWB 4JKPH 1CE6A 3VXSA 1UZ6F 1IEAA 1QSFE 1RUPL 4KKNA 4X9IA 3CSBA 2ZP0T 1FNGB 4O9HL 3TBYA 2CIIB 1AQDB 4RGNE 2IEPA 5IBUG 5GS1A 2UWEE 2Y6SC 2X4SA 2OCFD 5IMLB 5CEZD 1WWBX 1T21A 4PP1C 5C07D 2UUDH 4ZODA 5CBEA 3OX8B 2Q8AH 3G6JA 2HWZH 4GS7C 5H2BB 3RKDC 2XZAL 1MQ8A 4U1KA 1DSFH 1N6UA 3X13B 4XGZB 3TZVB 4LSPH 3ARDD 2BJMH 5HGBA 3LIZH 1CBVL 4ELME 4MQTB 2MCPH 3MRKB 1X5ZA 1YNLH 4N0YH 4G8GB 2P44B 3ZDXF 5FGBC 1DVFB 3KJ4B 3WDHA 1P6AB 3PQYA 5LQBH 1E28B 2BNRD 1D7FA 4JPWH 5GSVA 4J3OC 3IFNH 3SPVB 3RHWF 1J1OH 3CU7A 5ICXA 1XF4B 4UV7H 4UT6L 4APQA 3QEQA 3PNWA 3MGAA 3QDGD 4NQED 5FYKH 1GGCL 4MAYD 4RAUB 2DI8A 3QEGH 4PJ9D 1F8TL 3DTXA 1N0XH 3CUPB 3M8OH 5HPMB 2ZG1A 5T5NG 3UJJH 1EEYB 3TNMB 3AS2A 3PGFL 5I73C 4G6JH 3VXQB 4OCNC 3UCRA 5CD3B 5IEHB 2XZQL 1GPOL 5ESAB 2BNQB 1MHCB 2MCG1 5J13C 3ISWA 2R2BA 1MFDH 3UZQA 3ARXA 5IBTL 2VITA 4IJ3B 4PRHB 1Q38A 3O4OB 1S3KL 2XKUA 1WFOA 3MV9E 2ARJA 2CXKA 4G7VL 3I6KB 1K4DB 5F97E 3GSWA 3BIKA 3H2WA 4UQ3B 2J6EH 3RI5F 3AU1A 4G8GE 2NY2C 2WUCH 4HUKB 5ECJE 1H3PH 1JMXA 4JANA 1I1AB 5CFHA 1KB5B 4RMSA 3PWPE 4GAGH 2F74B 4HV8A 3PABB 3WNMA 1CBVH 1CFSA 3X12A 3QUXA 3CD4A 2YSSB 3ARYA 3DETC 5IIEB 3S6CA 1G9NL 3CFIC 1ERNA 1A7RL 2RQ8A 2D7NA 3KYKH 3HRZB 3D39D 4TVSa 2HLFD 2WW8A 4IMKC 5D9SB 4CRPA 1G6RA 1FE8L 3TBVA 2YRPA 1EHAA 43C9A 4OZGA 4Z95L 5T1MA 3O8XC 4U31A 4WU7A 1N4XL 1ZGLB 2P5WA 3L7FB 4NBXB 4DUXA 1PLGH 3V5DB 3VG9B 1NGZB 4H5SB 5C09D 2HRPH 2Y72A 1X3DA 5C07B 4NZDA 3VD5A 1E27A 4JO3H 4QRRA 2ZCHL 3MCLH 2CKBH 2BRQA 4PRHE 4MNHA 1F4WH 3V4VH 1QFWH 3OHXB 4O2EB 2AI0L 3ARDB 3L7EB 4G8IB 2P45B 3ZLQC 4B7IA 2X44D 3OB0K 3TFKC 1A6UH 4OZIF 5TQ0L 4DZBA 1OLLA 5MEQA 3DX6B 1NAML 4OF0A 4MJ5B 2XKNA 3C60D 3B5HA 1TIUA 3DVIA 3S35H 4XPGH 3QA3A 2X89D 4MQXC 3QQ3B 1J8HD 3BN9D 1ND0A 2VXQL 2UYLB 3LQZB 1IAOA 2X7LB 5EBWA 4Q6YA 3AMKA 2DN7A 1BFVH 2DQFB 3F7YB 1U9KA 1BIIB 2FR4B 1XR9A 2V7NA 2YUWA 4MAYB 2LV4A 3JV4B 3LD8B 3G04A 5D6CA 1WIUA 1GGBL 2CUHA 4MLSA 4A2LA 4M5YH 4B41A 1FVCB 1OD7A 4ZFOL 4LVNC 5I19L 4JVUA 4KMLB 1RUQL 3NTCH 1TVBB 5SWQB 3GM0A 4NKMA 4DK6A 3T08A 2EIBA 2H26A 1A7QL 1EZVY 3W9EA 1RD6A 5JPMA 1CDUA 1A1NA 4N8VA 5A2IH 1KJ2A 3NIFF 4Z95H 3RVWC 4NO3A 5BXFA 3MZGB 3WLWD 1YN7A 4YNYA 5D93B 1IC5L 4PJDB 3GBNH 4G8FB 4Y5XA 4Z76A 4OM0H 1MCEA 1MREL 4K94C 4B0MM 1P84K 1ZHKB 2DDQH 1DEEB 3W9DA 4CUCA 5HVHC 1WC7B 4OV5A 4QHNB 2HJKA 3AC0A 4K7PY 2OS7A 4AL8H 5IFAH 3EO9H 5GS0L 2CDGB 5JW4N 4HC1A 5HHVL 4YDIL 3NCMA 1NGQL 5C0GA 4ZTPL 1G9ML 1T1WB 3W5MA 3H9SA 1JZ5A 4OZ4A 3GHEH 2NTFA 3STZB 4PGBB 5HYSG 4UT7H 1MIEL 4P2QB 2ICES 5ISZD 1KTRL 1JHTA 2A6KB 4LIQL 3REWA 3ES6B 4S10A 3QIWA 2OXGA 1S7TA 5T3XE 3O9WA 1ACZA 3V8OA 1N64H 2R1WA 2AAVA 4QXUH 2I5YH 3O6FD 5L2JB 4NNYB 2VSDA 3R0NA 1YMMA 1X5XA 2CMRH 2BHYA 2GJZB 3IFPA 2WWMD 1IC4H 4PJDE 4OLVL 4AM0B 1A4KA 4Y5VB 5DJYA 5DJAA 4HCRL 1AHWC 4ZNEA 2ADJA 3P30L 4RGOL 5CUSH 1MAJA 3MBXH 2W0FA 2BDNH 3CSYA 2N7BA 4FFYH 3WUWB 1PKOA 4X7CC 5E8PA 4POUB 4EI5C 5ABDE 5JMRA 2HLAB 3C60B 1OGTA 2BZDA 3OGOE 1PEWA 1B0GA 1Y6KR 2CKNA 4NYLA 2ORBL 1SJHA 5FFLA 2NY0D 3WL9B 3C09C 3LN9A 5IB1A 1UYWL 1BF2A 5D6DC 5E2TL 5T5FL 3P9WB 5CSZB 1QVOA 4D8PA 4DVRL 3GJFB 3PWNB 4P2QE 3VGGA 1NCBH 3MRMB 4PJFF 1QFHA 3EFFA 4YDIH 1WZ1H 5E2WH 2YD9A 4K8RH 4ZAKD 4KKCD 3HI1B 4CGTA 2YD6A 1GZPB 4Z77B 4XXCA 1FJ1B 3ZKQD 2VUOA 1R3JB 5HHOD 4L9LC 4CNIA 1QSEA 5F8RC 4QHLB 1CE1H 3MXVH 5IB5A 3U4AA 3IDYC 4LAQH 3UPCA 3L5HA 3ZDXE 3ZT6A 1Y0LA 8FABB 3H9YA 1X7QB 5D5MB 1IAKB 1MFEL 2HG5A 3HC3L 1RZ7L 5D70H 4L4VA 4M6ML 3LHPL 3DURA 1HKLH 1C12A 4NP4L 4KRMB 3OJDA 2WP3T 3LPGA 4XTRD 1ZLSH 2PR4H 2YMXL 4MJ6B 4M7JL 4LSQH 4XPBL 4I0PD 4N0FB 5C86A 4JQVA 5JW3L 5DXWA 4R3SA 5IW1A 2EDTA 1A3QA 4NC0B 4U6XB 2ZPKL 4WW1B 3S97C 2V2WA 2HTKC 4HHAB 4OJFH 1G7HA 1M05A 1OM3L 1A9BB 3IDGB 3BDXA 1L6ZA 1LK3L 1HCFX 1K5NA 2IANE 4BQ8A 2LU4A 3AB0B 3E1F1 1C1EL 2B4CH 2VWEC 5LXGL 4NO0A 5J57B 1KENH 2J7LA 1Q0YH 3MXWH 5DVMA 1MCLA 3O6FB 4OZIB 2AXFB 3TNNB 1T1YA 1AD9B 4XMPL 5IB3B 1T1ZB 3RX8A 1QFWM 4X8JB 3RIAF 2ZUTA 2XG4A 3MRBA 2QSTA 1LGVA 1RJZA 5D5ME 1CXIA 5BS0B 2J8UB 1DBJH 5E9DB 5GGTL 4JFFA 4TTDC 2BVQB 4PBXA 5JIKA 3QEHA 4OZHF 4JZNB 1IM3B 1KCSH 4TRPH 2I07A 3ORJA 5F7LB 4G43A 4X6EB 1LO0L 2EC9U 4KUZL 1KCKA 2K3TA 1RZGA 4KTYA 1HHKA 1NDMA 1XGPA 4NBYB 3UPRB 3F65A 5HDOA 4RAVA 4XP1H 3RDTC 2NY0B 1TJGH 2BSSB 2R0ZL 2J12B 3VXPB 4M6NL 3WDJA 3JTTB 3CDGB 3HMWH 3WS3A 5T33L 2UZIH 5E4EC 2ATKA 4K2UL 5E03A 3T3PF 4JRYD 2OTPA 5D4QA 4D3CL 2CRYA 3WIHH 1DLFL 3ECBB 5GGRA 5I1GL 2F53E 1S78D 3TYGH 3EOTH 4ZAKB 1D9KB 3U6RB 1HQRA 5C9KA 4XNQB 3T77A 2CK0H 3EOAA 3QUYC 4K3DL 3FB8B 4WCYH 1V7MH 3IAQA 1KNOA 1T7XA 2QBWA 4OZIE 3S5LB 4LRIC 5JXED 2NQCA 5AWNL 2IPKB 4UT9H 3FHAA 4XAKE 2VQ1A 5BS0E 5E9DE 3ULSB 1KEGH 2YKLL 1IKNC 2VKWA 5I1AA 2GK0A 1MRDL 3DX7B 4K9EH 1CF8L 2CK2A 3LEVL 5GZNC 4WRLA 2YBRA 1YYMH 5GHWH 2VQTA 4L8CA 2FYYA 3GSQA 4I0PB 4HUWB 4O02H 4GRLD 2A38A 2VDNL 4QRSA 4LEOA 4RGMB 1KPRB 3PHSA 4HWBH 1UA6L 2RAMA 3HC0B 4PJEA 5KZCD 1UJ3A 1ITBB 3PP4H 1CFQB 5EUOB 1TITA 4J6RL 2C1PA 3Q48A 3TA3B 1GC1C 4G9FA 1NGXB 4ODSL 3DYPA 1HEZA 3MRGB 1U92B 1J1PH 3I6LD 4PPTA 5L2KD 4P2RB 5CHNB 3WDIA 5E2UL 2NY1B 1ZVSA 4YBQD 1C5BL 5D7JA 1U8LB 1OQXA 4ODXB 3WFHA 3MRJA 2A74B 3FO0H 4Z7VA 4JFEA 5FHBL 3HI6L 4G6AC 2FEEI 3BT2L 2EDYA 5I8CB 2F58L 1X6LA 4NC1E 4UMGA 1I7RB 2H2PC 5KOMC 3O6LL 3OKDB 1N2RA 3OKLA 4GH7B 3D2UB 1Q9KA 4M43H 1LE5B 1IZJA 2IMNA 3MCKA 4G5ZH 4R26H 3MRHA 3CX2A 3HZYB 4I3RL 3SE9L 2Y23A 4FXGB 1WWCA 2VZSA 1ZT4B 2X1QA 3UXFA 1A5FL 3D0VA 3UDWC 2PW1B 5FYLH 3CGTA 3S96A 1YQVH 3UTTD 4NNXB 1A0QH 1FL6A 1VFOA 4ZFZB 5EUOE 4R4BB 3ARVA 4H25B 1BWMA 5IFHL 4LHUG 4OM1H 3BP4B 4NPYA 1I9RH 1QA9B 2X42A 4P2RE 2ZCKL 1K4CB 4Z18A 1J0YA 1P1ZA 3CMOH 4WV1B 5SWSB 1L7TH 5I1KH 1M71B 2YOCA 1D5XB 2MSPA 5DQDL 5FGCB 1CVRA 4KK6D 4P3DA 5GGVY 1XR8B 3IKKA 5LGHH 4KAQL 1NAKL 1NLBL 3NPZB 1OGAD 1FZMB 4L1HA 1S5IH 4OD2B 4J23A 5DRWA 2NXYC 1MFCH 2DM7A 3WO3B 4ZOBA 4ETQB 1JGUH 2DQIL 3UJTL 2FB4H 2VDPH 2XRAH 1GGIL 2A9NH 3BT2H 4XP4L 1KFAL 5FO9B 2Z35A 3SDAB 3IDNA 3IF1B 4P48A 3M1BA 2DLEA 4ACPA 4JFDD 4ZSOB 1EX0A 2K7PA 3CX5J 4L3CA 5BZWB 2SEBB 4R0LA 3ET9F 3PV7A 3SY0A 5L9DL 4PJ8D 4OD1H 1XF5A 5E8OB 2K9UA 5GGSA 3T1FA 5FCUL 1R3IL 3D5OF 5KZCB 3BYTA 3UAJD 3KS0H 1AGFA 3JV6A 5JHDB 4OI9A 3VFRB 3AS0A 4JN1H 1D5BB 3S36L 4LDLB 4JE4B 5H94B 4XNZB 2EYRA 2AEPL 2D31A 3I2CH 2QL1A 1NUFA 5SWSE 2AJ3B 4L8SA 1MSPA 4U1GC 4HEME 3RNQA 5LWYH 2DQJH 1NC4A 5FGCE 4X7DC 4OZHB 3TT1H 3OAUH 3AMLA 4QTHA 3F7PC 1TJHL 1MLBB 3MACL 2XZCL 3VXUB 3QQ9D 4RGNC 3SCMA 3NN8B 3MLYL 5DD5H 4WU5B 1ZEAH 3NCYP 4PG2A 2CR6A 4P2OA 4DKFH 2VXUH 1ZGLP 2APFA 2GCYB 3IFLL 4ZUSA 3WXVH 2JJWA 3ZT5A 4HUVA 3B5TA 1CTNA 1A7NH 5J3HD 4N1EA 3FOMA 4OLEA 2CUIA 3BKJH 5EZIL 2DLTA 3CVHA 1F4XL 4HKXA 4IOFD 4ZSOE 1MCOH 1Q72L 1BM3H 4UI2A 4PIRF 3B2VH 3NCBB 4P23A 3O2WL 4FQQA 1KN2H 1X5YA 3QFJE 3VFSA 4JHAH 2WLZA 3ALWA 3VRIB 4HGKC 3DVNA 4MVBD 3FMGH 5JHDE 1DE4A 4M1DH 4LVOB 2VRAA 3V6ZB 3MUZ1 4FQHB 1FZKA 3LS5L 3HRPA 4YPGA 3HUJF 3UYPA 5EC1B 2KUTA 3NGBC 1FRGL 3OBAA 1FFPB 3SGKC 3CFJB 4OZHE 2W92A 1MVUA 3CSPA 3OAZK 2HFGL 2ITDA 5DVNA 1I3RB 3VXUE 4HMCA 1OGAB 4BA8A 5HI3C 4D9RD 3OJVC 3VJ6A 3PV6B 2IQAB 1GSMA 1CL7L 5DHVA 4NN6B 1A7BA 1JUFB 5CJ8A 5CWSB 1CFNA 1ZHBB 2H32H 2YA1A 4I13B 4XP9H 3TZVC 1QNZH 1MNUL 5I1CH 1OAYL 1QSZA 2AGJL 2OSLB 2BSTA 4JFDB 4KWUA 4OD3L 3BQUB 2XWJA 4MXVF 1K9TA 5E00A 3VWKD 3QUZD 2DWDA 3MUJA 4GW5B 5FKAB 3KDMB 4NJ9H 3W2DH 4HS3A 3F6LA 2BC4A 4FZEH 5BW7C 4MD0A 4U7SA 4QRQA 1BEYL 1JFQH 4GSDH 4X0KB 1JWMA 3SDCD 3TCLA 5I0ZA 3QXAB 3AFLA 4U1SA 2PXYC 2ZUQB 1OP5H 1WBYB 2NZ9C 2Z92A 4ZUUB 4YE4L 3LKOA 4M6OL 4PRID 3RBSA 3WFCH 5HXMA 2WBJD 2GFBA 4RRPA 3DGGA 4DUWA 5FA3A 2NLJA 4XZUA 4NKOA 5GGUA 4NQCD 2AJUH 2ICCA 2BRRH 4XPAH 2XV6B 4Q0XH 1H15B 2EYSA 2GEEA 5F3HB 1Y18B 3C6LA 5E94A 1RIVH 1HOCA 4N90D 4DFHA 1YEIL 4IIQB 1FNSH 3TVMA 4EBQH 1A9EB 3B5GA 1JPST 2E7MA 3U7YL 4PS4L 3FQUB 3LKQA 4ZD3L 2F5AL 2H8PA 4IJ3C 5KSAB 1V7NL 1EGJA 4L3EA 1V5JA 1WCBB 2YRZA 4NZTL 4LMQE 1HINL 3D6GA 3TJEH 5D1ZA 2I24N 5JPNA 3AXLA 4NFDA 5I0DA 1QZ1A 1DN2A 5K9QG 1I1AC 4TTGA 4M8QB 3N1PC 2AGJH 1X5KA 3LS4L 3AAZB 3FQWB 5D2LF 2LVCA 3EYFA 3PWJA 1Q9OA 4GKZB 1UADC 4DKAA 3GIVA 1UZ8B 5HDQH 3CVHL 1YC7A 1CXEA 4GT7A 1SVCP 1WEJH 1YYLH 3WKNA 4D9LL 4JRXA 5MENA 4PY8I 3ARGD 4K3GA 43CAA 1BFOB 2OJEB 4O2CA 1Q9LB 3FO2A 3GBLA 4XCFH 2HVJA 5JORA 3VG9C 1H5BA 1JTOA 2OI9C 2QKIA 4GBXD 1KYOK 1N6QH 4BH8B 3T4YA 3QO1A 2W0KA 3HCVA 3K81A 1CT8B 3MREB 4LRNL 3R06A 1OAUL 5K9KA 2FZ3A 5E8NA 3HC4H 5FOBB 3ARDC 1S8DA 2Z8WC 4XCYA 4UBDC 1UJTA 3B9EA 2MKWA 3C5ZA 3O41B 3VWJB 1U8QB 2PYEA 4C54A 5DI8B 5GGVH 4X6FB 5E6ZA 5AZ2L 4JHWL 1EBAA 1PAMA 4LPWA 3DI3B 3IU4H 4CW1B 3KLAB 4QHMA 5HVFB 4KK5D 1JNHA 1I3UA 1Z0MA 3DGCR 4ODWB 3U4BL 3IAGC 2RBLA 1S9XA 3VFTA 1ZLUK 5IFJA 4PD4K 3HR5B 4TQEL 4WJ5B 5E1HB 1I7UA 3Q5YA 4OFVA 1BVKA 5EN2B 1YPZF 1RU9H 2BXZA 3T09A 1YY9D 3GRWL 4I9WD 4FQ1L 4MAYC 4PRIB 2OL3B 4HFWA 2HJFA 4PJ9C 3HE6D 1KTDA 3DMMD 4DN3H 35C8H 4JY4B 3NA9L 5ESQA 1MJJA 2A83B 4YDJB 2D7MA 4GAYA 2E6JA 2RGSA 4FG6D 2J6EA 5DUML 3V6OA 2XXCB 5KBNC 1T4KB 4I0CC 4KHXH 5FUOH 5MP6H 2MFNA 5C0FA 6FABH 3U0TB 2DWEA 3GSOA 4HG4K 2C7UA 2EDWA 1OT1A 4P3CH 3SQOH 5T1KA 4RZCB 4M7KL 2ZCLH 3PHOB 4EIZC 5CJXA 4KZEH 3U36B 1MRFL 4NNPH 1INDH 4ZOAA 3OGCA 1U58A 3DVGB 1KTLA 5CGYD 4JN2A 4F9PC 5LBSH 1IQDA 4AG4L 5IJKC 1T1XB 4FP8L 5SX5K 3GSNB 3VD4A 2D7PA 4P4RA 3WE6B 5E5RB 5C0DB 4EZMA 2GTZA 4PRPB 3QDAA 3O11A 1LNUB 2CRIA 2CKBA 4AEIL 4L3AA 1JPSH 2V5YA 3ARGB 4KI5F 1DQTA 4KHTH 5I74C 1B4JL 1BPVA 1RJLB 4RISL 2G60L 3NH7L 1AGEB 2QHRL 4N90E 2FATH 3D0LA 5DJZA 4GQPH 4OGXL 4U6VH 1QP1A 1AY1L 3CJJA 3GO1H 5JQ6L 5FYKD 4I18A 3KLDA 5DJCA 1IEBA 2VR4A 5D7LB 4Y5VC 5C0EA 1NBVH 3GHBL 3T65A 3BUYA 4LLAA 2AK4A 4U0QB 2IBZY 1EO8H 5DD0H 5DUMH 1IGML 1SBBA 4AT6B 3RNKB 3HUJE 4CVXA 5AD0B 2DQTL 3MODL 1IGJA 1P53A 1FPTL 1UWGH 3LV3A 3C60C 3BP6B 2W9LA 4AZ8A 1QYGH 4TSCH 4PJIB 1B6UA 2DM2A 1U8JB 3BN9C 3KPLB 4HLZG 1CFTB 3TIEA 1PKQB 4M7LL 3RY6C 1INEL 4FMKA 5D7SL 5I18H 4ESKA 3FFCE 1HSBB 2FIKB 1L9MA 4GG6F 5CBAA 1U2CA 4S2SB 3VXNB 2WWKT 3ZE1E 1FCCA 5ILTL 2ATPA 3QH3A 4PRPE 5H8DA 1Z6JT 2V9QA 1PGRB 3DMMB 4YBHA 3QIBD 3D85B 5ADOH 3P77A 1AXTL 4S11A 2HAZA 2ZOLB 4JFXB 1HH6A 5HY9A 4MXVE 3HG1A 4W4OC 1R3LA 2P8MB 3BGFC 3I84A 3KPOA 4ONFL 2QSCL 2XZZA 2DLGA 4AY0A 3IB4A 4PLNC 2QSVA 4QTIL 3BP7B 2DS4A 1JYWA 5D7LE 1FDLH 4PB0L 3LH2H 4ZOEA 2X4PA 1Q9WB 4QXGH 1BMGA 2VLLA 3Q1SH 3ARSA 3I02A 4C4KT 1G7LB 2R4SH 5CJ5A 4MDJB 3RWEA 5I1LB 1JK8A 4PR5A 1MAKA 3BXNB 3LDBB 3P11H 4PV8A 4KTEH 4X7FC 3ULUL 1AXIB 4RBPH 1GAFH 5J89A 3RZCD 2JJSC 2D3VA 1WWWX 1LVEA 4BH7A 3T0XA 1PKQE 4DKEH 1BFSA 2FECL 3DV4A 1KXVC 3TEUA 5JOFB 4X5WA 3MROB 4OLUH 4AK1A 5AZEH 2Y5TB 3SE8L 3TN0D 4U1NA 1FBIL 2RCSL 5TQ2H 2A77H 5GSRB 1DL7H 3I9GH 1OAXL 2WMPA 4MDIA 3MJ7A 3AB0C 1PSKH 4OUUA 3KPRA 3RGVD 1VEPA 4QF1A 4WUKL 3RWGB 1S5HA 4P59H 2MNUA 3FFDB 5DYOA 4HLZH 4IOIA 1FVEB 2R9HD 1O0VA 2XPGB 4F80A 2R8SL 3O6FC 4RMQA 4LPVA 4HWEH 5KG9B 5IVXA 5EG6C 4J4PA 4XRCB 2WWMC 3VD7A 1V8HA 1EMTL 1U3HD 4R4FH 5I30H 2XIDA 1G0XA 1OL0A 3OXRB 3OR6A 3DSFL 1F02I 5GIRB 1A14L 5B8CA 1YPZB 5I8EA 1FZJB 4XI5D 4YIQA 1ZT7B 3L5XH 3CVIL 1AD0B 3RL2B 5DDHA 5EU6E 4JFPB 4IRJA 4K94H 2NY0C 5CGTA 2E7BA 2G2RA 4AEEA 4ODHH 5LGJB 3SN6N 1E4XH 2VTFA 5K9OB 5AUMA 1YEDA 1W0YT 3EYQC 4HBCL 3MJ9A 2LAGB 1F3JA 2F19L 5A40E 4NGHH 4KRPB 1VACB 4NQDA 3RU8L 1JZ6A 5BV7L 4ZAKC 4KKCC 1D6EB 1D9KC 5HYSA 5T3ZL 3QIBB 5IR1A 2DBLL 3L3IB 3GSRB 3STBA 3VG0L 4JB9L 5ALBL 1TCRB 1AGCA 1IBGH 5JIHA 1KULA 3DV6A 3LMJL 1NCDL 4GQ9H 1HHIA 4NC1C 4PJ7F 5FUZH 2CLRA 4KGJA 1YEHH 2JELL 4J1UA 1I9IH 4OLZL 3AVEA 4NWTL 3LSOB 4LFHG 3RAJH 3QHZL 2B5IB 4YHKH 5DZLA 1E4KA 3S4SG 4YQXL 3BWUC 3MUHL 3DBXA 2XY2A 3WJJC 2M8XA 4YHYB 3SDDA 4C83A 3PWLB 4KPHH 5DHYB 1YPZE 4LPYA 4ERSH 3MV8B 4XTRC 3VDBA 3P9LB 1IAMA 4NUGL 4OZGF 1NGPL 5KSVA 3U0WH 4I0PC 2B0SL 5E8EA 3SDXA 4HKJA 4P99A 1RVFL 2CQVA 4DW2H 5K9QI 3ULVF 3BO8A 3JVGA 4MJID 4LLDB 2F54B 1A3RH 3JWOL 3C2AH 4RX4A 4E5XB 1I9JL 1Q94A 4KDWA 4NRYB 2FJGA 1KV3A 1MF2L 1OY3B 2DKUA 2X4OB 1J88A 3TN0B 4PLOB 4JQIH 3V0WL 3QZWB 5HHPB 4P57A 3RGVB 1X6NA 3KYOA 4OGZA 4I5BA 3W82A 3CCHB 1ZS8A 1ES0B 1W72L 4ISVA 3RWIA 3E8UH 4JCMA 1MPAH 4NWUH 5C0BA 4HWUA 3KYNB 3LCYA 5I76B 3VMPA 5DO2C 3VRJB 2MHAB 4ZFGH 5GS0D 1MQKL 4WFFD 2NXZD 5GRUL 1N5YL 4JB9H 3MNZA 2R1YA 5HYJA 4TUJA 1T0NA 4JG0H 1EXUA 3MV8E 4HH9A 4LLVB 1IKFL 3BPCB 4GG6B 4OLYL 4ELKB 3NABH 1VDGA 2JF1A 1VEOA 4ODTL 3DJ9A 4JCLA 5F7DA 2GI7A 3CLFL 3KPQB 3WIHA 1F11A 3P0YH 4F58L 1NJ9B 4MAUL 5DRXA 1XIWD 2F54E 4KI5E 2C3XA 1EK3A 2Q6WA 1EFXA 4L4TB 2D4FA 4WW2F 5FGRA 4V1DA 3IJSB 3PWUB 4HKBB 2ZOKB 3PGCB 4HT1H 4WV1C 5DJ0B 1FGVH 3L5WB 3OKEB 1MH5A 1T7VA 1J9CT 3DUSB 5EULV 3AREB 5E7FA 3ZSTA 1R24B 2W38A 1R0AH 1P9MA 4EN3B 3L9RB 2E8YA 5BVPH 5J1SC 4Y4KD 3JSSA 1CE6B 3VXSB 4MXQC 2Z4QA 2R69H 1IEAB 3WEXA 5JXEC 4OKDA 2PTVA 4JZOA 4I4WA 3TBYB 5IHBA 2N56A 1HIML 3QXTA 4PY7A 4LSTH 1L4IA 2UVEA 2X4SB 3H0TA 2V17H 3MLZL 2DYPA 3DIFB 1CCZA 4NFCA 4DGIH 4HWBA 3MJ9L 1T21B 3TF7C 4LASL 1YUHA 4ZTOH 4H1LA 4ORGA 5L6YH 3SDAC 2OM5A 5CBEB 4HJ0D 1UM4H 4GG6E 1FFNA 3G6JB 5LJYH 1UEYA 1CG9A 3SKNA 5L8JB 4U1KB 3TYFA 1CGSH 5BRZD 3UTQB 3QULA 4ZDHA 4Y89A 1DANT 5HGBB 4GRLC 5D1QD 2XOTA 3ESUF 2EDLA 3FT3A 4HFUH 3FB6A 5C71A 1A7PL 3MA9L 4PRBA 1GZQA 4IDJH 4L4TE 2P5ED 4OTXH 3PQYB 4M03A 5EWIL 4EI6A 5GSVB 2I9LA 1VFAB 4W4NA 1QUNA 5GISH 4EDXB 2KZ1B 4YBQC 1NCWH 5DJDA 3B8SA 3ROLA 4E41A 1GGTA 3LB6D 4QOKA 2AK1H 5EU3A 2BCKA 3VFGL 4P9HL 3VXSE 1JZ3A 4Y1AA 1QLEH 5KSUB 4AQOA 3DTXB 3G5YA 2D0FA 4HJJL 5HYFA 1WJ3A 2BOCB 5F7NC 2NXZB 1YEEH 4NZUH 1A7OL 4HS8H 2VDOL 1YEGH 4NRXA 3GMQA 1FVDB 5F7EH 4XNUL 3KPMA 1FO0H 3G6JE 1IGIH 4WTZG 4LNVA 1V05A 3SGJA 2R2BB 4BFIA 5SX4H 3P4NA 2VITB 4I77H 2O5ZH 5IGXL 1UQSA 2ARJB 4OCSL 1UCBH 2JE8A 3MLUH 4DGVL 5E2JA 3QHFL 4YDLB 3AU1B 5JUEH 2KBGA 1NSNL 4JANB 3VGAB 1JV5A 3PQYE 4LVOC 1UWXH 2N4IA 3LKPB 4Z7NF 4HV8B 1CFSB 1JF5A 3QUXB 4Z0XA 4JM4H 1MCBA 2HVKA 1FGNH 5D1XD 3H9SD 2W9DL 1EO7A 3QEQE 2CUMA 2O5XH 4HZLB 4DFIA 3GB7A 4KK6C 1GC1H 2J1KA 3B9KA 4MB4A 4R8WL 5T1LD 1OSPL 2OZ4A 1G6RB 1HNGA 4ALAH 5JXAH 3TBVB 1WCQA 1JGLL 3CH1A 4WFFE 4NN6C 2P5WB 3IDIA 4JVWA 3UBXB 1MHHA 1QBLL 2BY1A 2R29H 4C58B 3IGAB 1KPVA 4L1DA 2NY5C 4RMVA 1E4XI 4PGDA 5EOTA 3V4PL 1E27B 3BH8A 4QRRB 5DC4B 4WFGD 1CQKA 3OSKA 1YZZA 5BRZB 4NJAH 5TPWH 3HKFA 1N3NB 5KJRL 3HE7A 5D1QB 2R39A 4PJ8C 2G9HA 4Q9BA 4DZBB 1KC5H 2XKNB 5FO8B 3HZKB 3UAJC 1ED3A 1RFDH 4EOWL 2CLZB 2VB5A 5IHZA 3E3QC 1J05A 3T0WA 4TVPL 1ND0B 1IAIH 5GJTL 1CGXA 3BPOC 2ZUQC 3MGOA 4LHUA 1VESA 4OSUH 1OHQA 5C0CA 1T03L 2Q87A 32C2A 1R5IA 1MCWM 1XR9B 2V7NB 2HT3D 3NZ8A 5FV1L 1TDQA 2E27H 4R7DA 3QQ9C 1ZLWK 4OZGE 4K7PL 5D6CB 3T0ED 1AO7D 4PGCA 2P5WE 1YEFH 1RV6X 3GM8A 4P9MH 2FLRT 4NKMB 3ULVE 4ONGL 4XBPA 4X9FA 2F15A 5J3HC 4XH2A 3W9EB 5KSAC 3UYOD 3FZUC 1MEXL 4QRRE 5JPMB 4LCWD 1KJ2B 4NO3B 4IOFC 1YN7B 3REVB 4MA1B 5IWLA 4ZFFA 4TULL 3W9DB 1I1YB 4FFVD 4MVBC 3Q6GL 3I3EA 1J0IA 4LSSH 4K3JL 1S7VA 1IT9L 2XXMB 4JM2D 2QQKH 3H3KA 2Z9TA 4TSBH 4WGVB 1IM9D 4NM8L 5C0GB 3SGDH 1RPQA 5D1XB 3H9SB 2QJDA 3LEYH 4OZ4B 2R2CA 2H32A 1ORQA 3WO4B 5T1LB 4O4YL 5FYJU 2OR7A 1QO3A 1LD9B 1JHTB 4JREB 3REWB 4Y4HD 3B9DA 25C8L 1G7JA 5L88H 5JZ7C 1UC6A 4HWNA 5E0QA 2AKRA 4ONOA 5BZDA 4H0IA 4L4JA 4F7CA 2P42B 1P2CA 1L6XA 3VXRA 1R5WA 3CFEB 4GMTL 5JDSA 1YMMB 5IMMA 5J9PA 1AR2A 4F7MA 5AAMA 4HX1A 1T66C 1JGVL 4MD5A 2CD0A 3V52H 2HKHH 1A4KB 5DJAB 3RWDA 4YGVA 4OFDA 2ADJB 4GG8A 2OZ4L 4Z7VF 4M9OA 3VWKC 4OQTA 4OIIH 4QRPD 3ARZA 4JFHD 2W0FB 3CSYB 5CSGA 1YNKL 2D7QA 2BXYA 3HFMH 1MCHA 3GKZA 5DK2A 1FZOB 4G6KH 4KROB 1WZMA 3HHRB 1B0GB 3F5WA 1G7PB 1SJHB 4S1SL 3WYRA 3GZKA 3OR7B 4YHML 3QO0B 3EBAA 4U2ZA 5IB1B 4MSWA 5BO1L 3H9SE 1QVOB 1QBAA 3VDCA 3V4UH 5C6WH 2LVEA 5F89B 3BAEH 4D8PB 4HUXA 1CZ8H 4GAFB 3SBWC 2VIRA 4FNLL 3ARUA 3EJYC 4JPKL 5ID1B 3V5HA 3BMWA 2DTML 3ARFA 3EFFB 3PWVB 4YX2L 3RGHA 4HK3N 4M62H 4UTBH 3K2UH 8CGTA 3O4LA 3GKWL 1AO7B 3TO4A 1GHFL 4KK9D 5KTEL 2D4DA 4CNIB 5ADPL 1QSEB 2A0LD 5C0AA 5GS3A 1YMME 5IB5B 2IG2H 2Q3AA 2YD3A 2X9XA 2XKSA 5E8DH 1VGKA 1FIGH 4LCWB 3GK8L 1DBBL 3FN0H 1WITA 1CLYL 2HG5B 3EYVA 4L4VB 2FL5A 4ZNEE 2FCBA 4BSWB 2GW5A 2IPTH 2YWYA 5EU4A 2VDLL 4YJZL 5ENWA 3C8KA 3OJDB 3C5JB 3L1OL 1XGUA 4BFBD 2ILLA 2P24B 4NM4L 5KSBB 2Q8BH 1U8KA 1CU4L 4WNQA 5D2NA 4WHTA 4ZS6D 4YPJA 4MQSB 1DQQA 4K23L 4NZRL 5DD6A 2DD8L 1CDJA 4M7ZB 3S37H 3QUMH 1IM9B 3H8NA 1QBML 3MNWA 2V2WB 2HFEA 3RVXD 5E1AA 1G7HB 1W0WB 2AJVL 1UKTA 4DGYL 1ZTXH 5C08A 3VGBA 3DXAD 1K5NB 3UP1A 1RJCA 1BJ1J 1DBAL 3ARGC 2IGFH 1HN1A 1K6QH 5F44A 1B4RA 5SX4I 4WI6A 1LO4H 3QCTL 4Q97A 4NO5A 3TBTA 4L5FH 4NO0B 1TVHB 1XH3A 5IB4A 4GBXC 3EYOB 2YPLD 5F6IB 2OK0H 4GRWF 4XBEH 4NHCL 4C56A 1QSEE 2WUBL 5TF1L 4XPTL 3LRSB 1A1OA 1JGEA 4LHQB 5FYJE 1T1YB 4D94A 3WIIL 1ADQH 1XCQA 2BP3A 3G08A 3MRBB 1RJZB 3LY6A 2H1PH 4UIKH 2IFFH 1GHFH 1Z3GH 2BVPA 2D03H 4L4VE 4HIXL 4JFFB 3BKYL 1C7SA 4HULB 2I07B 4PFEA 3KXFA 4QRPB 2PO6D 1RZGB 1HHKB 3PL6D 1NDMB 2E7LC 4ZUVA 1Q0XL 4RAVB 2Z31D 4Y4FA 3D1MC 2IAMD 2MOVA 2JJTA 2QTEA 1YY9C 4ODVH 4NQXA 1KB5H 1MCPH 3WS3B 1BQSA 4ZUWA 1L7IH 3DMMC 3HE6C 4HIHA 3MNVA 3RJQB 3C08L 3WXWL 5GGRB 3QDHA 4FOMA 4OQTL 5T3XL 4NUJA 4U6YB 2EEAA 4FG6C 1QPPA 4RFOL 5IROC 5IM7A 4RAHA 3T77B 2DQDH 4JKMA 1FYTA 3NCYS 3KJ6L 3IDMB 1R3HB 1KNOB 4JDTH 2VE6A 2YD5A 2E7CA 1OCWL 3VXOA 1MCWW 4UDUA 2ICWI 1Z0NA 3WHXA 1MHEA 2G75A 4HPYH 1VPOH 3OL2A 4JFFE 1S9WB 1IAII 2FJHA 3UO1H 5I1AB 3D3VA 2Y1VA 4F9LC 4I3SH 1PVHA 3BKCH 5FGBA 1GXEA 5C0JB 1AKJD 2B1AH 1F3DJ 5INCA 1BQLH 2DKSA 3WFDH 1D3CA 4L8CB 1K3IA 1YC8A 3LN4B 3OKYA 4F8QA 4D0CA 3TO2A 5JHLH 4N0RA 2J3SA 1K8IA 1BJ8A 1AQKH 4LEOB 5CGYC 2R56L 1BBDH 2AJZB 2EE6A 1TETL 3CXDH 3B2UD 1I8MA 5F3BA 4KRLB 4BQ9A 1VADB 4PJEB 1JHLL 4G3YH 1UJ3B 5HHXL 4MZ2A 2IBBA 4F37F 3K4AA 3FQNA 1X5AA 5I1HH 4X6CA 2R0LH 3RWJA 3W81A 3HNVL 2X05A 1HEZB 3GMLB 5F1OB 1ZVSB 1ACYL 1CK0H 5D7JB 1X5FA 4LSVL 3CDCA 5GS2D 1JF6A 1FQ9C 2YD2A 3WFHB 3MRJB 4Z7VB 5AAWA 4JFEB 3I85A 3QDJD 2GQHA 2NY7L 1G6VK 1H9VA 4XVTL 1CGYA 2E3VA 5HJ3A 3U7WL 3KGRA 3OKLB 3MYJB 1G7MA 1DUZA 1N2RB 4N5UA 3S3PA 4U1LB 2QLVB 3O2DH 3FT2A 1DN0B 2GTWA 3J7HA 3SGDI 3CX5K 1PW3A 3D0VB 3NFPA 5T1DH 1B90A 4LK4A 3NIGE 3A67L 5DMKA 4MCZA 4UZGA 3S96B 1JZ7A 1KJMA 2CGRL 4L8DA 2VN7A 3Q6FA 3O45A 1KN4H 4GOSA 1IGYA 4KY1H 1FL6B 2Z31B 5ANMB 4HPOL 4IDLA 1SEBA 4IMKA 4PJEE 2MKLC 4KRPC 4G9FE 3LN5A 2NYYD 3QWRA 2DLFL 2FX7H 4NPYB 2EH7H 2YK1L 3QIBC 3O8XA 5DWUH 5F96L 2IH1A 3ZDZE 3MOBL 2A6DA 1QFPA 4Q7DA 4PJAF 2CDEB 2VDRL 2YS4A 1S9YB 5DR5H 1QHPA 1OQOA 4J8RA 4Z7VE 4JFEE 1WFUA 3KLHC 4G8EA 4P3DB 4HJGA 5EPMA 3N06B 5D72L 3BSZL 3QDMD 5AYQA 3G6DH 4GAJL 1QRND 2W9EL 1K2DB 4BKLA 5DRWB 1MWAH 2B5IC 2IADB 2AEIT 4PB9H 4ZO6A 5BQ7A 1ZOXA 2XA8H 4A2MA 1NANH 1UXWA 2RJMA 3INUH 1JN6B 4CMHB 2X40A 2FX8H 1FNEA 4XNMA 2Z35B 3RZWA 1MFBL 1KLGA 3IDNB 3BP5A 3BPLB 3M1BB 3RZCC 3U7WH 3STLB 1NLDH 4L3CB 5JO5B 4QNPF 5I1DA 5B38A 1RIUL 2DL9A 5ALCL 1W2KT 4OCWL 4KI5C 1Z2KA 4R0LB 3NCFB 3QXDB 4JJ5B 2B8OT 3UTSA 3AGVA 1XF5B 1X44A 5FA4B 1AH1A 1T04A 4FTVA 4ZXBD 4O5LH 3TN0C 3KPPA 2W65B 3JV6B 4JFOB 3GI9L 4K55A 4DAGH 4YDKH 5JW4Q 3RGVC 1JMZA 2D31B 4PJCA 4BUGA 1BQHB 1C7TA 4NN7B 2AJSH 3HZMB 1UEMA 2DTSA 3LPWA 4PJFA 1NMAL 1NC4B 2XFXA 2ITCA 5K59E 1A3LL 2VLJA 1KCRH 3W0WA 3BEWA 4JPVH 3SCMB 1RK0A 2EYTA 5TE6H 1U3HC 3M07A 3UPAA 2IMMA 3VGFA 1G9NC 4ZUSB 3LKNA 3DETD 1UXSB 2F8OA 4HUVB 3SE3C 3K4DA 4AIOA 1H3TA 2FRGP 3QJFA 5JLZA 1IGFH 2CRZA 3FOMB 3NAAH 3IVKA 3CVHB 4HKXB 1WBZB 5DJXA 4S1QH 1T6WA 5BOPA 1XZ0B 4DWHA 5D1ZD 1WTGT 2R4RH 1H3GA 4FQQB 3MRDA 4LF3A 1VFBA 3GI8L 4LPTA 3DVNB 4LHJB 1RJYA 4HIIA 3CDYA 3GMMA 4ODBD 3BZEA 3HNSL 1DE4B 3MSPA 2FD6H 1HZHL 1AR1D 2J88L 3PF2A 4KH2A 4IRZH 1FZKB 3S5LG 3MQIA 1FORH 4DN4H 3PP3K 4KJYA 1I7ZA 3MLSL 3AREC 2GT9A 3NPSC 5KVFH 4EN3C 2YPKA 1A02N 3P4MA 4YHLL 1MVUB 1TQCB 5FM5O 4UOW1 4U1MA 2ITDB 2ADIB 3QDMB 1BREA 3WMSA 4OFIA 3H3PL 3ZYOA 5I1IL 4MQXD 3VJ6B 1I4FA 1N7ML 1AHWA 2JKXA 3OKNA 5DHVB 2C4FU 2JCCA 5M7QA 1XF3A 5MI0C 4TUKL 4WUUA 1LEGA 1RAMA 4G80A 2AJYH 3IXAB 3FO1B 2YUVA 2BSTB 2XWJB 5D6DA 5IHLB 2X4QA 2H3NA 4PJ5A 4MCYA 5T5NF 2Q7NA 4HUNB 1WIPA 3WD5H 5HGAA 1TTUA 4HS3B 3CLEL 2BC4B 5GGQL 1BJMA 4ZXBB 1J8KA 1PY4A 2CJUH 3OTTA 2MPAH 1U6AH 1UM6L 4YBLC 4MD0B 2YXFA 4QRQB 3RVWD 1JPFB 2LE9A 3QIUD 4NSKA 1JWMB 4I8DA 4U1SB 4L9LA 3IETA 3CXHJ 1JPTH 3BJ91 4N1HB 3LKOB 2IQ9H 2GFBB 3DGGB 3MA7B 5FA3B 2NLJB 4XZUB 4NKOB 3U1SL 1QLFA 3ULUD 3SJVA 4FQLH 4OUOA 5D8JH 5GS0C 1KCVH 2NXZC 1Q1JL 4MNQD 4QHKI 2ESVD 2DF3A 2E6QA 1HOCB 1KJ3L 1G9MC 5F21B 3TVMB 4NN5B 2ZUYA 3S4SA 3P73A 3LKQB 2H8PB 3FN3A 4Y0GA 1SY6L 5JTWA 3UX9B 4L3EB 2ED7A 1AJ7H 4Z8FH 1IQWH 3OKOB 3FB5B 5D1ZB 1PG7L 1KOAA 4WFED 4FQ2H 1K8DA 4YDLC 1H8NA 5JPNB 3AXLB 5LCVL 4M5ZH 1PG7X 2EDOA 5E08L 2A6JA 1AP2A 3K4ZA 1YJDH 1KIPA 1UG9A 1TQBB 1A6AA 2GY7B 4KFZC 2YWZA 1ZT1A 3VGAC 1B9ZA 1HDMA 5HYEA 3ARBD 1PQZA 2M2DA 3QUXC 1RI8A 2ZKHL 3EYFB 4HGWB 5IHUH 1F4YL 1Q9OB 3WFEL 3GIVB 2VZVA 3L3KA 2GY5A 3UYRH 4JR9L 5DQ9A 2P47B 3JWDL 5I75B 4Y4KC 1T3FB 4IMLA 4ONHB 4QLRA 4JRXB 3B83A 5MENB 3O3UN 1UFUA 4EI5D 1ODAA 4GXVL 1I75A 43CAB 4YWGL 3FO2B 2HVJB 5JORB 1EHNA 1H5BB 5I8OL 2QKIB 2Q86A 5I1EL 1BLNA 5HYIA 1BX2A 3TT3L 3T4YB 1ULVA 2V2XA 1JTTA 2IH3A 3HCVB 2VXSL 1NFDA 4PJBB 1DUYA 3R06B 4S1DD 2XY1A 4L3EE 2FZ3B 1JPGA 2AV7A 4PTTB 4XPHL 1S8DB 2VAAB 3JXAA 3RDTA 4JHZA 3C5ZB 4QHKJ 3DUUA 1W0VA 4P2YA 5D1QC 2PYEB 5T3ZD 5H35A 2IWGA 3ZE2F 1OF2A 1NMBL 2HYMA 4QHMB 3ZYJA 1I3GL 2C1OA 2BERA 5GRVL 3PE9A 3V0VA 4HK3J 2PKDA 2Y7QA 1I8IA 3RA7H 3U9UA 2VZOA 1INQA 1S9XB 4L8BB 3VFTB 5IFJB 2DQEH 3NCJL 4M48H 4LSDA 3KR3L 2OR9L 1I7UB 3VGDA 1U93B 1BVKB 1HHJA 1FC2D 1GIGH 4ZOCA 5HYQB 4YHOL 3LB6C 3V7AG 4MA7L 4CVZA 4P46A 5HGHA 4LRIA 1NANI 1FO0A 4HFWB 1NCAL 4UINL 2HJFB 3HN3A 4JRXE 1OPGL 1KTDB 3BDYL 2W0PA 4DUVA 5MENE 5C9JB 4K3EH 3TESA 4OCRH 1BGXH 5ESQB 5KVDH 4BQ6A 1MJJB 4YXHH 4JAMB 1IKNA 4X5LA 4QNPE 2O61A 5C6TH 4N9GA 3OPZH 4JR9H 5E99H 4I2XA 2WIIB 3HNTL 2GJ6A 5IBUB 5JW5A 2VL5A 3B9AA 2D0HA 1E4WH 15C8H 3P4OB 2C5DC 2R0WH 5IW6A 4XP6L 5C0FB 4RIRB 4MA1C 2DWEB 3GSOB 4YDVB 4LLWA 1NCCH 5CZVH 3QI9A 2C7UB 4EDWH 2C3WA 1MI5D 2PYEE 2VLMD 4EVNB 3OZ9H 3DRTA 1QLRA 1CLZH 3KWWA 4JGJA 1YNTA 1S7RB 4Z7UF 4H88L 3U2SA 4LARL 1OARL 4GW4A 3ARBB 3OGCB 1FNFA 3AS1A 4DVBA 4X98B 1RUKH 1KTLB 2XTLA 3VXMA 2V7HA 4JN2B 5D1XC 5MEPA 5IQ7H 1ZA6A 2JLLA 3HMXH 1R3KA 3BRDA 4P4RB 3GSVA 3UROR 4HZAA 3SDXF 2BMKA 1SJXA 2GTZB 1T5XA 4JREC 2MQ0A 3O11B 4RDQF 5DC0A 2V9RA 5GJSL 1IC7L 2DIBA 5DS8A 2D7TH 5DUBB 2VR5A 1NPUA 1M7DA 3LZFL 5EIQA 1Z9LA 5HPOA 5I8KL 4AH2A 1FN4B 3CK0L 1KBGL 4LOUC 3V6OE 2VMFA 4OCMC 3D0LB 4FQIH 5DJZB 1OSZA 2ICWA 2W91A 1DFBL 4LPUA 5CP7A 1SJVA 6CGTA 3UDWA 4J4PD 4OZFB 3RY4A 1AE6L 4I18B 5DJCB 1IEBB 4TNVK 4WTZA 3WNKA 3RX7A 3QNZA 4ZS7H 2Y36L 3BUYB 2AK4B 1D5ZA 2B1HH 3OB0H 1QKZH 4OI8A 1J0HA 2IC2A 4WI9A 4KVCL 4CVXB 4R97C 3LV3B 1FG9C 4DK3A 4HQQL 1F58L 3QUYD 4I3GA 4Z7WB 1LDSA 4CN1A 4IRJD 5ITFA 4LSRL 3SOBH 3FRPG 1U8NB 3TIEB 1T20B 4WHDA 3IFOA 1DBKH 2B20A 3OB8A 4X6BA 2DQUH 1P7QA 5CGMA 4F33A 3GBMH 5CBAB 2DQGH 1QQDB 3DX9A 1KPUB 4P5MA 4X80L 3WKML 4IS6A 3QH3B 2HT3C 5DRNA 3N1MC 4OF3A 1DBML 3THML 5GZND 1F6AB 4LVHB 4NHUA 1G0DA 1S7UA 5TFSH 3T0EC 1JNLL 2IFGA 1HH6B 5HY9B 1R3LB 1ZA3A 4PJGA 1H3UA 4OBRA 4PD4J 2XN9D 4JO2L 2GKIA 2DQCH 2FGWL 2AK4E 4XP5H 5J12B 4XVUD 2VLLB 3NCCB 4JY5L 3VFWA 2X4RA 4M4PA 3I02B 1MI5B 2NY5H 1PFCA 1JK8B 5F6HJ 3WSQL 3MLXH 4KI1A 4PV8B 2H2SD 3P0GB 3KNBA 2KDGA 3O3BB 2OP4H 5CLTA 4FRWA 4YC2B 2H41A 4JM2C 1G7IB 2GK2A 4BH7B 3DV4B 4PP2A 4HAGA 4M7ZC 5IG7A 4X5WB 3FL7A 1VA9A 2H2PD 3V2AR 3IU3A 4FQXA 1O7SA 1IGCL 1TTGA 3W39A 3QCVH 1T0PB 2GSIA 4U1NB 4TNWK 5F70A 4HG4J 4A6YH 4Y8AA 1QFUL 4KKAC 3QG7L 1JWSA 4OUUB 3KPRB 4QGYA 1RZJH 2WQ8A 4Y4HC 3ARTA 3SDYH 3WHE1 2EDFA 3MV7A 5MEOA 3N1GC 1BD2A 3DHMA 1LO2L 5F6IC 4CU8A 1RZKC 1WZKA 4OCXL 1CDCA 1LO3L 3D25A 4IOIB 3HG1E 2KL6A 5C0BD 3ARWA 3EYUH 3RVUC 5KVEL 4MB5A 5F9WB 4JKWA 1RURL 4LCCA 2YZ1A 5IVXB 4MJ4A 2CR3A 2V5TA 2N1KA 2AXGA 4YHZL 4NKDA 2EDJA 3OR6B 2CO6B 4XNYH 3NFNA 3T3MF 3VFUA 1L0XA 2QQLH 5DK0A 5KS9A 3H6JA 5I8EB 1NMCB 1OAKH 2FX9H 1JNNL 3HAEA 1FG2A 4LBEA 2OBGA 1XCTA 5DDHB 5ACLA 4OFYD 4OB5H 4IRJB 5EB9A 4L29B 4XMKL 5EO1A 4JG1H 5I15H 1N59A 5J56B 4QXTA 1ITCA 1YDPA 2G2RB 3UJIL 2P8LA 5AUMB 1EFXD 1YEDB 4BSVA 2J4WL 5D2LA 2OL3L 3OF6A 1FNGA 4O2FA 2CIIA 3SGEH 1M6OA 3N9GH 4KV5F 3KPSD 4JO1L 4NQDB 2X4NA 3ZL4H 3KPRE 1CFBA 2FO1A 5IMLA 5FHAH 5DT1H 3SKJH 1NFIA 4KK9C 4QYOA 2A0LC 1WK0A 1AGCB 1NFKA 2QADB 4HF5L 2BVYA 3DV6B 4QT5B 3ZE2E 3S9DB 4MYWB 5IVXE 1BQUA 2XN9B 3NFSL 1II4E 2CLRB 1UH4A 1KT2A 4J1UB 2DYPD 4WENB 5F9AC 3QUMA 3DBXB 3D9AL 4C83B 4XCCH 2EKSA 4NDMA 4J3SA 4PGJA 4U33A 5E6ID 4FQPA 1RUAL 5KSVB 5BW7A 2YPVH 3EGSB 1BOYA 4GRWH 3TV3L 1XF4A 2Q20A 3FN9A 2PXYA 3I50L 1YMHA 4RMRA 3GSNL 3RVXC 2BSED 4RAUA 1Q94B 2N7AA 3KHOA 1RUML 2FJGB 4FXKB 5IUSA 3ABZA 1RZIA 3RI5K 4NQDE 4TOYH 2FHFA 3CFDA 1ADQA 1MJ8H 3VI4E 5D7JC 2VXTH 3O6KL 4UB0L 4I5BB 4GKNA 4JKKA 1ZS8B 5AYUH 4ISVB 2Y9RT 2BNQA 1MHCA 1IFHH 5C0BB 5SWZA 1NBYB 3RX5A 1F90H 4FXLA 3BKMH 5IKCA 3S34H 4MXWL 2DL2A 5DJ2A 1P7KA 2YUXA 4UQ3A 1QR4A 4PJHA 4OT1L 1QBBA 2R1YB 4KUCF 1I1AA 5HYJB 2ZUVA 4TUJB 3OG6B 4QHUA 1T0NB 4J7RA 1EXUB 4H26A 5DVKA 5L7XL 2A9ML 5F7DB 1IILE 2YN3A 3SDXE 2L4OA 2ED8A 1NC2A 3D9AH 3HRZA 2Z31C 2R23B 5HI3D 1B2WL 3SKOB 3T2NL 3HI5H 3GSUB 4KDVA 2Q6WB 1U8IB 1DDHA 1EFXB 4E0RB 3RWHB 2E9BA 2AABH 5SV4A 4V1DB 5E5MB 2VDQL 1GJIA 3KPSB 2WZPD 3TZVD 1TZGH 1NGZA 4H5SA 4EKXA 1MH5B 3MV9D 3BWAB 5C07A 4M61A 4M1GH 5C0BE 1D5MB 1I8LC 4G8GD 5IVNA 3DWTA 1XFPA 1DVFD 4JZOB 4I4WB 3PWPD 1UM5H 4OIAA 3L7EA 4PY7B 4V2BA 1KCUH 4YEFA 3H0TB 4JPIA 2DYPB 3DX6A 1ZWIB 4CMHC 1YUHB 2Y4SA 5HYJE 4H1LB 4PBWD 2EH8H 1EHXA 1FFNB 1EH9A 2PW2A 4LQFL 1NUNB 2HH0H 1CG9B 2BNRA 2P7TA 5E6IB 4M93B 3WLBA 4YHIA 1NDGA 2UYLA 1GH7A 3QULB 4ZDHB 3B6SA 2X7LA 5C0IA 1D6VH 1KGCE 3D18A 1I8KA 1EPFA 1RMFH 4WWKD 3F7YA 3O6ML 3FB6B 3QDGA 4NQEA 4FFZH 3GMPA 5I71B 3H42L 4KVNL 4PRBB 4JZJC 3FQXA 1SM3H 3F12B 4Y2DD 5IP4A 4PJ9A 4XVSL 4UQ2A 4V1DE 4Z5RA 4EI6B 1X4YA 3G5ZA 4O58H 2I9LB 2I9TB 1TVDA 3CZFA 2ZZUT 1FAIL 3L3OA 4PRHD 5F93C 1ZANH 1ORSB 3E6HB 5DJDB 3ROLB 3O2DA 4QOKB 5EU3B 5IT2L 5ETUB 3JTSB 4XAWH 1D5IL 4TNWF 3WV0A 3MJ8A 3OJ2C 4M3KB 2VNCA 3SCMC 4Y1AB 5C7XL 4OCYH 4DOHE 3G5YB 3RVTD 4RWYH 2ENSA 3MGTA 1BOGB 3ZDYF 1J5OH 1WC7A 4RSVA 4TVPE 4NRXB 3GMQB 3GGWA 4RBPK 2FHCA 1RZFH 2YD4A 1I1FA 4TSAH 4WEBL 3K80A 3P4NB 5JIIA 3BW9A 2XNAA 3VXTA 4PRNA 1OD9A 4F9PA 5IJVA 1OAZH 5IJKA 3T0BA 3D39A 3N50A 3MRCA 4IRSD 1MLCA 4LSUH 3N85L 1FV1A 4Q6IA 3TIDB 2ADGA 3BE1L 4XHQA 2NYYC 2B2XH 1EHLL 3EO1B 1BAFL 2FBJH 1AGDA 2MTPA 1MWAA 4Z0XB 4D9QD 2HVKB 1I9EA 4YXKL 5TE7L 5L2JA 2FJFA 1FYHB 5EO9A 4E41E 4UBDD 5C09A 2R0KH 4QOKE 5FO7A 3MV9B 1JYVA 4Q9RH 1TQCC 3GB7B 1WWAX 5FKPA 3T3ME 3B9KB 1PZ5A 3QRGH 5DLML 3EYSL 4IOSD 4Y1AE 1YEJL 3R1GL 5GRJH 5FYLE 4YK4B 5MERA 2Z8VC 3PWPB 3QG6A 3CH1B 3V79C 3CPLA 3H3BC 3ZTNL 2NY4D 3IDIB 3MLVH 3GMNB 1KPVB 4BQBA 1QG3A 3C60A 5CKGA 4UUJA 4JFZL 2X89A 2F8VA 1J8HA 3U4EB 2DB8A 5CEZL 1DQDH 2DQHH 4U0RB 3VFMA 3U9PL 3RY6A 4LU5H 4KTDH 4Y16D 4AIZB 1BVLA 5EOCJ 3HE7B 4H20H 4EUPG 1S7SA 3QZWG 5T3XD 1XGRB 2BFVL 2G9HB 2JIXD 4WWKB 4XMLL 4AENB 2OJZH 3UTOA 4ZXBC 4HUMB 5CCKL 2AV1A 4WO4A 4Y2DB 1RUPH 5IHZB 2EZ0D 4LLYA 4O9HH 1GZPA 3LQAL 4LHUB 1R3JA 4UV4L 1WFTA 2AERT 3EIFA 4W4OA 4QHLA 5F9OL 5C0CB 1KJVA 5C2BL 1R5IB 4X6DA 3NZ8B 4MA3B 2QQQA 4Q9QL 2XZAH 8FABA 1X7QA 4R7DB 1IAKA 4HS6A 1UACL 2RIKA 1P7HL 1C08A 3X11B 3OV6A 2JB6A 4PGCB 4OGYL 4PJ7A 3TVMC 4NN5C 2J5LC 1J1XL 4XBPB 2BNUA 4XH2B 3TWCL 2LABA 5GRVK 3X3FL 1T83C 4P2QD 4YFDB 4M00A 3DRQA 5D1ZC 4P5KA 3RIAK 4YLQT 3QAZC 1TXKA 1A9BA 4UT6H 1TQBC 1DQML 2EDRA 4KC3B 4IRSB 1UWEL 1GGCH 3D87B 5ISZA 1S7VB 1F8TH 4HD9A 1AR1C 1KELL 1JF1B 2JJVA 1NGYA 3O6FA 5C0CE 3PGFH 4NCC2 2AXFA 2H32B 5I75C 3RWCA 1OAQL 1OWWA 4U1IB 1J0JA 3OAZH 4RCAA 1T1ZA 2XZQH 4EUPH 1ORQB 1EAPA 1GPOH 3T0DA 5DMIL 3WN5B 1QO3B 3FRUA 5IBTH 2J8UA 2KQNA 5A43C 3IDXL 1MJUL 1H5BC 1G7JB 1S3KH 1IM3A 5F9OH 2AKRB 3H7BA 5BZDB 4G7VH 4F7CB 2NY4B 1WT5C 2JB5L 4X6CF 3VXRB 2L0DA 1S9VA 3OKMB 3ZO0A 5JDSB 5IMMB 2EDEA 4CL7A 5J9PB 3UPRA 4X7EC 4F7MB 1JWUA 4BZ1L 4HX1B 2IAND 3CIQA 4GKSA 5CEYA 2A2QT 4MD5B 4N0CC 1LMKA 4DEPB 3KYMA 3MJ6A 2QQNL 5J6GA 3CDGA 4RFEA 4YGVB 3RWDB 1G9NH 1RULL 4Y16B 2ADFL 1A7RH 4GG8B 2EDQA 2BHZA 4N8CL 3O3EA 1KEML 2JIXB 5KVGL 3OXSB 4X7SL 1FE8H 1UB5B 5DK2B 1CXFA 3ECBA 3F7VA 5DD1L 4R7NB 5KW9L 5ACZA 5CZXD 3F5WB 4ZAKA 3FB7A 5IESL 2FWOA 3U6RA 3MYZA 3QIUC 4D9QE 4WW2A 1N4XH 4MSWB 1UENA 1ZXQA 2HKFL 4XXDB 5HHOA 1HNFA 4HUXB 2VIRB 3VMOA 3V5HB 3ULUC 2IPKA 1EAJA 2AJXL 2ZCHH 3PG2A 2A1WL 3ARFB 5CIPH 3ULSA 3H9ZA 2AQ3A 2DLIA 2AI0H 3F58L 3O4LB 1TJIL 3WJJA 4OLWL 3TO4B 1FYTD 1JRHL 4TYUA 3OG4B 3V6OC 1L9NA 3VXRE 5TQ0H 1NAMH 5C0AB 4PGZA 5J1AB 4I0PA 4PJXA 5EU5A 1UB6A 3HR6A 1VGKB 4U3XA 4RNRA 1KPRA 2VDML 2VXQH 1HXYA 3HC0A 2FL5B 4X8XA 2F53D 2Y25A 5F1SA 1CFQA 2VZUA 1NGXA 3ARBC 3MRGA 1U92A 1KUMA 4R2GB 5A2FA 2UZYB 4OLXL 4WNQB 4F8TA 2FIRT 3LAFA 4WHTB 5LG1A 1GGBH 3MO1A 1DQQB 2X41A 5DD6B 1A21A 2Z91A 2L7JA 4XAKD 5BS0D 5I19H 2APTA <