4NR0A

Crystal structure of the pseudomonas aeruginosa enoyl-acyl carrier protein reductase (fabi) in complex with nad+ and triclosan
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
259
structure length
259
Chain Sequence
GFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPELCFPCDVADDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRNVTIEEVGNAGAFLCSDLASGISGEILYVDGGFNTTAMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Pseudomonas aeruginosa Enoyl-ACP Reductase (FabI) in the Presence and Absence of NAD+ and Triclosan
doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
total genus 90
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nr0A00
3GNTA 1B0AA 3VZQA 2X9NA 3VH4A 1XDWA 1PSDA 4R1NA 2PGDA 4G81A 4PVCA 3PWZA 1JLLA 3ST7A 4DPLA 1E3SA 3GZ4A 3FTNA 1NAHA 1LSSA 3INTA 5DCYA 1N1GA 1ZK0A 5T57A 1E7WA 2BFAA 3Q9UA 5I7EA 4CMIA 3EAGA 2ZQYA 4CPDA 2BI7A 1PZGA 3DFUA 1GFSA 2BGLA 2EWMA 3EC7A 3B1FA 3RUFA 1F17A 3BMCB 4RVDA 2JCXA 1P1KA 4YJGB 1TVEA 1NQ5A 3JQ6A 3X2FA 2Q1SA 2IDZA 1HKUA 3Q11A 4M49A 1A4IA 3RUAA 1QYXA 4BNJA 4URFA 3SLGA 4FC7A 5BT9A 3ROMA 4JX8A 3VC7A 4BL5A 4RJTA 2YW9A 4OSPA 1P1RA 3SJ7A 5JDCA 3DBRA 1B2LA 1C14A 3L77A 3WGHA 1U1IA 3FN4A 1UXKA 2O3QA 5MGBA 5I7FA 2CDBA 5TX7A 1BHSA 1IPEA 2HMWA 1BDMA 2AHRA 1SB9A 4RO0A 4CMEC 5B4VA 4FC6A 1A27A 4KWIA 3F5SA 1NYTA 1T24A 4DA9A 4XJSA 1YBAA 4JNKA 1H5QA 1HWYA 1H6AA 2G82A 2HO5A 4O59O 1TT7A 1TXGA 1LSOA 4FOOA 2P2SA 4LISA 4UVIA 4B4OA 4AVYA 3FPCA 2HAEA 1S7CA 4JBHA 3WOHA 2BFOA 4LSWA 3WJ7A 4IMRA 3LVFO 3TFQA 4J1TA 2O3SA 4TRJA 4YVFA 3WGYA 5IF3A 3PXXA 1U3WA 4P4GA 3HADA 5FF9A 3H9JA 2QW8A 4A27A 1DJNA 1A7AA 5BQFA 4Z6KA 1I2BA 5AXBA 2GPTA 1QLHA 1RM3A 4C7KA 1HYGA 2JAPA 2VYND 3FWNA 1SOWA 2NTVA 3OFSA 1PWZA 3PYLA 4JIGA 4EJMA 1QSGA 2O7QA 5JMWA 4RV9A 3DZIA 1BSVA 1YGYA 3PQEA 3DAPA 3V1TC 3JQ8B 4TRMA 4GMFA 5COBA 5THQA 3NAQA 4AJPA 1X14A 1MC4A 4LCJA 4EEZA 1JKIA 2O7SA 3C1AA 2RH4A 1B8VA 3P2YA 4XX0A 2E82A 3GVHA 3C1TA 3AI1A 1K6XA 1ZVMA 3FR7A 5IZCC 1E0DA 1ZMTA 2RHRA 1P1HA 1CQJA 2GGSA 3PQFA 5DBFA 1SZJG 1C0IA 1SO8A 3NEPX 2F00A 1ZZEA 4HADA 4ZHSA 1XA0A 3VVBA 4TKLA 1PJCA 5JYDA 4TMFA 1IZ0A 3AK4A 1MP0A 4J16A 3IS3A 2IEBA 4YRAA 5TRTA 3AU9A 1NVTA 4RCVA 3ONEA 4GX1A 3NDRA 5A5FA 1KETA 1U7HA 2ZB7A 2AQKA 4HXYA 1E6EA 4YRDA 1E3WA 2QRJA 2AMFA 3GR6A 5KCZA 2J3HA 4KUGA 3LU1A 1HLPA 3PYMA 4YBZA 1NQAO 1RYEA 3HG7A 1PQUA 1FMCA 1QORA 2HKIA 4IXTA 2B4RO 4BNGA 5EQDA 3GMSA 5F21A 3NDJA 5JCJA 5GZ1A 4BO6A 3AUUA 1Z6ZA 2EJVA 2GYYA 1NWCA 2DBQA 4PLPA 3A4VA 1DB3A 3I9MA 2GO1A 4L75A 1DRWA 2B35A 4HKTA 2YV1A 4YQZA 2DTXA 4CQLB 4DYDA 1Y8RB 5BSHA 4UEKA 4MVJF 4XA8A 4BUCA 4RVHA 3OJEA 4IM7A 1XSEA 3D5TA 4RPGA 3A1NA 4Q3DA 1I2ZA 4Y9DA 1V3UA 3E1KA 4FFMA 4E5PA 2FY8A 1HDOA 4W6ZA 4CM4A 4R5HA 4D3DA 2D2IA 1NX6A 3TZ6A 2ZYDA 2D5AA 3U4IA 4K9DA 1YE3A 4EUFA 2Q45A 2VYNA 3ZWXA 4J9VA 5A06A 3V8BA 3ANMA 2C5AA 4DIOA 5L4LA 4A26A 5U1PA 4IZIA 3DZJA 3OM9A 3ORFA 4MKXA 1AE1A 2DKNA 2V7PA 1PTJA 5B4UA 3TZCA 4DIBA 1MXHA 2W2KB 4UUOA 1VJ0A 2HMTA 2ZJ0A 2I5PO 1U3UA 1B15A 3JQGB 3SBOA 3WFIA 3ADOA 3H4VA 3WYBA 1XGKA 4B7UA 4F46A 1EVYA 3VPXA 2FPGA 2VQ3A 5IAAA 1ZEJA 3ZHBA 1OAAA 3F47A 4J0EA 1YJ8A 1VSUA 4RF4A 3U9LA 1IE3A 1KBZA 5T6BA 1GTMA 1EBUA 1G0OA 1ID1A 4OSOA 4ALKA 2O4UX 2QRKA 3F46A 3KSZO 3MOGA 2Y1EA 3D3WB 3ANNA 1H9BA 5G0UA 3A06A 1F12A 3JQBC 3GN1A 1BXGA 3DWFA 4DGSA 1HZJA 1Y5RA 4QTZA 3HDJA 3U09A 1LNQA 2AE1A 4J1SA 4R16A 1DO8A 1XIVA 1Q7BA 3QWFA 4N7RA 1JVBA 3ZWBA 3JQ9C 4Y6RA 5AOVA 4G65A 5TJ9A 2WD8A 4BMSA 1I33A 2VHWA 4RVSA 1PWXA 4XIJA 3TPCA 3JQ8A 4DIFA 4LMRA 3WMXA 3JQ9A 3P5SA 4CMKA 1DBVO 1Z73A 1ZSYA 1GUYA 3AM3A 4FOSA 4GX2A 3VZSA 2X0RA 3DFZA 3GPIA 3GZNA 3HE3A 3AW9A 1FXSA 3M1LA 1SBYA 1UXJA 2CF5A 4CM5A 3GNSA 3EZLA 5CDUA 4JP2A 1GL3A 3LC7O 1J49A 5ER6A 3EY4A 2EF1A 3EYWA 3PK0A 3G0OA 2BKAA 4Z3KA 4E13A 3DHYA 3DTYA 1T2CA 3EHEA 3ETGA 3I6IA 4PLHA 3DO5A 4DC1A 3KXDA 3C7CB 5EJ2A 1TT5B 4AJHA 2ZB3A 3QW2A 3NT2A 1VLLA 4R3NA 2WM3A 1YB1A 1GR0A 1VJ1A 1DHRA 2FP4A 4O0LA 2P91A 1I3MA 3K2EA 4EUHA 3EDMA 3O9ZA 3H6KA 4OOFA 1LXCA 1QYCA 1DFHA 2C82A 2X9GA 4GPD1 4HBGA 3OQ1A 2ZYGA 3H9EO 1OZAA 1ULUA 3PWKA 1X15A 4LGVA 4U6SA 2VT3A 2HK9A 2YQ4A 3HN2A 3UICA 1A7KA 2WYUA 4IGFA 4WJZA 1IPFA 2GLXA 1N92A 4NZ9A 1U2DA 4JK3A 2NU6A 4U7WA 3KHUA 2EIHA 4IZHA 4FFLA 3JYOA 1FK8A 3UAGA 3ZWYA 3AOGA 5AVOA 3E9QA 4AJIA 1NASA 1ZKMA 3TZHA 4YTEA 4F6LA 3PHLA 2YHIB 1UAGA 3PI7A 4XEHA 4J90A 4CQLA 1W0CA 2VCYA 4IUYA 4Q3AA 4E12A 3BMQA 4DBZA 2PR2A 3NGXA 1PGOA 2Q3EA 5L4NA 5DF1A 1ISGA 3W8FA 3GFGA 3W8EA 3TNLA 2E48A 3WIDA 4MVJG 3AFNA 2DTEA 3EK2A 4A2CA 3ZHZA 4E30A 2PH5A 3HDQA 1I3KA 4OAQA 4DPKA 4HNHA 3ASVA 1U4SA 3PP8A 1Y8RA 3R6DA 2HJRA 3L6DA 4S3MA 3AOEA 3CTMA 2VNSA 1ADCA 1EK6A 1NPDA 3F1KA 3AY3A 1ISIA 4PG8A 2H9IA 1KC1A 2V65A 1DEHA 3AOEC 5DCWA 5IN5A 1TA4A 2OXIA 2DPGA 3F4LA 4JLWA 1AGNA 5G0TA 4XGKA 1NPTO 3NYWA 2BRUA 3COSA 3GF4A 3KO8A 3B1KA 3K6JA 2Y99A 4Z9XA 3CKYA 4ITUA 4CM8B 2VRBA 3GOHA 3HFSA 4HUJA 4NBVA 3ZH2A 2NU8A 1F14A 2B0JA 1HLDA 2JD1A 4M8SA 2FZEA 1K5HA 4FSHA 1JAXA 2X5OA 1HE5A 1HXHA 3DDNA 3KOUA 4W4TA 5DOVA 3FNFA 3K92A 5CEJA 1DRVA 4CLXA 1XU7A 4DL9A 3ENNA 3TN7A 4CLEA 1PS9A 4ILKA 3KYCA 2EXXA 2O3RA 5JFOA 4R3WA 3ICCA 4RZIA 5CG2A 4FJ2A 1NFQA 3OMLA 5A1TA 4N5MA 2YQ5A 3LT4A 2EERA 2W98A 1I01A 4NFYA 4JN6B 4XR9A 4YQYA 2XXBA 5CDTA 2YYYA 4LRTB 4W9NC 3TJRA 3I4FA 5IDXA 2PGJA 4ALIA 5BSFA 3NT4A 3W6UA 1ORRA 3VTZA 3D3EA 3ROPA 4E2YA 3IUSA 1PR3A 1GEGA 2PKQO 4BV8A 4XD2A 2EHDA 1F0YA 3HUDA 1ML3A 1Y1PA 3CUKA 3EVNA 1PJQA 2XPCA 2HQ1A 3GDFA 4BIIA 1B16A 4RZHA 5TIIA 1WAMA 1K6IA 2WYVA 4FJ0A 2VYVD 3TL2A 2PZKA 4FD3A 1W6UA 4BS9A 5EPOA 4CM3A 4K28A 3BHIA 3KB6A 1X7HA 4DBVO 2I76A 1HDCA 3ZNQA 2A94A 2X23A 2ZQZA 1M67A 3D0OA 3FBGA 5DOZA 2J5QA 1X0XA 4D41A 3U4CA 4QFCA 1G1AA 4WGGA 5G0WA 5C7LO 3A9WA 4Z9FA 4YJHA 2FPIA 4XQGA 3DZGA 3RI3A 4J3FA 4PLFA 1K2WA 3F9IA 2BFMA 4HFJA 4A03A 2GZ2A 4BNLA 1IY8A 2FWMX 1T1SA 2C5EA 1K3TA 2X5JO 2JD2A 2NQTA 3UVEA 4ZICA 3U5TA 4XYEA 1YQXA 1HDGO 4AFNA 4BVAA 1FDUA 5ILGA 1PGPA 1IOLA 3PGJA 3QLJA 1H94A 1OC4A 3I3OA 3GHYA 4WPGA 3A28A 3DBHB 1EUDA 3I52A 4AL4A 5KIAA 2J3JA 1L7DA 5GZ3A 1Y7TA 4K6FA 2F1KA 2HSDA 2PK3A 4BMVA 1WVGA 5TT0A 1SC6A 2O50A 5KWEA 1HT0A 2TMDA 3HWRA 1J6UA 4UUMA 4PCVA 2EKQA 2AG8A 1MC5A 1PX0A 3B6ZA 4EJ6A 2EG9A 2XF8A 5L7WA 2HRBA 3FRJA 3L07A 4OKNA 1D1SA 4CMHA 3HQ4O 4UREA 1E7MA 1LI4A 3LYLA 2NU7A 1AHIA 3ZI0A 4B4VA 4DTIA 4Y6SA 4ZU3A 1KVUA 2BH9A 3LF2A 1FJHA 2ZTLA 3I5MA 1Y81A 1EK5A 3GLQA 2UYYA 3INGA 2D8AA 1XEAA 3KYBA 5TF4A 4BO2A 5A05A 2D3TA 1JWBB 4EDFA 1J0XO 1IZ9A 2X1HA 1P44A 3GY0A 4Q3EA 1ZEMA 3K5PA 1I8TA 4H7PA 4MIYA 3WWZA 5F3RA 1P0CA 2D4AA 1PIWA 5BSGA 3KETA 2DLDA 3RUCA 4JJIA 4FJ1A 2CMDA 2I66A 4J49A 2QZZA 1C1XA 2CVOA 2ZCUA 4K6CA 4MO2A 5FFFA 5KJEA 3VPHA 4ALJA 1A71A 2FRDA 4B8WA 2O48X 1LLUA 3BTOA 3WQQA 4B7XA 5DBIA 2V6FA 2YJZA 3DEYX 3OEWA 4PLGA 4BGVA 2YFQA 2I3GA 4MVJA 4XDYA 1E92A 1P31A 4M55A 2OBYA 2POQX 3H2ZA 4KUHA 6ADHA 5LDGA 5ITVA 2J3KA 2O2SA 3PQDA 4DC0A 3TSCA 4JBGA 1A4UA 2B36A 4WEOA 3AWDA 5COQA 2W2LD 3OA0A 4XWYA 1E5LA 3RC1A 2UUOA 1ZXLA 1Y9EA 2AW5A 4A73A 2NSDA 1ENYA 2UUPA 2A35A 4M86A 4R1UA 4ZN6A 2NVUA 3WGQA 1PGQA 2WSBA 3DQPA 2FOIA 3VH1A 3DMTC 3EUWA 1GU7A 1Q1NA 4YJHB 5DCUA 1EVJA 2CDCA 4W82A 1O95A 4GH5A 2BGMA 4CV1A 3QIVA 3NRCA 1H0KA 3RBVA 4IJWA 4YAJA 4L9RA 3WJAA 2ET6A 3RUDA 4CM6A 3DL2A 2EEZA 4R68A 1GD1O 3CINA 2GN9A 3H65A 3ULKA 2EP7A 3JTMA 4QUKA 5C3MA 3OSUA 5TGDA 3QA9A 5IFLA 5K0ZA 1ONOA 4MP6A 2VUUA 4BGUA 3RIHA 2NWQA 5KOIA 1P1FA 2RCYA 3E5MA 3GUCA 3GRPA 3JYNA 3DBVO 4R54A 5A3VA 3VKVA 4CUJA 1NFFA 2BGKA 4F3YA 4E6PA 4J1QA 5B12A 5DULA 3ZDFA 1P1JA 3Q6IA 4QSMA 2OFPA 5I8ZA 3UCXA 3PFFA 5BNFA 2D5CA 5C7IO 1NQTA 4MVJM 2OUIA 2Y0CA 2CNBA 1BRMA 4GKVA 1KEWA 4O5OA 5JDCC 3LZ6A 5HTOA 1JKFA 4E31A 2JHFA 4U6QA 1Y8QA 3G49A 1C1DA 3OF2A 3FPLA 3GG9A 4ZQBA 1H2BA 1VKOA 4EZBA 5JY1A 1LRKA 4LSMA 3BMNA 2C7VA 5G4KA 3ZU4A 4CLRB 3W1VA 3ROQA 1EE9A 2G0TA 2JAHA 1NQOA 2CY0A 3DHEA 4PZDA 5IN4A 2HMVA 4NHEA 4ZGWA 5I8WA 4LRSB 4UVDA 2HK7A 4ZJUA 3WB9A 3AU8A 1BMDA 2AQ8A 3JCZA 1LJ8A 2HUNA 1M6HA 2PTGA 4CV0A 2PD4A 5KKAA 4BNVA 3X2EA 1Q0HA 1UR5A 2CD9A 1HDRA 1HL3A 5JC8A 1I30A 1DAOA 4DREA 4GAEA 2EW8A 1LDMA 3C1OA 5JCXA 1YH3A 1P77A 2I65A 2X8LA 4O1MA 3V1YA 1WZEA 4L4RA 2GN8A 4WLUA 3TWOA 4BKUA 2ZB4A 1GYRA 3TRIA 1N9GB 3ZV5A 4D43A 3DZHA 4JJFA 3JSAA 4J4BA 2P4HX 1V9LA 2O4CA 4QXMA 2CVZA 3VZPA 4XYLA 5T67A 1ZBQA 1EVIA 1HETA 4F6CA 4R1TA 1HE4A 3VPSA 5KJ1A 3V2GA 3V1UA 3WYEA 3GUYA 3U62A 1E3JA 1RYDA 4CUKA 3KV3O 1VM6A 2AE2A 2RAFA 5L7YA 1QLJA 1YB5A 1H6BA 2FSSA 3HSKA 3JQ7A 3QVTA 4IS2A 4MVJI 4CR7A 3WGZA 4ZA2A 5JCJD 3CSDA 5KJFA 4D7AA 4KWHA 2NV6A 2BI8A 3DC2A 2D0IA 3BMOA 5TNXA 1GUZA 2GD1O 2Q4EA 2H5LA 3QVOA 5JAMA 1GCUA 4HV4A 4G2NA 4MDHA 4DMMA 2PH3A 4PLZA 3WGOA 2GUGA 4D0RA 3ROKA 4R5MA 3M6IA 1IB6A 3H9QA 5IZ4A 1YQDA 3INRA 1E6WA 2VZ9A 3G1UA 3JD3A 2QIOA 3GVCA 2HMUA 4A0SA 3UKOA 2DTDA 1NPYA 2PV7A 3QVSA 5J23A 1X1EA 2A9FA 3WTCA 4AJOA 4AJEA 2W8ZA 3L6OO 1R4NA 3JD4A 7MDHA 2VZ8A 4H15A 4P22A 1UP7A 1A9ZA 3ZWMA 2J8ZA 1LA2A 2YHUA 3SLKA 1R12A 2I6TA 3IC5A 3LQFA 4CQMD 4PG4A 2C2YA 3LLSA 5ICMA 5L7TA 3STHA 3Q1LA 3SC6A 3PVZA 4ZVVA 4LVCA 5KJCA 1XQ6A 3T7EA 3UCEA 1WW8A 2XAAA 3RASA 3WLEA 5JAZA 3AUSA 3OQBA 2IE0A 1P0FA 3S8MA 1XCBA 1J4AA 3GGGA 4OL9A 3SEFA 4AG3A 1R66A 4BNKA 2H63A 4MOWA 4NK4A 3GEGA 3KEQA 1VL6A 3NX4A 1LLDA 5EINA 3WBFA 3DB2A 4PIVA 1ISJA 2BD0A 4W99A 5CPFA 3WBBA 1CETA 3ZV6A 3JQFC 1WWKA 2WTBA 4NNJA 3KYCB 2WYWA 4EGFA 1ISHA 1DRUA 3EVTA 3JD1A 3U4HA 1VPDA 5HA5A 3AFMA 1B8UA 1SEVA 3GT0A 1DIRA 3KLMX 4BNMA 1DFGA 2EW2A 1JVSA 2PA3A 3PEFA 1CWUA 2QYSA 3MWEB 1HE3A 3KLPX 2OORA 1KVQA 1Z75A 3Q3CA 1BDBA 1HE2A 3LLVA 4B79A 2VOJA 1K6JA 4JCOA 2P68A 5G4KB 3GMDA 4RDIA 1T2FA 3ZWCA 4C4OA 3E8XA 5FI5A 4LVUA 2XXJA 2GF2A 2ZTVA 4YCAA 1R4MB 5U4QA 4YAKA 1YVEI 5KVCA 1YO6A 2GN4A 1GPJA 2Y1OA 3TDKA 3TOXA 4NH4A 3IL2A 2YZ7A 4BNIA 3B20A 4YYZA 3JQEA 3JYPA 3SXPA 4PLTA 4I9UA 9LDTA 1WNTA 5I9LA 1OFGA 4RF5A 5ENDA 1Y5MA 3RQSA 2OO5A 3IDSA 2LDXA 3VPFA 2A4KA 2BF7A 2FMUA 3GN2A 2PLAA 3G17A 3IMFA 5CEFA 2B4QA 2E49A 4J4HA 2JCVA 1YQGA 1UUFA 4Z0TA 3ZZNA 4AJLA 2Y1CA 1GYQA 3JQGA 3ZGYA 1YJQA 2O23A 3D7LA 5IG2A 4XCVA 1YL5A 1GY8A 3L4BA 1NBOA 1PL7A 1PU2A 4MIOA 1O94A 4J9UE 1DOHA 1ZCJA 2BFPA 4WLOA 1W8DA 1U9JA 3LC2O 2OGUA 3ZWOA 2R00C 4PZCA 1F8FA 2W90A 3WR5A 4PG6A 3PHIA 3D4PA 1DHTA 2A92A 4R4JA 4Y67A 4II2A 1QXSA 5TT1A 3GH3A 1HSZA 1O6ZA 1RKXA 2HDHA 1XR3A 2OP0A 4ND5A 2LDBA 1GYPA 2WMDA 4F45A 4J7XA 4KDEA 3GVIA 4RORA 3K9QO 2X7HA 4OJNA 3NT5A 4EITA 4GMGA 3QE3A 2FN7A 2Y0EA 5KVQA 4I08A 4IIUA 2VTEA 1P74A 1FDVA 4AJ4A 5JLAA 4B3JA 2VWPA 1C1XB 5BR7A 4I5EA 3I83A 3M2PA 1J5PA 4X54A 3W4IA 3G1TA 5EQFA 1E7YA 4E5KA 2VHYA 3H3JA 4HY3A 3PJFA 4Y98A 1E1NA 2WE7A 5T8KC 3HDHA 2Y68A 1ZJYA 1C0KA 1HDXA 3UGKA 5B1YA 5JO9A 5CDSA 4EYEA 3QQPA 1BVRA 1U3VA 4NJMB 4UVGA 3P19A 3OH8A 1JAYA 4GKBA 4ND2A 3ZHXA 3JQAA 3W6ZA 3ZW8A 1I2CA 1Q7GA 2GR9A 4IJKA 5CFZA 1V3TA 3BYZA 3RAJA 3PTZA 3DOCA 1N9GA 2PFGA 5JXWA 1OI7A 2FR0A 4XDZA 4NFHA 1EFLA 1H2HA 3KYDA 1HYHA 2DUUA 2Q50A 2V6GA 4N54A 3ZNOA 3SX2A 3GPDG 3R3JA 3LT0A 4FN4A 2VNAA 3UHAA 3WGGA 3WTBA 2VZ0A 1FF9A 3WICA 2IZ0A 2V6MA 4E5YA 2DBZA 4NDNE 5HS6A 2Z95A 2X5KO 4OH1A 2VHZA 3DAGA 4Y8VA 3KSDO 4PGFA 5AQ1A 4EUEA 1YS4A 3MTJA 4XQ9A 4XRGA 3DXFA 1HTBA 4ALMA 3DBLB 4DLLA 3R0IA 3LSYA 2DFVA 4BV9A 3CXRA 4FGSA 2P4QA 4WKGA 3ZWVA 4YAIA 1MA0A 4QX6A 2YY7A 3K8ZA 5IXYA 3UCFA 3IJRA 3LT1A 4GWGA 4PLYA 4WLFA 3M2TA 3IKTA 5EN4A 1O8CA 3PHGA 5JNLA 3BMNB 4U8GA 4JGBA 2WDZA 4BNTA 2JKVA 1CERA 3IIEA 4RPHA 5JDIA 1XKQA 1O0SA 4BKRA 1X1TA 4O63O 1QMGA 4WLEA 4TQGA 3QHAA 4E3ZA 2CUKA 3HNPA 1OBFO 2QQ5A 4ZQGA 4KP7A 3OQ6A 1YB4A 1GADO 4CMEA 3ON5A 5KVSA 4EI2A 2RBEA 2HRZA 4IQ0A 4UEJA 1YL6A 1KY5A 3O8QA 3S2FA 1MB4A 3GAFA 3K2BA 3PGXA 3PIDA 4GI2A 1YOVA 3E82A 4IDAA 5AYVA 4HFMA 5TSDA 4CMAA 4ND3A 4UUPA 4BNFA 4A10A 4ALNA 3RSHA 4MINA 3D5QA 2AQHA 5T5QA 1X0VA 3DTTA 3S2EA 5MDHA 3UF0A 4CMJA 3DMTA 4BQPA 1H93A 2HMSA 4IMPA 4E32A 1DSSG 3C7DB 3BIOA 4YJFB 2FPPA 3JQBA 2I9PA 2AEJA 3IUPA 1Q0QA 3MJ4A 3D64A 1PJ2A 1E3EA 2IRWA 1PR9A 4ZQEA 3QJ5A 3ITDA 3UN1A 2TMGA 2X0IA 1D1TA 3UH1A 1PJSA 1LDEA 2NUAA 1UZLA 5JC1A 4FQ8A 4E2XA 5HRUA 3FTPA 4YT4A 2RIRA 3UFXA 2ZIZA 3FCOA 3OICA 4NQZA 4ZRMA 5CDYA 1ENZA 4OKIA 5A03A 3E6AA 1E1KA 1U8FO 2NVUB 4OMUA 4JBIA 2C20A 4FGWA 4YJGA 2VUTA 4TSKA 1PGNA 1MFZA 1NM5A 1NHWA 2I67A 3PYXA 4Q3BA 4WASA 1GV1A 4JP3A 4D79A 4TVBA 1ISFA 2W2LA 1QYWA 5IZCA 4UEOA 1NNUA 4RPJA 1PGJA 2C54A 2QHXA 4AJKA 4NBUA 5KVVA 5EERA 3WYCA 4KQWA 4XJTA 1VRWA 5COAA 3WX0A 5C5IA 3G3EA 3JQDA 5HS4A 1A72A 5DDIP 1BWSA 2E4AA 4KQXA 1BXZA 2GZ1A 4IDDA 4XB1A 3BAZA 2D59A 5TC4A 1NVMB 4NFSA 3NGLA 3W4JA 3SC4A 1QKIA 3QRWA 1VL0A 2Q1UA 2RH8A 2P5UA 4IDEA 3C3XA 1PZFA 2P5YA 4HX5A 1E1LA 1Y9AA 5AXCA 4WCFB 4RLHA 4XYBA 1M76A 1SCUA 4DRYA 1W73A 3H9GA 3QWBA 5CG1A 2X6TA 4CJXA 1ONPA 3BMOB 1LDYA 2D1YA 3NDIA 2X4GA 1NR7A 1JW9B 4I5GA 4CM1A 4OQZA 3FNGA 1U5CA 5ES3A 3T7CA 1QRRA 3I23A 4U5QA 1JU9A 3JQ7B 1EDOA 1T2AA 3RU9A 3DZKA 4YWJA 1PJLA 3F6YA 1I5RA 3RJ9A 2Z5LA 2PGLA 5JS6A 5JSFA 1KC3A 1UAYA 2Q2WA 1WDLA 2YUTA 5DZSA 2AG5A 4BO0A 3RBXA 4Q3NA 3DBLA 1N1EA 1T25A 4YT8A 5L9AA 3GVXA 5T64A 4B4WA 1C3VA 4QO7A 1T26A 3CMMA 3RFXA 3RUEA 1DIBA 1X7GA 2JD0A 3GC6A 3C8MA 3QWHA 1WDKA 4IDGA 4IJVA 5IJZA 4M1QA 3ABIA 1IULA 1WZIA 4NIMA 1GDHA 2DBRA 5HBRA 8LDHA 5L40A 4CMBA 3SVTA 5I9MA 2YV2A 1ZK1A 1N5DA 3C7AA 3NV9A 1NHGA 1YWGO 1GZ4A 1OC2A 3KBOA 2VTDA 5CDGA 1UZNA 1YBVA 3ONFA 3A14A 2EKLA 4PLWA 5B37A 4B3HA 5A5EA 1PJBA 3F5QA 4DUPA 4WEQA 4CQMA 3RROA 1MG0A 1R4MA 3MCVA 1VKNA 1WP4A 1BTOA 4IS3A 2YHIA 1O89A 1TEHA 4HNGA 2JJYA 4QEDA 1NR1A 3WDSA 2X58A 4J43A 2DU8A 3MJCA 1IYZA 4R9SA 4RL6A 4UAGA 1BVUA 5JAQA 1ZW1A 4CV3A 3AI2A 1CYDA 3F3SA 4RPKA 3BTUA 5JY6A 2E37A 2AEMA 2R6JA 3FNHA 1E7SA 1V3VA 3ADPA 1Z7EA 3KEOA 3D4OA 1U2GA 3KTDA 4I5FA 1DIHA 1PJ4A 1WXDA 4P8RA 3OIGA 3BMCA 4RF3A 3UW3A 3RD5A 3ZWNA 2GCGA 1HEUA 4W7HA 1UXIA 1LX6A 2AA3A 1N7HA 4XGNA 1JN0A 1GQYA 1RJWA 3Q9NA 2PD6A 4BNZA 1I3LA 3L4SO 3OIDA 4Q3CA 5U9CA 3RKRA 1EE2A 3S55A 4H3VA 1UXGA 3WNVA 3CZMA 4JQCA 3CZRA 1M6WA 2FR8A 4CLRA 3ONDA 1MXFA 4CR8A 3VAZA 4BNXA 3H5NA 4XIYA 4BMNA 3Q2IA 2IZZA 1PS0A 1Y8QB 4I5DA 2H6EA 2C7GA 3IQDB 3K31A 1BXGB 2JHGA 5AXDA 4YR9A 1LC3A 1SPXA 1Q7CA 4OXKA 5TJHA 2AEFA 3RBZA 3NUGA 1JTVA 3WGIA 1CDOA 4ONEA 5A9SB 4XQCA 1F06A 3PDJA 4YA6A 2X0JA 3OJ0A 3HZZA 3OJFA 5BNTA 1QR6A 4DYVA 1MG5A 1N7GA 3B1JA 7ADHA 5FWNA 5TS3A 1B26A 3FI9A 3AY6A 3PJDA 1DDOA 1MGOA 4D42A 1U8XX 2DQ4A 1VC2A 2V6BA 4CM4B 1K0UA 2B5VA 4YAGA 2ZB8A 2VT2A 4TZKA 4HFNA 4IQGA 5L3ZA 3BTVA 4GSKA 2J6IA 1EDZA 2QX7A 3WNQA 3DOJA 3RUHA 2ILTA 1ARZA 5JPIA 5KJ6A 4N5LA 4EEXA 3K30A 1ADGA 4U0JA 3E03A 4WNCA 2B69A 4OXYA 2EV9A 3VZRA 1BGVA 1ULSA 2B83A 4DQUA 3E9NA 4XR4A 4PLCA 4BO1A 1HYEA 1Y6JA 1KVSA 2GSDA 3JV7A 4FPXA 2P9GA 5JBIA 5L45A 1RWBA 1UDAA 2AQIA 4MP8A 2QRLA 1GCOA 1EQ2A 1W4ZA 3O8QB 5ICSA 2IYOA 5IXSA 2WE8A 3VH2A 1Q2XA 2YDYA 4GGPA 1Z45A 5HWSA 1DPGA 4YT5A 4J1NA 2IZ1A 4WUVA 1RPNA 2BELA 3QWAA 4P38A 4ND4A 2JFFA 1ADBA 1WPQA 1B3RA 3D1LA 4QFDA 1MLDA 4WOKA 2UAGA 4NJOA 4G5HA 2VOEA 1IHYA 4XGIA 4J2HA 5GZ6A 4KTVE 3GRKA 1M75A 4RPLA 3QSGA 4UULA 4QT0A 3OJOA 3MZ0A 4KUEA 3OHSX 1P1IA 9LDBA 2VHVA 1F8GA 4Z0HO 3GDOA 4NU5A 2GNAA 1T1RA 2IEDA 4HFRA 2DT5A 3MOIA 3UOGA 3OEYA 4CM9A 1VJTA 2C07A 2IODA 2PKQP 5IDWA 4XYMA 2J3IA 1H6CA 1DC6A 2NNLD 1GQQA 2VWGA 4XKJA 3KVOA 4IJUA 4CLOB 2BMAA 1UDBA 1R6DA 1DC4A 5H81A 4M87A 2NTNA 2RHCA 4O6VA 3TZQA 4J6FA 1ZK3A 4DPMA 1ZMOA 1EVZA 2UV8A 4CMCA 3PLNA 3VPGA 5I7SA 3AM4A 1XWFA 4GLOA 3HFGA 3EZYA 3C85A 3H2SA 3H8VA 3AM5A 1LTHR 1ZO8A 2NTJA 4YACA 1SEPA 1YL7A 4PG7A 2Y1FA 4YB8A 2C2XA 5FI3A 1XLTA 2WEKA 3E48A 1LLQA 1NTOA 2VUSA 4NR0A 3FHLA 1T4BA 1KS9A 5EMHA 4BB5A 1C1DB 4FFPA 4I1IA 3OJLA 4ZRNA 5B4TA 1MX3A 4PG5A 3DZBA 2O3TA 2WJPA 3GEMA 1E1MA 2GRAA 3OIFA 4J2OA 2G1UA 2FR1A 5G2OA 3AY7A 3MWDB 1LU9A 2NADA 8ADHA 3P7MA 4GL4A 4C7JA 1ZSNA 1TI7A 3PRJA 2GZ3A 2Y66A 3VHRA 1U7TA 4FW8A 3TL3A 5IDYA 4YAEA 4IGEA 2GERA 3IP3A 5A4DA 1JA9A 1UH5A 4PRKA 3FD8A 3V2HA 2Q46A 3HHPA 4W9NA 2W4QA 3ZNNA 4W7IA 4L74A 4RGBA 1XELA 4BO8A 2X0NA 4D3FA 3RKUA 4YT2A 1SMKA 4XYGA 3WS7A 3G79A 4TROA 2PD3A 1YDEA 4OO3A 2G17A 1YDWA 4AJNA 1TB4A 2Q1WA 3GFBA 4WE3A 4K1LA 4TZTA 2Y67A 4BO5A 3CEAA 3GGPA 3JD0A 5A9RA 4Z0PA 1R15A 3N74A 2DM6A 3W8DA 5FEUA 5EL0A 5TQVA 2ZK7A 3GEDA 1I10A 3ZNPA 4B3IA 2O3UA 2E6UX 3BZUA 4BHTA 4OGWA 3SJUA 3ZN2A 5BNIA 1D3AA 1KIFA 4IINA 4CL3A 4NBTA 1KEUA 4GX5A 6LDHA 3PPIA 4FIZA 3KUXA 3B70A 1QYDA 2J5KA 1YRLA 3PLRA 5CP8A 3GDGA 2BHLA 5KNLA 1B7GO 1KYQA 1PL8A 3TOZA 3ANLA 3WQSB 1I3NA 5CPBA 4BO7A 4K26A 2Z1MA 1ADFA 4CMIB 1ZK2A 1R0LA 1VE9A 1YONA 4FS3A 1I32A 1GQ2A 4YJFA 3L0DA 5F1KA 3OP4A 1TLTA 1PQWA 4MKRA 3U3XA 3L9WA 3ZU3A 4YRBA 3V5NA 4PLVA 3RWBA 3QY9A 4OIMA 3U49A 4BO9A 3DAFA 3OETA 4J91A 4RVGA 4GX0A 2I99A 4RLSA 3LF1A 2DAPA 1E3IA 1JWAB 1KOLA 3TQHA 2HLPA 3ZHYA 5L53A 4LW8A 4XRRA 2J5RA 4PN3A 4PVDA 1IUKA 4CV2A 4IDCA 1AHHA 4YXFA 1DFIA 4BOYA 4IDBA 2UDPA 1RM5A 3ZCXA 2HCTA 2IYPA 4B7CA 1B3BA 4TKMA 4P4LA 4YEDA 1P3DA 1XYGA 2Q2VA 3H7AA 2Y1DA 3AJRA 1HZZA 5ER9A 2PY6A 4I9NA 1V8BA 1EBFA 3NJ4A 3GVPA 4FFRA 1D7OA 1CRWG 3L4BC 3M1AA 4LCEA 1M2WA 5JW6A 4RQTA 4IXWA 3OA2A 5EIOA 4B8ZA 5JAIA 5HM8A 4BNWA 4KMSA 4WCDA 5ADHA 1LLCA 1BG6A 4IQ8A 1ENPA 1I36A 1GZ6A 1E7RA 1DLJA 4FDAA 2OP1A 1MFPA 2PNFA 1DIGA 2YV3A 4HWKA 5IDQA 1EMDA 2HU2A 2DBVO 2CZCA 2DC1A 1PL6A 4WCFC 2X22A 5H83A 1ONNA 5C37A 2B5WA 4TRRA 4ID9A 1PZEA 4E2ZA 3PIIA 2EGGA 4EJ0A 1KVRA 4RVFA 4E0BA 3WSVA 3R3SA 4J0FA 4MP3A 4MVJE 4MVJD 2PZJA 3E18A 1LBEA 1E3WB 3T4EA 3WGTA 1EUCA 4ROSA 5CHEA 4MJLA 4DQVA 2QYTA 1DC3A 1GEEA 3NTQA 4MVJH 1T2DA 4E21A 4PRLA 1DLIA 5JE8A 3RFVA 5F1PA 3IOYA 4FBGA 4ZQFA 5DNAA 1DXYA 1LDBA 1ZUD1 1ZIDA 1GAEO 1ZK4A 3S2IA 3MJTA 1G6KA 1H9AA 2ZATA 3JQCA 1YKFA 2O3JA 3GK3A 1HF3A 3IP1A 5L51A 3RFTA 3ZU5A 1KEPA 3FWZA 1GUFA 2NVWA 3LC1O 5K6AA 3L9XA 1SAYA 2O2YA 1R37A 3BHJA 3PHJA 4BNYA 3JYLA 3GG2A 2FHSA 2PZMA 1ZXBA 3PFWO 3CH6A 2WWRA 4DVJA 1UP4A 3TF5A 1EZ4A 1TT5A 1LEHA 2VWQA 5ILOA 2Q49A 4JROA 2OZPA 1V6AA 3CPSA 3E9MA 4J7UA 3ZV4A 3I9OA 2DVMA 3VTFA 3ENKA 4L76A 4D0SA 2VRCD 2ZTMA 1A9YA 1R16A 5C7OO 1B14A 1Q0LA 2ZTUA 2ZKLA 1CJCA 2ZJ1A 1L1FA 1T4DA 1ZSVA 3Q2KA 4N18A 4R69A 2NU9A 4BKQA 1ZFNA 1XHLA 3UUWA 1NVGA 1WMBA 3ETEA 3N7UA 4FFNA 3FF4A 1YOVB 4PFJA 2PZLA 2Y1GA 1UZMA 2R2GA 5I7VA 2OMEA 4KDFA 3CMCO 1D8AA 4RVUA 1QYVA 1LC0A 4CLDA 3TZKA 3PDUA 1B8PA 2PWZA 4R01A 3JQFA 1EQUA 5F5NA 4E5MA 1GPDG 1ISMA 3S1LA 3W4KA 3JQAD 1R4NB 2P9EA 1QG6A 3MJEA 3DZFA 3E5RA 2VWHA 2OHXA 2H1SA 3WIEA 2Q1TA 1HDZA 1SB8A 3N58A 4D3SA 5DN9A 1Z7BA 1O5IA 4JJGA 4YPOA 1JQBA 4WLNA 5JYEA 2AXQA 3PJGA 4R41A 1U3TA 2YFHA 3QP9A 3HB5X 3WSWA 1I24A 4R51A 1LQTA 4R9RA 2G5CA 1NFRA 4MVJP 3DONA 2Q99A 4FR5A 1FDWA 3EMKA 1X7DA 3VKUA 3RC2A 1FDTA 1HSOA 1LDGA 3KSUA 3AUTA 1PS8A 4HP8A 4FCCA 4KTTE 4M89A 3LK7A 3CIFA 1RM0A 4M54A 4RF2A 1C0PA 4AICA 2CDAA 5K9ZA 5A9TA 2C59A 4Q39A 3GHHA 2GDZA 2ZCVA 1DJQA 5G0SA 1CF2O 1P45A 1JKJA 4IY1A 3U0BA 1H6DA 1Z74A 3HN7A 2WD7B 2B37A 4WK6A 3JD2A 3S2GA 4CM8A 4NBWA 1U28A 1AN9A 1IL0A 2NLOA 3O26A 4TWRA 3WG9A 4Q9NA 4OM8A 1U5AA 1QV7A 3KYDB 4R1SA 1NWHA 4A5OA 5H82A 4BGIA 2JCYA 4CQMB 1EUZA 1IHXA 4FFOA 4P4NA 4S1VA 3LDHA 4L8VA 3ASUA 1E77A 2YDXA 3K73O 1XG5A 3VOSA 1QP8A 4YDRA 4RDHA 3KZVA 3H5AA 5ITWA 3RUIA 4NJMA 1SNYA 2GASA 2OOSA 3WMWA 1KERA 2Y0DA 1EEHA 3GNQA 2DFDA 4WLVA 4E2WA 4IPTA 3RJ5A 2HK8A 1T2EA 2R00A 4KOAA 2OBNA 4KZPA 3WQRA 4D44A 4L73A 3MEQA 1CQIA 4L0QA 4DWVA 4WCFA 1WLYA 1YXMA 3BHMA 1Z82A 1ZH8A 3ICPA 2Q2QA 4CLOA 3HDYA 3RCBA 5A02A 2JL1A 3VDRA 3WFJA 5THKA 2X86A 1VI2A 3NKLA 3RC7A 1LSUA 1OOEA 3FNEA 4FB5A 2I3AA 1OMOA 5A04A 4WNIA 1LUAA 2CFCA 1JDJA 3RU7A 1I0ZA 1E5QA 3BXXA 4EW6A 1DC5A 5BSEA 3O03A 3DOOA 4ZQHA 4D45A 3UXYA 5DP1A 1V0JA 4OHUA 4AJ1A 4BO3A 5L4SA 4UVHA 1R0KA 3PJEA 3ITKA 1KY4A 4NK5A 1LRLA 3NTRA 4DLBA 3GAZA 4DLAA 1V35A 3H9UA 1AXGA 3I4CA 3OECA 1XQ1A 3WXBA 2XOXA 2QZ9A 5TLSA 4DMLA 3H3FA 1N8KA 3I9LA 4BKPA 2QG4A 2C29D 1A5ZA 3IAHA 1EFKA 1BW9B 4D46A 4EBFA 3MJSA 5DP2A 3D4NA 3Q0EA 3FBTA 4BKOA 5G0VA 5I9NA 4OOEA 1PEDA 3JYQA 1CEQA 4BNNA 3EGOA 3NJ8A 4BGEA 3T4XA 4L4XA 1KEVA 1G0NA 5AXAA 4XB2A 4J7CA 3VH3A 4H16A 2EJWA 3GZNB 4GGOA 4I8XA 1CIVA 4QECA 4CUZA 4ESOA 1NAIA 1E3LA 4BQRA 4NMHA 1AUPA 2NM0A 2GN6A 1NXQA 4E33A 1GZ3A 1O9BA 2C0CA 3I6QA 5GY7A 3WWYA 2WD7A 1HRDA 5A3JA 1D4FA 2UVDA 3MJVA 3QV1A 3DHNA 1VL8A 3VDQA 3GQVA 2Y93A 1E7QA 3AUAA 5KTKA 3AI3A 4TRNA 4DXHA 2PKRA 5A9SA 1ENOA 1R0SA 4NI5A 4XQEA 3K96A 1ZJZA 4TVOA 1PZHA 3FR8A 1X13A 4OQYA 4AJJA 4UUNA 1WDMA 4LN1A 4Z9YA 3O38A 4IDFA 4Z3DA 3ZWPA 5FYDA 1DAPA 3I9NA 2FZWA 5JDIC 1RM4A 2X9VA 1HDYA 2IXBA 4GSLA 3DBHA 3ZU2A 1ZNQO 2NQ8A 3F4BA 1FDSA 4LK3A 2FSVA 4GLLA 1UXHA 1AXEA 3OBBA 4BNUA 1L7EA 3GA0A 4OXNA 1WMAA 2EP5A 4INAA 4BB6A 4JXKA 1NP3A 3MTGA 3LT2A 4CMGA 2G76A 1YBMA 1P33A 4YJDA 5JMPA 3I9KA 2VYVA 1DIAA 3R1IA 4IBOA 5DBGA 3ZV3A 5ENVA 3PWSA 4Y6PA 1M66A 2CSUA 2ZYAA 3PHHA 4CODB 2W2KA 1MV8A 5CEEA 4QQRA 3WLFA 4CLHA 4WOJA 1C0LA 2Y05A 5LCXA 3QVXA 2VRCA 3DMYA 4ZD6A 5LC1A 3CE6A 3HJAA 1K89A 1LDNA 4NPCA 5L95A 1GV0A 3KM0A 4DQXA 4L4SA 2P9CA 1PJTA 1UDCA 3FSRA 4PZEA 3BMQB 4GBJA 4NBRA 1UJMA 3IKVA 1XU9A 3RC9A 2CF6A 3QVWA 2Z1NA 4GVLA 5G4LA 4NG5A 3GGOA 4U0KA 2JFHA 1BXKA 1MUUA 3L6EA 3O4RA 1KVTA 5KKCA 3C24A 3HB4X 4UVEA 4GQAA 4OYRA 4AJ2A 4CR6A 3I9JA 1UP6A 4MIEA 1SOVA 4A7PA 4GVXA 4IIVA 4CM7A 4WECA 2Q4BA 3P2OA 4J4TA 3V2UA 3D3WA 4N5NA 4BO4A 1LSJA 1BW9A 3NTOA 3ZWAA 2EGHA 5EESA 3I1JA 3U4DA 5LDHA 3ZWWA 2NACA 4QO8A 2EKPA 3ETDA 4ALLA 3TFOA 2DPHA 3VVCA 3F1LA 1S6YA 2OL4A 5CAEA 3JQAB 2VN8A 5T8KA 1PJ3A 4XZ3A 3DBRB 3ZW9A 4CM9D 1E6UA 4MKZA 2BLLA 4E5NA 5F1OA 4CL8A 3PZRA 3EW7A 5K6AC 2SCUA 1QV6A 3BA1A 2IXAA 1LQUA 1LRJA 5F5LA 1P9LA 2JFGA 1PQPA 4BNHA 3H5RA 3KRTA 4II3A 4NU6A 1U4OA 1VSVA 4E4YA 3PZBA 4LMPA 4B4UA 4ND1A 5GMOA 2VHXA 3IJPA 3BTSA 4MPDA 2B4TO 5JO0A 2DUWA 3QWIA 2CVQA 4RQUA 2HJSA 4I9HA 3RVDA 3DR3A 4GWKA 1N2SA 2NVBA 5DT9A
chains in the Genus database with same CATH superfamily
3VZQA 2MMGA 1NV8A 4GI7A 4POOA 2PGNA 3H6HA 1A5BB 3UJBA 4NZYA 2NUTA 3ZIDA 4LJ9A 3IUJA 3ABSB 1PJ8A 3FTNA 4MI6A 3INTA 3IVMA 1N1GA 1ZK0A 4OHCA 1E7WA 1SURA 3HRKA 4GZMA 4QFMA 3DF7A 1K7FB 1SQ5A 3Q9UA 5FUWA 3ANYB 3EAGA 2KM1A 4EGCB 4CPDA 5I7EA 1Z12A 1M54A 1PZGA 2Z2YA 3GYGA 3KYIB 4YRMA 1Y6ZA 2YVAA 1G7SA 3RUFA 2V4MA 4IH9A 3OAAA 1F17A 1QFMA 4UBKA 4Y2QA 4YMIA 4RVDA 2JCXA 2P6UA 1P1KA 4YJGB 3R23A 1Q95A 5EUBA 1JSZA 4O4HA 2I3ZA 2FZLA 2Q1SA 4GDMA 3Q11A 4M49A 4AKSA 4H4EA 1RBMA 2QE6A 3UHJA 5JTTA 1A8IA 1C3EA 4XW2A 1GP2A 2WUGA 4CVNA 4EVIA 3M89A 2ZAMA 4BNJA 4URFA 3M8KA 4FC7A 1CS0B 4W5NA 2V58A 2VF4X 5CBPA 5EXEA 2Z3ZA 3SJ7A 2WG1A 2QI9C 4F2GA 3L77A 4FE7A 1DXHA 1D0IA 1IZYA 4LIPD 4HDKB 4ZCMA 4YRGA 1S2GA 1TVCA 2IU0A 2GTIA 1Z22A 2ADFA 2IUFA 1BHSA 4TL7A 5G1PA 5TX7A 2HMWA 1TU4A 2G1AA 4WFIA 4KWIA 1A27A 2Z5FA 3W1EA 4CL0A 4YXWA 1JG3A 1Q74A 1VE6A 1W85A 2P6MA 3G8CA 4GO1A 2HSWA 4MUBA 3RS3A 1E2IA 1A04A 1KY2A 1TJ3A 4QYXA 5IYZA 1H5QA 2JFYA 3UPDA 1H6AA 3GFSA 4L08A 5K0FA 4AUNA 4UVIA 2P2SA 3GZJA 4B32A 4BN5A 2BP7B 3NH6A 5AHWA 5IAGA 2DWPA 4Z4CA 5FX2A 3DL0A 2CXHA 2OBMA 2EVWX 4HXFB 5JG7A 3WOHA 1JAIA 3TDNA 3ZJYA 3AG6A 4A15A 2PIDA 1TD9A 4YNBA 1ZNZA 3TFQA 4TRJA 2XUGA 3UYLA 1C1HA 3WGYA 3HB1A 5IF3A 3GLHE 3PXXA 1SQ6A 3E9CA 4P4GA 4L50A 1JYFA 3H9JA 1X1RA 2QW8A 3U26A 3WNCA 1A7AA 1FTSA 3OFJA 1IXRC 2RC6A 1E1CB 1KDTA 3OOEA 4C7KA 3M33A 1NI4A 3QV2A 4DSNA 3OFSA 4FFVA 4JIGA 3JX9A 4EJMA 2D3WA 2PJUA 3ZDCA 4QYWA 4DN6A 1QSGA 2Y3IA 2X3FA 2CJXA 2BMEA 5JMWA 5CCBA 5LXTB 5ALOA 1BSVA 4QVIA 1GGEA 4B4KA 1CU1A 4FHZA 4GMFA 2GWRA 1QBKC 1RQ7A 3CVOA 3FXAA 4LCJA 2O2IA 2B82A 4R1QA 4UBNA 1HTWA 4LSZA 1ZH0A 3C1AA 4BMCA 3EWNA 4AMVA 3HEAA 3UA3A 1XZPA 4PPYA 4FT2A 3LLMA 3IHTA 5K51A 4C3UA 2R25B 1QGYA 3PA8A 2RHRA 2R60A 1SVMA 1A9SA 1SXIA 3HM2A 5AI5A 2FAXA 4C0JA 2GGSA 3MUOA 2PBFA 5DBFA 1SZJG 5HYVA 4DKXA 1SO8A 2Q0HA 1YIDA 5I5EA 1FU7A 1Z6XA 3W2IA 1JG1A 5L3SA 4D98A 2QNRA 3FKSA 4HADA 3WQHA 1V41E 3T9EA 1X7XB 3AIIA 3BEOA 3VVBA 3UA4A 4HS9A 1PJCA 4ND7A 4PZAA 1IZ0A 3CZQA 4RIIA 1RXEA 3AK4A 3W5BA 1U1GA 3IS3A 2IEBA 5EZYF 4QKQA 2X3YA 5TRTA 1NVTA 3V00A 4B84A 5IF9A 5K6TA 3ONEA 5B55A 1IUNA 1J5EB 4GR5A 5A5FA 3T41A 5KNBH 5FNVB 1U7HA 2YW2A 3CUTA 2I7XA 1AGXA 5IRCD 2CLIB 1VE7A 4YMSA 3S99A 4CL2A 3G9XA 3HC7A 1E6EA 3G5MA 1GUDA 1E9CA 1JT2A 2YVQA 3H4MA 4LYDA 5GINE 1MV5A 2WKRA 1NW4A 1CLUA 1E3WA 2CLKB 3QHQA 1GM5A 4UHKA 1W8IA 5KCZA 1IM2A 2R6DA 5D7BA 2J3HA 3BCRA 1SVIA 1WTAA 3LU1A 3BQ9A 3HG7A 1X7ZA 2HWKA 4M9CA 1D03A 4HI0E 4IXTA 2B4RO 3LQRA 2E7ZA 3GMSA 3KD2A 1KMIY 4BNGA 3NFRA 5DTMA 1C2TA 1L5GB 5HCIA 3A4IA 2X2FA 3GU3A 2LIVA 4BO6A 3PGLA 3KJGA 5ALVA 5GZ1A 4JY7A 2AIRA 3BGIA 2CJWA 2OQIA 2DBQA 3N2IA 1QNFA 4PLPA 4YRLA 4BJ6A 1PUIA 2YVKA 1PYGA 4G37A 4O8ZA 5ARBA 2GO1A 2XNHA 4L75A 4F06A 2B35A 2RK3A 1L7AA 3M81A 3QUSA 4RFLA 5IUKC 4CQLB 5JZOA 2DTXA 4BLOA 4DYDA 2EFEB 2W48A 1ZNYA 2FPLA 4MVJF 4XA8A 4PGAA 3TNFA 3TFWA 3S2SA 1C30A 4C43A 1XSEA 3D5TA 1RQGA 4C2UA 5JSQA 3E1KA 4JYZA 2HRRA 1GL9B 3QBDA 2QTMA 3N9IA 3X0DA 3DS8A 4WZBE 2FY8A 3ASYA 4GSYA 4MYCA 4Q4DA 1MJFA 4XWGA 3OWXA 3RSFA 2NPOA 2FUKA 2FPOA 2D2IA 2ZKIA 4RY9A 4GU5A 5IAJA 1FNBA 2M1ZA 1NC1A 2P6NA 2PZEA 4BFXA 1W5SA 3I5AA 3ZWXA 3VNVA 1T2UA 5MHTA 4F11A 1D9XA 1K4MA 1W5EA 2C5AA 4ZVRA 5I9TA 4DIOA 2WTMA 5U1PA 3P9CA 4RIHA 4AM8A 4NECA 1NXOA 4MKXA 1AE1A 3K2QA 2X5XA 3ICWA 3HB7A 2IHZA 4MZDA 1P5HA 5BVGA 2W2KB 2Z0MA 1VJ0A 1FYEA 1JMVA 2ZDGA 1QOZA 3T0GA 2I5PO 4BBPA 5A4MS 3WYBA 1D9ZA 3WSTA 1YK1A 3ADOA 3HL4A 1JILA 2JIBA 1ICIA 2C4VA 3REQA 1OPRA 3HZRA 3NVDA 5FWXA 1N32B 2H8GA 3CLUC 3C70A 2ZIAA 1KBOA 4J0EA 4TTRA 1OX5A 3TGPA 3SFZA 3U9LA 1SBQA 1KBZA 1PNQA 5T6BA 2YFKA 3V8MA 2RAPA 4KFUA 4QUDA 4RNDB 1U31A 3PEUA 1AGYA 4Q4HA 5KQPA 2I55A 1A4XA 1PFUA 5AJYA 1U0RA 1V1JA 4KQ2A 1E0AA 1Q1QA 1H9BA 1XKLA 2HDOA 2B3TA 3HZOA 1G5FA 1F12A 3R09A 1GPWB 1XCMA 1P9NA 4KIGA 2FSIA 2OBFA 1Y5RA 4QPPA 4TXJA 5IHPA 2PE5A 3BAFA 2ODAA 5HNKA 2OFFA 2E4UA 2AE1A 5AHOA 4X1YA 5FUXA 2B92A 2LPMA 4UTRA 1ZGJA 3DOFA 1DO8A 5IKXA 3FFTA 1NE2A 1JMKC 1JVBA 1WHTB 4IFEA 3ZWBA 4B35A 1CE8A 3OCWA 1JG2A 3CLUD 3LDGA 4BMSA 3GPBA 4RVSA 2OK7A 1PWXA 4TV9B 1V16A 3DYIA 3CSSA 4UZSA 1YZFA 1DBVO 4CMKA 4F60A 2R1UA 1E5TA 1NZFA 3BH7A 3UUEA 2F4NA 2XT6A 3TTTA 3AXTA 3MPOA 4UUQA 3GZNA 3AW9A 3K1YA 1QGZA 4S1OA 1RSZA 4OQNA 5F7ZA 3NM4A 1SBYA 2CF5A 3IVXA 5LA6A 4QJBA 3HYNA 3EZLA 1ZM9A 2X42A 1L5HA 4B6OA 4B3XA 1UKEA 2H17A 4OG2A 3ZYCA 4BMXA 1GL3A 1R5NA 4E5DA 4XB6B 1J49A 1NURA 3P2JA 3PK0A 4P2BA 3E1GA 3EIXA 3LGAA 4JUAA 3MM4A 3DP7A 2BGIA 3F3KA 4DQLA 1VYHA 2QE7A 3L82B 1OKKD 2UXCB 3SHTA 1N3YA 4KK4A 4PLHA 3AERA 3KXDA 3WK9A 1F0PA 5LB2A 1MB2A 1TT5B 1RPAA 4LTNA 4YCCA 3QNUA 1XZEA 2BTQA 2YZKA 4NCKA 1D2HA 1PG2A 2HREA 3BJIC 2WM3A 1YB1A 1VJ1A 2JH8A 2QDKA 4IRMA 4WD3A 5CXSA 1DP4A 1I3MA 2P91A 3FTCA 3EDMA 3U13A 2KLHA 3VSCA 3AC0A 3O9ZA 4ZK6A 1ZVJA 4OOFA 1UOQA 1LXCA 2VA9A 2ZYVX 3GX1A 4I14A 3ZLTA 4DVGA 2G0AA 1BS1A 1ZL0A 2DFPA 3T61A 3TUZC 1VMAA 2Q5OA 1XZHA 3OQ1A 5EP3A 4A2QA 4BFZA 4KHPB 1PT8A 1F8XA 3AR4A 4C6SA 3HABA 4EGJA 4YR7A 4MUKA 3TTXA 2W71A 5AJVB 3OQIB 4N5DA 1U63A 1P2SA 3PCTA 1YHZA 3UICA 2FN8A 4IGFA 4WJZA 1E98A 3BL5A 4MHOA 4GBGA 4ZEXA 4NZ9A 2O0MA 1QVRA 2I7VA 3L8FA 1NW3A 2B7LA 4KSYA 4LZPA 5TEVA 3JASA 3QOXA 2EIHA 4IZHA 3S1AA 2XMCA 2HIMA 1CR6A 3ZWYA 4WJKB 4D6XA 3AOGA 3CRQA 4ZKDA 4OI4A 3TQSA 1FY2A 5CBKA 2JLBA 4YTEA 1BD4A 3AV0B 4PX3A 2AXPA 1OASA 1AHPA 3IILA 4FIDA 4DBZA 4X1OA 2PR2A 1F6WA 2ST1A 4ZI7B 3QMWA 4R9NA 3G2HA 5L4NA 3NG1A 2HIAA 1ISGA 4NC9A 1M83A 3GFGA 4X71A 3BA6A 3IO3A 1A2OA 3L2OB 3HH8A 4KH0A 3AFNA 2DTEA 3BGDA 1AB5A 3M6VA 2R1VB 2CXQA 2ZSDA 3ZHZA 4E30A 1ACJA 1YHNA 4LE2A 1I3KA 4DPKA 2EEPA 2A7XA 3WB1A 3CNEA 1W9HA 1Y8RA 4PNEA 1E2GA 2M6RA 3D54D 3L6DA 1S2DA 3A9SA 3AOEA 2X9LA 1IZ8A 2YN4A 3O94A 4J29A 4S3MA 1JQLB 1ILWA 3DFIA 3JRXA 3QKIA 4BWFB 4C2BA 1MH9A 4UBLA 1VKHA 3NBMA 2W8BB 1Z16A 4Q00A 5DCWA 5FULA 5CT9A 2PCJA 2OXIA 1U2QA 2DPGA 1AF7A 2J9RA 2CXNA 1XROA 3F4LA 1B73A 3R5JA 4JLWA 4XGKA 4WFQA 3NYWA 2OCDA 4G0XA 1IXZA 1JR3E 2C95A 3COSA 1T5HX 3VO8A 1BNCA 1O58A 3IEVA 4HR7A 3AJ9A 3K6JA 3A1VA 3CKYA 3EEYA 4ITUA 4QOFA 1GLGA 2VRBA 3GOHA 3NHSA 4I4NA 4LOIA 1QH8B 5BN4B 1F14A 2B0JA 4H08A 2WLTA 4I99A 4M8SA 2M6KA 1XZ8A 3IV9A 3O8NA 3MJRA 2A1TS 1OJ7A 2X5OA 1HXHA 3DDNA 3Q5EA 4W4TA 4NV0A 5DOVA 4ZT3A 1KQPA 4GL2A 2RI1A 3DT6A 3P0JA 1NU8A 4H1TA 4JYMA 4LJ7A 3ENNA 5DNEA 4DL9A 4ETWA 5M29A 1ZD2P 1PS9A 4LPSA 4R2IA 2XUHA 2EXXA 4AY5A 3TYXA 3OM1A 1A8SA 4R3WA 3VUEA 1C3LA 4G07A 4NVRA 3UEOA 4BE4A 2CFTA 3NNSA 3OM8A 4FHFA 2GN1A 3G0CA 1A7JA 4KXNA 4C4PA 4M22A 5CB6A 2ZXUA 1T3SA 1G3UA 2EERA 4G5QA 3MWYW 3F97A 4K40A 2BJWA 3M5WA 2QWXA 5ED4A 2H1LA 4LF4B 4B3GA 3W6NA 3SDZA 4DDVA 1YVUA 4JN6B 1U0OC 3DFKA 5HVNA 3NVKI 2CL7X 2OD2A 4O2BA 2WSMA 4LRTB 4W9NC 4ZO9A 1D6SA 1J8QA 2FMIA 2XW6A 1YCDA 3I4FA 3QLTA 4JCCA 4UM5A 4X61A 2EBUA 4GEGA 5KO2A 4AO6A 4HZUA 2BN4A 3R9XA 3E1SA 4MWDA 2Z09A 3VU1A 3UT5A 5FPYA 5IKOA 4HXEB 3VTZA 1ZHOA 2C2BA 1OIVA 5EMKA 1CUBA 2PDAA 3MWFA 3AB7A 4QATA 3IT0A 4E2YA 2WU1A 1ZR2A 4KHZA 1GIAA 1ZN8A 4LJ5A 4TMVA 1F0YA 3WZLA 3CUKA 1Y1PA 4LJ4A 4WK2B 5GJCA 4D96A 4UPEA 1ILEA 2DB3A 5KBYA 3H8SA 1XCPA 2QJRA 2QRVA 4AIIA 4DLSA 3GDFA 2GKSA 3UPTA 1K6IA 1VKZA 2HD4A 2AVNA 3O95A 3Q41A 2KB0A 4FD3A 1W4LA 4QGFA 1GQFA 4BB0A 4BS9A 4CM3A 3DDOA 4AX8A 3CX4A 2XLCA 3KB6A 1M6EX 3PC8A 3Q5DA 4UUBA 5E9QA 3TKAA 1DEXA 1ZIXA 2CCKA 2SHKA 1HDCA 5KDLA 2IDMA 4OGGA 1H4SA 1ML4A 3H16A 4G24A 4YRQA 3PGKA 1NVKA 4FKZA 1CR4A 1JBEA 4F7WA 3FBGA 3LO5A 3L8YA 4RC9A 3IPYA 3U4CA 3Q7PA 4WCVA 3OD1A 4RIFA 4YJHA 3QYPA 4HHEA 1XA4A 4XQGA 1SUFA 2JARA 2HHCA 4PLFA 4ES6A 2PYDA 3HKCA 1D8TA 3UAVA 1M2VB 1IY8A 2QQFA 3OOWA 4BNLA 1T1SA 3RO7A 1K3TA 5JIBA 3W6ZA 2BPOA 4GPBA 3N28A 3U7QB 3B9PA 5AI8A 2JKYA 4BVAA 4ZICA 4RMGA 3H0KA 3D0RA 3GRUA 3O0TA 1IOLA 1VIDA 3FW1A 1GA6A 3R41A 4BAUA 3D6VA 1H94A 1OC4A 9GPBA 1NUPA 3GHYA 3A28A 3DBHB 3IERA 5MN4A 3C6BA 2J3JA 3LBYA 4K5QA 1KXZA 1TZBA 1Y7TA 4HMPA 4K6FA 4BMVA 1SWWA 3EJ6A 1MPXA 1SBIA 1SC6A 3G1WA 3N86A 4HGPA 5TT0A 1H2YA 2EQ5A 2JLYA 2YN2A 3AL2A 3KQLA 1TZCA 4QUGA 4WY8A 5TB5A 1BKSB 1BOFA 3DV9A 3RRJA 5IX8A 4ER7A 1GWNA 4RHTA 2VVTA 3LYHA 3RHZA 1DADA 2CWWA 5K3EA 1MC5A 1LX7A 2QUBA 4MW0A 5CYFA 2EG9A 4CI0B 2J67A 3GJSA 3EMBA 3L07A 4OKNA 1D1SA 4NCXA 5E9JA 5HIIA 4F9TA 1XDGA 4B1FA 1IXKA 2QTGA 1LI4A 1CT9A 3LYLA 2WWWA 4LECA 3TTUA 1RI5A 1AHIA 1XMVA 2GDJA 1C8LA 2X41A 4I8DA 4YLYA 4N7MA 3P0FA 4MR8B 5HEKA 4L15A 1OWOA 1YZYA 2FZGA 4Y6SA 4JENA 3R8XA 1N6HA 2BR5A 1CTQA 4OK6A 3PNKA 2W5UA 1Y81A 1BFUA 1CP2A 1AN0A 1CUUA 4YUXA 1ELOA 3P2IA 4BBAA 5KQRA 2ZSKA 3N0VA 2L19A 2WU3A 1JLHA 3ER6A 2QUIA 1EA5A 1XEAA 2OTCA 3KYBA 3MRXA 5AI4A 4ZRDA 4X7PA 5A05A 5LYYA 4BO2A 1JSLA 3BM5A 4B2PA 1R8SA 2VP9A 4GP6A 5MN6A 1U8UA 1RLOA 3RYIA 3W2FA 3AVQA 1BWPA 3BN3A 1J0XO 2J31A 5BQ3A 1T5LA 4UW9A 1ZEMA 3NUQA 1LFDB 4MIYA 1ZWLA 3LUCA 1J56A 4PC6A 5BQ5A 4X91A 3VU0A 4CNBA 2R4QA 4HDNB 4H7IA 2YKGA 2HWWA 4JJIA 2JDID 4BRZA 3DL4A 1MOSA 1NLFA 2CMDA 3BFXA 2QMOA 4FJ1A 4J49A 4UE6A 2I6GA 3ZUGA 3BJMA 1C1XA 2ZCUA 5FFFA 1CK4A 2XNJA 3U5ZB 3BK2A 4P1ZA 3VPHA 1JDSA 4EABA 3R9WA 1QB7A 3BTOA 4NU0A 4B7XA 1S01A 4GIBA 5FPKA 4KE8A 1IEVA 3D8HA 4RKRA 1KO1A 2CYAA 4EARA 1M5RA 4Q18A 1Z15A 2QR3A 2YJZA 1SZCA 4LPKA 5C18A 2O8BB 5A3SA 4FDUA 3MG9A 2OXCA 4DG9A 1TCVA 2I3GA 2FLWA 2R8XA 4I9FA 3V8EA 4XWTA 3WMRA 2OBYA 3EE6A 5LDGA 2FI1A 4HQOA 1GKUB 5ITVA 3E4CA 3PXUA 1FP4B 2P9QA 2JLAA 2O2SA 5JD6A 2XOEA 4QTUB 4PZZA 2V0NA 5TMEA 3QUQA 5FD8A 1I1HA 2R8EA 2W2LD 3AO0B 5EC8A 4OD0A 3DFFA 4U7FA 1EG2A 1XTRA 2JB9A 2VDQB 3PJRA 3ICOA 5CA0B 2O7NA 2WM9B 2W4IA 5LBTA 1U9CA 1DAFA 2AW5A 4AWBA 2CLSA 2NSDA 2QAGA 1H2EA 4C21A 5AOAA 2B0CA 5CR9A 3WGQA 1TYBE 1PGQA 4JXZA 2WSBA 4OXXA 4BQNA 1I5EA 1Z2AA 1AGPA 1W4RA 3GQBA 3DMTC 4H7HA 3EUWA 4X1IA 4YO7A 1U7XA 4JKYA 1Q1NA 4YJHB 2NTYC 4KYTA 5TXGA 5IDVA 4C2AA 2CDCA 5JLJA 2AF4C 1O95A 3CZPA 3G5TA 2BGMA 3QU5A 4GH5A 5HS4A 1U3FA 2G8LA 2Q1YA 4UMVA 2VKTA 1VLZA 5CA1A 1H0KA 4GZ5A 4MJ7A 3WJAA 1VB3A 3QPCA 4YQFA 4CM6A 3U1BA 4G9EA 2EEZA 1J99A 1GD1O 1VGQA 1JB1A 4RQAA 4Y0VA 2PZFA 1IB0A 3ULKA 3JTMA 2BFDB 4NICA 5ALRA 5SZJA 5C3MA 1ULHA 5EJFA 4P35A 3DLIA 5K0ZA 1NUSA 2BCEA 2VUUA 2PXHA 1TAQA 1JG7A 2PWPA 5LA6F 3T95A 4BGUA 2J48A 13PKA 3E5MA 2RCYA 3GUCA 3IP9A 3GRPA 4GRDA 3DBVO 4R54A 5BSMA 1IN1A 2KYRA 1NFFA 2BGKA 3WHPA 1RQXA 4P82A 2MJLA 1XVVA 3BF8A 3ZDFA 3O7WA 3Q6IA 4QSMA 1KAOA 4O3FA 2P62A 1ZIYA 5I8ZA 2K2QB 1L5KA 3PFFA 4DF3A 5LZ4A 1CE8B 4J0JA 3LCCA 1DU4A 2CNBA 4QSHA 5FV4A 4LWZA 2OYSA 4PANA 3M5CA 5TPZA 3UV7A 5FOQA 3EA4A 4FMDB 3FDFA 4EAQA 2WU4A 3PDIB 4IIJF 4RTKA 4I66A 4RSGA 3RIGA 1C1DA 2DY1A 3A1CA 3IT1A 3GG9A 3E22A 1OGIA 3OF2A 2EZ8A 4ZQBA 4EPYA 1H2BA 4GE0A 4WK0B 1LRKA 1U0TA 2C2HA 1LD3A 2I1VB 3KWJA 3IJ5A 1FFDA 1T5DX 5G4KA 4CLRB 5IC4A 1APBA 3OZXA 3SZ3A 4E46A 1EE9A 1QFZA 3TW0A 4PSUA 2JAHA 3CNHA 2CY0A 2TECE 4FYJA 5BRNA 3T35A 2ODEA 3DXYA 4CTJA 3KPJA 3P96A 2HMVA 5KUTA 1JLLB 1M73E 1Z9BA 1CZKA 2PBRA 1Z2NX 2YNMC 2YV4A 3PA6A 4I4TA 4PBSA 4OJMX 2PWAA 1YC2A 4UVDA 5DNDA 2HK7A 4BNDB 6YASA 3RSSA 3B1VA 1G291 3WB9A 4J6EA 4N01A 1JEDA 2H5IA 4HQRA 3IVCA 3JWEA 2ZZMA 4G41A 5A4KA 1LJ8A 4ARIA 2G5GX 1M6HA 2PTGA 1JE1A 4QT4A 4WZ6A 3PCXA 4DG5A 1I3OA 2C5GA 2H92A 2JH3A 3E58A 1HDRA 5JC8A 2H48A 1DAOA 2JCBA 4GAEA 4X6YA 1N36B 2I65A 4WI1A 2WWHA 3UM9A 4DSOA 2WUEA 4XFDA 4UMDA 1XD2B 1SIBE 2GN8A 4WLUA 4TKUB 5E9AA 4A0HA 4FGKA 1FZQA 1RWNA 1RRCA 3SCZA 1UCFA 2DKOA 1BU5A 3ZX4A 5B64A 1PFGA 3CV3A 3OX2A 1CY4A 2FSHA 4C06A 5KOJA 4JGGA 3SWWA 4ZAYA 1RNLA 5EIFA 1N9GB 3I8OA 5KVAA 1FYDA 1T3GA 3L93A 4JJFA 5JZ9A 3DC7A 3JSAA 1MQ9A 1XA3A 4J4BA 4L95C 2FW9A 2BSAA 2O4CA 3E3NA 5F77A 5K8TA 2CVZA 1SBCA 1NI5A 4IOLA 5T67A 2AK2A 1YS2X 2FB9A 5B36A 2CHFA 4ZVQA 1EGAA 1UT6A 2A78A 3VPSA 2AFHE 3AR5A 5BO5A 2VP0A 3V2GA 5FTJA 5JARA 3GUYA 4Q47A 1RYDA 4RTPA 3B1WA 4S1NA 2BFFB 2RHLA 3COWA 2J4FA 3BBLA 1AX9A 3UWDA 4EO9A 5I7UA 2WT4A 3OFNA 5CB8A 4C0WA 1YB5A 1H6BA 2FSSA 3JQ7A 3QVTA 4KQFA 4OTZA 4LX8A 3GJTA 3W2EA 4EJFA 5AIBA 1JMYA 4M1OA 2CXOA 2VXYA 1LVUA 3KQOA 5JSUA 1Z4JA 3BJEA 1RCTE 4IIHA 1PK7A 4PSKA 4L5CA 2D0IA 3T5MA 3AVXA 1H65A 4YUYA 2I1QA 3HWX1 4US1R 1NN5A 1M8JA 3TVYA 2ADOA 4G2NA 2MT9A 4HAVA 3I6ZA 1I6MA 3W79A 3ZQ6A 1PV4A 3K5IA 2WJIA 3DKRA 1JQEA 1U5BA 4CDRA 2W58A 1IB6A 4HO1X 4LYJA 4DJAA 3W5DA 1JFFA 1JI0A 2QAIA 2XE6A 3QNMA 4QYMA 3INRA 1E6WA 5ITZB 3G1UA 3LGXA 3N70A 1FFEA 5LA6B 2H4JA 1BWRA 4NKRA 3UO8B 4A0SA 1T8RA 2FN3A 1G4AE 2JEZA 1ZRNA 2VPWA 1O0BA 4JVNA 2JVKA 4HPWA 2R11A 4PPQA 5LNK1 4QBFA 2P9JA 4AJOA 2AR7A 4MYTA 4AJEA 2W8ZA 5K03A 1R4NA 4J3NA 5LP6B 1FQOA 2G80A 1WVMA 1BROA 3K0CA 3GLGA 2P4SA 5BNZA 2QSJA 1A9ZA 1YR8A 3NJRA 1WO8A 1Z33A 2IYUA 5C8DA 1Z0AA 5J5AA 1R12A 5KYNA 2DQKA 2XWSA 2ZUVA 2PSFA 3GXOA 3LQFA 4Q9AA 5ABPA 1F4PA 2X8JB 5L7TA 2VJYA 5JJ5A 3STHA 2W2NA 3G6KA 4KDRA 3SC6A 1EDDA 2ZJ4A 5FL7D 1UWVA 4QUBA 5IJXA 4Q9JA 1IQ0A 4LVCA 2FN4A 3A7EA 3GROA 1GHTA 4EB6B 3OJXA 3FVRA 1SXPA 3RASA 2C8JA 3FOBA 4PIMA 4AWXA 5JAZA 4ALLA 3S8MA 3IKLA 3C8ZA 1AK9A 5CDFE 4OL9A 2YHSA 3AKDA 2ZSEA 4JYAB 2BTEA 1R66A 1RI3A 4QEKA 4BNKA 3GEGA 4Q6WA 2JAQA 3NUZA 2QP4A 3HYTA 3MTIA 3NX4A 4I4TB 4WINA 1CEXA 1JEEA 4ZOQI 1HE8B 4YY3B 5AW1A 2WAOA 1TO1E 3PT9A 2FYTA 3P32A 1X7YA 5B3JA 4MS1B 3ENVA 4B80A 1G3RA 1UBFA 2FRXA 2RHMA 1SQGA 4F0JA 4Q48A 1Y5LA 3R5XA 3ZV6A 1EHIA 5E3IA 1TZJA 3KYCB 1PO7A 2WYWA 3H19A 1ISHA 4Z7JA 5C35A 3W8RA 2V3CC 4JR1A 3KKEA 4YGXB 1VPDA 1B8UA 2YR0A 4EI7A 1LK5A 3GT0A 2L82A 2WHYA 3USCS 2OORC 1ONSA 4F84A 1KKUA 2BKEA 3HDVA 3IPAA 3E3OA 5FB3A 1BCSA 2PA3A 3KB8A 1CWUA 4XVCA 4YRIA 2A67A 5C1DA 3MWEB 4PRZA 1W87A 3NXSA 4C3OB 3WGNA 1Y7LA 1Z75A 1J2YA 1TFRA 3LLVA 1HE2A 4B79A 1QTRA 2NV2B 2VOJA 2NSHA 3KZCA 3Q3VA 4MTCA 1YB2A 1QVWA 4E5VA 2DERA 1SWVA 2C4KA 1DRJA 3GYBA 3RSGA 3OOHA 2BFWA 1EM6A 2RBGA 4YCAA 5KVCA 1D6MA 2WTXA 3QSYA 3BH6A 3FFXA 4RMNA 4C6TB 1N0VC 3PD7A 1EP3B 2WIDA 2YZ7A 2P7HA 1OXBB 3B20A 1KYYA 2ZIWB 4G5GA 2HJWA 3BKXA 2ZGVA 4O4IF 4IRXA 5FKJA 5AHKA 5G53C 5CT4A 2R1TB 1T8UA 4GYKA 1W85B 1WNTA 3M9WA 5I9LA 5ENDA 3RQSA 4R1MA 2HLDD 4HDRB 1LNZA 3ZJ4A 2I6QA 2AS0A 2OO5A 3HNOA 2QTZA 4IKPA 2EZTA 3CF0A 1MAAA 4CFZA 2A4KA 2ZRGA 1SHUX 4QUJA 2FMUA 2XHEA 1OFHA 1F1JA 3TIGA 5ESWA 4J4HA 1OA0A 5AVUA 1JZTA 5DNVA 2CL5A 2ZBEA 3ZZNA 4AJLA 1AO0A 1E96A 1O94C 1Z0IA 2WAMA 2O23A 1TKAA 3KVRA 5DEIA 1A76A 3UTDA 2H0QA 2Y9PB 5JH7B 5IG2A 2EF0A 3QF4A 2BZ1A 1NBOA 1QH8A 2BZSA 3FHJA 3ZY3A 3TLMA 2BDUA 1G8GA 4DZRA 3T0IA 1Y1SA 2OZKA 3K70C 2V98A 3OMXA 5K4AA 5YASA 1E9FA 1QUEA 3LC2O 5HKKD 4ZALA 2GCNA 2OGUA 4V03A 3ZWOA 3I37X 1G7CA 4C7MA 4ENSA 5KOHA 5I48A 3LPDA 4HH3C 1WMDA 4MLPA 4A82A 1W0KA 3OLVA 3S2IA 3UQYS 3AVYA 2OLKA 4Q1EA 5AKYA 4II2A 4ZAFA 5TT1A 4XPIA 1XBTA 1JPNA 1VG1A 3Q4GA 1RKXA 3MHPA 1JZSA 4KE6A 4ND5A 4OHRA 4F45A 4J7XA 2VTKA 3ROEA 3RRZA 4LF6B 4CEJA 4IF4A 4XVUA 3D02A 4RORA 2FSUA 1YRWA 1ZI6A 1F4LA 2V7EA 5CH5A 3OOYA 1TEVA 4OJNA 2NSYA 5HQTA 4FILA 3O3CA 3BSWA 1K7XB 2P6PA 4GYJA 2ISCA 4I08A 4LKOA 4L8YA 1Q16A 4AJ4A 5H59A 1QP0A 3M5DA 2PS0A 4KGZA 3G0GA 5HFNA 5IH3A 5C4GB 1M34E 1HLFA 3WLQA 4NENB 4CKBA 3M2PA 1PD1A 1KO5A 2RGUA 2ZXEA 4JBWA 4DJEC 3FYSA 2YNMD 2GXAA 5DGDA 2WABA 4E5KA 2YWJA 3UWOA 2QJOA 3H3JA 3ZGVA 4C0KA 4ZK2A 1R10A 4TYNA 3KR2A 4S1PA 4YV0A 1I51A 5EIWA 5IAEA 4G0VA 1D07A 3TLBA 1XZQA 1U1FA 2HSJA 2XA9A 1K75A 3X1ZA 4ZODA 3AIKA 3IDAA 2HBYA 4JFRA 4ABYA 3AFHA 3HDHA 1LWOA 4KN9S 2HJGA 4F04A 5J1SB 2O8FB 3AGQA 1MB9A 1TUIA 3L4EA 5TQ0B 5UKDA 1NJFA 1Q6ZA 4Q93A 4REQA 5E4FA 4DLTA 5CFMA 3JR3A 2J9GA 3HMQA 3UTCA 3JQAA 4EATA 1YD7A 2P78A 3PGMA 3TCKA 5CFZA 3G02A 4IJKA 5K0TA 2WMNB 2XKKA 4RHUA 4P5DA 2PFGA 2MSLA 5BN4A 4JL6A 3L7DA 3KYDA 1HYHA 4U6NA 1FSZA 3SX2A 4NHOA 5KMGA 1G59A 2Q9UA 2XTJA 1N2OA 1X6VA 1J25A 3IUQA 4FN4A 3SKYA 3UHAA 3WGGA 4LJAA 3EC2A 1FFHA 4X45A 5JZBA 3AILA 3HR4A 4OI1A 1ONBA 2V6MA 2DBZA 1IM5A 3DZDA 3SHVA 6ABPA 4NDNE 2D5BA 5HS6A 4PO8A 2DXIA 4ZI2A 4PZUA 3DAGA 3WK7A 1RPTA 3B52X 2XUJA 4DV0B 4WK4B 3RYTC 3SYNA 4JVOA 1BKDR 2NUAB 3WKAA 4W5QA 3EXEB 4U2CA 3OKAA 1FRNA 3NB0A 3HVKA 3E4DA 4IF6A 1P7YA 4BY9E 4GMXA 4ZARA 5HKBA 2Q5QA 1P0MA 1V7ZA 5ICFA 2P4QA 2M1XA 5EJGA 4PX2A 4R2JA 4QX6A 3C5WP 4QAQA 4GRIA 3K8ZA 4KPEC 1EZZA 3E2PA 1HQCA 4WOCA 4GWGA 4JOSA 3M2TA 1H0SA 5DU2A 5EN4A 3FOEC 2Z6VA 1O8CA 4HEJA 3A4NA 4S0ZA 1OI4A 5ECYA 2YMMA 5ITSA 2XAUA 3KYJB 2V74B 3BE8A 3HUEA 3IIEA 3NC4A 2QL6A 1O0SA 3CVYA 4GOJA 1OLOA 3FUCA 2SECE 2WIKA 3EGWA 4MRVA 5EKUA 4K0KB 1SG9A 4XX0B 2C5SA 2A9PA 3C5CA 2V7GA 2EKZA 4ZQGA 4HATA 1X9HA 4R2KA 3RM3A 4CMEA 1AMNA 5BVGB 4YAOA 2XGGA 1OA1A 2IU6A 2XBUA 3FWKA 2HA0A 1W88A 3L5OA 3NASA 2RBEA 2WUWE 4G0OA 4LRYA 4ZIRA 3NEYA 4FK8A 5E3HA 1KY5A 1MB4A 3DE1X 4GI2A 4URYR 2ZVPX 3K8QA 1YOVA 3E82A 4E09A 4HFMA 3B8EA 4CMAA 1KXJA 2OUKA 4UUPA 5B1SA 4UEQA 1I9CA 2C92A 2MR5A 2MSKA 5T5QA 4V0RA 2PUBA 5CXQA 4ZFNA 1E18A 3DTTA 3QE2A 5MDHA 3VAAA 3GUHA 1T36A 2GCEA 4MTLA 5CLIA 3UF0A 1FXWF 4ZTBA 2ZVDA 4BQPA 1X3SA 3MLAA 4ODIA 2HMSA 1O87A 3BIOA 1EXWA 3DLAA 3QMMA 2WJ6A 2Q4RA 3W9YA 2DH5A 1OBOA 4M1TA 4PY2A 5LM3A 3D64A 3MUNA 3QKWA 3WL4A 3H42B 1PR9A 5IJ0B 2TMGA 3UH1A 2WHRA 5A3RA 2NUAA 3DWEX 3R3UA 4J0CA 2FR8C 4DIKA 4ZCPA 2KWIA 1TRKA 2KE5A 3QH4A 2QT1A 1X7YB 2XMSA 3A05A 5LZ5A 5ESDA 5GGXA 2V8OA 4YT4A 3CVXA 5AW0A 3UFXA 1YIOA 3OICA 5DLEA 1RQNA 3C0KA 2IQ5A 1JYEA 4OKIA 1G6Q1 1EX7A 4TQUS 1TVKB 4LNUA 2COKA 2NVUB 5M7EA 5KTSA 2HRCA 2VPXA 4OMUA 1XRRA 1T9CA 4KXLA 2QMEA 4TKZA 4FGWA 4IJQA 4MS4A 5KYXB 5ALXA 1Y63A 3IDOA 2GPSA 4TSKA 4KODA 1UXOA 5E6SB 4N7BA 3PKJA 1XX6A 4KXQA 1Q3HA 2I67A 3DOIA 3N5CA 3PYXA 3LLCA 4JP3A 4JI0B 4TVBA 2PX8A 1ISFA 4FHDA 5IZCA 3AR3A 4KAFA 4V0OA 1PGJA 4Y30A 3QLEA 4DRXB 2HA4A 4YUZA 2DZDA 1RBYA 4NBUA 4ZT4A 2G5PA 5EJ8A 3CZAA 1AQIA 3ZZUA 4GOMD 3IPCA 1NLZA 1PWEA 1EK1A 4J0HA 3C3EA 1C3XA 4H0CA 5C5IA 1KI4A 3G3EA 3JQDA 3QKSA 5AJZA 3SF8A 1A72A 5DDIP 5J59A 3PNQA 5L8VA 2O8EA 2W37A 3C6XA 4E07A 4ED9A 1E2UA 2B99A 5KYGA 2GZ1A 1DOZA 4NCNA 2BM8A 4IDDA 4QZVA 3VYTB 2QPOA 4JA2A 4NFSA 4EENA 3VSBA 4AY4A 5T4EA 3AETA 1QKIA 1JPVA 4KNVA 3LCMA 3FPJA 3QFCA 4MMXB 2IY9A 2REOA 1PZFA 3C3XA 4HWTA 4I2NA 4LVOA 4NMWA 4NH0A 4AKTA 2NXWA 4P3OA 2IYRA 4YFVA 4GI5A 3TD2A 2DFLA 1SCUA 4GICA 3V3TA 1W73A 1DAGA 2DEUA 3WIOA 5HX7A 3BMOB 1OJLA 5IBRA 1U6JA 4PV7A 1GKKA 3NDIA 2ZSAA 1NC3A 4FHCA 2AH5A 3USES 3ZWQA 1T1JA 1XDZA 3FNGA 1F5NA 3PGVA 2VK4A 3FOAA 1NULA 5ES3A 4Q6BA 5LNK6 4CIBA 3TI9A 3MLBA 1TM2A 3GXBA 3QEMA 3JQ7B 1EDOA 1HH4A 3DNMA 4QXQA 3T5GA 3L6UA 5GP1A 3RU9A 4DZZA 4JLUA 1I5RA 4M38A 4LZJA 3RJ9A 2Z5LA 4I36A 3IELA 1ESNA 4G4JA 3FMPB 4QIHA 2V7WA 3M5PA 3A2MA 4GOOD 4Z1MA 1Y42X 1Z4OA 2J45A 1YZ3A 2H3EA 1SIUA 2JIQA 1KC3A 2Q5LA 2V7XA 3EVAA 3LMKA 3OPQA 4RWEA 3HSSA 4BO0A 2GZMA 4PIPA 1FMJA 3RBXA 4KX3A 1TJPB 1N1EA 2FFJA 1T25A 5L9AA 1FPQA 1C3VA 3MMNA 2XDQA 1KSJA 1T26A 3N75A 3RFXA 5DN6D 5EVJA 4XD7D 4ZI7A 4MEJA 5ED0A 5IJWA 3LX5A 4KQGA 3ZU6A 5FCDA 4L9WA 4LS3A 5GONA 1JIQA 1UFRA 4M1QA 3ACCA 4HDSB 5AKHA 3LUGA 2EC5A 2GD6A 1IULA 2OM2A 3BDVA 5FAXA 1LH0A 3ME5A 2DBRA 8LDHA 4HNAB 3GLGB 1GTL1 1BDIA 1X87A 4FNAA 3K0EA 2Z4SA 1RXYA 3F5MA 2QLJA 1T8WA 4MW4A 1NHGA 1CJSA 1GZ4A 1YWGO 1CUSA 2VTDA 3B48A 4RETA 4W5WA 2HEGA 2DPXA 3NQ41 2P9HA 2EKLA 3ONFA 4PLWA 4C78A 5FLKA 5LQNA 4DUPA 3S8EA 4GKJB 1DVRA 3C5VA 1I4DD 1R4MA 1SG6A 1WP4A 4IS3A 3OFKA 2YHIA 1CEEA 1E2JA 4HNGA 1GKYA 2VT7A 2O2HA 1QHFA 3L79A 1NR1A 2HTEA 4QEDA 3TTYA 2VHUA 3ZD8A 4F9FA 1SCUB 2G9ZA 2FSGA 2X58A 1PCXA 3JQRA 4RLFA 4XGQA 1IYZA 4R9SA 1VJ5A 2D0OB 1MVOA 3WO1A 4CV3A 4HNTA 3UMFA 2OV8A 3H11B 1CYDA 1GNVA 1B8OA 3O8DA 2G9NA 1YDMA 3WA6A 4EF6A 1PL0A 4FKMA 1BX3A 1KY3A 1U7WA 1A9OA 1KQOA 1V3VA 3KEOA 3I53A 3ZLUA 4Z8XA 1PJ4A 3VKFA 3PXCX 2ZBRA 5DFAA 1L3CA 3OIGA