4NR0A

Crystal structure of the pseudomonas aeruginosa enoyl-acyl carrier protein reductase (fabi) in complex with nad+ and triclosan
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
259
structure length
259
Chain Sequence
GFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPELCFPCDVADDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRNVTIEEVGNAGAFLCSDLASGISGEILYVDGGFNTTAMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
publication title Crystal Structures of Pseudomonas aeruginosa Enoyl-ACP Reductase (FabI) in the Presence and Absence of NAD+ and Triclosan
doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 90
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nr0A00
3D5QA 2D4AA 3QW2A 2FPGA 1J0XO 3A1NA 1P44A 3IMFA 3O4RA 4D0SA 2O4UX 1DAPA 4I5DA 1SAYA 2DTXA 1MUUA 4J16A 1LLQA 4B7UA 3W8FA 1BHSA 1I3NA 1T2AA 1Q0HA 4MP6A 3F4LA 1GCUA 1YOVA 1BXGB 4WK6A 1V8BA 3WS7A 3FSRA 4PIVA 1P33A 2BGLA 4UULA 5AXBA 4EDFA 1P1FA 3OBBA 4J6FA 2R2GA 1ULUA 4XGIA 5A5EA 4CLRA 2ZK7A 3JYNA 2UDPA 3E48A 5DBIA 3JQDA 1SB8A 2FWMX 1C0IA 2Y1CA 4Z0PA 3AY3A 3GOHA 4Z0HO 3KYCB 4YAKA 3GEMA 3AUTA 4CLHA 1PIWA 3PHIA 3JQAD 1LSUA 3JD1A 3EW7A 3TN7A 2WSBA 5JSFA 5IZCC 3I6IA 3F5SA 1BG6A 5A9SB 2PNFA 2J8ZA 3RBZA 1E6WA 4CV2A 4EJMA 1PJQA 2YV3A 4DTIA 3VH1A 4GGOA 4CUJA 2YJZA 3L9WA 4D45A 1GEGA 1UUFA 1HE5A 3V2HA 3VTFA 4BNUA 3AY7A 3PHHA 4MPDA 3LDHA 5JBIA 1MC5A 2DC1A 4YJFA 3VZRA 3U62A 3G17A 4MVJM 2PV7A 1FDWA 3D1LA 1HE4A 4YWJA 3AU8A 4E5KA 5AVOA 3QJ5A 1LBEA 5TT1A 3Q11A 2W2KA 3WSVA 1GUZA 2ET6A 2OBYA 3RIHA 3GF4A 1N1GA 4ALIA 1U3WA 1WNTA 1WZIA 2E4AA 1LDEA 1H94A 4MVJE 3CINA 2JAPA 2Q3EA 1QMGA 2TMDA 3R3SA 1M66A 4IS2A 4RVSA 5EESA 4UUOA 1PZEA 1EBFA 2O3QA 5JO0A 1A72A 4NDNE 1U4SA 1PJ2A 3P2OA 4JGBA 3I9OA 3ZWOA 1H5QA 4NG5A 3S2IA 2FSVA 3OQ1A 1IZ9A 2PK3A 1T26A 5CDUA 1ADCA 1X7HA 2VQ3A 2CF6A 4J1SA 4CMCA 5U9CA 3NTRA 4PRKA 2PZMA 4UUNA 3U9LA 2VT3A 3LT1A 2YHUA 3TZKA 5TRTA 4L75A 4CLOA 1PEDA 4XJSA 1AHIA 1WWKA 3KLPX 3QRWA 4W9NC 4MVJH 5ER6A 4RPLA 4U6SA 1KETA 2B4RO 4JQCA 2WYWA 3ZHZA 4NBWA 4GQAA 2VHXA 4MKXA 1P1JA 3DOOA 3CMCO 1GPDG 1JTVA 2BRUA 1JW9B 1YOVB 3E6AA 3K2EA 4WLEA 3K6JA 2X0NA 3NJ8A 3BHJA 3DZBA 4NPCA 4NR0A 1NQAO 4DWVA 4CLRB 3JTMA 1RM3A 3BTOA 4WECA 5AOVA 1E6UA 2OMEA 4DVJA 1R16A 4DQXA 4IS3A 2AQKA 3QQPA 4KWIA 4U8GA 1EUZA 3B6ZA 3WWYA 1UXHA 2EERA 2NQ8A 4TQGA 1U2GA 4NH4A 3RAJA 3ZNPA 4BNKA 4OSOA 1UXGA 4J1NA 3OQBA 4BMSA 2GZ1A 2UVDA 1UJMA 1N7GA 3KSZO 1VJTA 3EZYA 3JQ9C 3VPHA 1Z7BA 3GG2A 3LC7O 4R54A 3ZWVA 3JD3A 4DYDA 1ISMA 3WSWA 4ZHSA 5A3VA 1GFSA 1HDZA 2Q1SA 2J3HA 1OOEA 3BMQB 1Z6ZA 4JBHA 1ZZEA 3ONFA 3PIDA 3NDIA 3ZH2A 2V6BA 3RCBA 1B3BA 1MB4A 2BFMA 3ANNA 2CY0A 4MJLA 1IPEA 1ZJZA 3QVWA 3M2TA 4I1IA 4L8VA 2DKNA 2CVZA 3M1LA 1O95A 1DRWA 5DNAA 2W2KB 3D3WB 3N58A 5L3ZA 3KEQA 3DC2A 3D5TA 5EL0A 4LN1A 4DPMA 2GN6A 2Y1FA 1R4NB 3NV9A 3JYLA 4PZDA 4YT2A 3I6QA 1WXDA 4CM1A 4CLDA 2C2XA 4NQZA 4OYRA 1NYTA 5CG1A 3NDJA 3CEAA 3FPLA 3C1OA 2C54A 2P4QA 4GI2A 2IXBA 3QP9A 4Z9XA 2YW9A 2CDCA 1XEAA 3I5MA 3QVXA 1YO6A 1NQOA 4XR4A 3Q0EA 4CM3A 1JKIA 5L9AA 1UXJA 3LVFO 3WYBA 1BDBA 5L7YA 4TKLA 1V0JA 2ZCUA 3H9QA 3QWAA 3DONA 3O8QB 4CLOB 4CMAA 3C7CB 3H9UA 2HRBA 3UHAA 2X6TA 4IDDA 1EK6A 4CM5A 2GRAA 5DBGA 5CDYA 3RFXA 4BQRA 2C0CA 2BKAA 3MOGA 5G4LA 4DREA 2AG8A 1EVYA 4XCVA 2OFPA 1H9BA 2VRCA 3MCVA 4K26A 4BO8A 3VPSA 2IODA 3WMXA 4CV0A 3R6DA 5T57A 2NU8A 3CPSA 2YHIA 4RVFA 3TL3A 3H3FA 2FPIA 3M6IA 2HDHA 3WQRA 2WTBA 2X22A 4TVOA 4CUKA 4IDGA 5EN4A 4ZQGA 4KDEA 4R9SA 3OA2A 3IC5A 1AE1A 4PLFA 2O4CA 3LC1O 1IZ0A 4RV9A 4WNCA 1MV8A 2ZKLA 3CIFA 3HB5X 4CM6A 4UREA 1NPTO 5TGDA 3UCXA 5BNFA 5JYDA 4FC6A 2GN8A 2NU9A 4IDCA 9LDBA 3ANMA 3H5RA 4RF5A 2NVWA 1NXQA 1OC4A 2AEFA 4OL9A 1ZO8A 4UEKA 1C1DA 1PGOA 2HJSA 1Y1PA 4FS3A 3TZQA 2NU7A 4XX0A 3QV1A 3KXDA 3AUUA 4ZD6A 3DTYA 4DGSA 2VTEA 2OBNA 5AYVA 4R5HA 2WJPA 2PLAA 4P8RA 5KVCA 4XGNA 3BTVA 2EV9A 3PQDA 2CDAA 1PS8A 3E5MA 4TZKA 1LDNA 4Z9FA 4ZRMA 3FNFA 5FI3A 5L40A 1FDUA 1I2CA 1PJ3A 2VYVD 1SEPA 2Y1EA 4XB1A 1B8PA 2G76A 1TLTA 4KQXA 1I33A 2FP4A 4C4OA 4YJHA 3DAPA 2O3TA 4L74A 2J5KA 3O03A 4OOEA 4E5PA 4YRBA 4ND2A 2ZQYA 2W2LD 3JYOA 4M86A 1SPXA 1I24A 2IDZA 3WGQA 4CMEA 2Q2QA 2RAFA 5I9NA 4DQUA 3NKLA 3EYWA 2XOXA 1PQUA 1EK5A 1KVTA 1U1IA 3I83A 5KOIA 3VPGA 1JU9A 1IUKA 3AI2A 1WDLA 1GPJA 5JAIA 4EITA 4IINA 3GVXA 1KEWA 1ZUD1 4LRTB 4GLLA 3KO8A 1E1LA 1M6HA 1LNQA 3KYDB 2NSDA 3JD4A 3ZU3A 4WCFB 2R00A 2EW8A 2WD7B 1Q2XA 4D3DA 2AQIA 4XB2A 1EUDA 3V2GA 3RFVA 3DZKA 3KBOA 5ILGA 4LW8A 2EGGA 4IZIA 5JMPA 1X15A 4L73A 5KVVA 5A9TA 4BGEA 2D5CA 1U2DA 1QRRA 5JAZA 2NU6A 4N5MA 5I7FA 4ZJUA 4BNHA 1F8FA 2X7HA 4BGUA 2CF5A 3GEGA 3HZZA 4E5MA 1Q0QA 4C7JA 1E7YA 1PR3A 4CV3A 5CFZA 1H6BA 2DBZA 1NVGA 3JQ7A 4B3HA 2FN7A 3SBOA 1H6CA 1HZZA 3FR7A 1HEUA 3ZHXA 1I32A 1LA2A 3U4HA 1E5QA 1V3UA 2DPHA 4WLNA 3ROKA 4OKIA 1GU7A 1WPQA 2O2YA 1CDOA 3V5NA 3WJAA 5IG2A 1BVUA 3F47A 2J3JA 1Q7BA 1P74A 2VWQA 3GUCA 3KVOA 4JK3A 2HMSA 3GDFA 3TJRA 4A73A 2B37A 2UAGA 1WZEA 4PLPA 1LX6A 5IZ4A 2PH3A 1DBVO 1O9BA 1ZK1A 3MOIA 4JBGA 4A0SA 2NTVA 1DC5A 2X1HA 4GX5A 4NFYA 4NFSA 4YT5A 3PWSA 5CEEA 3NTQA 2BGMA 4L4SA 3ASVA 3QA9A 4GX2A 4PLWA 2WM3A 2P9EA 2DFDA 4CMIA 3DHYA 2BI7A 4WCFC 4BHTA 3LZ6A 3DBHA 3OIFA 2PD6A 1F12A 2D8AA 4GSLA 2DTDA 5TIIA 1ZBQA 3NT5A 1VSVA 1DHTA 1VL6A 3MJVA 4B79A 5A9RA 5A05A 4YJHB 4N54A 3EC7A 4JNKA 4GAEA 4ZQBA 4DBVO 4XWYA 5FFFA 4BKPA 3GGPA 5KCZA 1DRUA 4Q3CA 2WYVA 1HDRA 1F06A 2GO1A 3WGZA 4FGSA 2PTGA 1GUFA 1DFIA 4IDAA 4RVDA 1EZ4A 4IDBA 3WIEA 3KUXA 4LRSB 3T4XA 2YV2A 3JQEA 1F8GA 4ZN6A 1E0DA 3RASA 4CM4A 4AJOA 4PG8A 4BB6A 4BOYA 3BZUA 3EZLA 4D43A 1GEEA 3MZ0A 2XF8A 3BMNA 3VDRA 2OZPA 4KDFA 3C24A 2V6FA 4DC0A 1R66A 4WNIA 1EQUA 1PX0A 4EGFA 2GDZA 3ZHBA 2EHDA 4FR5A 3UH1A 4M87A 4DL9A 5AQ1A 3GVHA 4YTEA 3U3XA 2WE8A 4EUEA 1N92A 4XIJA 1R4MA 4N7RA 3AU9A 2XAAA 4Z6KA 3L4SO 2AXQA 3C8MA 1I8TA 2HQ1A 2B69A 2W8ZA 4K6FA 2RIRA 3WX0A 4S3MA 4CR8A 4D7AA 4BIIA 4IJKA 3BMCA 1TXGA 3GHYA 4XQEA 3UCFA 1ISJA 1DIRA 3WYEA 4E32A 3ANLA 3ONEA 2C5EA 3AJRA 3I9KA 4LMRA 3RWBA 3WOHA 4CODB 4AJ2A 4FDAA 3ITDA 3F46A 4GMGA 5CEFA 1Z45A 5KIAA 4X54A 3L77A 1LDBA 4J1TA 5JAMA 2DUUA 5FWNA 2O3UA 3FTPA 2B83A 3AY6A 3JQ7B 3MEQA 5THKA 1ID1A 1CQIA 1QYDA 3DZFA 3JYPA 3KYBA 4R68A 1V3TA 4G65A 3BTSA 4UVEA 1UXKA 2BF7A 2EKPA 2C2YA 1DHRA 1E6EA 4KWHA 3DFZA 3RSHA 4N5NA 2YV1A 4R1UA 4WASA 3HDHA 5IXYA 1GDHA 4MINA 3I52A 4HWKA 4AJPA 5HM8A 1P9LA 5ITWA 1PU2A 2VUSA 1YL7A 1NWHA 1DC3A 1J6UA 1E7RA 3CSDA 3HDJA 3H9GA 2NTNA 2H6EA 2B5WA 2PZKA 3O38A 5DF1A 2FPPA 4ALMA 3INRA 4I9NA 4QTZA 4BKQA 4LVUA 4CLXA 1NHGA 5ENDA 3VDQA 2I66A 2X58A 2QG4A 1LI4A 2O3JA 4AJHA 1YQGA 3PYXA 4FD3A 5F5LA 3I9LA 5IZCA 2ZB8A 1SB9A 3QSGA 3JYQA 3RUAA 3DBHB 1I30A 2VTDA 4CL3A 2I5PO 1JQBA 1QLHA 3ZW8A 5BR7A 1TI7A 3H65A 3WICA 3WMWA 1H2HA 3RKRA 1MFZA 2DBRA 1VJ0A 2HMVA 1ZSVA 4XKJA 3L6OO 2IYOA 2YYYA 3TDKA 1EMDA 2DUWA 1ZIDA 1YONA 2QRJA 1UZMA 1ISHA 1YJ8A 3FNGA 1B14A 4BNIA 3H2ZA 2NM0A 1QYWA 3V1TC 3ZHYA 4CM4B 3PDUA 4QFCA 3T7CA 3WTCA 3HDQA 4YYZA 4NJOA 4BO5A 4YT8A 1ZXLA 3GGGA 4W7IA 3ZWNA 1Z74A 5A04A 1JWBB 3LF1A 4HADA 3AM3A 1YDWA 1YKFA 1VRWA 2VHVA 2Q50A 4P4LA 3QVSA 3JV7A 1LQTA 3BIOA 1BXGA 4QT0A 1XELA 4FOSA 3LT4A 4KTTE 4CLEA 1PJLA 1R4MB 1IY8A 1X7GA 1DFGA 3KZVA 3Q6IA 1P0FA 1A27A 3OJEA 1YL5A 5BQFA 4YAIA 4IJVA 3KYCA 4S1VA 3RQSA 3MJEA 4E33A 5ADHA 3PLRA 2JCVA 1A9ZA 1PGJA 1GY8A 3OMLA 1K6IA 5FF9A 2JJYA 3CZMA 2B4QA 1PTJA 3RU9A 2ZJ1A 3MJSA 3HJAA 3ZI0A 1HL3A 4FPXA 5F1PA 5I7EA 4W9NA 1U3TA 1Q7GA 4D42A 3G49A 5A3JA 4IQ0A 4OOFA 3SJUA 1NX6A 2RCYA 4NU5A 1U28A 2JL1A 3RD5A 4WEOA 4HNHA 5CAEA 3ADOA 1YE3A 4XEHA 2Q1TA 1GADO 3I1JA 3KM0A 2Y05A 4DMMA 3DZJA 2Q2VA 5F21A 1HE2A 4FGWA 2I3AA 1UP7A 2V65A 4JJIA 4D79A 5A03A 3DDNA 1XWFA 3HWRA 2G17A 3ITKA 1VKNA 2O23A 3SX2A 3ULKA 3GVCA 1ISIA 2YFQA 4TWRA 3JD2A 1A5ZA 4NBTA 3X2FA 5LCXA 5KJCA 1YWGO 3AI3A 3ZWPA 1PS9A 3ZWYA 3AUAA 3GPDG 5KJ1A 3PK0A 4LK3A 1A9YA 3UGKA 3QHAA 1YB4A 1HXHA 3JQGB 3FRJA 1O8CA 1ONNA 1JDJA 2Y99A 1C3VA 2J6IA 7ADHA 2H63A 2OGUA 3TL2A 1FK8A 1HLPA 1ZMOA 4WLVA 3PWZA 1ISGA 4I8XA 4WUVA 4CMKA 4KTVE 3SC6A 2A94A 1KVQA 3HNPA 2IZZA 4CR6A 3GZ4A 3TPCA 3FHLA 5ICMA 5L7TA 4NIMA 2HU2A 1ULSA 1GTMA 3FN4A 4QO7A 1PGPA 3C7DB 4BO0A 1G1AA 1GZ6A 8LDHA 1NHWA 1Z75A 2VNAA 1ZVMA 3KHUA 2IEBA 1GAEO 3ST7A 1FDVA 3AFNA 2X86A 2FHSA 3IJPA 5THQA 5EERA 1A71A 3VH3A 1R0SA 1NWCA 1RM5A 2GSDA 3HDYA 2PKQP 4KZPA 3AUSA 4RVGA 1Q1NA 3AK4A 3OFSA 3QIVA 1EVJA 1WP4A 1KYQA 4BO3A 4QEDA 4LISA 3GZNB 3I4CA 1T24A 2A35A 4WLFA 1DC6A 2BFOA 4IY1A 2XPCA 5L45A 3RKUA 2VRCD 3O26A 2EIHA 3Q9NA 4XYGA 1YJQA 2NTJA 3D0OA 4CQMA 1E1NA 1VC2A 3BMQA 3DHEA 2Q46A 3CMMA 3DZGA 1PSDA 3DXFA 3BHIA 3DMTC 1NQ5A 2DBVO 3N7UA 2AW5A 2GYYA 4E21A 3E18A 4Z0TA 1EFKA 3I3OA 5JPIA 4BS9A 4BNXA 2PZJA 2QRLA 4ITUA 1NM5A 1AHHA 3AOEC 3ETEA 4TMFA 3JQ8B 5GZ6A 3OIGA 2NACA 3QVOA 2Y66A 2E49A 4BNJA 3D3WA 3WLFA 1P0CA 1FDSA 1E3WB 3A4VA 3UAGA 3OF2A 1PGQA 2O48X 1K3TA 3E1KA 1SO8A 2HMTA 4IQ8A 4YR9A 3WJ7A 1ENOA 5CPFA 3GNTA 5KKAA 3F3SA 1BXZA 2EWMA 1R4NA 4FW8A 4O63O 4E2WA 4ALNA 5C3MA 1N2SA 3TZHA 3QWBA 4ALKA 2JKVA 4R69A 3D4NA 3GN2A 1HYHA 4MIYA 5DCYA 4AICA 4J43A 2A4KA 1SOWA 3DEYX 2VWPA 2ZCVA 4ND4A 3H9EO 3HN7A 4U7WA 3JQ6A 4MP3A 1M75A 4ZRNA 1PWZA 5CG2A 4PLYA 1VJ1A 4FFNA 1OZAA 2EKQA 4K6CA 4IGFA 5A4DA 3ENNA 2OL4A 3O8QA 3AOGA 5JMWA 1Z73A 1KBZA 3PPIA 1CF2O 3DQPA 5TJ9A 4XD2A 2YUTA 1YDEA 4BNMA 3L0DA 5A02A 2VN8A 4WKGA 1X13A 1OBFO 1P3DA 2Y68A 1R12A 3B70A 1HSZA 5BSFA 1LUAA 1OC2A 1N8KA 5L4LA 3F1KA 4Y9DA 4IXTA 1GUYA 4U0KA 4B8ZA 1IL0A 3GC6A 4URFA 4E12A 5DN9A 1XKQA 4E2YA 3DR3A 2JD2A 1ZK0A 5G0TA 2GF2A 3V2UA 3MJ4A 4TRJA 3LSYA 5JS6A 5AXDA 4BO9A 1W6UA 4A5OA 3DL2A 1JAXA 3AI1A 3F5QA 1BGVA 4I9HA 4E2XA 5HWSA 4Z3DA 3UVEA 1HYEA 1U7TA 1JA9A 1G0NA 2ZATA 4RZIA 2VRBA 2Q2WA 5C5IA 4DLAA 4XR9A 2X0JA 2YDYA 3TFQA 1KVRA 3RBVA 3FNEA 4EW6A 5IF3A 4NK5A 3C1AA 3V1UA 4W6ZA 4CPDA 3WNQA 2NQTA 3OEYA 3ON5A 3OETA 5G0WA 4BGIA 4BNFA 4CQMB 2LDBA 1TVEA 3ZWBA 4BO6A 3BHMA 3RC7A 4XYLA 4HFJA 4LCEA 4TZTA 3O9ZA 2Y67A 1PWXA 1H2BA 3ZU4A 3ZWMA 4KP7A 5H82A 1XG5A 1GZ4A 2RHRA 2CMDA 3DBRB 4RPJA 2VWHA 3SC4A 2HMUA 5U1PA 1LLDA 1ZK2A 4ND3A 2EP7A 2GASA 1L1FA 5TF4A 3ADPA 1J4AA 1X0XA 4XYMA 4BNYA 1WVGA 2I99A 2I67A 1KY4A 1P31A 4YJGB 4BNLA 4MVJA 3VVBA 3ZDFA 1CETA 2PGDA 5JW6A 1T25A 3DTTA 2VWGA 4R1NA 4XDYA 3TZ6A 1U5AA 5HS4A 1NR7A 5JE8A 1DJQA 1I36A 4BMVA 3D3EA 5LDGA 5DBFA 4R5MA 3FBGA 2CD9A 1XHLA 3OICA 5G0VA 3P7MA 2HKIA 4PG5A 2BHLA 2V6GA 4BO7A 2ZYAA 2Q49A 1IB6A 1HDOA 3BTUA 4D44A 2YQ4A 1R37A 3ZNOA 5JO9A 1Q0LA 4FJ1A 1C1XB 2GN4A 4OJNA 4RVUA 1XLTA 2QX7A 3KYDA 3F6YA 4XDZA 4WCFA 1LSOA 5IFLA 2P2SA 2WD7A 1FXSA 4ZQEA 1BW9A 1E3LA 1KY5A 1LSSA 4MVJG 4TRRA 1JLLA 3A9WA 2ZYDA 4AL4A 4DXHA 1XU7A 3RUIA 3EHEA 4OM8A 4YAGA 2B35A 1LDGA 3GVPA 4RQTA 3VVCA 2QYSA 5TC4A 1NQTA 1JN0A 4RLSA 3CTMA 3W8DA 4BNGA 3LT2A 3QY9A 2C82A 4HX5A 5TX7A 3SEFA 4L4RA 1PJ4A 2PD4A 3PJGA 4E31A 2NUAA 4I08A 4PFJA 1B8VA 4HFNA 5C7OO 5IDWA 2D5AA 1M67A 3EY4A 5ICSA 1DOHA 1V35A 3BAZA 1NBOA 3UOGA 2DT5A 4JJFA 3ABIA 5JXWA 1MXHA 1YBAA 3ZWCA 1RKXA 1OAAA 5JAQA 4GMFA 4PVCA 4JX8A 2DVMA 3WBFA 4E6PA 3DWFA 3PDJA 4FBGA 4IDFA 2NADA 4LGVA 1OI7A 4BO1A 4GLOA 2OHXA 3K31A 2X8LA 5L51A 4NJMA 5JY1A 4DBZA 2FRDA 3RUHA 2VUTA 3GQVA 4NMHA 3G1UA 4L0QA 4B4OA 1E1KA 1XGKA 2IZ1A 3JQBC 3NT2A 4KMSA 2O3RA 5DP2A 3GR6A 1ZMTA 2AG5A 1DPGA 3LLVA 3HHPA 5F1KA 2HLPA 4YDRA 3RBXA 4H15A 2AQ8A 5KWEA 3TRIA 4XQGA 3VPXA 3DZIA 1DIAA 4IXWA 5DCUA 4XYEA 4BVAA 1R0LA 4DMLA 4J3FA 4UVDA 3H5NA 4F6CA 3G1TA 4Q3EA 3TSCA 4II2A 4D0RA 2HMWA 4K1LA 4CM7A 5TSDA 1GQ2A 3PYMA 1VPDA 5TJHA 1DO8A 1YRLA 3KB6A 1T2CA 3VPFA 3Q2KA 3TWOA 2VCYA 4JIGA 3SLGA 1PS0A 1ADBA 3DB2A 1T1RA 2YQ5A 3HSKA 4CL8A 4IQGA 5FI5A 3VAZA 2B4TO 5MDHA 1Y7TA 2GERA 1SMKA 3PI7A 1KC3A 5C7IO 1N5DA 2X5JO 4DQVA 2X0IA 4TRNA 2C7VA 2P91A 1GQYA 3E8XA 4L76A 4ZGWA 1BW9B 5EIOA 4HV4A 4CMGA 2OO5A 4U6QA 1ZSNA 2HK9A 3L6DA 1PZFA 4UUPA 4ZICA 3EK2A 3L4BC 4DPLA 4O0LA 1WMBA 2P9GA 3HFGA 4NU6A 2EJWA 2VHWA 3LU1A 3CE6A 2C29D 3MWEB 1B0AA 1YB5A 1RYEA 3L07A 4CJXA 2D1YA 2OP0A 3H8VA 3JQAB 3ZU2A 1YBVA 3ZV6A 1LC3A 3DFUA 4WLUA 2GN9A 1C0PA 4OXKA 4BO4A 2V6MA 5ENVA 2UUOA 4BKOA 2ZB7A 1UDAA 2DM6A 1KEVA 2G1UA 4PG6A 5I7SA 4OO3A 2X4GA 4YPOA 2RHCA 4LSWA 1VI2A 4TVBA 8ADHA 2IE0A 4D3FA 1NAHA 2WDZA 4PRLA 2WEKA 3RU7A 2GZ3A 5COQA 4M1QA 1V3VA 1ENYA 1FJHA 3NGLA 2WD8A 3T4EA 3INGA 2O3SA 2FR8A 4FSHA 4NJMB 2AHRA 3ETGA 5T8KC 4RORA 3L9XA 2ZJ0A 4R3NA 4YEDA 1XQ1A 4ALJA 2EXXA 3GHHA 4R1TA 1U3VA 3CKYA 4UEOA 4D3SA 2FSSA 5DP1A 4R4JA 1Y6JA 5IN5A 1CQJA 3QE3A 3LK7A 1IYZA 3OM9A 5IXSA 1QSGA 4J7XA 3W4KA 4RF4A 4K28A 3JQFC 3WQQA 2GPTA 1ZCJA 4G5HA 1HDYA 4RQUA 3H4VA 2Q45A 3K73O 2HAEA 4P22A 1GYPA 1RYDA 1NPDA 4Y98A 1L7DA 1R15A 1LXCA 3BXXA 4NI5A 3PJDA 4J91A 4PZCA 4BKRA 5TLSA 4C7KA 4YACA 5FEUA 3NRCA 2QZ9A 1MP0A 4MIEA 3S55A 1HLDA 3GRKA 4G81A 5LC1A 4BNTA 2I65A 4BV9A 2VNSA 3VKVA 2D0IA 1MG0A 2RH4A 3TZCA 4BKUA 4UVGA 4B7CA 2VUUA 4CM9A 3VC7A 1YB1A 3E9NA 3VZSA 3NAQA 3ZV5A 1I3LA 2ZQZA 4M89A 2J5QA 3R0IA 4YA6A 3MJTA 3GAFA 2JHGA 5C37A 1LC0A 4XYBA 2UUPA 4AJLA 3HB4X 1ZSYA 2WMDA 3IP3A 1H9AA 3E03A 3HUDA 1Q7CA 3E9MA 1WDMA 1LU9A 2IEDA 2DPGA 4DYVA 3E9QA 2W98A 1QV6A 3K30A 4OSPA 5ILOA 4F46A 4FC7A 4XRGA 1HF3A 1UAGA 5KJ6A 4B3IA 3UFXA 4EZBA 4RLHA 2Z1NA 4GVXA 2PZLA 2Y1GA 3GNSA 3L6EA 4Y6PA 5EQDA 2A92A 1O5IA 2Y0CA 4MKZA 1LQUA 3PTZA 4ILKA 4MVJF 4BNNA 5FYDA 4ND1A 1FF9A 1P1HA 3DAGA 3OSUA 1BWSA 3EGOA 4QECA 4WOJA 1XCBA 1ZH8A 3SLKA 1ZW1A 1B3RA 4GWKA 4GSKA 3W6ZA 3WFJA 5KKCA 4RVHA 3STHA 3WYCA 5EPOA 4H3VA 4CM8B 3S8MA 4EYEA 1YGYA 3WLEA 4M8SA 3C3XA 4RO0A 5A5FA 1EUCA 4RDHA 3DOJA 5F3RA 2FOIA 5T5QA 5EMHA 5IJZA 2Y1DA 4CQMD 4QQRA 2VZ9A 1NTOA 2X9NA 2HCTA 5JCXA 1ORRA 1GD1O 5JDCA 1D8AA 1IE3A 2XXJA 3JQGA 4YT4A 3C1TA 1HTBA 3WWZA 2QRKA 2HSDA 1QKIA 4MOWA 1UDCA 1T1SA 2X5OA 4I5EA 1PZHA 3DMTA 3ROPA 3VZQA 1Y5MA 1RM4A 5K9ZA 3GN1A 1EVIA 4R9RA 4J7UA 2NLOA 3AOEA 2JD1A 4LCJA 3FWZA 2EP5A 5L95A 3WGHA 4ZQFA 2ZTUA 4E5NA 1ADGA 2P9CA 4E0BA 2PKQO 3TFOA 1LLCA 1AXGA 4A26A 2DU8A 2GNAA 1NAIA 1XIVA 1BXKA 3NJ4A 4IJUA 4J7CA 4XQ9A 1LSJA 2X9GA 2JCXA 3WG9A 2YDXA 3NEPX 4INAA 1AN9A 1Y81A 2JFGA 4A27A 2FMUA 3PFFA 2BMAA 1R6DA 3OECA 3UICA 5G0UA 3UN1A 1Y9EA 1UDBA 1NFQA 5A1TA 4LVCA 3F1LA 4MVJI 1K6XA 1LRJA 5GZ3A 3OA0A 3DMYA 4EJ0A 3GZNA 5GZ1A 2FY8A 1I3MA 3Q1LA 4YCAA 1M6WA 5JDIC 3PHJA 3MTGA 2IRWA 4WE3A 4EJ6A 4YXFA 1X7DA 2BFAA 3B20A 4FFOA 4YQYA 4QXMA 2C5AA 2O50A 3C85A 4GWGA 4B7XA 2PA3A 2YFHA 4L4XA 1XA0A 1HZJA 1DIGA 1GQQA 2Q4BA 1HRDA 3RFTA 2V7PA 3GUYA 4BMNA 3NT4A 2Q1UA 3RUCA 5AXAA 3WNVA 3VOSA 1Y5RA 4JJGA 3S2EA 5JCJD 3JQ8A 3VTZA 4AJ4A 3I4FA 4Q3BA 1I5RA 3A06A 5CDTA 1X0VA 4H7PA 1E3WA 4PG7A 3GA0A 5JFOA 1ONOA 3JD0A 4J0EA 5ITVA 3UF0A 1NVMB 1WLYA 1DAOA 3GAZA 3B1KA 4L9RA 4B8WA 4IMPA 3SJ7A 1P77A 4RDIA 1B2LA 4GKBA 2JFHA 1U4OA 3I9MA 3S2GA 1K2WA 2H1SA 4J2HA 1GL3A 5LDHA 2POQX 5TNXA 1DB3A 5F5NA 3WGGA 3HADA 4JCOA 1QV7A 2FR0A 1CJCA 4LSMA 3PZBA 4RPHA 1DLIA 4CMHA 2Y93A 1PL8A 4OQZA 4FB5A 4J49A 1J5PA 4H16A 1JWAB 1PQWA 1YBMA 1DRVA 4GX1A 1JKJA 4QX6A 4IPTA 4CMJA 3ZNQA 3GDGA 4MVJD 3UCEA 4JP3A 4PVDA 2VHYA 2VHZA 2RBEA 1ENZA 2RH8A 3UXYA 3M2PA 4RZHA 2YZ7A 4J9VA 1X1EA 1MG5A 4W4TA 3W8EA 2D2IA 4NBRA 2GGSA 1W8DA 1TT5B 3IS3A 4YRAA 3PRJA 4J0FA 1GYRA 3ROMA 4HY3A 4DPKA 5JC8A 5B1YA 1A4UA 1G6KA 2ZTLA 4EUFA 3EVTA 3G3EA 3R1IA 3Q9UA 3D7LA 1E1MA 1I2BA 5JDCC 3IIEA 2Z5LA 4I5GA 4GBJA 2C59A 1W73A 1P1RA 3KOUA 1A7KA 4NNJA 1MC4A 5DULA 3X2EA 2PGJA 3B1JA 2W90A 1E7QA 3WTBA 1W4ZA 1ARZA 4Q3AA 4O6VA 4BNZA 1AXEA 5CEJA 4FFMA 1ZEMA 3GPIA 3ZN2A 2EJVA 3ZW9A 2CVQA 1P1KA 3PGJA 4HXYA 3VZPA 4WEQA 3AM5A 3DBRA 1BDMA 2NNLD 1A4IA 5JYEA 1CYDA 4Y67A 3CUKA 3P19A 3AW9A 3ENKA 4XA8A 1J49A 3KV3O 1U3UA 3GVIA 3I23A 1UH5A 2PH5A 4YJGA 5I8ZA 2YY7A 5CDSA 1OFGA 3LYLA 5BNIA 2X9VA 1E7WA 4CR7A 1F17A 5JY6A 1SCUA 4DIOA 1RPNA 1EEHA 1F0YA 3Q3CA 1RWBA 3RUDA 3WR5A 1HDGO 1VM6A 4OQYA 4PLZA 1JVBA 2ZIZA 2JAHA 3RC9A 4MDHA 1E3SA 1BSVA 1K0UA 3ZWAA 3RI3A 4KUGA 5G4KA 1K89A 1ZK3A 5IDYA 3FR8A 1C1XA 4BNVA 4DLBA 3JQBA 4Y6SA 2AMFA 1E7MA 4RF2A 3IP1A 5EQFA 4OHUA 3K9QO 2QHXA 2OXIA 3GMSA 4NFHA 3LT0A 5I8WA 1KERA 3KRTA 3FBTA 4WOKA 4XJTA 4PLTA 2E6UX 2C07A 5B4VA 4ZVVA 3PHGA 3GDOA 3BMOB 4J9UE 3LC2O 1LJ8A 3WGTA 3VKUA 3E82A 4G2NA 2P5YA 5T6BA 1EVZA 3AFMA 2CZCA 1HDXA 3HE3A 4P4GA 1XSEA 2BH9A 2Q1WA 4FCCA 5JCJA 1KEUA 1N9GA 2EF1A 2PFGA 4R41A 4R51A 5B4UA 1E92A 2OP1A 1VLLA 4RGBA 5ER9A 1VL8A 1DJNA 2IXAA 3B1FA 5GMOA 3UW3A 1UZLA 4CUZA 4E30A 2LDXA 3U4DA 1T4DA 4ZA2A 2FR1A 4GX0A 1LRLA 3PQEA 4DUPA 1QG6A 2DQ4A 2PKRA 3OJFA 4ND5A 3ZGYA 3CXRA 3FTNA 3H7AA 3ZU5A 1H0KA 4MP8A 4R3WA 3ZZNA 2E37A 4XZ3A 3ZWWA 3L4BA 5DOVA 2CUKA 5I9MA 1WAMA 4OXNA 5COAA 4R1SA 5DCWA 5G2OA 4FFPA 3GGOA 3ICPA 1EBUA 4PCVA 1V6AA 4A10A 2I76A 2IYPA 2P5UA 3PJEA 4LMPA 4FFLA 4F6LA 4J1QA 4ROSA 4PZEA 3F9IA 2WYUA 4Q3DA 1S7CA 1E3IA 1HETA 3DO5A 3VH4A 2CSUA 2G0TA 4W7HA 4YJFB 4GH5A 4EEXA 3N74A 4KUHA 4M55A 4Y6RA 3G79A 4GL4A 1U8XX 4Y8VA 1NFFA 3PLNA 4FJ2A 4PLHA 3ROQA 4CV1A 3PXXA 5L7WA 3ASUA 2ZYGA 3COSA 3E5RA 4IGEA 3IKVA 4AJIA 5JLAA 3H6KA 5T8KA 1ML3A 4EBFA 2A9FA 5HS6A 3IOYA 1C0LA 1P45A 5G4KB 4KOAA 5L4NA 4DIBA 1BRMA 4D41A 4I5FA 1DIHA 2BD0A 1D4FA 4PLCA 5BNTA 2C7GA 2FZWA 2X5KO 5B37A 5H83A 1QR6A 2E48A 3OJLA 3TOZA 3W6UA 3JQFA 3ONDA 1LRKA 2H9IA 4CQLA 3EVNA 4MIOA 2C20A 1QYVA 1NASA 2GUGA 3GY0A 3DHNA 3FD8A 1ENPA 3OH8A 4A7PA 1ZKMA 3PEFA 1NP3A 3UKOA 3BA1A 3JQAA 1D1TA 4OGWA 2X0RA 1FDTA 2TMGA 3DBLA 1HT0A 4ZU3A 4B4UA 1GV1A 1N9GB 4HP8A 4OIMA 3GNQA 4CM9D 5L4SA 3IL2A 1EDZA 4R01A 1DLJA 2Y1OA 1UAYA 3K96A 2VYND 1UP4A 3D4PA 3A28A 3MWDB 3QLJA 4JROA 3PWKA 1B16A 5H81A 3GG9A 4RCVA 1YS4A 1E3EA 4D46A 5B12A 3NTOA 3W4JA 1DEHA 1DDOA 1LDYA 1TA4A 4QFDA 3C7AA 2NVUA 2VOEA 1ISFA 4DRYA 5I9LA 1Y8QA 3GH3A 2XXBA 2Q4EA 4UEJA 1PQPA 1XYGA 2B5VA 2BI8A 4P38A 3EMKA 3HFSA 4IJWA 2VT2A 3SXPA 3RVDA 4TSKA 3DAFA 4A03A 1E5LA 3MTJA 3M1AA 5G0SA 1CEQA 2OOSA 4FFRA 5T64A 2SCUA 2Z95A 3I9JA 2B36A 4OH1A 2PR2A 1QYXA 4KUEA 9LDTA 2GCGA 3PVZA 7MDHA 1D3AA 1B26A 1C0KA 3JCZA 4BV8A 2BELA 1OMOA 2NV6A 1U7HA 3IUSA 1HSOA 3PQFA 3WGYA 4E5YA 1KVUA 1E77A 1TB4A 3GMDA 1PZGA 4Z9YA 1UR5A 3AM4A 4EUHA 1RM0A 3Q2IA 3KSDO 5KVSA 1DC4A 3I9NA 5KJFA 2DAPA 4DC1A 4RF3A 5HA5A 1NPYA 2BFPA 1SBYA 2AEMA 1BTOA 1PJBA 4IUYA 3AWDA 2IZ0A 3UUWA 5T67A 2J3KA 3H9JA 5HRUA 1YXMA 5DT9A 5AXCA 4NK4A 3U4IA 2VZ8A 5MGBA 3PP8A 2ZB3A 1S6YA 2WWRA 1H6AA 1O0SA 3PIIA 5COBA 5JC1A 2CNBA 4CQLB 1XU9A 1E3JA 3NUGA 1T2EA 1IULA 5DDIP 3GFBA 2QYTA 3IDSA 4IBOA 3DOCA 1VSUA 3GFGA 2F00A 1BMDA 5KNLA 2HO5A 2Y0EA 4B3JA 2O7SA 3GLQA 1PL6A 3DBLB 3PJFA 4PGFA 4WJZA 3WIDA 1QORA 2X23A 1IPFA 1I2ZA 1B7GO 3DZHA 1P1IA 4PLVA 4RL6A 3WGOA 1LTHR 1MA0A 1SC6A 3RC2A 1YH3A 3ORFA 4YQZA 4M49A 5EINA 2ILTA 4Q3NA 1MX3A 4IM7A 3MJCA 3OHSX 3PZRA 4YAJA 2J5RA 2UV8A 1NNUA 1UZNA 1R0KA 2YHIB 5IDQA 1XQ6A 2DLDA 1T4BA 1ZFNA 2JD0A 5CP8A 3RUFA 4M54A 3P5SA 1TT7A 1JAYA 2DBQA 2ZTMA 3PFWO 1MFPA 3QWFA 4YB8A 1Z7EA 4UVIA 2NVUB 1GCOA 4CM8A 4AG3A 1CWUA 4ESOA 5IN4A 3VHRA 4BNWA 6LDHA 4AFNA 1Y8QB 4BL5A 2HK8A 2R6JA 2Y0DA 4DLLA 4J4HA 2OUIA 3F4BA 3PHLA 4GGPA 3OP4A 3CZRA 2AQHA 3K8ZA 1PJTA 4AVYA 1KEPA 1QYCA 4EI2A 5GY7A 3PYLA 1VL0A 2QZZA 4HFRA 2DTEA 3WXBA 1C1DB 1ZXBA 5JDIA 4XQCA 1DIBA 3OQ6A 5L53A 1KC1A 2QQ5A 3ZWXA 3HN2A 4B4WA 2BLLA 1YL6A 2QW8A 2AA3A 3BYZA 1XDWA 3D4OA 3LF2A 4GVLA 4WGGA 2Q99A 1HYGA 4FOOA 3IKTA 2G5CA 1EQ2A 3HG7A 4RPGA 4IIUA 3PGXA 3FF4A 4U5QA 5DZSA 4I9UA 4AJNA 1NVTA 3ZV3A 4B4VA 1M76A 3K2BA 4J90A 1EE9A 3K5PA 1PGNA 2PGLA 3U5TA 5C7LO 2GR9A 3WQSB 4ID9A 2AE2A 1G0OA 2O7QA 3RJ9A 3R3JA 4EEZA 2EEZA 2D59A 3KSUA 1O6ZA 3W1VA 2JHFA 2VYNA 1M2WA 2CDBA 3GRPA 4NZ9A 3NX4A 6ADHA 2CFCA 1T2DA 4E13A 2O2SA 2EG9A 3QVTA 1D1SA 1GYQA 1HKUA 5CDGA 5U4QA 1MXFA 3ETDA 1K6JA 3WB9A 1IHYA 1ADFA 4JLWA 3TOXA 4AJ1A 3WBBA 4RJTA 3QWHA 3CH6A 1T2FA 4AJEA 4E3ZA 1D7OA 1PJCA 1CIVA 1GV0A 5K6AA 2W4QA 1AGNA 2WE7A 4JXKA 3KETA 4TROA 2OORA 2AEJA 4OXYA 5F1OA 4GKVA 4JBIA 1IHXA 4YAEA 1LEHA 3GK3A 1ZK4A 4P4NA 3U49A 1YVEI 4UUMA 3NYWA 4A2CA 4PLGA 3S1LA 4BO2A 4K9DA 3LLSA 1DXYA 2NWQA 3EDMA 4HUJA 3INTA 2EW2A 4IDEA 3QWIA 4WCDA 4DA9A 1GZ3A 3ZV4A 1EE2A 4J4TA 3ZNNA 2EGHA 4OMUA 1TEHA 3DBVO 1X1TA 4QUKA 3EAGA 1YQDA 1WW8A 1HDCA 1CRWG 4JP2A 1WMAA 5K0ZA 4TRMA 4WLOA 1ZJYA 2VYVA 3H5AA 4QO8A 4W82A 4CMEC 3OJOA 1JKFA 1UP6A 1KOLA 3IQDB 3A14A 2HJRA 4W99A 4ZQHA 4Z3KA 2W2LA 3TQHA 4BUCA 3OEWA 1IOLA 3KLMX 1XR3A 1SEVA 1ZEJA 5TQVA 4IIVA 4QSMA 1EFLA 4O1MA 3RUEA 4J4BA 3K92A 4UAGA 1U8FO 3H2SA 5DOZA 3KTDA 1MGOA 4IMRA 1U5CA 5J23A 4N5LA 4BQPA 4CMIB 1RJWA 2JFFA 2R00C 3RC1A 1A7AA 3KEOA 1I0ZA 4KQWA 4TKMA 2GZ2A 1N7HA 1JVSA 1PL7A 5BSEA 3VH2A 5BT9A 1C14A 2B0JA 4O5OA 2F1KA 4YBZA 3V1YA 1Y8RA 2NVBA 1K5HA 1MLDA 5CPBA 2PY6A 2P68A 4YRDA 1F14A 3U4CA 1O89A 2PD3A 3NGXA 4N18A 2ZB4A 1U9JA 1X14A 4HFMA 1KIFA 4J2OA 4OAQA 2ZTVA 4OKNA 3H3JA 4IZHA 5EJ2A 3FPCA 1WDKA 3GEDA 3TNLA 3SVTA 4GPD1 3G0OA 1TT5A 4NHEA 4U0JA 2VOJA 5KJEA 1ONPA 4FIZA 4ONEA 3BMNB 2HRZA 2I9PA 5A06A 3P2YA 1Y9AA 3IAHA 2D3TA 3V8BA 4NBVA 3FI9A 4XGKA 3ICCA 1B8UA 5B4TA 1QXSA 4YJDA 1SNYA 4Q9NA 2AE1A 4F45A 4MKRA 1DFHA 2EKLA 3LQFA 1EDOA 4MVJP 1L7EA 4FQ8A 3OJ0A 4AJKA 1PR9A 5TS3A 1W0CA 1LLUA 1ZNQO 1QP8A 1H93A 3GT0A 1SOVA 4BGVA 1N1EA 2QIOA 3BMCB 5ES3A 1KS9A 4RPKA 3OIDA 3TF5A 2BGKA 4E4YA 4MO2A 3FNHA 1H6DA 3IUPA 5A9SA 3FWNA 2PWZA 1QLJA 3JQCA 1UXIA 4II3A 3JSAA 1E7SA 1HWYA 5KTKA 2J3IA 4R16A 1KVSA 1GR0A 1NR1A 2CVOA 1LDMA 4UVHA 1I01A 2GLXA 5IDXA 4XIYA 2FZEA 4HNGA 5JNLA 2I3GA 4NBUA 4PG4A 1SZJG 1B15A 1Z82A 1VE9A 4E2ZA 4ALLA 1PJSA 2G82A 2JCYA 3NDRA 1FMCA 4JN6B 5CHEA 1O94A 5TT0A 4FJ0A 2I6TA 1CERA 5I7VA 1BVRA 5IAAA 3T7EA 4Q39A 4HKTA 2Z1MA 3WGIA 4DIFA 3U0BA 3WFIA 2P4HX 1HE3A 2GD1O 2VZ0A 2UYYA 1NFRA 3HQ4O 3W4IA 5K6AC 3ZCXA 4WPGA 3D64A 5HTOA 2E82A 4BB5A 4PN3A 3JQ9A 2H5LA 2HUNA 3RROA 5HBRA 4AJJA 3U09A 1I3KA 3RJ5A 5BSHA 4XRRA 1Y8RB 4F3YA 3FCOA 1DSSG 2HK7A 4HBGA 5KVQA 3S2FA 3EUWA 2DFVA 1I10A 3IJRA 4YVFA 3BMOA 1VKOA 1V9LA 4O59O 1AUPA 4CMBA 4FN4A 1YQXA 5BSGA 3WDSA
chains in the Genus database with same CATH superfamily
1RMQA 4UPDA 4G85A 2ZU6A 4HGPA 2IIBA 2OV4A 2Q7XA 3K9BA 5HFJA 1M2NA 2F62A 3O4RA 2NSYA 1SXQA 2O8CB 1DXQA 3HLTA 4GPTA 1SAYA 1U80A 4ZANA 4BCBA 2MIIA 2O2GA 4O1IA 3SICE 4B7UA 1X87A 1PCXA 3FM9A 3VTKA 5FBKA 3QM1A 1GCUA 2XT0A 5B7NA 3MJRA 2KSQA 3L7KA 3O83A 3QPBA 4RJIA 2X6QA 1DO0A 5CTAA 3FSRA 5C1OA 4UULA 3M4YA 2FETA 1U3DA 3C1UA 1M6YA 1VPEA 5C52B 1J25A 4KPYA 1P1FA 3OBBA 4OLFA 1E61A 3GD7A 4Q9LA 5A5EA 4CLRA 4HSGA 2IBMA 3FCUB 1SUEA 1JP7A 4LHXA 4QLBA 3OAAA 3Q3HA 3W5JA 4X92A 4W5TA 2LCIA 3N3BC 1PIWA 1N8NA 4CLHA 3JD1A 3F78A 3TN7A 1KZ1A 1DKQA 2WSBA 1M2EA 1AQYA 1Q84A 1T9GR 4RWZA 3AVVA 2Y1WA 3G0CA 2C57A 2H1VA 3P9XA 5HKKD 2GN0A 1JEOA 4L75A 2JI6A 3IP6A 4CV2A 2JW5A 1AU9A 1K66A 1PJQA 1Q5PA 4DTIA 4I8IA 1Y80A 2WAXA 3LHFA 2YJZA 3RM3A 3M5WA 1GEGA 3AEUA 4TQ9A 3EPKA 1RJEA 1X1BA 2EL7A 3EXFA 1CZUA 3I0ZA 5CFLA 4Q1BA 2SKEA 3HKCA 1NI4B 3SR3A 1Q12A 2ZRIA 3B5EA 2BV3A 2QTAA 4MVJM 3U62A 1ESMA 2PV7A 4K6GA 2ZVQX 5KYWA 3D1LA 1RBYA 3LGXA 4TUYF 3P2IA 2BDEA 4YWJA 4YV1A 3GCWA 4UHDA 2QA5A 3QJ5A 1XP8A 1LBEA 3CXUA 4HRAA 3DJYA 4BEBA 2W2KA 1MAAA 3WSVA 3F8SA 1GUZA 4RV4A 4RVCA 4RYLA 3HXLA 3RIHA 4EYOA 5TPZA 1O03A 1U3WA 3EXHA 3JRNA 4CT0A 1UPXA 2DLCX 2ATVA 4UU0A 5T41A 5EMMA 5JQGF 5JYBA 4L8WB 1UL1X 2HY7A 3KDAA 1ZHHA 1XZAA 2BKVA 4LI3X 4TXLA 5KCMA 4MAMA 2DPXA 4I9GA 3F6CA 1A72A 2EWVA 3Q87B 2HA2A 5AJWA 1V95A 3FOFC 3KEFA 3I9OA 1NZJA 3A11A 4AI6A 2BCGY 4LXIA 4NG5A 5FDFA 3OQ1A 3AF4A 3SDBA 3FMIA 2PK3A 3OU2A 1T26A 4WBNA 1U8EA 1NUQA 1P4JA 2GZAA 3L7JA 3AEZA 3NKVA 4Y2PA 4XOUA 1JA1A 3UAXA 1FLNA 2PZMA 4G0MA 3RRJA 4E5UA 1ULTA 4EYQA 1XMOB 1NP7A 5E3HA 2DQZA 2YHUA 1B00A 1PTJC 2AJCA 3A04A 3L0YA 3AKDA 1PEDA 1E6LA 1AHIA 3FVRA 2FZVA 3K9GA 3OUZA 4BLUA 5BUQA 1DC8A 2OCXA 4CI0B 4GKJB 3I34X 1LWNA 3DBOB 1KETA 2B4RO 2ISCA 2L42A 2FPGB 3GFSA 3LXUX 4ZU6X 4H3KB 1THZA 4FHFA 4MKXA 1RTTA 3U80A 3Q1KA 3Q8XB 4O3MA 2BRUA 1OLSB 3PU6A 3HZHA 1JW9B 3E6AA 2LIVA 3IUNA 4GP7A 5CYFA 4YRSA 2IY9A 5ADVA 4AN0A 4B7AA 4JNCA 2XMZA 2XMRA 1KO5A 3BHJA 2F48A 3HM9A 2CYBA 1Z9BA 3BJEA 3I58A 4XWOA 1F1JA 3HWWA 1KBOA 4BX9A 1FFYA 1PEAA 2G7MC 1O96A 3I0MA 5AOVA 3JWPA 4ETWA 3S27A 1K8RA 5JXGA 4DVJA 3S8EA 1R16A 1U0OC 2XUPA 4PZYA 1K0FA 3B6EA 1NR5A 4PONA 5JNVA 1GUAA 3QQPA 4CM7A 3B6ZA 1XYYA 3DV2A 5AP9A 1ZGGA 3KHTA 1U2GA 2Y92A 3KEGA 1BHQ1 1G8YA 4P93A 2H4ZA 3RAJA 3WL7A 5LU9A 1UXGA 4J1NA 3OQBA 2FWIA 4BMSA 1UEXC 2UVDA 2HHHB 1N7GA 2RCNA 4RJKA 5CB8A 3EVAA 1BQ3A 1MAVA 4UHCA 3JQ9C 2BGUA 4R54A 2OO7A 1C2TA 2P7IA 3BGWA 1XXHE 1ISMA 4Q7KA 4KGZA 1HE1C 5CM2Z 4D9EA 1U8TA 3WDMA 3G0IA 2IV2X 3WLHA 1V9CA 3FIJA 2J3HA 3C87A 2AOTB 1T9GS 3IR5A 4OAPA 2IEGA 4DIUA 1ZZEA 1EP2B 1TAHA 1M34A 2Z3VA 3DBIA 4QGAA 1MB4A 2BFMA 4EG7A 2CY0A 2PVSA 3O4VA 3QVWA 2WUVA 5K7SA 3GLGA 3IAFA 4P0TA 5EHIA 2Q0QA 4AO8A 2AFIA 3KOYA 1FE8A 2WT9A 4IHAA 5DNAA 3AFGA 4AQYB 3RRZA 2C9OA 3GA5A 5JXHA 2FLKA 1WUIS 2OHOA 3P97A 1A9RA 5DIZA 1E6CA 1ESDA 4EJSC 1R6XA 1C1HA 4FYIA 4MRRA 2C3OA 3R0VA 3RREA 3ROGA 2RE8A 3FMOB 4HDKA 2F90A 4PZDA 4DIEA 3IUBA 3W5CA 2AVNA 2BSXA 2MYPA 5JEDA 4CLDA 3K05A 2C2XA 4NQZA 3T4UA 3OE7D 3TZEA 4QICA 4QATA 4WOPA 3FPLA 4PBRA 4KYUA 4MULA 2C54A 3EG9B 3V1NA 5CVJA 4GI2A 1SG6A 4M8LA 3QP9A 1F2UA 4DMHA 2PX5A 2RGYA 1IZYA 1VBKA 4XR4A 2BT4A 3WLTA 2QE6A 2QK4A 5TDHA 2IJGX 2YWEA 1CRZA 1A9SA 3CV3A 3WYBA 4BVLA 1Y6FA 4TKLA 1CZLA 5CNIA 2ZCUA 3H9QA 4UAJA 3O8QB 1CQPA 4CMAA 2VRWA 1GO2A 4KWCA 1USWA 1UQRA 3K53A 2KI5A 1K63A 3E8MA 1EK6A 4IDDA 2QQEA 4CM5A 3HDGA 1PAUA 5DBGA 5CA0B 5LA6A 1WMSA 2WTAA 2C0CA 1SELA 3GLSA 4EUKA 1XZQA 5IULC 4BQNA 1T8WA 3AKYA 1EVYA 2OFPA 3MCVA 4OUDA 4K26A 4YCJA 3ZY4A 1XCGB 2O9JA 4BO8A 1M8PA 2HSEA 4EG5A 1NM5C 1D07A 1TLLA 2VJKA 3M81A 5H3LA 1T3HA 5T57A 2NU8A 2EP8A 2XYGA 2XCQA 2YHIA 5E38A 3H3FA 3IDZA 1HE8B 3M6IA 2HDHA 2GVDC 4J76A 3TL3A 3WBKA 4TVOA 4DA8A 2CVFA 3OCCA 3WRYA 1NNEA 3VYSB 5IAKA 1CEEA 1OYWA 2P2LA 1DCFA 1E20A 1GPYA 1QFYA 2O5VA 4PLFA 3CEMA 5IUKC 1PR5A 3U56A 2QD1A 3G2IA 5LN1A 3EZ2A 2QMYA 1ZIPA 4B3RB 2JJMA 1Q1BA 3HB5X 3RNLA 4NECA 4CM6A 2ALJA 4UREA 1SPBS 4RLQA 1T29A 3N70A 1QH8B 3FF1A 3Q4GA 1DQYA 1R3DA 2WSLA 2XVYA 1K7YA 1M7GA 1YHZA 2G9RA 2OY0A 2WAOA 4IDCA 3M89A 3SJZA 4RY0A 5REQA 4G0ZA 1N57A 1SHKA 2FMHA 4OXXA 3T9EA 4LXUA 3VDMA 4L5YA 5INTA 2NVWA 2AEFA 4YWHA 4AY2A 4KPUB 1QE3A 4AZTA 2FMXA 1Y1PA 3H8SA 1Q3KA 2AS0A 3O4FA 4XX0A 4Z54A 4PIPA 3PCXA 3TOVA 2P6PA 1CUGA 1H1TA 4HO1X 1M8KA 3LKBA 4RJLA 2OBNA 5H7XA 4KWEA 2WJPA 2X8WA 2Z57A 3BHNA 4P8RA 1XTQA 3VKWA 1FFDA 1POXA 4KI0A 1BWPA 3WFZA 3IEUA 3L7BA 3LUGA 1C8KA 2B61A 5EAIA 1WULS 1W8IA 1X9IA 2OEPA 4HMQA 4JQSA 3C4QA 5FI3A 1T9DA 2D7CA 2W6JD 4S24A 3GUZA 1I2CA 5CIQA 1WVMA 5ICEA 2VYVD 5JXJA 3UJ7A 2EJTA 4BV3A 4BP8A 1XO1A 2I22A 4V0NA 3T0FA 3ZCPA 2O3TA 1A2OA 3L1JA 4L74A 4Q21A 4X9XA 4E5PA 1Q91A 3ZK8A 3FZNA 1U2QA 2YJTD 1HQCA 2OCBA 2W2LD 2QROA 2ZSKA 5JTUA 4M86A 1SPXA 5KQPA 1I24A 2R6HA 5LUBA 1D9ZA 4QNRA 2Q2QA 1KYIA 3LL4A 3PDCA 5LBUA 3JVUA 1AQIA 5CLIA 5BRAA 2R3SA 5C7YA 4G0VA 4Y2RA 4E07A 2E4ZA 2XOXA 3NI2A 3PX2A 1PQUA 2EJBA 1EK5A 1KVTA 1Y37A 2VP9A 3FE2A 3GPBA 3F6BX 5KOIA 2RG1A 4YONB 4TYWA 1U2GC 2LGJA 4ZO8A 4IEIA 1NVXQ 1WDLA 4YMHA 2YN0A 3KQSA 3KLOA 3KKZA 4KR3A 4IKEA 3GVXA 4BVBA 5CW2A 1YVDA 1E1LA 2J6HA 2CHQA 1OBHA 1JXAA 3EBPA 4WCFB 3I45A 4AX4A 4C6RA 4HEHA 1EE1A 1X7WA 4D3DA 5AVYA 1Y3IA 2IH5A 1GKKA 1EUDA 2NUPA 2QZ4A 3OZSA 3DVLA 4F72A 2CLIB 5HIMA 1ODJA 4ZI5A 5KQGA 4LW8A 3J81k 3CUVA 2XADA 3BB1A 1X15A 3KSRA 3M5CA 4L73A 5GINE 3NHYA 1QHGA 1JHPA 1NLFA 1QRRA 2F3PA 3D0QA 3FYDA 4PZ0A 4C08A 3KQHA 1TVKA 3CIOA 5E3IA 1UJ4A 1F8FA 1NYLA 3CNBA 4PAOA 3ANTA 3GEGA 1B42A 2XUDA 2W4IA 1G16A 4WCVA 4C7JA 2R4QA 5IM4A 4A2PA 1PR3A 2IPMA 5CFZA 1BX0A 3IPAA 4R2JA 4B3HA 4WXMA 2PXXA 4AUNA 1L1EA 2D3WA 2YVLA 1HEUA 1LA2A 5G3YA 5C35A 3C3DA 5E0KB 4Z4GA 1I7PA 4OQ4A 1JJVA 1Z8HA 2RK6A 2YY6A 3OOHA 1VL2A 4WLNA 3ROKA 1M74A 4J29A 5IG2A 2IYWA 1XMJA 3QOXA 1VMKA 3D3NA 2J3JA 3F47A 1K4MA 1GCGA 1VGVA 2QUKA 3REQA 5JI3E 5KX5F 4FNGA 2HMSA 1GQOA 5FKJA 3NH6A 2OECA 4UDYX 1BXRB 1MH1A 1P17A 4EHKA 4KR6A 1OBCA 2VCHA 1WZEA 1ZH2A 1LX6A 1B1AA 1OREA 4LWZA 1DBVO 4HWGA 3F2IA 4JBGA 1XNQB 1GAXA 4YMUA 1FW8A 4DM7A 4IXDA 4DHEA 5MHTA 3D7MA 3K16A 4RA9B 4NFSA 5C8YF 3PWSA 2CV0A 2IUUA 5CEEA 2OA0A 4K6HA 3EZ6A 1C30B 1PQ4A 2BGMA 1IUOA 2XX3A 3HN6A 3M9XA 4L4SA 4LZJA 4QRHA 5D6NA 5DHAA 2WM3A 3O8RA 5DMXA 4GM0A 3LO8A 1W87A 4C6TA 1B23P 3DBHA 1E9VA 3JXEA 1NF9A 5FTKA 3T7AA 5DM60 1ZBQA 1MCZA 3DT6A 5EWJB 3K70D 4GL2A 2Q0HA 1YIAA 2H1FA 3MILA 6Q21A 8ATCA 4B79A 1GNTA 4IRUB 3F6SA 4N54A 3A4IA 4DBVO 1EFVA 3RWMB 4OFBA 2A59A 5DHPA 2P6MA 4PXSA 2WYVA 4NBLA 1F06A 3P9IA 4D4LA 1O94D 4ZFNA 5I4IA 2XCIA 4FGSA 2PTGA 3VX4A 4FXPA 2FMFA 4EQ6B 4X6XA 3O8LA 1NG9A 3WIEA 3W04A 5IYZA 4RXTA 3T4XA 5CMLA 2D5LA 5M29A 1TUIA 2CCKA 5F2OA 4ZI7F 3IUQA 3NS7A 1YULA 3AUYA 5BRJA 3ZK9A 1KMHA 1N2GA 4BB6A 2ABWA 4JEHA 1RQXA 2H2HA 3KQVA 3MZ0A 4PPYA 3BL5A 4I9FA 1P5RA 2OZPA 3ADCA 3IDQA 3ZXUB 4FEEA 2BE7A 2EDAA 1SVWA 2V6FA 5DH9A 2ZUBA 1CUYA 1PX0A 2GDZA 4JYMA 4CIDA 2IOYA 4FE4A 5AQ1A 2JFOA 2Q5LA 3GVHA 4M1MA 1UAAA 2QN3A 1DDIA 1ELOA 4WY2A 4MSUA 3T1YB 5KO2A 3L4SO 3IMEA 1K1EA 4F4JA 2WIGA 3S28A 2LNDA 5D3QA 2B69A 2ODTX 2XLCA 2W8ZA 4JX9A 1RXVA 1SH7A 2FRDC 1T5TA 2H2AA 4RMJA 4Y2XA 5H5JA 8OHMA 4QC2A 4BIIA 2AKEA 2V59A 2BFBA 3GHYA 1QHHB 4J0QA 3VBEA 4IKPA 1TQ6A 4JUIA 1BMFD 4HUQA 4TV8F 4E32A 5HYVA 2JJ2A 2JHPA 2C5EA 3I9KA 2BMDA 2H29A 1TECE 1JYSA 2P6UA 4UNQA 4XUEA 4EO9A 3AXTA 4FDAA 5CEFA 5KIAA 1Z45A 4X61A 1F48A 1LDBA 3L77A 2GPBA 4I1OA 1MEOA 2DUUA 4MUHA 4Q7EA 3FKSA 1HC7A 4TMVA 4K88A 1L7XA 4ZC8A 1BU5A 5THKA 3R5XA 2H59A 2YV4A 1L1RA 2ZBQA 1ID1A 3A3NA 3ENQA 3HXTA 3O1LA 1CQIA 3QJGA 3KYBA 3DTVA 4R68A 3ZS9A 1V3TA 1E32A 2CDRA 3BTSA 4X63A 1BIFA 2BF7A 5EMNA 5FNVA 4ND8A 3WIUA 4J6EA 4HNUA 1F8YA 2FN3A 1G6Q1 5K51A 2QAJA 3DFZA 1XVLA 1VJCA 4BV2A 4N5NA 2YV1A 3GJYA 4LOLA 4O3FA 2X1LA 5B2FA 3HDHA 1IBMB 4EW2A 1GDHA 2C96A 2AC4A 3GCXA 5DTRA 3WGMA 1P9LA 5HM8A 3F4KA 5ITWA 2ZRFA 1KFEB 1W581 1J6UA 4JI3B 1E2JA 2VH1A 4KK4A 4CWAA 2FSPA 1VLMA 5JALA 2FPPA 3L04A 1N5RA 3LNTA 5BN3B 4W5QA 3TB6A 4CLXA 3OMWA 3ZD7A 2EZ8A 4WWHA 4MJXA 3IKJA 1E0JA 1S02A 4KITB 3D6NB 1M0WA 4Q7LA 2ZLBA 1LTKA 1VE6A 1JEAA 4LIPD 1EHIA 2IDMA 4FD3A 1CR2A 1NMYA 1FFXA 1LFAA 2OKGA 2ZB8A 3QSGA 3VYUB 3JYQA 4JLMA 1G21A 1GA4A 2VTDA 4WN9B 4NBNA 4DNPA 1MH9A 3EFOA 1MQ8B 3SSOA 1AKMA 4M4SA 3NMUF 2W2QA 1QOZA 4QPJC 1QG2A 3WICA 2JLCA 1WQ4A 2VJOA 1S2DA 3VBCA 1VJ0A 1ZSVA 2ACEA 4B33A 4M1EA 3C8DA 3N2GB 4NATA 5AW3A 1P7VA 3LDFA 3I53A 4ID3A 1YJ8A 3D81A 3FNGA 1WUJS 2JLRA 3TNFA 4BBJA 5HOEA 1REQB 1L4LA 2EJUA 2QE7A 3MTEA 3G6KA 4M0LA 2OHFA 3RS8A 3OPYB 4CM4B 5FX2A 5HUHA 1PKEA 4LFBB 3KR0A 1J42A 2Z9DA 4YYZA 3DXYA 3ORYA 3SYKA 3ZWNA 2IS4A 1Z74A 3ND8A 4HADA 2GLTA 1YDWA 5JROA 1FNDA 2VHVA 2VDWA 2ADOA 3QVSA 4TTJA 1P5JA 1WUHS 1SXJD 2LKDA 3JV7A 5JNRA 1M9NA 1WD5A 2NIPA 2BDUA 2CL7X 3EBLA 4LZNA 4TMZA 1YCHA 1BXGA 2H18A 4IMJB 1XELA 4KHZA 4M99A 4XX1A 1NVAA 2QMQA 2GM3A 2X5XA 4KTTE 4BFYA 1PJLA 2YZKA 2EQBA 1R4MB 4D8UA 1X7GA 3QFHA 1AQNA 3CF2A 3DVRX 2OAP1 4I4CA 3M0EA 2CLHB 4NYIR 5KPJA 3GAMA 5TMDA 3OJEA 1E89A 2IV7A 1J56A 4IJVA 1J33A 4H0CA 3EEYA 4KR7A 1L9XA 1Z5OA 2Q1YA 3UNXA 2JCVA 2A78A 4HF7A 5JZBA 2Y1XA 3QVJA 1QP7A 3OMLA 1RAGA 5FF9A 4NU5A 3FMPB 1XNJA 3DS8A 2OV2A 4X1IA 3RTGA 3WHPA 4BXOA 2WW8A 2CB9A 3LKVA 3TW4A 3MJSA 4J0JA 4DM4A 1IQPA 2C2ZA 1F6WA 2KPOA 3EXG2 3OD1A 2J09A 4FWBA 4ZIRA 3ZLBA 2PZAA 4JI0B 2X8JB 3UFXB 4B6EA 1TAUA 4D42A 3DKVA 2AF3C 4PHTA 4IQ0A 4PQRA 2G3YA 1NX6A 1N25A 1WW3A 2AN9A 3HCCA 4A8JC 2R6GA 3RD5A 2VF2A 2YX1A 1Y1RA 1VG0B 4LY3A 2Z43A 3RSZA 1DUIA 5FORA 1F2DA 2Y05A 3JWHA 4W9RA 1I14A 1SQ6A 1Z4IA 5H9WA 3KD3A 5CK4A 2Q2VA 4MR7B 4LMAA 4K6KA 5C4GB 1YDGA 3OC0A 3L1VA 4YPVA 1Q95A 1KXZA 2ZRBA 2QUZA 4WOCA 3CCBA 4L6CA 4RWEA 1OW3B 3BD7A 4KFSA 2HFJA 3L79A 2EBWA 2RD2A 3DDNA 3IP7A 4EHJA 4ZMBA 4CEJA 3HWRA 1XTRA 3L8EA 3QVGB 1VKNA 4JASB 1IEVA 2O23A 4NMWA 1A2QA 1G6HA 4M0UA 4Q4AB 3ULKA 5KREA 3BFKA 2OZVA 1VXRA 3QVVA 3JD2A 4KRYA 3UH0A 3UV6A 5KJCA 4BC1A 3IURA 2ZJ2A 2BHNA 3ZWPA 1D5CA 1PS9A 2ZWOA 4RC9A 4N01A 3ZWYA 1HV8A 2X13A 3AUAA 4GMDA 1TC2A 4LK3A 5KJ1A 1IIBA 4E2FA 5ALQA 2DH5A 3M49A 1OTXA 2R4UA 1YRBA 4G3XA 4KNYA 7ADHA 3N2LA 3ISTA 3TL2A 3AUFA 1ZMOA 2RBKA 4QYWA 2PIAA 4NYJR 4UQLA 4XVQA 1XHFA 4GXQA 1ISGA 5FPTA 1BZYA 4JKOA 3OF3A 4NLLA 4WUVA 4CMKA 2QN8A 4KTVE 5B7PA 2H4HA 4P0QB 3D2LA 3VSEA 1JB9A 3FNQA 3V9AA 1NUPA 4FHGA 2WQZA 1UBHS 2W7TA 2XQGA 4R8LA 1EDBA 1H69A 1UMDB 5ICMA 1KH1A 3GFTA 4NEGA 3RHZA 4OP2A 1DMRA 1JQ5A 4NIMA 5AJUA 1U04A 3WLJA 1ULSA 1GTMA 1SKBA 2GVZC 4QO7A 1KQNA 1PGPA 3SBDA 3UO8B 4R2WA 2XH8A 2J0QA 5EZYF 2XJ4A 1Q0PA 4D4HA 1X7XB 1OI4A 4KR9A 4LS3A 1VOTA 2O52A 2VNAA 3U40A 5IVHA 1GN8A 1HGXA 3ST7A 4B44A 4KN5A 3MUFA 5ICFA 1RQNA 3QE4A 2X86A 2FHSA 4JA0A 2Z2IA 1MJGA 3IJPA 3PR2B 4YRGA 4DGQA 5THQA 2R1VB 1OXKB 4QOEA 4WOBA 4QUDA 5EKSA 3OTOB 1QP4A 2DEUA 4P0PB 5T7BA 2ZWVA 3SD7A 4EAQA 2R7LA 2RHLA 1RM5A 4X8OA 3KPUA 4M0KA 1Z7WA 1MJNA 2BF4A 3ROZA 4CCYA 3ADBA 2XBLA 3L8HA 2AWNA 3O7MA 4KZPA 3TVTA 4A6EA 2M1ZA 3SK0A 3OFSA 4IV0A 3T38A 1S4MA 5EVJA 4B32A 1KYQA 2WF7A 4DEVA 4CF7A 1ZR4A 2BGGA 1WKBA 5E1MA 3KAKA 5K3FB 3W5VA 1K9VF 1T24A 2A35A 1FYEA 2A0UA 3L7LA 3C39A 2I3ZA 4D9MA 1KI6B 2NXCA 2VRCD 4FLEA 3IBGA 5E7IA 3Q9NA 4MUIA 2QBYA 2Q8QA 4O2AB 4C4RA 2ZXFA 2I80A 3N5CA 2B4YA 1O6CA 1R9MA 3BMQA 3DHEA 3DEHA 3EGDB 3CMMA 2GCIA 5K3BA 3RLFA 3SYTA 1ACJA 1PSDA 2PUDA 4NXNB 1U9ZA 3DMTC 4DDVA 2DBVO 5FLEX 2GYYA 4IHQA 4E21A 1LPBB 1P61B 4HOYA 4Z0TA 1DELA 4HD8A 2QRLA 3EVDA 1YJ5A 3HR7A 1R5BA 4UMEA 3SQNA 1AHHA 4ZHQB 5GZ6A 2AR7A 2NOAA 3OIGA 4PEVA 3KT6A 3GLKA 1WTCA 4KE9A 4MA5A 3D3WA 1RFGE 2AN3A 2A1TR 3RO7A 3A4VA 5BYBA 3UAGA 3S8YA 1T2NA 1N3IA 4NICA 3E1KA 2FP3A 1K3TA 1C7QA 4IQ8A 3WY9A 3ZUGA 4D9BA 1K75A 4YMVA 2OXTA 3GNTA 5KKAA 1EFPB 3F3SA 4WBSA 1BXZA 5AKKA 4EELA 1LX7A 1PZNA 1PBNA 2XB9A 3F98A 4TLLB 3WHLA 4ALNA 4E2WA 1ZW6A 5LZ9A 1QUEA 4LZPA 1N2BA 1XRJA 2XWBF 1OV6A 2EDCA 3IBCA 4A16A 1M6NA 3D4NA 4XTCS 1KAOA 2AI3A 1XDZA 2OB1A 4MIYA 521PA 4CHGA 2C8LA 2K2WA 3KELA 3E53A 4GVPA 4J43A 4L5AA 3DEYX 2I4TA 2VWPA 3H86A 3INYA 4ND4A 2HYIC 3NDBB 1HTWA 3JQ6A 3ONNA 3QBVA 1KDZA 3WK4A 2W0SA 4A0RA 5FOXA 5HQ3B 3TSZA 4ZRNA 5CG2A 1YJBA 1SVMA 3DE1X 4Y7CA 5FPHA 2G1AA 3MUEA 2ZSIA 2W42A 1CIJA 4FFNA 1OZAA 2FDCA 1TEZA 4K6CA 1IC6A 1XAJA 3SFTA 4Z7OB 1AURA 1NLYA 4Q47A 4M8KA 1RJDA 4RAQA 2OL4A 4ES6A 3AOGA 4KX3A 2AFRA 5LP6B 1KBZA 1YDHA 4HXFB 1QWOA 3NHJA 4IDQA 4HH0A 1XKTA 4PSCA 3OEHD 4XD2A 2O1XA 1JXQA 2HWKA 1MW9X 1YDEA 2PZGA 1PV1A 4L50A 1GQFA 2HU7A 2VN8A 4NP6A 4DSOA 3CYFA 4KV9A 5K0LA 5BQXA 1MPXA 4K8OA 5T3YA 3Q8KA 1DEXA 1R12A 4C0WA 4QQNA 3CTPA 3EH2A 4CKWA 2B30A 3A4MA 1RZRA 2DY0A 2JGMA 4AIRA 3UUGA 1JU4A 4Q7MB 3AFIA 4BECA 3I8OA 2RHMA 4U0KA 3RVNA 4BP1A 4V1CA 3KOXA 5CA1F 1SOMA 4LHYA 4E12A 5DN9A 3TLGA 5AKHA 4ZT4A 1XAHA 2HU5A 1Z33A 1YOBA 2O8FA 2JFUA 2GF2A 4AM8A 3AJEA 4EI9A 2P0EA 2P8JA 3AHEA 2W8BA 4RK4A 4MB6A 1W6UA 3K0EA 1LW7A 1OFUX 2JC3A 3F5QA 1BGVA 1APBA 1GP2A 2QAGA 4KIJA 3AFOA 5HF6A 1W59A 5AHXA 4DFDA 4Y2JA 5LD2C 3E0QA 4KH1A 1RNLA 2X5NA 2Q2WA 1Z06A 4L4UA 3TFQA 3WIVA 2ILVA 2P9BA 1BHJA 1KVRA 2YDYA 1P7WA 2BCJQ 4EW6A 5CFOA 4HTFA 2QJFA 1UPAA 3V1UA 5BO5A 1GGJA 3B89A 1M2GA 1BNCA 1EI9A 1G5FA 2CV2A 4G9EA 5C5IA 3BSWA 5ISMA 3I61A 4CQMB 1TVEA 5CH8A 3TXXA 3A9SA 4IWNA 2WLTA 4BO6A 2DFKB 2ZIWB 3DDHA 3QUCA 1ZNYA 4I1PA 2IYZA 2R0QC 2VP4A 4HFJA 4IOKA 1VDZA 4LCEA 4R0VA 4TZTA 5WRFA 2PNJA 3SVLA 1H2BA 5EJ6A 1MQ9A 3LX6A 4KP7A 4P4SB 1U9YA 3ZQKA 1A95A 3L84A 1N4DA 2YVUA 2LZ0A 5FUWA 1KS2A 2K4MA 1O2DA 4RPJA 4PBTA 1M8GA 1P2FA 1Z16A 2PU7A 5U1PA 1IRXA 3AVUA 1LLDA 1ZK2A 4ND3A 2EP7A 5KC9A 5LFAA 3LOPA 5TF4A 4PS1A 2WIBA 1QFZA 2G36A 3K9NA 4CF3A 4BNYA 1TO6A 2I67A 2J3DA 2QYHA 5KYUA 3ZVRA 2HN9A 2WJWA 1Y5NA 3UWOA 3HXQA 2ICAA 1L3CA 4N48A 4JP8A 4JWKA 1CETA 5JW6A 3U4QA 2P75A 3I01M 3DTTA 1CR4A 1SCUB 2C78A 4OATA 2XE8A 5EIXA 5HS4A 1UK8A 3GP8A 3A2NA 3OI7A 5GQSA 1EJ0A 3D3EA 5DM4A 1IN4A 4R5MA 2PZEA 3P96A 1L7OA 1XHLA 3PLAE 4MTLA 3P7MA 3IQZA 4PG5A 5G0VA 2X19A 5ALPA 1D4AA 2QR2A 2BJVA 1ACLA 4I2NA 4D44A 3CLTD 2BE9A 2OYRA 3TIVA 4C0HA 2WJ4A 4K0RA 1KAQA 1Q0LA 4FJ1A 1C1XB 2GN4A 4QLOA 4QU5A 4RJJA 2QX7A 1XTJA 5TMBA 5CT9A 1JQJC 4K9KA 3CUYA 1CY0A 4B09A 5IFLA 1WCXA 3LOUA 3CLRD 1LSSA 4MVJG 4MPTA 1PFVA 1JLLA 3ZCQA 3A9WA 1V6CA 5K0GA 1XU7A 2YFYA 3I2HA 4O4JA 4OM8A 2AI2A 4JI4B 1ZD4A 4H27A 4RQTA 1L7NA 4YJ2B 1J2UA 1NQTA 4II7A 4YCSA 2RB5A 1V43A 4RLSA 5A7HA 3CTMA 2Q7DA 2B25A 2VTBA 4HX5A 1LJUA 3LX4A 4G5XA 3EPHA 3V8MA 1QJCA 1D6SA 1P9WA 2GD0A 1QX3A 3KPYA 4PFJA 1QCYA 3S7ZA 1B8VA 3BFVA 4HFNA 4HHEA 4RKQA 5C7OO 2SECE 1A50B 1FY2A 2OCGA 3EY4A 2PH1A 4MGKR 1NXXA 3BAZA 5ICSA 3IT2A 4INOA 4KAFA 3BD6A 4JJFA 3UOGA 3VZCA 2J0EA 4BVHA 3ABIA 5JNTA 1E60A 5JUWA 1OHHD 4G25A 1N36B 3RT1A 1OAAA 5JSZB 1ZD5A 5LQUA 4X7MA 3TRDA 4LDQA 4QBTA 4JX8A 2PGNA 4URHA 5DGDA 1I5OA 1WB6A 2Q2OA 3PA8A 4E6PA 3UOAB 2ZYIA 4Y2UA 1JUDA 2NADA 3DKPA 1OI7A 2AOUA 4G63A 5E8RA 5EYPB 4ENRA 4AC9A 3T7SA 2OHXA 3GARA 5JYCA 1OI3A 3HGQA 2ACVA 4L57A 4YP6A 5FHRA 1GARA 3SMVA 3VR5D 2X8LA 6GPBA 1HURA 3VSDA 4EA9A 1XMQB 3ZI4A 5JY1A 4R98A 4DBZA 5T6MA 3H6GA 4QOHA 3IOMA 2VUTA 4NMHA 4YJ3F 3RTAA 2H5EA 4L0QA 4M9CA 1E1KA 1R8XA 2C9CA 2VYFA 2WYHA 4TXNA 4RYDA 1XZKA 1KK0A 2YXLA 3A9TA 3GFRA 4CG0A 5BV0A 1FC0A 1DPGA 2ZJ8A 3LLVA 1L4YA 3VJMA 4TMXA 1J8MF 2AQ8A 3VYTB 1E94E 5KWEA 3EISA 4QNMA 3TRIA 3AX6A 1T0BA 3UK7A 1S8AA 4BRZA 1SULA 1KOJA 3KZ1E 3AC0A 4Q9KA 5C1IA 4TQAA 2DPMA 3V1MA 4PO3X 1T8TA 4HPXB 4XYEA 2NO5A 1RS0A 5FL7D 3LGAA 1CR6A 5B58T 4BVAA 3IAUA 2IUEA 3MMXA 3HKDB 2FWAA 1RYBA 3AI7A 3CR3C 3LCUA 4PQEA 3D4BA 2GBFA 3QXXA 4J7AA 4MQBA 1GQ2A 4PAWA 3PYMA 1FTWA 4P36A 3VUEA 1L4EA 4CNBA 3KB6A 5A4IS 1J09A 2JIMA 3VPFA 5EJMA 3Q2KA 2QLMA 1PS0A 3SLGA 4RKWA 2QAGC 4F3NA 3E9DA 1X19A 1T1RA 2G5PA 2YQ5A 3HSKA 1JE1A 1VFNA 4D4JA 5EKTA 2L82A 2ZG6A 4I4NA 5IPFA 2PBLA 3LDGA 4Y1GA 5BVGA 1EWQA 4FUTA 1DP4A 1TVCA 1KTIA 2ZS7A 4QD3A 4RVNA 1RAAA 1H1LA 4TRNA 2WIFA 5E9QA 2C7VA 4R6WA 3N0TA 1NBHA 1FNBA 4L76A 1LVHA 2MSLA 3D02A 2GTPA 4ZGWA 4B1FA 3CE9A 4OHZA 3HVKA 5K09A 1RRCA 1T0PA 1XD9A 4HB3A 5HPYB 2H0QA 2A9JA 4HV4A 3EEBA 4LQCA 1AZSC 3G0GA 4HNAA 2J9RA 2OO5A 1EGMB 2EGUA 1ZN7A 3AJAA 1WE2A 2I7DA 2SKDA 3L6DA 1JDBB 3EK2A 1G9TA 3JATB 2GOYA 3U4GA 4BDTA 5PNTA 3EPLA 4DV1B 2CVPA 1P1CA 4OYYA 1K98A 2VHWA 1PDWA 3TB4A 1ODFA 2OBXA 3HB1A 3MWEB 1JE0A 4FBLA 2G07A 1NW6A 1YB5A 1Y7IA 2P2ZA 2VPTA 5CNMA 5ALTA 4LNUA 4HTAA 1G20A 2HRCA 3E4CA 4QJIA 2RHOA 2EWWA 3DFUA 4WLUA 3EVGA 4KO1S 1FX1A 1L5LA 3DOEA 5ALWA 3TLBA 2AG0A 1V25A 5K0FA 1GSOA 3Q88A 2Z0MA 3KKLA 2UUOA 5AW9A 4W1QA 3EUFA 3ICEA 3O4JA 4PYIA 2DM6A 3C3BA 1KEVA 2P9QA 2UZAA 3GRZA 4OO3A 4PG6A 4QDJA 3ERCA 8ADHA 1D6NA 2RHCA 1VI2A 2I54A 3HBMA 1MGPA 5H8WA 1NAHA 1TGYA 4JDUA 2JIQA 5E1DA 4H35A 1FRZA 3OSZA 3IHWA 1BA3A 2CXHA 2GZ3A 1BX3A 1V3VA 3H2KA 4M1QA 4OHWA 5ECDA 4D5GA 3NGLA 3VOAA 4R8RA 1VP9A 2O3SA 2IYAA 2RKOA 4NJMB 1VKJA 3UM9A 1GPWB 1EJ6A 5FV4A 1XQ1A 3NHLA 5DXFA 4PHFA 4RHYA 5SV2A 3I6BA 3RW9A 4ALJA 3C5VA 2ODQA 4EKEA 2PLRA 5DSZA 4C2AA 4D92A 1Y3FE 4OLAA 1ZESA 4R4JA 2HDWA 2YVQA 3A9RA 3DDOA 3I05A 3R0QA 2DMRA 4FXOA 2BFFB 4XUCA 5IN5A 1VIMA 1JPJA 2A1UB 3ZE7A 4ER7A 2Z09A 1VB5A 3WAGA 3WHKA 2X41A 4RTLA 1O97C 4G1VA 2O2DA 3U7RA 2PX6A 1D04A 4Q9IA 2JI8A 4BFTA 1VHWA 3IP5A 3MINB 1ZN8A 2OPBA 2GPTA 4Z1OA 4G5HA 4RQUA 1GFZA 3DH0A 1QIIA 4B3XA 2Q45A 2WIDA 1TQ8A 3UJAA 1SIBE 4C3UA 5JRZA 2DHEA 2VUIB 4LE1A 1OKKA 1U94A 1AKRA 5LQJA 3BXXA 1RRFA 4BWFB 1EFAA 1QCCA 1NVKA 1V11A 2O0JA 1T0JB 2XY4A 1TCVA 2YXBA 3DMHA 3PJDA 4M9SA 2AXEA 3CNEA 1U0RA 3FHCB 3AGPA 2IIPA 5FBWB 2QZ9A 1MP0A 4G4GA 4MIEA 4R1OA 3O47A 5G1OA 1L9KA 5HF8A 1NVVQ 3WDKA 3AH8A 1I4EB 1WKCA 4YC7A 3QPUA 4DN6A 2A6PA 2P7HA 4OB8A 1FTGA 3GRCA 3LT5A 3O2JA 1SBCA 2G09A 2YJ3A 4IWYA 5EP1A 5AUNB 3ECSA 3RS4A 4N6GA 1NT2A 1GGHA 2VUUA 1QKJA 2I6SA 3AB7A 1XFAA 3VZSA 3FUUA 1WKVA 3BQMB 3FTCA 2MT9A 5FFNA 3AW8A 4M89A 4HYYA 3BDAA 2ANCA 3MJTA 4HH3C 5C37A 1M6EX 3T61A 5IRCD 4XJVA 3X2SA 4N49A 4LAFA 3WK5A 3HB4X 4MB2A 1Z5ZA 1TYCA 3JZMA 5BN4B 3IP3A 4HQ6A 1H8EA 4DLRA 2VZEA 5BOSA 1PWHA 5IX8A 5AI9A 1LU9A 1MQAA 2HQRA 3FFAA 4OSPA 1DBIA 5ILOA 4G0WA 5J4KA 4C3OB 4WNYA 3ZQ6A 4ZJYA 4U9UA 4WKPA 2XA1A 4QJ5A 2BR4A 1Z62A 4FC7A 3G8DA 5I7UA 1NULA 2BZ1A 3KBBA 1E8NA 3T1OA 5KTPA 1WB4A 1QONA 5AJYA 1TDJA 1WM1A 4ZOBA 3V34A 2ZI3A 3NIGB 3QOYA 5DWDA 4Y6PA 1VL1A 3LO5A 1T0IA 3U9SA 2UUAB 3PUXA 1WOYA 4NMLA 1P1HA 4Z8YA 1RTKA 3A2LA 3KXKA 3M6UA 4C76A 5FL7A 1XCBA 1X92A 2WB4A 1JXOA 1ZW1A 2HF7A 3KB2A 3KVRA 2QGFA 3W6ZA 1ZOOA 4WY8A 1T1JA 1SUSA 1FLDA 4NABA 4H0FA 2HRDA 4CDGA 4EYEA 3TD9A 4M8SA 2W83A 5A5FA 7REQA 3VVLA 4HATA 5F3RA 1E5TA 1HFJA 3BWCA 3H9BA 1I13A 2IEZA 4RV5A 5EMHA 1OXXK 3FAZA 2CNLA 2Y1DA 3GJQA 3CUSA 2OPHA 1NZFA 4QQRA 5AW8A 3DDWA 1KZHA 1GT91 5JCXA 1DXHA 4Q4JA 4JOCA 1KSGA 3WLKX 4CEHA 3N53A 4JT8A 3A3YA 4K03A 3MA0A 5BYKA 1JR2A 1ID8A 3IDAA 3KTAB 4HX2A 3HABA 4YP9A 4RIFA 1R4AA 1PG2A 2JEOA 3IELA 4F38A 1HTBA 3WWZA 2JI4A 5BORA 1IB0A 1S3IA 3AG6A 4BX8A 3VZQA 1Y5MA 1FP4B 1K08A 3LPNA 1SN7A 1LPOA 1PBTA 1GLGA 2YJ5A 4R9RA 2VF8A 5CJJA 2PJUA 1Y8CA 3MBIA 5IVDA 2RK3A 2EP5A 5FWXB 2CB0A 2SNIE 3PJRA 3WK9A 3O2SB 3W6PA 1W2HA 4UBLA 4WH0A 3BWEA 5TEWA 4A26A 2GNAA 3JAWB 3U3ZA 3H0KA 1BXKA 4LF4B 1TJ5A 4NV0A 3NJ4A 5DNYB 1CIPA 2A5JA 4M8NE 2EFJA 2ZBEA 1C9YA 1FLAA 2X9GA 1Q1GA 3K0FB 2Y4OA 5IABA 3NEPX 1PO7A 1Y9JA 4NAVA 4I3HA 2A3RA 4B2YA 3CNQS 4HLUC 4LDRA 2DKFA 2JLAA 1M72A 2I6QA 5L6MB 2B1GA 2PT9A 1E63A 4WHMA 1R6DA 3STTA 3B9QA 3UICA 2D4HA 4Y1RA 4LNAA 4TTIA 1PNRA 1RRGA 1Y9EA 5A1TA 1E0AA 3F1LA 1CUCA 1I51A 1LRJA 3KXPA 2YOFA 5GZ3A 3JWGA 4DCPA 3UG6A 4CE6A 1CXZA 5GJVC 4ZYZA 2A8YA