4NR0A

Crystal structure of the pseudomonas aeruginosa enoyl-acyl carrier protein reductase (fabi) in complex with nad+ and triclosan
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
259
structure length
259
Chain Sequence
b'GFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPELCFPCDVADDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRNVTIEEVGNAGAFLCSDLASGISGEILYVDGGFNTTAMG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
publication title Crystal Structures of Pseudomonas aeruginosa Enoyl-ACP Reductase (FabI) in the Presence and Absence of NAD+ and Triclosan
doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 90
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nr0A00
3BMQB 1DC6A 5JYDA 4NJOA 3JQGB 1YDWA 3WSWA 4Q3BA 3V1UA 3VC7A 1HDOA 5CDUA 1C1DB 1IZ0A 5CEJA 3FSRA 4ND2A 1HDRA 4BNFA 3K9QO 4OQZA 4RL6A 2PH5A 4I5FA 2VZ8A 4I8XA 4GWKA 4N54A 1DIRA 4MKRA 1H6AA 4Q9NA 3F3SA 3KYCA 5TRTA 3ZWWA 3DOCA 4C7JA 3C7DB 1M67A 1A7AA 1XU7A 2WYVA 2O2SA 2VHWA 1WXDA 3WSVA 2GO1A 3AI1A 4EJ0A 3UXYA 3IP1A 1WMBA 2XOXA 4FFMA 2CDAA 4AJ4A 1S6YA 4AICA 4DC1A 1TT5B 1WDLA 4OXNA 3QSGA 4BB5A 3GUYA 1QR6A 2X4GA 4AL4A 4AFNA 2J6IA 2ZJ1A 3ZGYA 1EFKA 1SC6A 1B26A 1T2EA 2FOIA 2UV8A 2EKPA 1N9GB 1EUCA 3ZWVA 1I2BA 4A5OA 3VH2A 5GZ1A 1GZ6A 4KMSA 1M6HA 5LDHA 4QX6A 2A35A 1E6UA 3ZV6A 3ZWYA 1YB1A 3X2EA 1DHRA 5A03A 4D3SA 4BNUA 4BO6A 2EWMA 3VPXA 1DFIA 1DXYA 5EERA 3OIDA 4BKRA 2I9PA 5F5LA 2BGKA 4MO2A 4J7UA 3D3WB 3PHLA 4IGFA 4ZJUA 3WGTA 1KC3A 3PLNA 1X0XA 2UAGA 1CWUA 5JLAA 4BQRA 3JYPA 4GWGA 3B6ZA 3NJ4A 4RF4A 2J3KA 2W90A 2JKVA 4ROSA 4DL9A 3BMCB 1C0PA 2FRDA 3K5PA 1R12A 5DNAA 4LVUA 2W8ZA 3ANLA 1HDXA 1PJLA 3VZPA 2BD0A 1ISJA 2HJSA 2PKQP 2YFQA 2YV1A 3JQ8A 4DMLA 5THKA 1JVSA 4Q3DA 4KUHA 1QYCA 1U2DA 4II2A 3FR7A 2NV6A 2ZYGA 1UZLA 5AXDA 1BRMA 1MUUA 4KQWA 1ZKMA 4CMIB 1U3VA 1KVSA 3FRJA 3W1VA 4AJNA 5KJ1A 1NASA 1LLDA 2DVMA 4LN1A 3ASVA 1H9AA 2VZ9A 1G0NA 5CPBA 2AXQA 3TPCA 3QVTA 1V3VA 3F46A 3TL3A 1E1MA 4I9NA 1N8KA 3F1LA 3TSCA 1UR5A 1PL6A 3INTA 1BDMA 4QXMA 1PJ2A 1YWGO 1GY8A 1E7SA 5JDCC 2CF6A 1P0CA 2ILTA 2X0RA 4Q3NA 1F14A 2DUUA 4MVJP 3DMTC 1PR3A 2G5CA 3MJEA 3S2EA 1GQYA 3EC7A 2VOJA 2GZ3A 4XQGA 2G17A 5CEFA 2E6UX 2X86A 3JSAA 4ZQBA 4CLOA 1JWAB 1KY4A 1H93A 4GBJA 5KJFA 2AG8A 3AI2A 4WCFC 1GFSA 1P1FA 4WLFA 1HXHA 3BMQA 3FNGA 4GX2A 3JQGA 4CM1A 4KWIA 2PD3A 1OC4A 1JKJA 1B8UA 4M89A 1C1DA 2X0IA 4OXKA 3GVPA 2PD4A 1T2CA 4NBRA 5K9ZA 3SLGA 4CV3A 3WGGA 4PLVA 5L45A 1LDMA 2AQIA 3QQPA 2HK9A 2ZB7A 3JD2A 3MJTA 4K26A 2GN6A 2C5AA 4RGBA 1SOWA 3MTJA 2XPCA 2Q49A 1ISGA 4GX0A 2W2KB 4BGUA 4YAKA 3EY4A 3OH8A 5EL0A 1T1SA 2GASA 4H7PA 2R00C 1PSDA 1P1HA 1F17A 1TT5A 4IS3A 2O3JA 2RHCA 3W6UA 4WCFB 3P19A 4GLLA 5BSEA 2VWGA 4IQ8A 1BSVA 2CF5A 1JTVA 4D79A 4IUYA 5JDCA 3R3SA 1YONA 5AYVA 1LLCA 1N9GA 3TDKA 3RBZA 3WYEA 3ROPA 2NLOA 5TGDA 1IPEA 1KBZA 3W4JA 5G0WA 4BO0A 2QZ9A 2WMDA 3IKTA 4Q39A 4MKZA 1AHHA 4ESOA 2VWPA 3JQBA 1ZK4A 4YAJA 4EJ6A 2AG5A 2D3TA 2HLPA 4CMEC 4Q3EA 2AQHA 3FBTA 4B7CA 4JBGA 4BKUA 4DQXA 4OL9A 3INGA 4P8RA 2HMWA 1R6DA 4NU6A 5F3RA 4G2NA 4JK3A 4MIOA 3WFJA 4NBWA 4B8WA 5LC1A 5KJEA 3VKVA 2J3IA 3BMCA 4N5MA 3SVTA 2O7SA 3IIEA 3ICCA 5JNLA 1ONNA 2YUTA 1GQQA 4AJJA 1KETA 1HLPA 3B1JA 1DO8A 1JKIA 4YBZA 3ZU4A 4W7HA 4RDIA 4YJDA 2Q3EA 3ETDA 4XJTA 5JAQA 3FR8A 1NFFA 1OOEA 1B15A 1NWHA 1RM3A 1XU9A 3GZ4A 3BTVA 4IIUA 4OYRA 4WEQA 4RVHA 3MCVA 2IYOA 1GZ3A 4ZICA 5DULA 3UICA 4CMIA 2I65A 4CV2A 4J16A 1HZZA 1AHIA 2PZKA 1I30A 3NKLA 4AJEA 4CR8A 3ZWMA 5B1YA 1IHYA 3FCOA 1M75A 2V7PA 5H83A 2CD9A 3GFBA 1ZK2A 4XIJA 2X9GA 3V8BA 1PR9A 1ULUA 2EW2A 3GLQA 4DC0A 3WLEA 3HDYA 1NFRA 2EKQA 2TMGA 3MWDB 4GI2A 4EUEA 5I7FA 4JJFA 2HSDA 5A1TA 2NU6A 1CQIA 4ALJA 3LQFA 2VWQA 5ER6A 4G81A 3DL2A 1ZCJA 3HNPA 4CLRB 1ARZA 2PY6A 3F6YA 3A06A 2JCVA 3DFUA 3F5SA 3NT4A 4FGSA 4IXTA 3NDJA 2HO5A 4PCVA 2YDXA 3LLSA 3QVOA 2IRWA 5IDXA 4NR0A 3GRKA 5G4KB 4ND3A 3WMWA 4RF3A 3GPIA 3VKUA 1FF9A 5I8ZA 1Y9EA 1YO6A 4HADA 4A7PA 4PLCA 4FQ8A 3DONA 5JMWA 3FBGA 4MJLA 4R9RA 3L77A 3QVWA 3I4FA 4XRRA 1NVTA 5TS3A 3WQSB 3K2EA 4R1SA 4BO4A 5CDSA 1ZXBA 1RKXA 1X13A 4KOAA 2YDYA 1I3KA 3C7AA 4DRYA 3AI3A 1XA0A 2HUNA 3MOGA 4YAEA 1GYQA 1HDYA 4CLDA 1EQUA 3CH6A 1NXQA 3ICPA 2BFAA 3GPDG 1W0CA 4XKJA 1LDGA 5DBFA 2W2KA 4EZBA 3JQEA 3PZRA 2Q2QA 1B3RA 4JBIA 1DAOA 1DC4A 4WCFA 4JP3A 1QYDA 3DBRB 1WMAA 2C20A 3GRPA 1L7EA 3VPHA 4WJZA 4ZGWA 4PG6A 5BR7A 5L7TA 5DOVA 1DRUA 5MDHA 4RPGA 4Z9YA 1DAPA 2C0CA 3ZW9A 4HFNA 3GT0A 1ZSNA 1QMGA 1FDTA 5IJZA 4DWVA 5JO0A 2WJPA 4E5KA 7ADHA 3RVDA 5HTOA 3JQ7B 3ZWBA 2BELA 4IDBA 1LQUA 5AXAA 1BG6A 4B4OA 4I5DA 1I36A 4A26A 1GEEA 2HMTA 2I67A 3KEOA 3ADPA 1O89A 1QXSA 2Y0EA 2ZTUA 3O8QB 3PXXA 1ZMOA 3F47A 3ENNA 3GN1A 3WMXA 4IDEA 5L95A 1CF2O 2GCGA 2Q2WA 4UUOA 3ZI0A 1Q0HA 3BHIA 1H9BA 4DLAA 3FNHA 3EZYA 3BMOB 2OUIA 4Z3KA 2R00A 3F4BA 4QEDA 3DTYA 1I2CA 4I1IA 3WNQA 1NWCA 2AEMA 2W2LD 3KM0A 1N1GA 1A27A 5TJHA 2B4QA 4BNLA 5JO9A 2EERA 2VZ0A 5EINA 2O3SA 1IL0A 3GMSA 1PQPA 4E5MA 3NT5A 1B14A 1E0DA 2OFPA 3W8DA 1CDOA 2LDBA 3D5QA 2IE0A 4E2XA 3MJCA 5KTKA 5EESA 3KEQA 2IXAA 3KSUA 3W8EA 3ZV4A 1E3IA 2A94A 4K6FA 2DBRA 2GF2A 4BHTA 4J9UE 4GVLA 1VLLA 2BI7A 3GNSA 5I7EA 1VSVA 1TLTA 2RH8A 1DIHA 2ET6A 1SEPA 2HRBA 2NU7A 3T7EA 1BVUA 2CDBA 3CPSA 3R6DA 4KP7A 3ONDA 4J0EA 4CLRA 1ISFA 3DBLB 4NBUA 3GVIA 4J4BA 1LC0A 2Y99A 2NVBA 4FC6A 3UUWA 3WGOA 2DAPA 3FPLA 3U4DA 3PHGA 5CHEA 3E82A 3PGXA 5G4KA 1ZK3A 4P38A 4HBGA 4XEHA 4NI5A 4J7XA 3AJRA 1F06A 1C0IA 4LCJA 2QRJA 4OAQA 3C24A 5TQVA 5HRUA 1EUDA 2J8ZA 1ZXLA 5T64A 3TQHA 3RWBA 5DP2A 5JS6A 1RM0A 1T25A 3H3JA 1F12A 5HWSA 3ZDFA 3OM9A 1XQ1A 3GA0A 3SLKA 4XCVA 4CM3A 5JC8A 4RQTA 4AJ1A 5ICMA 1EFLA 1AN9A 5IF3A 4YAIA 1PZEA 1W73A 5G4LA 1M6WA 1KERA 1PS8A 2HK7A 4ALKA 1P0FA 1LLQA 1HE2A 5FF9A 1GPDG 3QWFA 4OHUA 5TF4A 2B4TO 2O48X 5FWNA 3GHYA 1PWXA 4FJ2A 1X1TA 3LT0A 1LI4A 1NTOA 3L0DA 4PN3A 1YB5A 2GR9A 2AE2A 3DBRA 4MINA 3V1YA 4FFPA 1HF3A 3INRA 4NU5A 1C0LA 3D1LA 4PIVA 4DPKA 3JYOA 2NTNA 4CQLB 1WP4A 3KXDA 1BTOA 1ZNQO 2EIHA 3BHMA 2FSVA 4BL5A 1U8XX 4KTVE 3W8FA 3OMLA 4LW8A 3WGYA 4EYEA 1I32A 3VTZA 3UCEA 3ZU2A 3JQ7A 5L4NA 4CMBA 3NT2A 4JJGA 3CZRA 1KVTA 4ND1A 3U49A 1TT7A 1BMDA 2YV3A 1SPXA 1VKNA 2JFGA 3O8QA 3A1NA 4Y6PA 1A4UA 1IHXA 2BH9A 1ZO8A 2Y93A 4L4XA 1LLUA 4R1UA 2YHIB 5GY7A 1UAGA 4AJ2A 1LBEA 3VVCA 3GAFA 3BMOA 3H2SA 1E7YA 2AQ8A 3H9QA 4M49A 4RVDA 2PKRA 1Q0QA 2PK3A 2DBQA 1YBAA 1G0OA 2PGDA 3SBOA 2UYYA 2CMDA 2VYVD 3DWFA 2WM3A 1C0KA 1U3WA 1P74A 2VT2A 3I9OA 4FFNA 2NADA 4PLPA 3KLMX 2BFPA 3ULKA 4XX0A 1OZAA 2ZTLA 1MB4A 5ES3A 1YJ8A 4DLBA 3QLJA 3RUEA 1XLTA 4YRAA 4LGVA 3AU9A 4DBVO 2VT3A 3V2UA 2C7GA 3BYZA 5DF1A 4WE3A 1GEGA 4CUZA 2JD0A 2EP7A 2EJWA 1DBVO 1I0ZA 1M76A 2VHYA 4KDFA 2NQ8A 1Z74A 3WGZA 2WE7A 1H5QA 3UOGA 4BKOA 4O63O 3DBLA 1CEQA 3GFGA 4DBZA 1LDEA 2NTJA 2IZZA 4BNZA 3ROMA 1WLYA 2PA3A 2Y1OA 1IYZA 3CE6A 1H94A 2DLDA 2V6BA 1HWYA 3V1TC 2GN4A 5IN4A 4R68A 3D4PA 4D43A 3N74A 1U2GA 4W99A 1XYGA 4S1VA 2RBEA 3F1KA 4HY3A 4B3IA 1Y6JA 1R66A 4MVJM 1PJSA 4B7UA 3LSYA 3FF4A 1LSJA 3RROA 1PS0A 1DDOA 4M55A 4Q3CA 3ADOA 4P22A 5ICSA 1BDBA 3K8ZA 5F21A 3PIIA 3OETA 4D7AA 2GZ1A 1UDBA 3SX2A 3OA2A 2ZB4A 2WSBA 4U6SA 1PQWA 2QZZA 4J90A 1RYDA 4IMPA 1Q7GA 3ZHBA 1C1XB 1JVBA 4G65A 2A4KA 3DC2A 1ZMTA 2JFHA 2RHRA 2O3UA 3VOSA 3WB9A 3ZWXA 4E2WA 4D41A 4BO7A 1Z75A 4FOSA 4YTEA 3TZCA 4E6PA 1WPQA 3GNQA 3I83A 1O9BA 1DRWA 2EP5A 3S2FA 4QO8A 4L8VA 3DBHA 3QV1A 1SOVA 4CQLA 4BNXA 1MFPA 3DZKA 4TZTA 1GUYA 4ALMA 3UCFA 4EGFA 1MA0A 3C1OA 3ETGA 1DC3A 1BXZA 3DAPA 1ORRA 4GMFA 3LLVA 4TRRA 2X5JO 5I9MA 1EK5A 2VNSA 3JD0A 3I1JA 5A3VA 1H2HA 2P9CA 3K2BA 3TWOA 4D3DA 3I6QA 4WOJA 1HYHA 4UUMA 1D1TA 3QIVA 2CSUA 4RO0A 1UXJA 3DHYA 3TOXA 1I5RA 1N2SA 3U9LA 5A05A 3OP4A 1U9JA 1VRWA 1ZSYA 2YHIA 4U6QA 3WQRA 4HNGA 4Y8VA 3AK4A 9LDBA 5CEEA 3Q11A 1VC2A 2OP1A 1PJCA 1T4BA 3TZQA 1J5PA 3H65A 4TKMA 1E5QA 1PL8A 3AUAA 3DZIA 3R3JA 1XHLA 1J6UA 2Y1DA 3B1FA 1E3JA 3I6IA 2D59A 1HYEA 2GZ2A 4LRSB 1RPNA 4PRLA 4I5EA 5JCJD 4NPCA 4B4WA 5TNXA 4ALNA 3CSDA 4RPJA 2HMSA 1IPFA 2GYYA 2GSDA 2EJVA 3CIFA 3PJFA 3ZWPA 4CLHA 1JDJA 2BGLA 4A10A 3L4BC 4XDYA 4EITA 5CDGA 4PG4A 2I6TA 2PGJA 3FNFA 4MVJG 4WLEA 4F46A 3RCBA 4OIMA 4UULA 2AE1A 1EBFA 4FW8A 4IDFA 4A2CA 3OSUA 2DC1A 4NK5A 5T8KC 3JQ9C 4GKVA 4ZHSA 2P4HX 3EVTA 5HS4A 4BNHA 4J2OA 4EBFA 3BXXA 1VE9A 1ENPA 2EW8A 2VRCA 1PIWA 2X9NA 2WDZA 4W82A 3BTUA 4UVDA 2CVZA 1QKIA 1NQ5A 4E13A 3HZZA 5TT0A 2X0JA 2HJRA 1R37A 1PS9A 3E9QA 3IAHA 5JDIA 2PTGA 2Q50A 3RC9A 4XA8A 3Q2IA 2BFOA 4L76A 4NBVA 2QRLA 3SC4A 3I52A 4LMPA 3UH1A 5TX7A 4KDEA 2UUPA 1P44A 4BNMA 5CG1A 3EAGA 1L1FA 3W4IA 5HM8A 2WEKA 4IBOA 4R5MA 3PHJA 3W4KA 4MIEA 1ISMA 1XKQA 4Z3DA 1E7MA 3IUPA 3GDGA 1E5LA 5ITWA 1KEPA 3WTCA 2HU2A 3D5TA 4BGEA 1FJHA 1EQ2A 4C7KA 1WNTA 2F00A 3NAQA 4LK3A 3U4HA 4CLXA 3EMKA 1B2LA 5C7IO 4NMHA 3LC7O 4CM9A 5JFOA 1DB3A 2RH4A 4TVBA 1PZFA 4PLFA 3WGIA 3LDHA 4XJSA 4IDGA 4BV9A 5G0VA 2YW9A 1C1XA 2IZ0A 3JQAD 4RVUA 5K6AC 3ZHYA 3L6EA 4O6VA 3B70A 1A9YA 4TRNA 5JYEA 2V6FA 1D8AA 1X1EA 3T7CA 1X0VA 3Q9NA 1DJQA 2W2LA 3S8MA 3TRIA 3HFSA 2Q1TA 5T67A 1K6IA 4B7XA 4NFSA 3S1LA 1ENYA 2B5VA 3P2OA 1KOLA 3DZJA 5B4VA 1E3SA 1GL3A 3BZUA 3TJRA 1YXMA 2YFHA 4J1SA 3E5RA 5A5FA 4YT4A 1JKFA 2C29D 5KVVA 4GX1A 3TFOA 4JLWA 4YEDA 3RU9A 4YAGA 2P9GA 5THQA 4JBHA 2YY7A 4YWJA 5C3MA 4GKBA 5JPIA 3RI3A 3PEFA 1Q0LA 1JQBA 3DAGA 3L9XA 3MZ0A 2PLAA 7MDHA 4DA9A 4FN4A 3OJLA 3M2TA 1CYDA 1EE9A 1XQ6A 5TJ9A 4PLYA 4YCAA 5T57A 3ZHXA 2FR0A 1OMOA 4A03A 2OORA 3I9MA 3AFNA 3ZNPA 4AJIA 3PQDA 4J91A 1YGYA 2VN8A 2O7QA 1VSUA 1XWFA 2DM6A 4RPKA 3HFGA 4FCCA 5T5QA 1CIVA 1JU9A 5B4UA 1I01A 1LNQA 4Z9FA 5LCXA 1TVEA 2DU8A 3IC5A 3WX0A 4IM7A 3FWZA 2DPGA 1B8PA 1K0UA 3OEYA 4LMRA 3NEPX 4B4UA 2HMVA 3EHEA 4B3HA 3IL2A 3KSDO 3BTSA 3VZQA 1R16A 1ONPA 2C07A 4OXYA 3VH4A 1O8CA 3KB6A 1Y9AA 1TB4A 3NGLA 3DEYX 3ANNA 1Q7BA 2Q46A 1Y8QB 1A71A 3G3EA 1MGOA 5EJ2A 4ZN6A 2ZYAA 3UF0A 2LDXA 3D3WA 1U3UA 5EMHA 2D2IA 4PG8A 1F8GA 1R0SA 5GZ6A 1D1SA 2OHXA 1VKOA 4FGWA 4BO8A 4P4LA 3SXPA 1X7GA 3WGHA 4CPDA 2NUAA 4BVAA 1W4ZA 4R16A 4L73A 4PGFA 4Z6KA 1KVUA 3OQBA 4YT2A 1ZJZA 3S55A 2X22A 4YYZA 3NTQA 3WR5A 1U7HA 3AUUA 5CDYA 5G2OA 1O5IA 4I08A 4HKTA 3HSKA 1E3EA 3GZNB 3AUTA 2D5CA 1EVIA 1BVRA 1WDKA 2YYYA 3HDJA 2O2YA 3L4BA 2JCYA 2BMAA 2QG4A 2P4QA 4MIYA 3RUDA 4DQVA 3ZWAA 2WWRA 2FHSA 4CMKA 1NR7A 3GMDA 3DMYA 3OQ6A 2OL4A 4BO2A 3P7MA 5CP8A 3JQ9A 1T24A 8LDHA 1J4AA 2E37A 1AXEA 4JNKA 5TSDA 5L7WA 1GTMA 1NHWA 4MP8A 4L4SA 4MVJE 1A4IA 4CUKA 4B3JA 3LVFO 4IINA 5DDIP 3E18A 4XD2A 1HT0A 2B37A 1L7DA 3ITKA 3GGGA 2PWZA 3WGQA 4XDZA 4J43A 1SNYA 1Z7EA 2GRAA 1LX6A 2VQ3A 4RZIA 1GDHA 1P1KA 3GG2A 1A5ZA 4NQZA 1UXHA 2VYVA 1LQTA 3QA9A 4BUCA 1E92A 2EV9A 4XRGA 3DXFA 2DBVO 3BHJA 3GQVA 3IMFA 3IUSA 4NBTA 2AA3A 3D64A 2BGMA 4LVCA 1A72A 5L4SA 4YJFB 3CZMA 4TVOA 5BT9A 2ZQYA 4J49A 4FPXA 5KWEA 1FXSA 4IQ0A 1ZIDA 1T26A 3DZGA 1V3TA 2NQTA 1RM5A 1HDGO 3PYXA 5H81A 2X8LA 1EVZA 3RC1A 3AY3A 1D7OA 3UKOA 3WDSA 1FDWA 4IJVA 3VZSA 2H1SA 5KJCA 2HRZA 2Y67A 4BGIA 1EMDA 1T2AA 2VNAA 5K6AA 1SBYA 4CMHA 2Q2VA 3HQ4O 5IFLA 2ZQZA 3DMTA 2G0TA 1ZEJA 3M1AA 1ZEMA 5DP1A 1C3VA 5EPOA 3ZNQA 4PLGA 3DO5A 4BNIA 1GZ4A 1OBFO 2VRCD 3GY0A 2DTDA 1NYTA 2VYND 3SJUA 4XR9A 1CJCA 3QWBA 3PGJA 1GYPA 2DUWA 2AHRA 2I76A 2O3RA 1HTBA 4XB2A 4H16A 3GF4A 3JQDA 2NM0A 4PVDA 3Q1LA 3DDNA 1LU9A 2QX7A 4Y98A 1NPTO 3STHA 2HAEA 1ENZA 1LDBA 5L7YA 2ZTVA 3ZHZA 3HB4X 1PTJA 2YV2A 3G79A 1GUFA 3RASA 1PJTA 4M86A 2HK8A 3SJ7A 1NVGA 2OMEA 1KYQA 4L74A 2Z1MA 3A28A 4D44A 4TKLA 1QV6A 4J6FA 1Y8QA 9LDTA 1HEUA 1PX0A 4RLHA 4DIFA 1R4NB 3EK2A 3H4VA 1GR0A 4YACA 1MFZA 1Y1PA 2ZYDA 1V8BA 5U9CA 1MG5A 5L4LA 3HB5X 1E3WB 1LTHR 1H6CA 1M66A 1SAYA 2DQ4A 3JQAB 4EUFA 2QQ5A 4A27A 4CR6A 5HS6A 4CM9D 3ON5A 1PGJA 4J4HA 4PZDA 2GN9A 4TSKA 1UXIA 2Y1EA 1H6DA 1BHSA 4NZ9A 3JV7A 1P3DA 2PFGA 5EIOA 1WZIA 3PDUA 3GZNA 1P1IA 3LT2A 4YDRA 4DVJA 4EJMA 3RBXA 1KIFA 5JSFA 4JROA 4E30A 2IDZA 1WAMA 4CM7A 4OGWA 1E3LA 4ZQHA 3AM4A 4OMUA 4TRJA 1MC4A 5IDYA 3G1UA 4PG7A 3Q3CA 4CUJA 1UP7A 4CM6A 2X6TA 3H5AA 3HWRA 4LISA 1PJ3A 1HKUA 2TMDA 4CV0A 4N5NA 3ZV5A 1JAXA 3VAZA 2PR2A 3PDJA 3QWIA 4TROA 4TQGA 4L9RA 4CMCA 3KOUA 3ITDA 3D4NA 5IDQA 1W6UA 4JJIA 4CMJA 4WLVA 4CMEA 3RJ9A 1ML3A 4NHEA 5I7SA 1ZBQA 1TXGA 4Z0HO 3D0OA 1CERA 4IJKA 1U4OA 4OQYA 4PZCA 2Q45A 3QW2A 4PLWA 4CMGA 1KEVA 1E7WA 4XQCA 4FSHA 2FPIA 1KY5A 5G0UA 1XG5A 5JCJA 3EVNA 3AOEC 1G6KA 3RKUA 2Y1FA 3A9WA 4ZU3A 5JBIA 4QQRA 2B69A 3I9JA 1ID1A 3NTRA 1BWSA 3T4XA 4CR7A 4IJWA 4KUGA 5EQDA 4YJFA 4BO5A 1QYWA 1V35A 5IDWA 4GMGA 1EE2A 3AY7A 2CUKA 1EZ4A 4O59O 4YJGB 1WZEA 5IN5A 2QRKA 1MV8A 4J4TA 3OEWA 2B83A 4F3YA 1H6BA 4R69A 3TOZA 1Y5RA 3ENKA 3KZVA 3CTMA 4H15A 4WECA 5EQFA 4Y6RA 5G0SA 3VH1A 5ITVA 3D4OA 4GLOA 4BO9A 2P68A 3KV3O 3V2HA 3H6KA 3ZU3A 3AM3A 5I8WA 3A14A 1UP6A 2YHUA 5TC4A 3UW3A 3GVCA 4ZD6A 4BKQA 1IOLA 4MP3A 2J5RA 3OJOA 3MEQA 4DTIA 2R2GA 3OQ1A 4WOKA 4D0SA 1X14A 1U28A 5B37A 3GH3A 1JA9A 5C7OO 3LU1A 4WK6A 3PIDA 2GGSA 2V6GA 2NTVA 2XAAA 1IUKA 2IODA 2H5LA 3HADA 4L75A 3ZWNA 5JC1A 4FR5A 3OIFA 4RF5A 5IXSA 4F45A 2X1HA 2G82A 1SZJG 1A9ZA 1VJ1A 6LDHA 3JD4A 4CL3A 1LXCA 1RM4A 2BRUA 5DCYA 3L4SO 4GSLA 4E4YA 1XGKA 3PWSA 5JMPA 4RPHA 5A9SB 1QYVA 1G1AA 1T2DA 4E5PA 1I3NA 2QIOA 4AJOA 3NDRA 1JW9B 3RC7A 2G1UA 4HFRA 2FR1A 3JQCA 2JD1A 5EN4A 1Z7BA 3GG9A 2ZATA 3GEMA 3LF1A 3RBVA 5ER9A 1UH5A 3PJGA 1E3WA 2EGGA 1I10A 3FI9A 3JQAA 4PFJA 4RLSA 3ZV3A 1MG0A 4DYDA 1ADFA 1ADBA 5L53A 2DKNA 5FI3A 4HX5A 4GL4A 1QP8A 3D7LA 3VTFA 3PWKA 1E6WA 3GK3A 3RIHA 3UFXA 1D4FA 2DTXA 3WJ7A 4BGVA 2CZCA 1PGQA 2EF1A 3RC2A 4LCEA 4YT8A 5TT1A 4YJHB 3UN1A 1P1RA 2B35A 2Z95A 5HBRA 3O26A 1WWKA 3RU7A 5L51A 4K1LA 3L6DA 4BMNA 3PFWO 1RJWA 4Q3AA 4Z0PA 3EGOA 2FP4A 4HP8A 3PYLA 4HXYA 1NQAO 4U7WA 4E5NA 2E48A 4PLTA 3T4EA 4AJLA 4EW6A 2PD6A 1X7DA 3QVXA 2GPTA 4BNJA 2EXXA 2PV7A 2UUOA 5KKCA 4WNCA 5A02A 3KTDA 5CPFA 3PYMA 1OFGA 5K0ZA 2IYPA 4MVJI 3L07A 4Z0TA 4DGSA 3U4CA 1TEHA 3EYWA 1NBOA 2VWHA 2O4UX 3KVOA 1O6ZA 4FOOA 4YR9A 4U5QA 4NH4A 3WBBA 4XGNA 1HL3A 2VUTA 4O0LA 4B4VA 5JY1A 1HLDA 2P9EA 1UP4A 4FFRA 4M87A 4J2HA 4E3ZA 3NRCA 3V2GA 4Y6SA 1YB4A 3H5NA 1Z45A 4RVSA 1GQ2A 4II3A 1VPDA 1P77A 3GEGA 1Q1NA 1VJ0A 5J23A 2C7VA 2GDZA 4I9UA 1I3LA 4MKXA 4MDHA 1QORA 1UAYA 1YL5A 2Y05A 4OOFA 4YJGA 3PJEA 5I7VA 2RIRA 3Q6IA 2C2XA 3WQQA 4BS9A 1ZK0A 4XGIA 2CY0A 1O0SA 3NV9A 1QG6A 3SEFA 3ZWOA 4QECA 4CV1A 1FMCA 1PJ4A 2PZLA 4IDCA 4E12A 4R3WA 4ZQGA 1N1EA 4U0KA 4CODB 4FB5A 4L0QA 1ISHA 1YL7A 1GD1O 2WYUA 4ONEA 1GPJA 4GVXA 3WIEA 2WE8A 3QE3A 5U4QA 4J1NA 4IZHA 2JHGA 2J3HA 4IDAA 2X9VA 3AOEA 4JIGA 4BNYA 1EEHA 4DQUA 4WGGA 2AEJA 3RFXA 1A7KA 2P2SA 1PGPA 3GGOA 4OOEA 2DFVA 3Q2KA 4QUKA 4WPGA 3HN2A 4Y67A 4E5YA 4KZPA 1KEUA 1EVJA 3AOGA 3IKVA 1UJMA 3VVBA 4UVEA 1OAAA 4RORA 3MJSA 1LSOA 3CKYA 3ZU5A 2DBZA 2X5KO 1ADCA 1NP3A 2Q1WA 3PZBA 1SB8A 3JCZA 1JAYA 5I9NA 4MOWA 2AMFA 2O3TA 3NTOA 3PWZA 1J0XO 3RUFA 4W6ZA 2YJZA 2C82A 3VZRA 1ZH8A 3E1KA 3JYNA 5FFFA 4QSMA 1E6EA 2WD7B 3ZH2A 3DHNA 1ZW1A 4ZQEA 2HCTA 2NU8A 2PKQO 1DIBA 3K31A 1YQGA 3AUSA 1LRJA 1DRVA 3PJDA 3H9JA 1YVEI 5DZSA 3BMNB 4Y9DA 1DPGA 2JAHA 2AW5A 2WYWA 3GGPA 3E9MA 4YJHA 6ADHA 5FYDA 2P5UA 2JD2A 4BKPA 3VPSA 1GV0A 4UUNA 3G0OA 3DBVO 3F4LA 5KVQA 4NDNE 3CEAA 3LF2A 5COBA 1J49A 3LC1O 3DHEA 3WIDA 3CMMA 1LDNA 1ZFNA 2FWMX 3LT4A 3IS3A 4OSPA 1UXGA 3VH3A 3JQBC 4CL8A 4GPD1 5AXCA 4B79A 5A9RA 1HETA 3WXBA 5BNIA 4U8GA 3HN7A 1I3MA 4MPDA 4IY1A 4EEZA 4XYLA 4J0FA 3OBBA 3MJ4A 4IGEA 1F8FA 1ONOA 1ZVMA 3VHRA 1BXGB 2HDHA 2SCUA 4R1NA 4P4NA 3G1TA 4KUEA 3E5MA 2XF8A 1Y8RB 5L40A 1ZZEA 4WCDA 2JAPA 2Q1SA 2E4AA 1LC3A 1PL7A 2DPHA 5CAEA 4NNJA 4XIYA 4UEKA 2D0IA 2VYNA 3LT1A 3VDRA 3WYCA 1LRKA 4UVGA 4OKNA 5ENVA 4D45A 1V3UA 3OHSX 4TWRA 2P91A 3KETA 3I23A 4XYGA 2A92A 1B7GO 1XR3A 5IZCC 3H2ZA 2J3JA 4WKGA 2OZPA 4URFA 1P1JA 2I3GA 4U0JA 3DOJA 2I66A 4WNIA 1BXKA 1Y5MA 3FTNA 1LSUA 4DIOA 1DSSG 4YRDA 4ITUA 2FZEA 1UUFA 1NFQA 5AVOA 4W7IA 1VL8A 3C8MA 3BIOA 4KWHA 4R9SA 1GCUA 3QWAA 1IB6A 4ZRNA 4RVGA 1BGVA 4QFDA 1P33A 3PQFA 2O50A 1NAHA 3EZLA 5A04A 3H8VA 2CNBA 2Y0DA 3MJVA 4MVJD 3HDQA 5I9LA 3DQPA 4UAGA 5F5NA 3QJ5A 4W9NC 4YPOA 5LDGA 3VPFA 2BI8A 2IZ1A 3RKRA 4DYVA 5JY6A 3F9IA 1ENOA 2EHDA 5HA5A 4BNWA 5ILGA 5JAZA 2GLXA 3E03A 3C7CB 3OA0A 2IXBA 4XQEA 3IP3A 5JW6A 3WJAA 5AOVA 4J7CA 2EKLA 4ZQFA 3ZNNA 2RCYA 3CINA 3MOIA 2GERA 1AXGA 3IOYA 3GVHA 4DMMA 3WLFA 1LJ8A 3E8XA 3NGXA 4S3MA 3MWEB 4BNKA 3CMCO 3O9ZA 1YQXA 1PJBA 2Q99A 4EDFA 3PLRA 1QYXA 5U1PA 1DEHA 3H5RA 1KEWA 1HDCA 3PQEA 2ZCVA 4N7RA 1P45A 2ZTMA 3PI7A 3GEDA 5BSGA 5T6BA 5KIAA 2VUSA 4E32A 1EVYA 3L6OO 4BIIA 1EDZA 3N58A 1U3TA 1M2WA 2WD7A 3UVEA 2NVWA 5MGBA 2JFFA 4XQ9A 2UVDA 2VHXA 3H7AA 4OM8A 3BMNA 4LSMA 4P4GA 4AVYA 2W98A 3R1IA 2Y1GA 3QY9A 1HSOA 5JXWA 4XYEA 3G17A 4RQUA 2JJYA 1NQOA 1QLJA 4RF2A 1N5DA 5BQFA 4KTTE 4NJMB 3K6JA 3C3XA 5FEUA 2Z5LA 4CQMB 3ZNOA 1I2ZA 4X54A 3VPGA 3M6IA 2HQ1A 2W4QA 2JL1A 5KKAA 5BNTA 4ID9A 3WFIA 4JCOA 3K96A 4YB8A 3WBFA 3GOHA 1U5CA 1R4MB 4UVIA 2C59A 4NK4A 1KVQA 1LEHA 3I9KA 1BXGA 3TZHA 3C1TA 4GQAA 1B0AA 4NG5A 4PG5A 4BMVA 4ZA2A 4F6CA 1HZJA 3KO8A 1PEDA 3I9LA 5COQA 1BW9B 1HDZA 1V9LA 1XEAA 1Y8RA 4GGOA 3D3EA 1HE4A 5L3ZA 1IULA 2EEZA 5JCXA 2D5AA 4WUVA 4CM4B 2Q4BA 3M2PA 1JWBB 3FTPA 1EUZA 4DUPA 1PGNA 1Z73A 3N7UA 4BNGA 1Q7CA 3DAFA 3KLPX 1XELA 2Y1CA 3GC6A 4FDAA 3EUWA 4ZRMA 5C37A 3TFQA 3NUGA 1MX3A 4R3NA 3IJPA 4D42A 1PJQA 4A73A 1DLJA 1DHTA 1XIVA 2JHFA 2ZK7A 3KRTA 3NX4A 5IG2A 3TF5A 2C54A 3RUCA 3PTZA 5CG2A 3FPCA 4YA6A 4I5GA 4K6CA 2VOEA 2X7HA 5C5IA 1LA2A 4QT0A 4R41A 5T8KA 1E1LA 2E49A 2NSDA 1GU7A 3BA1A 3S2GA 5IAAA 3TNLA 3EDMA 4GAEA 4OJNA 4IQGA 4M8SA 4BV8A 3H9GA 4ND5A 1V6AA 5AQ1A 2EG9A 2QYSA 2I99A 4FC7A 4IS2A 3I3OA 3K30A 4Z9XA 2FZWA 2POQX 3AFMA 3Q0EA 2B5WA 5DOZA 5ILOA 1B16A 3WG9A 2ZCUA 1DFGA 1EK6A 3R0IA 2NNLD 2RAFA 5IZCA 2Y66A 4O1MA 3GN2A 4KQXA 1ULSA 1FDSA 3RUAA 2DFDA 4D3FA 3TL2A 3ZW8A 4OH1A 4YXFA 1X7HA 4PRKA 4CM8B 1MXHA 5TLSA 4EEXA 3BAZA 3JQFC 5DT9A 1YOVB 1I24A 2X0NA 4RPLA 4JXKA 3E48A 1IE3A 1UDCA 2A9FA 1FDUA 4E0BA 1X15A 4BNTA 2B36A 1JN0A 4AJHA 1YS4A 1UXKA 4B8ZA 1YBMA 3O4RA 4PZEA 1NAIA 2OXIA 3FN4A 4DPMA 2FY8A 4QO7A 3PP8A 1K6XA 3A4VA 3V5NA 1SEVA 3HJAA 3C1AA 4K28A 1K3TA 1DIAA 3L9WA 1VL0A 4FBGA 4DXHA 3ONFA 2V6MA 4UEOA 3WTBA 2PH3A 2O23A 4W9NA 1U8FO 4IZIA 3O38A 3GHHA 4HUJA 5A9TA 2P5YA 1AUPA 1B3BA 3KBOA 1V0JA 8ADHA 4R51A 1HYGA 2BKAA 3U3XA 5KOIA 3K73O 3B1KA 2AQKA 2FN7A 1Z6ZA 4DPLA 1QLHA 4AJKA 4DLLA 4J1QA 3QHAA 5KCZA 4BO3A 1E77A 3FD8A 1YQDA 4NJMA 2NVUB 4CQMA 3GAZA 2X23A 4RDHA 4WEOA 4W4TA 4WLNA 1DJNA 3ZWCA 2H6EA 3TZKA 2PGLA 3GUCA 3U09A 4ND4A 2D8AA 2Y0CA 1MC5A 1R4MA 5JAIA 1NVMB 3PRJA 3E6AA 5G0TA 4D0RA 1Q2XA 4E2YA 3U5TA 4GX5A 3AU8A 1BW9A 2UDPA 5DBIA 1QRRA 2C2YA 2E82A 2D4AA 1ZUD1 2QW8A 4R5HA 5DCUA 1CRWG 4RCVA 5BSFA 2H63A 1U7TA 1GUZA 1I8TA 1PQUA 5KVCA 4ZVVA 4CM4A 3FNEA 4JX8A 1YRLA 1E7RA 3QRWA 4RVFA 1YBVA 1R0KA 3RJ5A 4E31A 3RAJA 2YQ5A 3LZ6A 3KUXA 3TN7A 1T2FA 5B4TA 1HE3A 4YQZA 1YH3A 4MVJH 4XWYA 4A0SA 3ZZNA 3E9NA 3LC2O 3I4CA 5L9AA 2ZJ0A 2ZKLA 4FD3A 1SB9A 1MLDA 3G49A 4FFOA 4FFLA 4DIBA 3PHIA 3AM5A 2VRBA 3OICA 4HV4A 2B0JA 4LRTB 3LK7A 1HSZA 2WTBA 1NNUA 1FDVA 3NJ8A 2Q1UA 3NDIA 1H2BA 2R6JA 3ONEA 1XSEA 3RUIA 2O4CA 2F1KA 4G5HA 4F6LA 1K2WA 1NR1A 1KVRA 3JYQA 1UZNA 1N7GA 1GAEO 4NFHA 1DLIA 3COSA 5IXYA 4OO3A 1GV1A 3PVZA 4JQCA 3WS7A 5KVSA 2VTEA 1LUAA 3JTMA 3DZHA 3C85A 3ROQA 3M1LA 4BQPA 4H3VA 1RWBA 2NU9A 4CM8A 1Z82A 1CQJA 2I3AA 1F0YA 3OJ0A 1B8VA 4R54A 1YOVA 4IJUA 1NQTA 3SC6A 2JCXA 3ETEA 5TIIA 2BHLA 3JD1A 4FJ0A 1YE3A 2QHXA 4NIMA 3OIGA 5DN9A 3VDQA 2CVOA 4E21A 1MXFA 3U0BA 5JAMA 4FS3A 1P31A 4CM5A 3I5MA 3ZN2A 4TZKA 4CMAA 2Z1NA 1NHGA 5A06A 3DOOA 2VHZA 4J3FA 3F5QA 4OSOA 5H82A 3UCXA 3HDHA 1KC1A 4ILKA 4JN6B 2B4RO 3AWDA 1K6JA 1U1IA 4NFYA 3PFFA 4BNNA 1DC5A 1DIGA 4PVCA 1NPDA 3UAGA 1ZK1A 2IEDA 4IIVA 2PNFA 1OC2A 3ORFA 4J1TA 2VHVA 3CXRA 4M1QA 1ISIA 1SMKA 4WASA 2HMUA 3WWZA 3JQFA 2FPGA 1WDMA 1SO8A 4UUPA 2NVUA 2Y68A 4QFCA 3S2IA 4BMSA 3X2FA 5IZ4A 1S7CA 3KSZO 5CFZA 5DBGA 1I33A 3JD3A 2HKIA 4OKIA 3PPIA 2OO5A 1R15A 1D3AA 1E1NA 2FPPA 2PZMA 2FSSA 1PGOA 3O03A 3ZCXA 2AEFA 3ABIA 4MP6A 4MVJF 3WWYA 2IEBA 4D46A 4AG3A 1C14A 2J5QA 4RZHA 3AW9A 3P2YA 4MVJA 4N5LA 1P9LA 1JLLA 5B12A 1R4NA 4GSKA 3ROKA 4TMFA 3WYBA 5A3JA 3JQ6A 1GYRA 1T4DA 3RSHA 1SCUA 3DBHB 4C4OA 4YT5A 5KNLA 4ALIA 1LDYA 5KJ6A 4RJTA 3H9UA 3DR3A 1EBUA 1QV7A 2OBYA 4RV9A 5F1OA 3WOHA 2OP0A 1OI7A 1UZMA 3IDSA 2X5OA 3KYDB 2Q4EA 4INAA 1H0KA 5FI5A 3DZFA 1N7HA 5F1PA 4GGPA 3HE3A 3QP9A 3RD5A 3GDFA 1LRLA 2D1YA 3KHUA 1YDEA 1ZJYA 4I9HA 4N18A 1Y7TA 2QYTA 2O3QA 3TZ6A 4ALLA 4E2ZA 4LSWA 4UREA 4TRMA 4DREA 1O94A 2ZB8A 2OOSA 2GUGA 3W6ZA 3PK0A 1K89A 4XR4A 1TA4A 2DT5A 1NX6A 3H9EO 2NACA 4R01A 5C7LO 3KYCB 4PLZA 1GADO 1HE5A 1U4SA 3KYBA 3PHHA 3OECA 1LSSA 5GZ3A 2VCYA 1WVGA 5JDIC 3U4IA 1YKFA 3WICA 1PZHA 1VI2A 2XXJA 2ZIZA 5BSHA 4AJPA 2FR8A 1FK8A 5JE8A 4BB6A 4YQYA 2C5EA 1DFHA 1Y81A 1K5HA 2WD8A 3IQDB 3OJFA 5A5EA 1E7QA 1NM5A 4JGBA 3RFVA 3OFSA 4R1TA 3UGKA 5A4DA 2CDCA 4XGKA 3RFTA 4CJXA 5ADHA 2I5PO 1NPYA 2J5KA 2H9IA 3CUKA 4WLOA 2FMUA 3MTGA 4YVFA 4HNHA 1U5AA 2GN8A 2OGUA 5AXBA 1WW8A 3FWNA 2V65A 1W8DA 3JYLA 4R4JA 1AGNA 3P5SA 4CQMD 3OF2A 1EDOA 4EI2A 1YJQA 2VUUA 3GDOA 5F1KA 4IPTA 4BO1A 1GCOA 5GMOA 3ASUA 4UEJA 4WLUA 4XZ3A 1DOHA 4XYMA 4JP2A 4UVHA 3QWHA 2G76A 4BNVA 3K92A 2X58A 1HRDA 1MP0A 3RUHA 1N92A 1XDWA 4YRBA 1ADGA 4FJ1A 5COAA 1TI7A 1R0LA 1QSGA 2EGHA 2PZJA 4O5OA 2BF7A 3I9NA 4M54A 2OBNA 3IJRA 2ZB3A 2VTDA 3JQ8B 4HWKA 3RQSA 1E1KA 3GNTA 3DB2A 3UHAA 4GH5A 4HFMA 3LYLA 1XCBA 1VM6A 2GNAA 4L4RA 3NYWA 3ST7A 4K9DA 2CFCA 3AY6A 2CVQA 1YL6A 3FHLA 3DFZA 2NWQA 1O95A 3HHPA 3B20A 5DCWA 2YQ4A 1PU2A 1ZSVA 2GD1O 3DZBA 4FIZA 1KS9A 4PLHA 5A9SA 4EUHA 3HUDA 2BLLA 3BTOA 3Q9UA 2XXBA 4IDDA 4QTZA 3WNVA 3ANMA 2YZ7A 1IZ9A 4J9VA 4XB1A 1AE1A 4HFJA 1IY8A 4IMRA 3U62A 3GVXA 1PWZA 1VJTA 1PZGA 1UDAA 3QVSA 4CLOB 4XYBA 4BOYA 3HG7A 1T1RA 3GR6A 3OJEA 1CETA 3DTTA 5BNFA 1RYEA 3EW7A 4E33A 3KYDA 4IXWA 1VL6A 5CDTA 4CLEA 2DTEA 5ENDA 2BFMA 3H3FA
chains in the Genus database with same CATH superfamily
1S2NA 2LIPA 2V7GA 4LBYA 4DWOA 1A8QA 1NW6A 1U7OA 5DEIA 3WSWA 3UJ7A 1MO6A 1JEEA 3FYHA 4LUCA 1HDOA 1XZBA 4G9BA 3GX1A 1C1DB 2J45A 2JNWA 4NCJA 4S1PA 5JWHA 4AKTA 2YJTD 1KZ6A 5L9AA 3LI2A 4P58A 3UYKA 2XVZA 3HM2A 3E3OA 3K9QO 4QGFA 4KBYA 2O1XA 2PVPA 3ET4A 2PR7A 1J8MF 2VZ8A 2G4VA 1N78A 3IEXA 4I8XA 1SU6A 3IX7A 1R88A 4Q9NA 2QTLA 1TYCA 3F3SA 4LTMA 2WVJA 3S40A 4NH0A 2OEPA 2IH2A 4R05A 4ZXFA 1A7AA 1XU7A 1RW4A 2GJ9A 4PQYA 5IH3A 4CIDA 2WYVA 2HDWA 3RIGA 1P8JA 2GO1A 1TUGA 4LJ6A 4EJ0A 4CKZA 3IP1A 2XOXA 4QICA 5C1PA 3OFVA 4JVNA 2Q8NA 2CDAA 4TKZA 1X9IA 4BB5A 1XRRA 2GK3A 3GH1A 4POOA 1F60A 5L3RA 1D2HA 3E0QA 4KXVA 1EFKA 2R8EA 1B26A 2FOIA 5B4UA 2OSBA 3OEHA 3TRJA 1N9GB 2ISCA 2ZYUX 2QN6A 3H13A 4RDCA 3UTDA 4RTNA 4OA8A 4OHKA 2QTVA 1NMYA 5GZ1A 5EHIA 1XDGA 1M6HA 5KSYA 5LDHA 5DBEX 1SN7A 3ZWYA 3LXRA 1YB1A 2IP2A 1IM8A 2OCIA 4JUAA 1V11A 5IJAA 4D3SA 1QK4A 5CXQA 2DFNA 4PCUA 4WIAA 4LYDA 4Q18A 4PX9A 1PNRA 4ZJUA 3PHLA 3Q7SA 2CMKA 4PCAA 3BFJA 2X77A 4O2AA 1WB6A 1X0XA 3L8GA 4LYYA 2IEIA 3HVHA 2C97A 2R1UA 1BZYA 1CF4A 4NBLA 4AMZA 4IVRA 3VNUA 4Q1DA 2NX2A 4MJ7A 3MPOA 4K2AA 2FCAA 2W90A 1V96A 3CPEA 4HD8A 5EZYA 4DLXA 3BMCB 4G8DA 4A15A 2FRDA 2QR3A 3K5PA 4AG5A 2J0SA 1HFWA 1X8KA 3GB9A 2WDPA 1NUPA 2BD0A 5J4LA 4UCWA 2F9LA 5H59A 2HJSA 2PKQP 4YCSA 1RJ9B 4BQOA 1XLUA 5AM3A 1JVSA 2J85A 1CHNA 1SUAA 4KUHA 3BJRA 4Q4LA 3N2NA 4AP6A 3IXLA 5CVEA 3A4IA 1LD3A 3COYA 3PEEA 3DKVA 1MUUA 5HEKA 2GQ0A 4A91A 1YHNA 3B60A 3WYAA 3FRJA 4AJNA 5FTJA 3HTXA 5KJ1A 2BTQA 1TE2A 3LCRA 4BMYA 4Y6QA 3V8RA 2W5UA 1Z5VA 3E3MA 2W2TA 4HN4B 4CKEA 1E1MA 4I9NA 5U4XA 1HDIA 3INTA 1DC8A 1YK0A 3G5UA 4F2GA 2C5FA 5TVKA 1PJ2A 3ABRB 2NUBA 4C6RA 4CETA 4FSDA 4C4TA 4G0PA 3UMMA 3EB9A 1E7SA 4DQDA 2RGNA 1GZUA 2ILTA 4Q3NA 1A82A 1LCIA 2NU6B 3DMTC 4UBIA 3R7SA 4AZVA 4B73A 4HB2A 5KU1A 1RMYA 3R7NA 3EC7A 1FVFA 2UZ1B 2JLYA 1EK2A 2VOJA 4TS4A 2C2MA 4C76A 1OUMA 2G17A 3OJWA 2E6UX 1XA4A 2Q21A 4JJ4A 4DLVA 2X86A 4FYKA 4ZQBA 4KWTA 3W9SA 2QRQA 4CLOA 1JWAB 2J0VA 4UEQA 5E4FA 5HFAA 4GBJA 3VC2A 4RSHA 5KJFA 3AI2A 2QR2A 3PNYA 3ZDAA 2EJTA 4PU0A 4WKOA 3GLIE 1P1FA 4WLFA 4JI7B 4IFEA 3GD7A 4JU9A 3VJKA 5GV7A 1QKKA 1VFPA 4Q9IA 4BLRA 2IOFA 3BMQA 1ZHOA 1RIFA 2MYNA 4BMDA 4DLTA 2Y1KA 4GBED 3TZEA 2XUIA 5T4HA 1JKJA 1K7CA 4L2IA 2FW7A 1JAIA 2OTCA 3HZRA 4OXKA 5F51A 2XUGA 3GVPA 5CITA 1Z18A 4RBNA 3AEKB 2QAJA 5CVJA 4M9QA 4CV3A 2VPTA 4IH9A 3WGGA 2EHJA 2PDAA 3EY9A 2BSQA 2ADOA 2ZJ6A 1LDMA 4EHNA 1QF7A 2ZB7A 1UT6A 3MJTA 2C5AA 1RPJA 5AM1A 2FV8A 1DPFA 3MTJA 2JGEA 4M46A 3KQNA 1OREA 2ZAOA 1RLOA 1RC0A 2ZIEA 2ZXUA 3MWYW 1I51A 5A6VA 1W76A 2XZOA 3H1FA 1TQ6A 1W0JA 2P9FA 1QTNA 3D6MA 2ZANA 2BF4A 3OX3A 4HLUC 4LXXA 3BGWA 1OYVA 4KH0A 1OWMA 1F17A 1JIUA 4IF4A 2LR0A 1EJ6A 2O3JA 2RHCA 3P19A 4QU8A 3VU9B 3W6UA 1FE8A 5IFKA 5JV5A 1D2MA 3KJHA 4DMFA 4IUYA 3HEMA 5AVXA 3R3SA 3B85A 5JDCA 1YONA 1QYRA 3D0RA 1LLCA 3EGDA 4TWZA 1THMA 5I9BA 3D6VA 3E7WA 3SBDA 2IEAA 3CC8A 3W4JA 4K03A 3DDZX 3SXJA 1GZVA 1JFSA 1Z4LA 2QZ9A 2H07A 3IKTA 4Q39A 3SKVA 5AOCA 3BCRA 3V7WA 5ENZA 3MCUA 2P69A 1CS0A 4Z7OB 1PP4A 1M0TA 1KWKA 3W5UA 1F6DA 5AW0A 4HPJB 1GA1A 2W6CX 1WBBA 1NKTA 3RJZA 3N8IA 2ZI9A 4CMEC 5JWRA 4B7CA 4PQEA 2O8VA 1FFAA 1E4EA 1EESA 4OL9A 1GHTA 3INGA 3JATA 4L8WB 2C1XA 3U3RA 1WUKS 3K9BA 4DABA 4MIOA 5KNCA 2GD0A 3VKVA 2J3IA 4HNAA 2GILA 4N5MA 2O8DB 3SVTA 2WM8A 2DUJA 2XT0A 4D96A 3G5LA 2Z8YA 5TQ0B 1WZUA 2GBLA 1N1DA 2VBGA 1KETA 3FCAA 1RADA 3P27A 4W7HA 4XQ0A 4RDIA 2LW7A 3ETDA 2DT8A 5CTAA 1OOEA 3CV3A 3CF6R 3ZVKA 3BTVA 3B6KA 1FSGA 3L0IB 3N5CA 1MQ9A 1BX0A 1QGDA 3N2EA 1U7PA 4RVHA 3DV0A 4TTVA 5DI9A 4I0WB 2YIVX 4FGKA 3ZY3A 1KI4A 4BFSA 1AF7A 1RYHA 3CY6A 2BL4A 1AHIA 2ATIA 4HEHA 2PZKA 1I30A 1J70A 1N0VC 1V7ZA 2OCPA 2PVSA 4FT2A 1W5BA 2A30A 4ZOCA 3L6BA 3UGTA 5B1YA 2PX2A 1U8EA 2J9XB 2OUKA 3AFIA 3I6ZA 4NVRA 5H83A 3R75A 1ZK2A 2IV2X 2QUBA 1PR9A 2CYAA 3AUJB 3GLQA 2IELA 3CNHA 3MMZA 2SKCA 2WF5A 3RC3A 3HDYA 3UGJA 1CTQA 2G80A 3HPQA 1VECA 1EJBA 4JJFA 4JI1B 2R8PA 1JECA 1Z25A 1UL1X 1FS6A 4QKQA 3LQFA 3PB3A 3KCNA 2WUDA 4HB0A 3DAYA 5ER6A 5H3LA 1ZCJA 1ARZA 2G09A 1Y34E 3A06A 1Y6GA 5I7RA 3EVAA 3CUSA 3OE1A 3F5SA 4PCVA 3UJ6A 4N01A 1MKYA 2QTBA 4OQEA 3I2GA 2XEXA 4IUBS 4CF7A 1XN1A 4FE3A 3E0XA 1G63A 3RYIB 2HA4A 1CJMA 3GRKA 3GRAA 1GNQA 4BV3A 4ND3A 1GG5A 3IBGA 3PR1A 2C7PA 3GPIA 1N2CB 4NTZA 5C3UA 4IAOA 2UUBB 1FF9A 3B1ZA 1YO6A 2A9OA 1M73E 4HADA 4PLCA 1L5SA 3J7AC 4JT2A 3WAGA 1RI3A 3W5HA 3ADCA 1KFEB 3F6EX 3O2JA 3L5OA 4EEKA 3L77A 4EP1A 3G0HA 3EWIA 3DB1A 2QE7A 3IAM1 4CKWB 1P2UA 4R8VA 3EVZA 4IWYA 3T7KA 2RH5A 3UMRA 1N6NA 3WQSB 4F38A 3KQLA 4BO4A 1L4EA 3EFHA 1X13A 3ODGA 4KOAA 2HV8A 2O57A 3BRWD 4PZ9A 4IZOA 4WK2B 3URKA 2C5SA 4DRYA 3R6TA 4YAEA 3QU9A 2RHWA 2NNWB 1Z5NA 2GB4A 3MTIA 4L6AA 3PBKA 4NAUA 1C5KA 1T3ZA 2GCIA 3ICPA 2BFAA 3GPDG 1UPXA 3ECSA 5KAMA 3GPCA 1CXZA 3IXQA 1CVLA 1W93A 4Q21A 4AB1A 5CFLA 3B9QA 3TOCA 3D6TB 4KRYA 3W2HA 5C2JB 1UJ6A 1NW5A 3JQEA 3PZRA 4MI6A 2IS6A 1TCCA 1JHUA 3N8NA 2Q2QA 1FX1A 3MCTA 4LXYA 4ZIRA 1PZNA 4EMBA 3T5DA 5JMTA 4FVTA 1V25A 3J81A 1OI2A 5H4HA 2JIPA 3O8OB 5T4EA 3TGWA 5DV9A 3B9RA 4BE4A 1Q17A 2QQEA 2Y77A 3GRPA 4RK0A 2XA9A 1T9GS 2O59A 3DH0A 5L7TA 1BQEA 1GNVA 1RI1A 5BUZA 1P73A 3ACDA 1Y9DA 4QODA 1NF3A 4M4SA 5CXUA 1DQYA 1DAPA 1ORHA 3FUVA 3GT0A 4MWOA 2X13A 2XTZA 5IJZA 2XSZD 4TYMA 3RG2A 1WS6A 1GKIA 4JFRA 4E5KA 2FNAA 3Q72A 3D9QX 3I8XA 1U7XA 2P8JA 4AW9A 2WJVA 4HDNB 1LQUA 5AXAA 4Y6OA 4I5DA 1NUSA 3HNOA 3IVAA 2ZRMA 2RGGA 3HM9A 4FNOA 5AM0A 2FXVA 3PDCA 2IYUA 3F47A 5T3YA 3V48A 3TB4A 3PLAE 2FUG6 3M5CA 1FMLA 2WY2D 1E3MA 5AI8A 2BEWB 1GAWA 1CJBA 4JI0B 4UUOA 2L19A 4P5PA 4ER7A 2XJ4A 3ZI0A 3BHIA 5F98A 4Z54A 4XPIB 4DLAA 5B55A 4ZREA 3EZYA 2H7XA 2R00A 3HABA 2NXEA 2OESA 2QG9A 3F4BA 4OBBA 1RRKA 5KTMA 2F4NA 5A0VA 3TQTA 1NR5A 2EP8A 1EINA 2R47A 5H0IA 3TVTA 3N5KA 3KM0A 4PY2A 4PBSA 4GMXA 3NHKA 1QCCA 3PDWA 3SYLA 4B1FA 4N0DA 3OHMA 2GBPA 3ACCA 3DCJA 4WZBA 5THXA 4F3NA 1PQPA 1DQRA 3RS7A 1NXPA 3W8DA 4YRCA 1BEUB 1L5FA 1YBHA 2ZAYA 3FHCB 3ZDYB 5F2KA 4E2XA 3R5KA 5KTKA 2OSVA 4L9SA 2IXTA 5EESA 3G8BA 3KSUA 4E5DA 1E3IA 2PRYA 2GF2A 2YWRA 1IBSA 1RBMA 2YC2C 2I03A 4GVLA 4NYIQ 2FUEA 3T1VA 3IBCA 3GNSA 3RS0A 4P84A 4LYEA 1U1DA 1XKTA 4HYQA 3AF0A 1T9GR 5HMMA 3VYRB 5C52B 1NNEA 5M7EA 4A0RA 3L84A 2JI6A 4M0KA 5FNVF 1W9MA 1S8FA 3B3QA 1SEPA 5LOVF 3NDBB 2G9RA 2CDBA 4EHFA 4BJHB 4J0EA 1YAJA 3P2KA 3PCXA 3B13B 3DBLB 3GVIA 3WRYA 3EGXB 1G21B 1VPTA 2BFFB 4J0KA 4J4BA 4A4DA 1KI6B 1WU8A 3EXHC 4FC6A 3UUWA 4F8EA 1FJXA 4GZ6A 3WGOA 4EZEA 3PNBA 3TTSA 4KK3A 4LXUA 3EG9A 3BREA 1KIAA 3AIIA 4NP6A 4Y3UA 1CR2A 1GFWA 3U81A 1C30B 4DV3B 1NE7A 4HBGA 4J7XA 3BXOA 1X80B 1W0JD 2GNPA 4B3XA 3E1GA 5K05A 1GQSA 4OAQA 2Q5OA 2BOVA 3BD8A 3F98A 4ARZB 4EGCB 2ZROA 1UT5A 3KVRA 1PF7E 3W9YA 9ABPA 5H02A 3THYA 2J8ZA 4IMIB 1DC7A 4GYYA 4MCHA 3RHFA 1CZKA 3RWBA 5J5AA 4QPJC 3TQHA 1UPCA 5JS6A 4GR4A 4QSHA 2FXIA 4N12A 2XMDA 1F12A 1UQUA 3GRVA 5LLTA 1KPGA 1VHTA 2J46A 1Z5OA 3IUEA 3JW8A 5F52A 1UODA 4EF5A 1TDJA 1E4VA 4MRPA 5IBCA 5KSZA 4DRXB 5ICMA 3Q3IA 2OKCA 1QIKA 2V5AA 2WB4A 1PZEA 1JA1A 1N4AA 1Y4AE 1WL8A 4QQ8A 2QL7A 2DGDA 1Y4ZA 1YR6A 1M6WA 4K88A 4JENA 4QVIA 3NEJA 1PS8A 4LF4B 1C3OB 2F1RA 4HNVA 1FFXA 1HE2A 3EXHB 1GPDG 1VLHA 2QTGA 2YRXA 3P0RA 4LJ5A 4DCJA 3I8OA 4BQFA 5FWNA 4C0BA 4IVPA 3R7LA 1U5BA 3NHSA 4JBYA 3CNQS 2YZNA 1NTOA 4KQ9A 2R5WA 2A67A 5KNCD 2V5VA 1YB5A 1A8IA 4B17A 2AUMA 2GR9A 2ZRJA 1JG3A 4MRNA 1KR2A 3SN6A 1AKEA 1W8IA 3LCJA 3SX0A 2O5EA 4DQLA 3EPRA 1C0LA 4PIVA 3GLUA 4MGKR 4CQLB 4UMFA 1WP4A 1X1AA 5IAKA 3KXDA 2A33A 1UJNA 4BL5A 3BWXA 4JVOA 3OMLA 4LW8A 4ID3A 3W8FA 3WGYA 4AO7A 1JHZA 4ZCRA 2EEPA 5J43A 4RACA 3T5GA 3EF1A 1OTYA 3FUWA 2XUHA 3JQ7A 3ZU2A 4KDRA 5L4NA 5C1OA 4IKOA 2B1IA 1W88A 3CWZA 4U8HA 1IK4A 3I3SR 3GLVA 4JCCA 1OIXA 4ND1A 4H0CA 4RMIA 3M5WA 5FPPA 3U49A 4ATNA 1L1RA 2AF4C 1DKUA 2A0XA 1BWRA 1YDFA 1VCNA 3ZHCA 3Q2OA 3A1NA 1A4UA 1D07A 1IHXA 4OB6A 2H2GA 4XSGA 1YZ3A 3ZLBA 3Q8MA 3PXBA 3QSYA 2B4YA 3CKKA 3FPHA 3GFFA 1THTA 2E4UA 3AGQA 3ZE8A 2RFLA 4UBJA 1LBEA 3VVCA 1JV2B 4WV3A 3ZVRA 1JE1A 2PKRA 3ZU6A 5A6SA 1YBAA 3L1KA 1KZGB 3OKPA 5AK4A 1Z8NA 2HBZA 2IOQA 3I28A 2PX3A 1ISRA 4MUMA 4KKVA 4QJ4A 3LL7A 3C87A 4RH0A 3MS2A 1F2TB 1QR2A 1R6TA 2GCPA 3DE5X 3NTLA 3ZGOA 1H1LB 5FD8A 4H6WA 4GXNA 3CTPA 1Y3AA 4G84A 2H1VA 4KFSA 2V7UA 2F3QA 4Z5XA 1RZRD 2AOUA 5TDHA 4XX0A 1E5TA 1H2EA 2ZTLA 4P33A 1RFLA 5ES3A 1VB3A 2HUPA 1H1TA 5FPSA 4HAZA 3VU3A 1XLTA 1M8KA 1TUEA 3K32A 2JJ2A 3H11A 5FJIA 4TMVA 3CVOA 4KR7A 4DBVO 2H7VA 3AVUA 3A6PC 1K97A 2AFIA 2HPAA 3NC1C 1XNQB 2R6AA 5CD1A 4J7AA 4PXSA 1P3Y1 2P6RA 2JLAA 3FDFA 1IM2A 3NBQA 2VHYA 1WHSA 3TSAA 1S3IA 5BW4A 3HS3A 1H5QA 3C7TA 1M8PA 4QXQA 1TLFA 2JZOA 5J5CA 3HJCA 5KKNB 2LRHA 4O63O 3V80A 1O97D 1CEQA 2QI9F 4AN4A 4BYMA 2C92A 4DTCA 4PNHA 1V3QE 2TS1A 1NUTA 4Y2YA 4ZXPA 2EDCA 2W6PA 2BBOA 2C1ZA 5GVRA 3TXAA 4DBZA 4KQ2A 2BW0A 1RLUA 1DEXA 1P72A 3CE6A 3DO6A 5C8YF 2JARA 1H94A 2DLDA 3HC7A 2H2HA 1HR0B 2MYUA 1B6SA 4NOJA 3CN9A 3A3NA 3BQ9A 1XK7A 2C2ZA 4TSFA 1G3MA 1DOZA 1I9CA 3TNJA 2FG5A 1X9HA 3MMSA 3B6JA 3AONB 3RRZA 5A4FS 2DXIA 2BFDB 4H18A 4WKCA 1Y3BE 3CW2A 3OPYI 4EHIA 4C06A 2WA2A 1FSFA 1PJSA 1UIRA 4XIFA 5LQAA 3MCAA 3SZ3A 5A0FA 1XTPA 1ZCBA 1KZYC 2WWFA 3CX4A 4Q3CA 4MQEA 3ZDQA 3K8ZA 2ZULA 4GMDA 2PZ8A 4TWIA 3OETA 4D7AA 2GZ1A 1ZOLA 4WDRA 4Y2SA 3STTA 3U9SA 5JI2E 5K3CA 1E2PA 4U6SA 3GJYA 4ZJPA 4M38A 2XMRA 1SCNE 2QZZA 3GJ3A 3LDUA 3ZLUA 1CUYA 2R60A 3GFSA 3L0PA 3RTBA 1PEAA 4XGQA 3ZHBA 1JVBA 4RV4A 1HTTA 3WWPA 5IT4A 3N59A 3DC2A 3WMGA 4W6QA 3NPAA 4PSCA 4X61A 4D41A 4REQB 1Z75A 4AZ0B 4C5AA 4FOSA 3KQKA 1PQYA 4IHQA 4RYLA 4X97A 3SCZA 3UHOA 1ND5A 1U81A 3MS4A 3OP1A 3E7XA 1JR6A 1T9BA 4FDMA 3MWLA 2JC3A 3WB2A 4MW5A 2BP7A 3DBHA 3IEUA 3CH7A 4DLPA 3K6SA 4XWAA 2FN3A 3DZKA 1P9NA 4ALMA 1NV9A 5REQB 1OA0A 1VMIA 2OHGA 4MUFA 5CXSA 4ZT7A 5TY0A 4ZJYA 1MA0A 1N3IA 3MOSA 5E7MA 1FB5A 3HNRA 1DC3A 1BXZA 1QHFA 1SKAA 3E58A 4GMFA 5EWJA 3LLVA 3BG5A 5EP2A 5I45A 2VDQB 2X5JO 1N6HA 2XGMA 4UTRA 2CLLB 4ZO7A 2EF0A 3B51X 1E2MA 2VUIB 4IRUB 5FLEX 3Q40A 5AW5A 3F0TA 3TD6A 4TMKA 2P9CA 3K2BA 4RSGA 3WL3A 4ZYXA 3SQOA 4WOJA 5F7JA 1SUDA 1PTKA 1EM6A 1P2TA 4ARUA 1FTSA 3DHYA 4H31A 3O4VA 5ALPA 2PIDA 3C8ZA 4HQRA 2CZQA 2VS1A 4HSGA 3QOFA 4G4IA 1YTLA 2OXFA 1ZSYA 2H2AA 3SSMA 3VR3A 3WB1A 4YCLA 1H4TA 2NZJA 5DRTA 1E0JA 2AWOA 3QX7A 5SY9A 4BTEA 5CEEA 9LDBA 3AF1A 3R5HA 2I7CA 4IDHA 2H4ZA 2E5LB 1PJCA 1T4BA 1UBRS 2OP1A 3FWHA 3H65A 3PC3A 4JOBA 3ES9A 2PEYA 1ZD1A 1PL8A 4C43A 4EOGA 2BFCA 2J5BA 2N1MA 1QQ5A 4M9XA 4Q82A 1V5GA 5CBPB 3PE3A 3B1FA 2WBLC 3P71T 1UAAA 1GAJA 1LWNA 1XUOA 2H2FA 1NKSA 4RZUA 1L4GA 3ZH9B 1HYEA 2Z6AA 1VYTA 5JCJD 3BDAA 4NPCA 3O3NB 1Y5NA 1MO3A 4X8LA 4QTTB 1TK9A 1CJTC 1OKKD 5IYZF 2R3SA 4DJTA 1DBRA 1AU9A 2GEUA 3KWMA 4WERA 2LKCA 2O07A 1MORA 2H29A 3WKAA 5DNWA 4WXEA 2JEZA 5CFRA 5ERGB 4F46A 4GQBA 4EA7A 4OQXA 1W2HA 1DRKA 1MOQA 2DWUA 1W19A 3JAWB 3MJDA 5NULA 3OSUA 5JSKA 2DC1A 4NK5A 5AD1A 3NASA 3FWYA 3C3WA 3BQMB 1VQ1A 3AY0A 5I3CA 1EFPB 2BMJA 2I3DA 3JQ9C 5B7NA 2UYCA 4ZHSA 1KI3A 2ZRKA 4D4HA 4H7DA 2JJ1D 3P52A 4J2OA 1ORVA 2BI4A 1XPRA 1TGYA 5JSQA 4FKMA 4F9GA 1MB0A 4MQFB 1PIWA 4R9UC 2WDZA 4FR2A 2JI4A 5C1DA 2GF0A 2NUPA 1JAZA 1RVV1 2HY7A 3N76A 4BN0A 5JYCA 1QKIA 1Y7PA 1P0MA 3IPAA 3OTWA 3EA4A 4ZVOA 4R8MA 4HAVA 1D2GA 1IWBB 1I7PA 2Q50A 1DMSA 1NX9A 3RYFA 3RS2A 3ZHUA 4EX7A 3AVWA 4MDEA 1YI0A 3T15A 4RZQA 2IGBA 1HG0A 3FMGA 4ZMSA 3WI7A 1NURA 2IEZA 2NO7A 3I52A 3JRNA 3N87A 4TV9A 2P75A 2UUPA 4KDEA 4R2JA 3EJWA 1P9WA 3SU8A 3ZHTA 3C6QA 4BPRA 5IULC 1NMQA 1WKBA 2H4FA 3D3KA 3ICOA 3I0ZA 2YBEA 3W4KA 3DE4X 1XKQA 2IIQA 4Z3DA 1SHLA 3GJTA 4FW9A 1E7MA 3IUPA 3GDGA 1WULS 1N9KA 2NZXA 3L7MA 4XVUA 1LH0A 1SURA 2R6ZA 2R1ZA 5L3QA 2F55A 3G9QA 1SCBA 4ZVMA 3UJBA 1IOVA 2NQ2C 4M0UA 2XA1A 5EKDA 1EQ2A 1J23A 1WNTA 1M54A 3U4HA 4YMTA 2A5GA 1O1YA 2HFJA 4OHCA 4YWHA 3WHPA 1NV8A 4HNRA 4NMHA 3COWA 1NVUQ 3ET5A 5T4FA 2RH4A 3MRXA 1JZTA 2MJLA 3WGIA 2J67A 4COKA 1SJ9A 2QY6A 4Q37A 4M7WA 5F73A 2ZYIA 1QIGA 1RWVA 3K2QA 1Y48E 3L6EA 3OQJA 1O97C 4TKVA 4PGMA 5FWXB 1U9CA 1CUWA 4XVCA 1IHPA 2V6FA 1D8AA 3HCEA 2XE6A 3Q9NA 1DJQA 4C0AC 1HUQA 2W2LA 2WTAA 2WT8A 4CEHA 2LP4Y 3LOUA 3M6LA 4DZRA 3LH5A 3ZTWA 1OD6A 2I6XA 2YFKA 2Q1TA 3O73A 3FB1A 2VH1A 4AQDA 2B5VA 2IKSA 1DU4A 2JAXA 2JLCA 3C41J 4YQEA 5CVVA 1PVVA 3ZY2A 5JZOA 3DVLA 4ZANA 1BDHA 1YXMA 1P0QA 2YFHA 5A5FA 2N46A 1SG9A 5C31A 1ECJA 1JKFA 1UBLS 2C29D 5KVVA 4GX1A 1RQRA 2FUKA 1KJIA 1P17A 3RU9A 3P0HA 3Q85A 3UK6A 1QH1A 2P9GA 4F8YA 3SDZA 3A2LA 2ZUUA 4CKXA 4MPRA 1FOEB 3PEFA 3U4MA 4EWLA 3L9XA 4KLRA 1P62B 1PK9A 2BV3A 2J41A 3MZ0A 4EECA 2D3WA 4DA9A 4O08A 1QPZA 1N5LA 1QH0A 2ACKA 3M2TA 1CYDA 1XQ6A 3MUFA 5T57A 2QZPA 2YX1A 3CR8A 4COOA 5KYGA 4JY7A 1V1RB 2XF2A 1AB6A 2H4YA 2Y4OA 4MRRA 1BAPA 4TM7A 3ZNPA 3PQDA 1QGAA 3FGPA 2P35A 2X7XA 3RSFA 2QP4A 3HDVA 1RWKA 2JLBA 4NZZA 4WA8A 5C8XA 5K8VA 1VSUA 3KNZA 3E2PA 3HFGA 2JGDA 1LPSA 3RE1A 4FZ3A 3RVOA 3ESCA 2JLUA 2C7OA 3D2BA 4UDYX 1C9JA 1G8JA 2TSYB 1V2HE 5HBGA 2YN0A 2DU8A 1GG9A 3IC5A 2O8NA 2JAWA 4G0NA 5I5GA 2NMVA 2C83A 2Z58A 1WMDA 4JSRA 2QORA 5HQJA 3DFKA 2WLSA 3OCYA 1U65A 3IL2A 3BTSA 3A58B 3RIYA 4IXMA 1YRWA 1Z13A 4DSOA 4DAOA 4XM1A 3X43A 2B92A 5CW2A 2PQ2A 2UVPB 3FPKA 1DCMA 4L3VA 1W4BA 1ZGHA 1Y8QB 4RD6A 2WF9A 1II8A 4R1QA 3AP3A 3URMA 3DEFA 4ZN6A 1MGOA 3CCBA 4LJKA 4KPEC 2EGUA 3AIOA 1U3UA 2YOHA 1E4OA 3KT0A 5IHPA 1R0SA 4FI3F 1TLLA 2WJJA 3BL5A 4ZT4A 2I22A 1MENA 2IPOA 4P4LA 2XE8A 4O2BB 1W4ZA 2J6HA 1ECCA 2ZSHA 4Q7QA 4HGOA 4TUYB 3S55A 1YCHA 3CBGA 1ZX1A 4TKUB 5B2EA 4NEGA 1XOIA 3U48A 5CA0B 5CDYA 5G2OA 1YFZA 4NYJQ 3HWX1 4RY0A 1Z34A 1ISSA 1Z0SA 2D5CA 3HKEA 2YYYA 3L4BA 3ND8A 3UWDA 4DQVA 2P4QA 5GOZA 3EMVA 2WWRA 3TR0A 2HWKA 2QVZX 5IJ0A 3GCZA 1VCIA 3K4HA 4I1YA 4J0QA 3GMDA 4GKJB 2W11A 4YJ2B 4PZUA 4PNPA 4Q34A 4ZVLA 3OCJA 4Q9DA 3OQ6A 5BYKA 4N9WA 3A1VA 3P7MA 1KJYA 4Q4HB 2QN2A 1BYIA 2QVGA 2D5BA 2FPUA 2E37A 4JNKA 4XJXA 4AX4A 4YIKA 5TSDA 5L7WA 1GTMA 3BWMA 3I2IA 4M1WA 2GHRA 1QRSA 1I1HA 2FWIA 4IINA 1XD9A 2Q9UA 2ZYSA 5DDIP 5JALA 4JXXA 3OLCX 2VLBA 4AS3A 1Z88A 1IY1A 3GGGA 1PT9A 3IAEA 1I80A 3CZ4A 3CS3A 2J5XA 1SNYA 4G4SP 4J43A 1RAEA 2Y1XA 3E5HA 3UB3A 3KKNA 2QJWA 4X8MA 2FPWA 3WGLA 3N7TA 5HIJA 1D2RA 2IU4A 3S81A 2VQ3A 2JA2A 1FCJA 1P1KA 1DXQA 4C4RA 1A5ZA 1SXPA 5KX5A 1W6RA 1XVIA 3KV1A 2VYVA 3MAAC 4DR2B 3OUTA 1ZOOA 4BUCA 1GNTA 4X64B 3BHJA 1Y3FE 2FMFA 5AKZA 2AG1A 4Z4CA 1E58A 3IUSA 4LGMA 5CJ2A 4B6SA 1Y5IA 2P1RA 4G1UC 3D64A 1ZY2A 2BGMA 5L4SA 4EQ6B 4G25A 4YRFA 4TVOA 5BT9A 2VT7A 5KWEA 4FPXA 1L0BA 3B78A 5EQJB 4IQ0A 5E3HA 1TECE 5IW8A 4ICIA 1T26A 3HGMA 3AR3A 1JJAA 4DUGA 2NTYC 3IP9A 2EL9A 4NMWA 4R2KA 3D8TA 1BIFA 3PYXA 5H81A 5ICFA 2WSSA 1W2WB 2GYUA 2OO5C 2JBAA 3NRJA 4OXIA 4C22A 2BEUB 2VJCA 3KZOA 3UKOA 2ATEA 4EG4A 1RXEA 2VXBA 2YWEA 3SIRA 1V7PC 1FDWA 4RADA 1M7BA 3HCNA 1UKYA 3PWTA 1SC3A 1P6XA 3V8EA 1SBYA 1W35A 4KXYA 5AK3A 2FA9A 5K6AA 1QCDA 4QU0A 4UDXX 3BE4A 4A2WA 4C6TB 3DMTA 1Z7WA 1YAHA 5FP0A 1ZEJA 2KBEA 4MHSA 3M1AA 4BE9A 4PC6A 4KBFA 2J3LA 3W77A 3AVPA 4JP1A 2XB2A 2V0GA 3ZNQA 1W30A 4X6LA 3DO5A 4BNIA 4FCWA 2J9RA 2DTDA 1NYTA 2QJRA 2NYUA 2EBFX 2QTRA 3CUVA 1WXGA 3F3YA 3KDPA 2EG5A 3PGJA 3U3KA 3FOEC 5I4KA 2AHRA 3K16A 4RD3A 2BHNA 2ECOA 4XB2A 3JQDA 4PVDA 2OZLB 1WOMA 2M1XA 3DDNA 1LU9A 2GLTA 5IJ9B 2FCRA 3GFVA 5L7YA 2F1JA 1UPFA 1KEKA 1GUFA 1ECGA 4M86A 1KZ9A 4M8KA 4HDMB 1WM1A 2H4XA 1NVGA 4R7ZA 2W58A 2Z1MA 1OSNA 1I6LA 2XLBA 4EUKA 3VHXB 1HQKA 4D1YA 1EFHA 5JEDA 1PJRA 3ORSA 1FTGA 3HXLA 1P7ZA 4QRDA 3UXEA 2GA8A 3VAYA 3ZE1B 1PX0A 1YV9A 4ZK6A 1R4NB 1W0KA 1GR0A 3TSWA 3NR2A 3H6GA 2JCBA 4QIHA 1MG5A 2J7KA 2KYRA 2QPTA 3E9YA 3K0CC 4OGFA 5L4LA 2DQ4A 4ARCA 2F9MA 3B48A 4CU2A 5D84A 1PGJA 4J4HA 2X0DA 2GN9A 3WK4A 3SFZA 4F1KA 1D6SA 1UXIA 1CRZA 4LJ9A 2Y1EA 3RBAA 4AUKA 5C53B 1BHSA 4HLUA 4AN0A 5CLLA 5LXTB 1P3DA 4X6UA 2E4XA 3PICA 3PRYA 1WCWA 2H57A 3KDSE 3PDUA 3GZNA 5JSFA 2XIQA 2OBFA 4XM0A 4Q48A 3SE7A 3UK2A 1GNRA 1SVOA 3A8TA 3AM4A 5E95A 4H7JA 4E5SA 3WMFA 3G1WA 2IP4A 5IEBA 5JRDS 3WLRA 4D8YA 2Y1WA 2X6TA 4QRIA 3WXMA 1PJ3A 3O1JC 3T4PA 1HKUA 3X1WA 4FMDF 1KYZA 4LHYA 4TQGA 4TROA 4XTCS 1XRPA 2WJ6A 2X2PA 3D4NA 3IDFA 5FBKA 1K98A 2MU1A 2R9VA 3ESRA 4CMEA 4CIWA 1ZBDA 4IO1A 3ZX4A 1Y8ZA 1ML3A 2AJBA 3QLVC 4NHEA 2P8SA 4BLOA 3P9QA 4CVNA 4URYR 4EHDA 1ODTC 3FVVA 2F64A 3JWHA 1XROA 2K87A 4IJKA 4OQYA 1R5BA 2FK7A 5FHRA 3IBFA 3T95A 4F3TA 1QONA 1ZJ4A 2AI2A 4XWKA 1RAIA 1BC5A 4US1R 4PYKA 2GK6A 3EULA 2BSXA 5CX4A 3VAAA 1EDDA 4OP3A 1KEVA 3PJRA 1IN6A 2PVCA 1JR3E 3EVNA 3AOEC 5MN5A 1AQIA 1M9NA 1E5VA 2REBA 4LWOA 1IVSA 1I4LD 1ZL0A 4AMYA 4A8HA 4B6RA 4JC8A 4QG3A 3T4XA 2JLWA 4KUGA 3TBKA 3DUWA 3UWMA 1E5XA 1PFVA 2AJDA 5F1YA 4ZU6X 1TU0A 4GMGA 1EE2A 4YUWA 2X2OA 3AY7A 2CUKA 2F9FA 4FGZA 4O59O 5D3MB 5IN5A 4KFCA 4DR5B 4FEAA 2IYEA 5IASA 2A9JA 1MH1A 4R69A 1KQOA 1U3DA 2I4RA 4MV4A 2R0QC 4HWGA 4H15A 4Y6RA 1C9EA 2DQKA 1HFJA 3D4OA 2HNBA 2PRSA 3SXUB 4BLSA 4DM3A 1M6YA 3RIXA 3VJRA 3DFMA 4XI9A 4EELA 1XZKA 1TU4A 4JKYA 2FRXA 2G7ZA 3HVUA 3FMOB 3GVCA 1M2EA 4ZD6A 4UAVA 3UW3A 4DOMA 2ONZA 1TCUA 1V4VA 3FVTA 4BKQA 3EBPA 4AWBA 3PU6A 2ZE6A 5LU8A 2GYVA 3P4YA 3G2NA 1EVLA 4P5DA 3WFZA 1E9VA 2ECPA 4Q9AA 5FBVB 5A5VA 3A3OA 5K0EA 1XWIA 2PUJA 5E8RA 3GA5A 5B37A 4A92A 3WP0A 1SGWA 3YASA 3DUFA 2AG0A 4QDJA 2CXRA 8GPBA 1ZN8A 2V6GA 5A62A 1XFAA 1S96A 2C9BA 3GRZA 4I66A 3VR0A 1Z6QA 2W6QA 3NBMA 2P78A 1UBTS 1AF4A 1UWCA 1ATIA 2ATVA 3HP4A 3NTUA 3NALA 4B43A 3KJFA 3EUFA 3IIMA 2AYYA 2G82A 3EIWA 4N7BA 3RV4A 4ZMRA 2FF5A 1WA5A 3FDIA 3H1AA 1LXCA 3LO8A 4V0OA 2QL9A 1ZU4A 3NNDA 4YCDA 1KSFX 3TINA 3F6RA 4EJSC 1RAGA 2PWPA 1SULA 3U4GA 5ESXA 1OX4A 3KB2A 5JMPA 1MAAA 2BT4A 4RPHA 5A9SB 4RWZA 3I30X 2QVLA 4AJOA 1XQWA 3T12A 1JW9B 5JS8A 2G1UA 4HDNA 4M1EA 2JFUA 3JQCA 5FL7D 5DI3A 5ALIA 3RV3A 1YHZA 1ESMA 3NHRA 4JLUA 1QHXA 2SHKA 5ER9A 3OCWA 5IDVA 4JYBA 3TD9A 3VO1A 4AUEA 2BSAA 3L6RA 3LW8A 1NOJA 2IXGA 3UXHA 3HMKA 1CUBA 1UANA 2AC2A 4XUDA 3L1HA 5AVZA 2MCFA 3PWKA 4UE3S 3GK3A 1GU0A 4RAOA 1H2XA 2X41A 2C3MA 3ISJA 3PVSA 2CZCA 1ULHA 2EF1A 4QYXA 4RFLA 3DBIA 2VFAA 1FIUA 1C7FA 1YS2X 1U1EA 4U7PB 3OMXA 4NICA 4XWOA 2B35A 4L50A 1UFKA 4B87A 3IB6A 5FLXA 1WWKA 4NHOA 3SIXA 3Q5GA 4BRZA 1UMDA 2IPAB 4MULA 5L51A 4K1LA 4MI9A 5FUYA 5HW0A 3PFWO 1G8YA 1SXHA 5AW2A 5JS1A 4TV8A 4EJSB 3EGOA 1CZLA 4M8LA 3ZV7A 1X70A 1KPIA 1NQAO 1S3GA 4J76A 4DS3A 1VI5A 2F62A 3KL2A 4LHWA 4F7WA 1QJ4A 3A6GA 1TQHA 3LUAA 1JQLB 1USKA 2A9QA 3DULA 3HA3A 2PD6A 2QMUA 4EW6A 2EAUA 4DJEC 4GUAA 3L1UA 3G02A 2R8OA 5FA8A 4HB3A 1JLSA 2IYZA 1JYFA 2WAXA 2IYPA 3ABSB 3FOZA 2JZCA 1BXRA 1YR3A 3L07A 1TEHA 3HMQA 1ZM2A 1MX5A 3NXKA 5BRNA 2IHBA 2VWHA 3AUFA 3GGCA 3LQYA 2O8BA 2WSSD 2PJDA 1JEDA 1AG9A 1O6ZA 3CR7A 3F9RA 4X1YB 1U0LA 1ZN2A 4DR1B 2VQDA 4FOOA 3PFIA 3LK6A 1F20A 1EWKA 4F5WA 3GLGE 2IZ6A 3WBBA 2PANA 4M0EA 2DLCX 3GAAA 5JY1A 3WGUA 1HLDA 3THWB 4PPNA 1YFLA 1RYZA 3LNCA 3T6KA 3ZX5A 4M87A 4FFRA 4I6EA 3FNIA 2ZCJA 4RD1A 2VDJA 1FVXA 2D0OB 1Z2DA 3E81A 2WVGA 3UM9A 3V2GA 4Y6SA 1YB4A 5CT5A 4E3ZA 1EX6A 1E9CA 1RHQA 4GICA 4Z2AA 4II3A 3GZJA 2AH5A 2AK2A 3GEGA 4YHBA 2AL7A 4YMUA 3IUYA 4YY3B 1U2EA 4R7GA 5SICE 1O9GA 1V8DA 2BFNA 1Q1NA 1VJ0A 1Z29A 2BFBA 2C4HA 2GDZA 2ZI4A 4Y1RA 4B8YA 1L8OA 1I3LA 2GJKA 1QORA 2ASVA 3I64A 1YIDA 2Z30A 2H5EA 4X63A 5LL6P 1JEYA 3TAUA 3ITEA 2CLKB 2RIRA 1NJ1A 3Q6IA 2C2XA 5DN6A 1V5EA 2R97A 3WQQA 5I7HA 5IRCD 3IFSA 4XGIA 2CY0A 1JFTA 4TT3A 1QG6A 1TYAE 1CUGA 1P7WA 2PZBA 3BE6A 3GJ4A 5DYYA 3W90A 1QIEA 2Z5FA 2I7TA 4GF5A 3TW6A 3NIFB 3M4JA 1U0NA 4CV1A 2WLTA 2W6NA 3OOWA 4RMNA 4E12A 3SWWA 5GJWC 1KJ8A 4OTZA 1DG9A 2AFVA 3A1EA 1E0AA 1CY1A 1GPJA 3CRW1 3IV6A 3QE3A 1AQJA 4DDVA 1W0KD 3KIPA 4HAUA 2WNIA 1Y4DE 2JHGA 3U6KA 3JZFA 1G9XA 2J3HA 4JIGA 3EXHA