4NR0A

Crystal structure of the pseudomonas aeruginosa enoyl-acyl carrier protein reductase (fabi) in complex with nad+ and triclosan
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
259
structure length
259
Chain Sequence
GFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPELCFPCDVADDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRNVTIEEVGNAGAFLCSDLASGISGEILYVDGGFNTTAMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of Pseudomonas aeruginosa Enoyl-ACP Reductase (FabI) in the Presence and Absence of NAD+ and Triclosan
doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
total genus 90
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nr0A00
3GFGA 5LDGA 4J1SA 5J23A 3HE3A 3NX4A 1AXEA 3IOYA 3O4RA 1KEVA 1P1HA 4J7XA 4LSMA 5JCJA 5A03A 5FEUA 2YJZA 2EKPA 4OXYA 5BSGA 5JY1A 3GDOA 2QYTA 3W4IA 4DA9A 3S55A 1B3RA 3D3EA 2IE0A 3DTYA 4EI2A 1O6ZA 1S6YA 1H6DA 4YJFA 5EIOA 5JDIA 4NDNE 2NU7A 3ONFA 3QQPA 1ULSA 4R54A 2BH9A 3B1KA 3DZJA 2ZTLA 3KEOA 4NBWA 2A94A 3I3OA 5CFZA 3E82A 2ZCVA 5L7WA 3V1UA 2X23A 1F0YA 5FF9A 4ZU3A 1ML3A 1UDCA 3PFWO 5F3RA 4TKLA 1MXHA 3KUXA 1QLJA 2ZK7A 4KWIA 1LX6A 5DF1A 2P9EA 4IINA 2YDYA 2IYOA 4MINA 3Q9NA 2YUTA 3DZBA 1M75A 3EVTA 3BHMA 3H2ZA 4MKZA 3H9GA 1S7CA 1IULA 3ZNNA 1IY8A 4ONEA 3K5PA 1TT5B 5T57A 1P0FA 3I9NA 3DOJA 4PLWA 4OL9A 1MFPA 3NJ8A 5JW6A 5AOVA 1U4SA 1ZUD1 5DCYA 4TVBA 5CPFA 3DQPA 2C5AA 2I3AA 3ENNA 4MVJI 3RIHA 3R0IA 4K6FA 4Q3DA 1I32A 5IDXA 5H81A 3WXBA 1NQ5A 3DR3A 1PEDA 2V6GA 3G17A 4R51A 5DP1A 4YAIA 5IZ4A 1PS0A 3FN4A 3VPFA 2YZ7A 4IPTA 1U3WA 1M2WA 2AXQA 3WNQA 2YQ5A 1KC3A 4TRJA 2G1UA 3DB2A 3GUYA 3PVZA 3QIVA 4D42A 2UYYA 4YQYA 2C59A 3VC7A 4JQCA 1E3SA 3OQ1A 1WDKA 2B4TO 2V7PA 2WSBA 1V8BA 1VRWA 4CQMD 2NTNA 3QP9A 3KM0A 2SCUA 2WMDA 4IY1A 3OJEA 4WNIA 4DIOA 8LDHA 4BQPA 2PA3A 4PG8A 4WLNA 1JVSA 4UREA 4TRRA 3S2GA 1DHRA 2E37A 4AJ1A 4E5YA 2X0JA 1DB3A 2Q1SA 2BGLA 1F14A 1CEQA 1ZNQO 4N5MA 4P4NA 3PEFA 3RI3A 4AL4A 4B4VA 1VSVA 3MOIA 2WYVA 3G1UA 5COQA 1MC5A 1T1RA 5LC1A 4FPXA 2UUPA 5HS4A 4MKRA 1EVYA 3ZN2A 3KYCB 1E5QA 2VWPA 1V3TA 2YQ4A 3EYWA 3PXXA 3UGKA 3CKYA 3F5QA 1YE3A 2HMUA 1W6UA 1LDEA 1T25A 3E48A 4RVDA 5DOZA 5TJ9A 3TFQA 2Y67A 5IJZA 1I5RA 3QVWA 3Q2IA 4RORA 2D8AA 2FMUA 3Q11A 1ARZA 4O0LA 1X7DA 1PR9A 3GZNB 4IGFA 2I67A 2GN9A 1V3VA 2JCYA 4BO3A 1D8AA 1XGKA 2DTEA 2YDXA 3OICA 3U4DA 5KVSA 4E31A 4R3NA 2X7HA 4XEHA 3RUHA 3JD1A 3G0OA 4A73A 1HDZA 4E6PA 2B0JA 1C1XB 3SEFA 2WDZA 1PU2A 2E82A 2B4RO 3HSKA 4BV9A 2C7VA 3ASUA 4XDYA 1JKJA 1X1TA 1YB4A 3LC7O 1ZFNA 1H2BA 4HNGA 3LF2A 1D4FA 3HB5X 4WCFC 4DVJA 1YH3A 1JAXA 2PD6A 4J9VA 2HJRA 3C1AA 1MA0A 3DBRA 2AEJA 5IZCA 1ZW1A 2WM3A 3FTNA 4IQ0A 2VUUA 1GY8A 4CM7A 1DPGA 5L4LA 1LTHR 1ISGA 3QVTA 3WBBA 1E1MA 1DC6A 3ZHBA 5K6AA 2HDHA 1UDBA 3EW7A 4JLWA 5B37A 4ESOA 1HDOA 2P4QA 1BMDA 1QYCA 3GFBA 3CZRA 4PLHA 4XX0A 6LDHA 4F46A 3GPIA 1P45A 4FFPA 4ND2A 3R1IA 4QSMA 5JY6A 3FI9A 4PGFA 3L6DA 4Q3CA 2PZKA 3DZIA 1U7HA 3C85A 2JL1A 1E7YA 4WE3A 4MKXA 2Y0EA 3TN7A 4CV1A 3FD8A 3PTZA 1B8VA 1MUUA 1SOWA 1M6WA 3O9ZA 5CPBA 1EQ2A 3U49A 4II3A 2H1SA 1ZVMA 3OJOA 1A71A 4L4XA 4WLOA 4IXTA 5G4KA 5T8KC 2HRBA 3DMTA 1UXGA 2ZKLA 4JN6B 3KTDA 3KXDA 2A4KA 5CG1A 4DGSA 2GSDA 1PGPA 5CHEA 4L76A 4R41A 2LDXA 4J0EA 4PLTA 4CQMA 3VH1A 2HUNA 3SLKA 1DLJA 3UF0A 2VYND 2J5RA 5IN5A 3DHYA 3F46A 3SX2A 1TA4A 3GGOA 4CM1A 4XJSA 3GDFA 4IQGA 3U62A 1PTJA 1ISMA 3N58A 1PQUA 4JJFA 3PWZA 4FW8A 3PPIA 1QLHA 3WGYA 3D5TA 4JP3A 5L40A 1P1KA 4Q3NA 2BLLA 1ZH8A 2EKLA 2GN4A 2EKQA 2Q99A 2X8LA 4RDIA 3TZCA 2EW2A 4ZD6A 1GYQA 4RF2A 1UZMA 1YB1A 1ZK0A 1H0KA 1LUAA 1PZEA 3ZV6A 1HYEA 3GH3A 3JQGB 4YJHA 3ETGA 2VZ9A 3AM3A 1CF2O 2Q1WA 5DDIP 1U8FO 2OO5A 4U5QA 4P8RA 2JHGA 2OHXA 4JX8A 2V6BA 4YWJA 5A06A 1ZJZA 2VRBA 3WGIA 5TX7A 4EW6A 5CEJA 4ND1A 1T2AA 4PLVA 3NJ4A 2CZCA 3PHLA 2AE1A 2EGGA 4ND3A 4MIOA 4CLRA 4P4LA 3L0DA 5T67A 3ROMA 4CMIA 2R2GA 4CL8A 3H9JA 1K6XA 2FRDA 1C0KA 1FDTA 4BQRA 1MXFA 3LSYA 3HDQA 4RQUA 2VT2A 3AOEA 4UVEA 4JCOA 4AFNA 3UVEA 3CZMA 1TEHA 2QYSA 3ZHZA 2PH5A 3UOGA 4BO9A 3LDHA 4ALMA 1PZHA 4NK5A 2R00C 5JXWA 1BG6A 4XDZA 3GHYA 1HE4A 1LLUA 3FNEA 4NFHA 1YKFA 4FOOA 5A4DA 1N7GA 3QWBA 4ZQHA 1ZKMA 1PJBA 3ZWWA 1RM5A 3MCVA 3LT1A 2AA3A 3WJAA 1D1TA 2BGKA 4WLUA 5JDCA 3GRKA 2VQ3A 2QX7A 1K89A 3FWZA 1YL6A 5U1PA 3BMQA 4GI2A 2I9PA 1I36A 3E1KA 1ZEMA 1CWUA 4CMIB 5CG2A 4CLEA 2E4AA 3FBGA 4RVGA 2DM6A 4J6FA 3GZ4A 3W4JA 3ZGYA 2VYNA 4YT5A 3GC6A 4GMGA 4GAEA 1RJWA 3ICPA 3GVCA 1QKIA 2VNSA 4B8ZA 2OBNA 3JQ7B 1YO6A 1A7AA 3TL2A 1HL3A 4UVDA 2C07A 2X9GA 3BMNB 2EJWA 2IYPA 5COBA 3RKRA 4ZGWA 1IOLA 2VRCA 3L07A 1PJSA 1V35A 4DIBA 4J3FA 2NTVA 1UZLA 4IIVA 4FSHA 1H9BA 3RAJA 3RSHA 1LU9A 1ONPA 2ZB8A 3JQ9A 3HJAA 3WQQA 2JJYA 4ZQGA 5TS3A 1SMKA 5KJCA 1HZJA 3C1OA 4O63O 2DBVO 1HRDA 3TL3A 4G81A 1DO8A 2FR8A 3GPDG 4D0RA 4JGBA 4LSWA 3WX0A 1EMDA 3SLGA 4OMUA 1ZEJA 4HADA 1YB5A 3UN1A 2G82A 4XYEA 1EE2A 1H93A 4ALNA 4D46A 4EDFA 5ER9A 3WTBA 1BWSA 1HDYA 4Z9YA 1Z45A 1N92A 2Q4BA 3JSAA 4RVFA 4CUJA 4P22A 5F1KA 5EN4A 3HWRA 2O3JA 4D3FA 2TMGA 4AJ4A 3VPXA 3K6JA 2HKIA 2O7QA 2X4GA 4WCDA 4AICA 4CQMB 2IXAA 3ETEA 1E0DA 1DHTA 3Q6IA 1WZEA 1GD1O 4LVUA 2B5VA 1GTMA 2I65A 9LDBA 1O0SA 1EVZA 2J3HA 2ZB3A 5KNLA 1KVTA 4QUKA 5LCXA 1DIAA 2X6TA 4PG5A 4YJDA 2P4HX 3DBHA 3PZBA 3PP8A 1J49A 4BKOA 4BO0A 1FJHA 1JTVA 2P2SA 1Q2XA 3RUCA 2D4AA 1DFHA 4WOJA 5ICMA 2CVQA 1JQBA 3GNTA 4WLVA 4BO1A 4IZHA 2Q2WA 2XXBA 3QWFA 3UXYA 5JMWA 1IYZA 1ONNA 4I08A 4Q9NA 1JVBA 4YXFA 4K6CA 4YDRA 4W7HA 3JYOA 3BMNA 2DVMA 2W98A 3LC1O 3BTOA 3RJ9A 1CJCA 1B7GO 4BNIA 1GDHA 5JE8A 1ZK3A 3D4PA 4N5NA 4UEJA 4B7XA 1O89A 3UCEA 2WD7A 4C7JA 4PZEA 2WYUA 3K8ZA 4L0QA 4A2CA 5B4UA 1DJQA 1FDSA 5T5QA 4U6QA 3RBXA 4G65A 5HRUA 4UVHA 5L9AA 2P9CA 4DPMA 2YW9A 1MGOA 1NFQA 1C1XA 4K1LA 1I30A 3GQVA 4CUKA 1Z7EA 3TOZA 2YV3A 1YBMA 4BMNA 5KVVA 3DHEA 5G0WA 1UP4A 2GPTA 2FPGA 1ZMOA 3V1TC 2DC1A 3WSWA 1YXMA 4L8VA 3AWDA 3I9LA 3MJ4A 4PZDA 3IP3A 3EGOA 3OIFA 2AEFA 4OQZA 4RPGA 4ZRMA 3MJCA 2OMEA 1XU7A 2I3GA 3AFNA 3HDYA 2BRUA 1U3TA 2Z95A 3K73O 3NGXA 4GLOA 1NFRA 1ZXBA 2OORA 3AUAA 2OFPA 3EDMA 2Q46A 4D3SA 5TGDA 1YBAA 1Y8QB 2QG4A 3U9LA 1P33A 1ZCJA 5KKAA 1IZ0A 4MOWA 4J2OA 2I5PO 4QXMA 1K5HA 3H9QA 1GZ6A 4CMKA 2NWQA 4QX6A 3IUSA 2RHRA 5IG2A 2E48A 3KVOA 2VOJA 2O3RA 1GZ3A 4NJOA 3H8VA 4YPOA 4XB1A 1BW9A 2P9GA 3HUDA 3EVNA 4ZHSA 1N2SA 2W4QA 1VL8A 3GDGA 1Q7GA 1PSDA 3KSZO 5DBGA 4XQCA 3ZDFA 3GMSA 1E3WA 2NU6A 3LYLA 5EESA 3OQBA 4LCJA 1I3MA 1YQGA 1NBOA 3VZQA 3TWOA 1E1NA 4ROSA 4QEDA 3RC2A 4XD2A 4YRBA 5DULA 4OXKA 2Q1TA 3K31A 3ZW9A 3PI7A 3DOCA 3GG9A 3QWHA 2RIRA 4TVOA 3DZHA 4F45A 3I9JA 1YS4A 3F4BA 1OFGA 3VH4A 4W4TA 1FDUA 1LSOA 3BTSA 3IJPA 3INRA 4H7PA 4XR4A 3WYEA 1J6UA 4DC0A 3GEGA 2C29D 3MJVA 4NHEA 5AXDA 4EUFA 1K2WA 4FGWA 4CLDA 3C7AA 3K2EA 2Y68A 4IDAA 1BXZA 2Q2QA 4RL6A 3ZV4A 4E33A 3LVFO 1KBZA 2NU9A 3PK0A 3B1JA 1QORA 5HM8A 3ZWAA 2YV1A 1O8CA 3CPSA 3KSDO 1C1DA 4CLXA 5AXAA 2NQ8A 4R16A 1M6HA 3FR7A 4GX5A 3FR8A 1DBVO 2WEKA 4CLHA 2NVBA 2OUIA 2VZ0A 3M2PA 2HJSA 1YGYA 4BNLA 2YHIA 2AW5A 1LA2A 4RDHA 3H9EO 2A35A 3TZ6A 3GNSA 4WLFA 1TB4A 5I8WA 3EC7A 3G49A 2O3TA 4M8SA 1DIRA 4P38A 2VWHA 3SC4A 3QLJA 1B26A 4MVJH 1N8KA 4R1NA 1MP0A 3V2HA 5HS6A 3TZQA 3PGXA 1NAIA 1WLYA 4N18A 2X9VA 4CLOB 1YQDA 1KVQA 1WMBA 3B70A 3LLSA 1F8FA 1GAEO 1EE9A 3WFIA 4ID9A 2VNAA 3JQ7A 3PJGA 1CYDA 4RZHA 2IEDA 1WPQA 5FWNA 1TT5A 3GEMA 1XCBA 3DTTA 2A92A 4JJIA 4OOEA 1HE2A 4CMBA 3JQDA 1Q1NA 1GCOA 2JCVA 2EJVA 3BTVA 2EEZA 4DLLA 4A27A 4E5NA 5L4SA 4Z9FA 2Y05A 1I24A 5B4TA 3I4FA 3GR6A 3S8MA 1Y81A 2AE2A 4TMFA 4R9RA 4YBZA 4XGKA 1QRRA 1I0ZA 1KYQA 3KYDB 1DRWA 1FDWA 4RCVA 1DAPA 2CFCA 1XQ1A 3TPCA 2JAPA 4N7RA 1I2CA 3AU9A 4WCFB 3L4BA 4E13A 3SJUA 4WCFA 3BHIA 5B1YA 1JKIA 3NTRA 4OHUA 4XYGA 2VHVA 1CIVA 4L74A 4XJTA 3CXRA 4M86A 4EEXA 3CE6A 2Y1GA 1T2FA 4FC7A 3C1TA 3QRWA 4PIVA 1E7QA 2C20A 2QHXA 1PJLA 2VYVD 4CLRB 3QY9A 5DZSA 5JYEA 1SOVA 3OJLA 1L7EA 3GVXA 5K6AC 4DC1A 4H3VA 5FI5A 3B1FA 1NQAO 3ZWYA 4B7CA 2NQTA 4J0FA 2CVOA 2PD4A 1Y8RA 3H5NA 3JYNA 4CM9D 5A02A 2P68A 4NIMA 5DOVA 1GQQA 1C0IA 2BI8A 5L51A 1BDBA 3IQDB 1LC3A 4CM8A 1LSUA 5HWSA 1EUDA 2F1KA 1PJCA 3AK4A 4LVCA 3RASA 1L7DA 3X2EA 4MIYA 4XQ9A 4YQZA 5TLSA 2Y1DA 3WS7A 1GYPA 3BTUA 3WYBA 1NHWA 4UULA 3WWZA 4I9HA 1IE3A 1EK5A 3D5QA 3AOEC 4BUCA 2P5YA 4GH5A 4E0BA 4PLPA 3GRPA 4PLGA 3TOXA 3DBHB 4S1VA 2RH4A 1QG6A 5F1OA 4BKQA 3K92A 5A9TA 1ZJYA 1PWZA 1LDYA 1IHXA 4XQGA 1I01A 1RPNA 4FFOA 4WK6A 4BO4A 1M67A 4XQEA 4UVGA 5TT1A 2P91A 1UZNA 1SB9A 4MPDA 2I76A 1P44A 4NR0A 1R6DA 4PFJA 2ILTA 4HFNA 5A1TA 5CDTA 4L9RA 5A3JA 3O03A 1O95A 2HU2A 1C14A 4B7UA 4OGWA 2R00A 3ADPA 3QWAA 5GZ3A 1I2ZA 3FRJA 4BNXA 1LEHA 3VOSA 5L7YA 3RC1A 1BW9B 5ITWA 4YTEA 1GV0A 3ZV3A 4BB6A 2NVUA 1Q0QA 1HDGO 1VL6A 4DREA 4DQXA 1XEAA 2GZ1A 3CMMA 2HSDA 4IXWA 1R4NA 1GCUA 4NBUA 4U8GA 5KOIA 5JDCC 5THQA 4J1NA 4ZRNA 1E92A 3LZ6A 2CMDA 4B4UA 3OECA 4KTVE 4O1MA 2X22A 2VOEA 4OKIA 1DIGA 2GO1A 1O5IA 4MP8A 2QW8A 1A9YA 3ORFA 3UFXA 3D7LA 4HWKA 3G79A 3NEPX 4YRAA 4URFA 4U7WA 4XA8A 4E5KA 1O9BA 1HYGA 4W6ZA 5COAA 1Y6JA 3V5NA 3GGPA 4HXYA 4QQRA 4NPCA 1DC3A 3TSCA 1RM4A 3RUAA 5T64A 2ZJ0A 4DMMA 1VPDA 1X13A 4KMSA 3VPGA 1Z7BA 4CUZA 3K2BA 1WWKA 3ZWOA 1P9LA 3ZNPA 4FGSA 4OO3A 3WIEA 3OHSX 3RUEA 3DWFA 4RF3A 4HP8A 4E2ZA 4AJHA 2O4CA 1PGOA 4YAEA 1YJ8A 4DBZA 1R0SA 4BNMA 4E2YA 3WQRA 5IAAA 1HZZA 1JWBB 4RO0A 3ENKA 1ID1A 1LRJA 4FD3A 2AQ8A 5C3MA 3TFOA 3H5AA 1A72A 4FS3A 2YFQA 2LDBA 3PIDA 4UEKA 2IEBA 4BNJA 4E3ZA 3L9XA 5L53A 1GADO 1KEUA 2YYYA 3JV7A 2VZ8A 3VKUA 4LN1A 2EP7A 2PZLA 3DO5A 1NNUA 2W2LD 1GL3A 1DRVA 3HN7A 4R3WA 1L1FA 1XG5A 3AJRA 1G0NA 1C0PA 2GLXA 4R4JA 5H83A 2FN7A 3N74A 5TC4A 1WVGA 4CV3A 1LDBA 2AG8A 3RD5A 1DSSG 2ZIZA 3PRJA 4XRRA 1V9LA 4NU5A 2X5JO 4ALJA 1LXCA 4Q3BA 1LNQA 3VPHA 1KVRA 5JLAA 1MFZA 1YL5A 3MEQA 2Y99A 1P1IA 2PK3A 4RVUA 3IKVA 5CAEA 4WEQA 4BV8A 1XHLA 3JQEA 2ZYDA 4C4OA 4RPJA 3SXPA 1PS9A 4B4OA 2O50A 3RROA 1EFKA 1KEPA 1T2DA 4ZA2A 4GWGA 4KDEA 5HBRA 3W6ZA 1AHHA 1HYHA 2E6UX 2ZYGA 3VH2A 1PQPA 4OSOA 4NZ9A 1M66A 1NPYA 3GNQA 4GBJA 2FOIA 4HBGA 4I5GA 3CSDA 3ZI0A 2DPHA 3QHAA 1AGNA 2PZJA 1UDAA 3PHGA 4KUGA 4AJEA 3HFGA 3U5TA 1NQTA 1RYDA 2RHCA 1H6CA 2OXIA 2X0NA 2HK8A 3F1KA 3L77A 2UV8A 1PQWA 2HMSA 3JQBC 5T6BA 4DUPA 4EEZA 2ZATA 4J4TA 2D2IA 4JNKA 2ZQZA 4EGFA 1RKXA 4A10A 1HSOA 3ONDA 1PGNA 1YOVB 5G0SA 3ZU2A 4XYMA 1QSGA 1R0KA 8ADHA 1IUKA 1XU9A 3VPSA 3C24A 1FDVA 1Y5MA 3BMQB 3NDRA 4UVIA 3LT0A 4YAKA 1KETA 2DT5A 1PJ2A 3NT5A 4UUOA 4LISA 5CDYA 4IJKA 5C7LO 5L95A 3P7MA 1ZK1A 5TSDA 3EHEA 3D3WB 2XOXA 4CR7A 4QO8A 2Y0CA 2XXJA 4IDGA 3I9MA 3I6IA 3JTMA 4ZQFA 5JC8A 3IMFA 3OIGA 3VTFA 3E6AA 1DLIA 4S3MA 4PLCA 2DUUA 5LDHA 1D7OA 4D45A 1EDOA 1LLQA 1UP7A 2EGHA 2IODA 1T24A 2PLAA 3DXFA 3WBFA 3RFTA 3JQAB 4FFMA 2PD3A 4RVHA 5A9SA 1E1LA 4UUMA 3D3WA 5G2OA 2NLOA 3E9NA 3WWYA 2C2YA 1ZSYA 5BNIA 3PQDA 2OP1A 4Y98A 4BKUA 2FSSA 3PHIA 4HV4A 2GZ2A 3KOUA 4F6CA 4YT2A 1T2CA 1ULUA 5A5EA 4BNUA 1H94A 5CEFA 1HDRA 2YV2A 2DQ4A 1LQTA 2ZYAA 2GASA 4FC6A 2BFAA 1HKUA 3OSUA 3UCFA 1U2DA 1MB4A 3MJTA 4NBVA 4TZTA 5IXYA 5CDSA 1PR3A 1UUFA 2NV6A 1EEHA 4J4BA 2B69A 2B5WA 4DQUA 4Y9DA 3PWSA 1LDMA 4FFLA 2CF5A 3CMCO 1KVUA 4E5MA 3JCZA 1I2BA 4YCAA 5C7OO 4HUJA 4BO6A 4IBOA 1R4NB 2VT3A 2XPCA 2V6MA 4CQLB 1EUCA 4ND5A 2QRKA 3KYCA 3H2SA 3GN2A 3HB4X 3WOHA 3FHLA 5IXSA 5I9MA 3AY7A 1E3JA 4NU6A 4CJXA 3PZRA 1P74A 3ST7A 4BGEA 1Y1PA 3P19A 4TSKA 4CR8A 4B3JA 5I7SA 1QP8A 3ON5A 1ONOA 1PL7A 4GSKA 1TT7A 4Z0HO 3ZWCA 3SJ7A 2X5OA 1F12A 1IPFA 5I7EA 3ZWBA 4BNKA 2RH8A 4OQYA 4WUVA 1R4MB 3ZZNA 2VTEA 4FBGA 2VUSA 3WSVA 5TNXA 4KDFA 4BOYA 3L4BC 4X54A 1JWAB 4CM4B 1X0XA 3R3SA 2DPGA 2JFHA 2WTBA 2O3SA 3K96A 4R69A 1GPJA 1QMGA 3TNLA 2G5CA 2JFFA 4CMHA 5B12A 1X14A 2CSUA 3NV9A 3ZHYA 2FSVA 5JAMA 2GZ3A 2NACA 4I5FA 4IJUA 1NHGA 3RU9A 3STHA 3EZLA 2J6IA 1PZFA 2O48X 4K9DA 1Z73A 3ZWMA 1DFGA 1MG5A 4BNZA 3GVHA 4CMAA 4PVCA 3TF5A 4QTZA 3ZWXA 3WG9A 4D7AA 3O26A 1XR3A 1Y8QA 4HFMA 2QZ9A 1DFIA 4G2NA 1ZK4A 3ZV5A 4UUPA 2Z1MA 1B14A 3Q3CA 4BS9A 3WTCA 4AJOA 4F6LA 4IQ8A 4Z0PA 3JQ6A 2VWGA 2RAFA 3ICCA 2AQHA 1KC1A 1I10A 2GERA 2FPPA 2X0IA 5L4NA 2HO5A 2CF6A 4DRYA 1GFSA 3FPLA 3F6YA 3LC2O 5ILOA 2ZCUA 3UCXA 2Q50A 3DAFA 4XYLA 1SC6A 3AM4A 1AE1A 5JDIC 1T2EA 2FZWA 1SEPA 2B83A 4F3YA 2W90A 1UXHA 2P5UA 2ZTVA 3OEWA 2BFPA 3PQFA 4K28A 3VZPA 1K3TA 4KUEA 4Y6PA 3RBZA 3JQBA 3JD0A 1YWGO 2DBRA 2XAAA 5JNLA 2JD0A 1E6EA 1QYWA 2WD7B 3S2FA 4GSLA 4I9UA 4GX2A 3T4EA 1XIVA 3P2YA 4XWYA 4UAGA 4XYBA 3EMKA 1EDZA 3QVSA 1PGJA 5JCJD 1W0CA 1HWYA 2NADA 1EQUA 3ETDA 4HNHA 3NTQA 4PG7A 2BKAA 4JP2A 4FFRA 3UHAA 3MTGA 3PLNA 4IJWA 1B2LA 4BL5A 4GKVA 5BSEA 5HTOA 1NAHA 3RUIA 3LLVA 2O7SA 3I4CA 2Q4EA 4BGVA 4A5OA 1E5LA 1LC0A 3BAZA 5FYDA 5BT9A 2B35A 4TRNA 3TQHA 4CLOA 1R12A 4J43A 3PFFA 4J2HA 4YACA 3VVCA 5JAQA 5JSFA 4XCVA 1EVIA 1FMCA 1D1SA 1R37A 2Y1OA 1GEGA 3BMOB 1QYXA 2Z5LA 1OC4A 2BF7A 1LSJA 3AY3A 4TQGA 4XZ3A 1NPTO 1W8DA 2XF8A 5G4LA 3U4HA 2BD0A 2PGLA 4DIFA 1XYGA 1EFLA 1U2GA 1AHIA 1HDCA 1SO8A 2Y0DA 4NNJA 1C1DB 2GR9A 3EY4A 3OF2A 1R0LA 1DC5A 4OH1A 3JYLA 3I6QA 3OEYA 2QQ5A 1OOEA 4J49A 3PDJA 3OIDA 2CD9A 2EF1A 4DXHA 3WLFA 2NSDA 5JMPA 5U9CA 1ZSVA 2DTXA 2H5LA 5B4VA 1U3UA 1MC4A 2PKRA 4BO7A 2JKVA 7MDHA 4DBVO 2FP4A 2VHYA 3IP1A 2GCGA 4J90A 3HADA 4M87A 2IDZA 3MJSA 3WLEA 3DDNA 3V1YA 1SNYA 1U4OA 3GN1A 1GV1A 2WWRA 4GMFA 3OMLA 3Q2KA 4Q3EA 2V6FA 5JC1A 1UH5A 4II2A 5DCWA 3N7UA 4WASA 4XKJA 3RC7A 4Y67A 4GGOA 3RWBA 5BQFA 1ADCA 3GMDA 2GD1O 4IDEA 3D1LA 3C8MA 1U7TA 3HFSA 2DAPA 4MVJF 2W2KB 2WE8A 3RVDA 3GEDA 3CINA 4J1QA 1OI7A 1LLCA 5IFLA 3KHUA 1F17A 3IS3A 1F8GA 1E3WB 3NT2A 1G1AA 3JQ9C 1Y8RB 4WOKA 1H2HA 3PLRA 5JO0A 1PIWA 4ND4A 3VTZA 3MOGA 3OFSA 3F4LA 4IM7A 3VH3A 1RM3A 4NFYA 3GVIA 3WIDA 5KJ1A 3I52A 2IZ0A 3C3XA 3E18A 2C5EA 1EUZA 1NVMB 4YAGA 2BFMA 3TZKA 4BNNA 3I23A 4AJNA 4BGUA 4Q3AA 4DPLA 3VAZA 4IUYA 4GL4A 2POQX 3BYZA 2OGUA 1TI7A 1W73A 3A4VA 4RF5A 1CRWG 2I99A 3M6IA 4RLSA 3E5MA 5KIAA 4Y6RA 3A14A 4CMCA 3EZYA 2F00A 3TZHA 5DBIA 1UAYA 1BRMA 4MIEA 1SZJG 5K9ZA 1ISJA 1GZ4A 1ADBA 2VN8A 1NVGA 3KB6A 1FK8A 2CY0A 2JAHA 1SCUA 4QFDA 4RJTA 2O2YA 1NM5A 4YVFA 1IHYA 2AQKA 1H6AA 5JS6A 5KJFA 4WJZA 3OH8A 1NVTA 3FCOA 3JQ8B 4R9SA 4EBFA 1U5CA 2HMWA 4XGNA 5F5NA 1AXGA 1LSSA 2QZZA 3NUGA 1I8TA 1Q7CA 1RWBA 3Q9UA 1KY4A 4W9NC 3MZ0A 3BMCA 1E3LA 3LQFA 1UXJA 4WEOA 3GZNA 2PKQP 1N9GB 1DJNA 3PJDA 3ANLA 4JJGA 2AMFA 3WGGA 2BI7A 4YJHB 1YVEI 1YONA 2J5QA 1LLDA 4LMRA 1VM6A 3S2EA 3OETA 2D59A 3F3SA 3DC2A 4GLLA 1WP4A 4YA6A 2GN6A 1BXKA 1UR5A 3S2IA 5GZ1A 3MWEB 3OJFA 4GVXA 3PYLA 2C2XA 5CDUA 3DHNA 4PCVA 2E49A 3I1JA 3A1NA 4I8XA 4L4RA 1LBEA 3I9OA 1OC2A 1N1GA 3FWNA 4BO5A 4AG3A 1MX3A 3HNPA 4OAQA 1IL0A 1ORRA 1ENOA 4J1TA 5F1PA 2HAEA 2GN8A 4PG6A 4AJJA 3P2OA 3L6OO 5AXCA 4NI5A 1P1FA 2NVUB 1ENYA 1U28A 4EJ6A 5AQ1A 3H9UA 5GY7A 4XGIA 3CH6A 1R4MA 5EQFA 2CDBA 1PL6A 1SAYA 4YJGA 3U4IA 4ZQBA 5JCXA 4CM4A 1JW9B 3FNFA 4L4SA 1C3VA 3JQAD 2EWMA 3DEYX 4O59O 3TRIA 4UUNA 2C82A 5ENDA 4FDAA 1J0XO 4PRKA 1JAYA 1XWFA 4HFJA 4I9NA 4QECA 2GDZA 1NX6A 4LRTB 5CP8A 3AUUA 1EBUA 4MJLA 4UEOA 4YJGB 4A03A 3I5MA 4RLHA 4MP6A 1R66A 3KO8A 1NR1A 1V0JA 1PJ3A 3R6DA 1K6JA 4XIJA 1E7SA 5ILGA 3RC9A 5JYDA 3E03A 4RQTA 2CUKA 4CR6A 4BVAA 4M89A 2PR2A 3JQFC 4KQWA 3AM5A 3D4NA 4MVJM 3MWDB 4IDBA 4XIYA 1C0LA 3ZNQA 1P1JA 2EXXA 4CQLA 2FHSA 2R6JA 5IZCC 3KRTA 4PG4A 3ASVA 2FZEA 3HQ4O 3A9WA 4BHTA 4LRSB 4IMRA 3WR5A 4HKTA 1J4AA 2A9FA 4YAJA 3RBVA 4TZKA 1ZBQA 4RPHA 3JYPA 4M55A 4N54A 5EINA 1EBFA 4MVJE 3GAFA 2O3UA 3DBRB 3GY0A 4WLEA 1JKFA 3P5SA 2EERA 1NP3A 3IUPA 3PYMA 1Q0LA 3PQEA 4IDFA 2Q45A 1KOLA 1WNTA 2B37A 1DIHA 3HN2A 3R3JA 2B36A 4BNWA 3GVPA 3WGTA 3NTOA 3JQ8A 3GA0A 1DOHA 1RYEA 3VHRA 1LDGA 1RM0A 2HCTA 2H9IA 1WW8A 3FPCA 1ADFA 4E30A 3U0BA 3IDSA 2VHXA 4OKNA 5ER6A 3WGOA 9LDTA 1PJTA 3AI1A 3PJFA 5A9SB 3JQAA 1NWHA 2UVDA 2NUAA 2NU8A 2DKNA 4M1QA 3Q1LA 4CM3A 3GGGA 4LMPA 2Q3EA 2D0IA 3F47A 3DONA 5FI3A 4AJLA 4P4GA 1ADGA 1VL0A 3RU7A 1U9JA 4D3DA 5ENVA 4FQ8A 3VDRA 3DBLA 3GT0A 2G76A 1ISFA 1JU9A 2OL4A 3AY6A 4Y8VA 3WMWA 4FJ2A 3IAHA 2ZQYA 3GK3A 1XQ6A 3RCBA 4GX1A 3LT4A 1HTBA 1HT0A 3K9QO 3HG7A 4B4WA 2C7GA 3ZHXA 2GYYA 2Q1UA 2VYVA 4Y6SA 2BGMA 5KVCA 1XDWA 3KETA 2X0RA 1U8XX 4JBHA 5TIIA 4E21A 1EK6A 1TXGA 7ADHA 3RKUA 3O38A 4IS2A 3L9WA 1EZ4A 4QT0A 3H7AA 4MVJP 1N5DA 1HF3A 3INTA 2ZTUA 1G6KA 2JCXA 2OOSA 3PIIA 2Y1CA 1BVRA 2NVWA 4NK4A 1JLLA 4DTIA 3LK7A 1YL7A 4MVJG 1QR6A 2Y93A 5I8ZA 4DL9A 1N7HA 3WQSB 5C37A 5L7TA 3V8BA 2JD1A 2DBQA 1BGVA 4YEDA 1HLDA 2JHFA 4NFSA 4BNYA 2VHWA 5EL0A 5IN4A 4FJ1A 4LCEA 1YJQA 3BA1A 1B8PA 3SBOA 4CMEA 4OOFA 3QWIA 4D43A 5AYVA 4EYEA 2GUGA 4HX5A 4CM6A 3ABIA 3FBTA 3BMOA 5DCUA 5A3VA 2RBEA 1JA9A 4CL3A 1X1EA 1A9ZA 1HLPA 1PX0A 1WDLA 3JD3A 1Z74A 4FJ0A 3LT2A 1PS8A 2OBYA 3O8QA 1BHSA 3CEAA 5TF4A 2CNBA 1HE5A 3FNGA 3FSRA 1YRLA 4CMEC 2HMTA 1ISIA 4ZJUA 4D44A 1M76A 1XKQA 2GRAA 3KEQA 2WYWA 2Z1NA 3DBLB 3X2FA 3ZWVA 5G0TA 3EK2A 3KZVA 3VZSA 5GZ6A 4OXNA 4D79A 2DBZA 2VCYA 1D3AA 3W1VA 1XA0A 4A7PA 2HRZA 3NT4A 4FCCA 5EMHA 3M1LA 1VJTA 4BNFA 4FN4A 3ITKA 4E2XA 4YJFB 4HY3A 3D0OA 3H3FA 3H6KA 3ZWPA 3H3JA 4BKRA 1BVUA 3AI2A 2IXBA 5AXBA 4IDDA 3AUSA 3ZCXA 2DUWA 5DBFA 1DIBA 4JK3A 4ZVVA 1P0CA 2J5KA 4CM9A 4CMGA 4BO8A 3A06A 5L3ZA 2D5CA 1LI4A 4I5EA 3PYXA 2UUOA 1AN9A 3DL2A 1T4DA 1GUYA 5I7FA 5TQVA 4I1IA 3EAGA 5TRTA 2WD8A 2EW8A 3KSUA 4E5PA 5KTKA 2PNFA 2J8ZA 1UXKA 4PZCA 4NQZA 1HETA 3CUKA 3C7CB 3VZRA 3BHJA 3PGJA 1I3LA 3H65A 4YYZA 1VJ0A 2GF2A 4DQVA 3E8XA 4R1SA 2AQIA 4C7KA 2D1YA 1I3KA 4KP7A 3INGA 1PJQA 1DEHA 2BMAA 3K30A 4KZPA 4GPD1 1E6WA 3KLPX 5KCZA 4MO2A 4YB8A 4NBRA 4N5LA 4BMSA 2D5AA 1XSEA 3VKVA 3NRCA 5EERA 2O3QA 3ITDA 1U1IA 4W99A 3WNVA 1DAOA 4Z9XA 2DU8A 3T4XA 2G0TA 4TWRA 5ADHA 1QYVA 3PJEA 2NM0A 4D41A 3JQCA 1ENZA 2FR1A 5DNAA 4RPKA 4TRMA 1BXGB 1TVEA 3H5RA 4B3HA 4DMLA 4KWHA 3SVTA 3NAQA 3F9IA 3QVOA 2W2KA 3ROKA 3AU8A 1WDMA 1R16A 5DP2A 5IDWA 1HDXA 5K0ZA 5BNTA 3KV3O 4WGGA 2BFOA 4FOSA 1LRLA 3I9KA 3E9QA 4DYVA 3AI3A 2X86A 1Q0HA 1Z82A 2ZB4A 2H63A 3L4SO 1SBYA 1OZAA 2YY7A 1UJMA 4ZN6A 3HZZA 2HLPA 1YDWA 1UP6A 2HK9A 4BGIA 2EHDA 1BXGA 3WICA 2JFGA 2B4QA 1O94A 2NNLD 2OP0A 3BZUA 4U0JA 4W9NA 5DT9A 3U09A 5THKA 3QW2A 1PJ4A 1B15A 1T26A 3COSA 1IZ9A 1OAAA 1KERA 3RFXA 2GNAA 1VSUA 3F1LA 3BXXA 4FIZA 1XELA 1CDOA 4WECA 3IJRA 1R15A 4B3IA 4WKGA 5BNFA 1GEEA 3QVXA 3DMTC 2QRJA 3DMYA 3FTPA 4QFCA 1CQJA 3AUTA 1DC4A 3TJRA 2G17A 3V2UA 1H9AA 4AJKA 3WGZA 4J7UA 3FF4A 2EG9A 4JXKA 3PWKA 1OMOA 1X7HA 2O4UX 2VWQA 1PL8A 3WMXA 3A28A 1GUFA 3T7EA 1EVJA 2Q49A 3M2TA 5EPOA 4RVSA 4BNHA 1FF9A 4NMHA 3NKLA 5TJHA 1NFFA 2C54A 2AEMA 2PH3A 3B20A 5JPIA 3WDSA 1JDJA 1U3VA 5U4QA 2DLDA 3ZNOA 2Y1FA 5CEEA 3RUFA 2UAGA 4XRGA 3GUCA 4MVJD 4PLZA 1XLTA 1H5QA 4U0KA 1YDEA 1ZO8A 5CDGA 4NH4A 2BELA 3U4CA 4H16A 4CM5A 1ZK2A 3MTJA 4LK3A 2VRCD 1CETA 1HXHA 1P1RA 1A4UA 1PWXA 3ZWNA 3NYWA 4Z3KA 3IKTA 3KYBA 1BTOA 4DLAA 4GQAA 1MLDA 2OZPA 1SPXA 3QV1A 5IDYA 5JAIA 4CV0A 5ITVA 1GYRA 4CMJA 4BKPA 1Y7TA 1VKOA 1WXDA 5FFFA 1ZSNA 3AOGA 1NPDA 1UAGA 1YQXA 2W2LA 3GG2A 3IIEA 1Z75A 2H6EA 1VKNA 3KYDA 3OBBA 3LF1A 1T4BA 3T7CA 1MG0A 5G0VA 3VVBA 3SC6A 4ZICA 2BHLA 1NASA 3ZH2A 1PGQA 1QXSA 5C7IO 3CIFA 2IZ1A 2ZJ1A 1OBFO 4DWVA 1QYDA 4LW8A 4Z3DA 6ADHA 5G0UA 2FWMX 4L75A 5EQDA 2Q2VA 1SB8A 3JQGA 1DRUA 4FR5A 3HDJA 3QSGA 3JQFA 1GU7A 1HSZA 1V6AA 2I6TA 2ZTMA 3H4VA 5JO9A 1ENPA 1YOVA 2AG5A 1X0VA 3KBOA 1V3UA 5HA5A 3UH1A 3E5RA 2PTGA 2YHIB 5I9NA 1NQOA 5IDQA 1MV8A 4DPKA 4NJMA 2PGJA 1GUZA 1P77A 4ILKA 4JBGA 1G0OA 2ZB7A 4IZIA 4LGVA 4R01A 1E7WA 1VC2A 5A9RA 3OP4A 2AHRA 4E12A 1JN0A 5BSHA 1QV6A 4MDHA 3ULKA 4IMPA 2J3IA 1E3EA 1NYTA 2IRWA 3G3EA 1VLLA 2EP5A 4EUHA 3GAZA 4EJMA 1P31A 4AJIA 2TMDA 5BSFA 2PV7A 2FY8A 4FFNA 4I5DA 3UW3A 3RJ5A 1HE3A 1I3NA 1BSVA 1A7KA 2HMVA 3QE3A 2Y1EA 3RFVA 4IDCA 4OM8A 1I33A 1ZZEA 4OIMA 1WMAA 4R1UA 4TKMA 4GWKA 5G4KB 1CQIA 4J16A 4RPLA 1B3BA 1ZXLA 3B6ZA 1NR7A 2NTJA 1X15A 1T1SA 5JFOA 4G5HA 2CVZA 3DAGA 3ONEA 1VI2A 4ZQEA 4A26A 3WJ7A 4ALKA 3BIOA 2V65A 3WYCA 2PKQO 2EV9A 4A0SA 1WZIA 3W8FA 5F21A 3NDJA 4XB2A 3ZU5A 1E6UA 4Q39A 4R68A 5EJ2A 3WGHA 5I9LA 4GVLA 1HEUA 4H15A 4CV2A 1GQ2A 3DFUA 1J5PA 1LRKA 2DTDA 3OM9A 1ISHA 4JROA 4O6VA 3PDUA 4PN3A 3OJ0A 2QIOA 2VHZA 1IPEA 5BR7A 1DXYA 2I66A 3ANNA 3KLMX 3OA2A 3HHPA 3OQ6A 4FB5A 2QRLA 5ES3A 3DZGA 5KWEA 3M1AA 1N9GA 5KJ6A 1KY5A 4AVYA 1E77A 3HDHA 4J4HA 4U6SA 5GMOA 3VDQA 4AJPA 1LJ8A 2J3KA 3W6UA 4B8WA 1P3DA 2CDCA 4R1TA 1H6BA 1NTOA 4BMVA 5T8KA 4DYDA 2CDAA 1GQYA 1TLTA 4KQXA 1DDOA 5A05A 3G1TA 1KS9A 4OYRA 4E4YA 5A04A 4YR9A 2PY6A 3UKOA 1X7GA 2IZZA 4B79A 2VUTA 3PHJA 2PGDA 3DBVO 4EUEA 4EITA 4L73A 4NG5A 4OSPA 1ZMTA 4RV9A 4BB5A 4OJNA 3FNHA 1N1EA 1GPDG 4W7IA 2YFHA 1YBVA 3AW9A 3GLQA 3GOHA 3DOOA 1WAMA 1W4ZA 4GKBA 3UUWA 3ZU3A 4RZIA 4J9UE 3D4OA 4BNTA 4CODB 1Y9EA 1F06A 5JAZA 2GGSA 2PWZA 3L6EA 3WFJA 3ZW8A 4EZBA 4J91A 2ET6A 5JBIA 1CERA 2WJPA 4ALIA 1GR0A 3GF4A 4PLFA 4EJ0A 3ROQA 1KEWA 1Y5RA 1PZGA 5DN9A 4CPDA 4BNVA 1QV7A 4PVDA 1B0AA 1NXQA 3E9MA 3CTMA 3V2GA 5MGBA 1A27A 2C0CA 4KOAA 2HQ1A 2DFDA 3PHHA 1AUPA 4R5MA 2WE7A 5KKCA 5L45A 3JD2A 3DAPA 1B8UA 1E7MA 4J7CA 4BNGA 3ANMA 2FPIA 4BIIA 4WPGA 4YT4A 3IL2A 5H82A 3I83A 5I7VA 1SEVA 2YHUA 5IF3A 3LU1A 4AJ2A 3O8QB 2X58A 2O2SA 4JIGA 3ROPA 2EIHA 5C5IA 3WGQA 2VTDA 2X5KO 3ADOA 2DFVA 2RCYA 2Y66A 4MVJA 3JYQA 3W4KA 4ITUA 4RGBA 3S1LA 5KVQA 4E32A 4M49A 1UXIA 1BDMA 4O5OA 4IS3A 2O23A 1U5AA 3C7DB 3IC5A 4TROA 3EUWA 5MDHA 1KIFA 2D3TA 3RQSA 1KVSA 5TT0A 4PRLA 5A5FA 3MJEA 2FR0A 4IIUA 2HK7A 1LDNA 4YRDA 4E2WA 2J3JA 3DZKA 4MP3A 4PLYA 1E1KA 2UDPA 1FXSA 3GHHA 4KTTE 3ZU4A 3U3XA 3Q0EA 1A5ZA 1E3IA 3RUDA 4D0SA 4INAA 3DFZA 4HFRA 1A4IA 1Z6ZA 1Y9AA 2PZMA 5KJEA 3D64A 4YT8A 1Q7BA 3W8DA 1K6IA 1IB6A 4Z6KA 2PFGA 4GX0A 1VJ1A 4NJMB 3JD4A 4XR9A 3F5SA 4W82A 3AFMA 2X1HA 4Z0TA 3NDIA 2JD2A 3TDKA 1K0UA 3QA9A 3BMCB 4NBTA 4IGEA 4BO2A 4KUHA 1E7RA 1ZIDA 3W8EA 4WNCA 4QO7A 4R5HA 2X9NA 4K26A 4CM8B 4RF4A 2W8ZA 3QJ5A 5F5LA 4M54A 1NWCA 3OA0A 4DLBA 3WB9A 3NGLA 4GGPA 4JBIA 1B16A 3DZFA 3UAGA 4ALLA 1VE9A 3UICA 5ICSA 5AVOA 1LQUA 4IJVA
chains in the Genus database with same CATH superfamily
2XRMA 4J1SA 4M0UA 3NX4A 1AXEA 1E18A 1X92A 1KEVA 4E03A 5JCJA 5A03A 1QTIA 3H5LA 4OXYA 2IF2A 4RTSA 1HLFA 1RFGE 1T36A 5BSGA 3RT7A 5BSUA 3ZZ1A 4ZK2A 3GDOA 3KFXA 1KNQA 2QYTA 3W4IA 2O2ZA 1SR8A 4ZEMA 4IOKA 4Y30A 4Z8XA 1KFEB 2ATCA 4JT9A 5CYOA 1S6YA 4HDMA 1E1QD 1ULSA 1ZRNA 1X2BA 4TKVA 4EY4A 4RIEA 5JJCA 2IH5A 1AMOA 3E82A 4OY3A 2PEYA 5HKAA 1ODKA 3M89A 3SCZA 1F0YA 2DPYA 1JUDA 2FCRA 4Z86A 1Q1GA 4Q66C 4CTMA 2EYUA 1UEIA 1TE2A 2XXAA 5AVSA 3VO1A 4I3HA 3G2JA 4C4RA 4X90A 1H22A 1GNQA 2ZUUA 2WY2D 4O4LF 2A57A 3EVTA 3DE5X 3BHMA 2B8WA 3I1IA 3K0KA 3H9GA 3A2NA 2CV2A 4XWTA 2R8PA 2GZHA 3LDGA 1IULA 5FLEX 2X77A 4ONEA 5E9AA 5B1IA 4ZDIA 4DLUA 1RXSA 2GM3A 3PCRB 3ESBA 4NC9A 3PXGA 3RODA 4CG1A 4UU1A 4DJJA 1BDIA 3AESA 1O4VA 2NYUA 2YBDA 3ZBQA 2RKWA 3SF0A 2P4EA 3TQIA 3IQWA 4FYHA 4MB0A 1ZUNB 5CPFA 3P26A 2PQ0A 2I3AA 2R5WA 1M7HA 5SYNA 4UBMA 821PA 2PZEA 4O25A 1YDGA 4URVR 5IHXA 2Z2JA 5H81A 2O0LA 2FZVA 2HT6A 1OFHA 2VQDA 3TK1A 4BLUA 1PEDA 2V6GA 3G17A 1RXIA 3OM8A 4XDHA 4MR7A 5DM1A 2Q8NA 3AQ4A 4YAIA 4P7FA 1PS0A 3TSYA 3KJZA 4DLVA 4V39A 1YC2A 3AEQB 1M2WA 3KR0A 2W22A 5T7BA 3GLUA 4HBZA 4B6OA 5L6MB 5GJWC 3KQQA 4RIFA 4H6VA 3LJKA 2G1UA 3DB2A 1F7VA 1U0RA 2UYYA 1Z56C 2C59A 3ORYA 4HLUA 4PXYA 1YUBA 2DWPA 3H9CA 3IPLA 1J00A 4JQCA 5CT9A 3VAYA 3RLFA 1GITA 2V7PA 2YCLA 1UEJA 1V8BA 1VRWA 4P86A 4X85A 4QSHA 3QP9A 4IY1A 4LOHA 2WMDA 4TXHA 5HIAA 2BZ1A 1BXRA 4WNIA 2I1QA 4BMYA 2AJDA 4WMLA 3K1AB 3KVVA 3UK7A 4KLNA 1XVVA 2PRZA 4PG8A 2P62A 2VTKA 4RXUA 1L4GA 3R7BA 3PNSA 1X86B 3WRXA 5BWLA 4UZEA 4ZCTA 2HA4A 4PBTA 4GYJA 4AZ3A 1QGED 4MUMA 4AJ1A 4FFDA 1Y4UA 4PZ9A 3UT0A 3Q5EA 2BGLA 4LWPA 4EGQA 3PEFA 2PRYA 1D03A 1C30A 1ILWA 4LJLA 2Z4RA 4ACBA 4AKIA 1T5HX 1E9SA 1VSVA 4AKGA 1LJLA 1WHSB 2WYVA 4D4LA 4H3KB 1O8BA 4B31A 4B3FX 5HS4A 4AULA 1OB2A 4LY6A 3Q3VA 1EVYA 4G85A 3MTQA 3FVVA 4M83A 4MKRA 5IKEA 3KYCB 2OT3B 2VWPA 2ATVA 3K0CA 2FCAA 2AJCA 5TQ0A 4CFZA 3AJ9A 1ND5A 1FXWF 3OO1A 4RSHA 1J8YF 4P84A 4RJKA 4UM8B 2HIAA 3SS8A 5CNJA 3M6XA 3DPIA 4GI1A 4XCQA 5I5GA 2HMUA 3UOAB 4RVDA 5IJZA 1L9XA 3L6BA 1XK6A 4AF8A 4QBKA 4U7HA 5FPKA 3Q2IA 5AVYA 3C3WA 1X7DA 5DT2A 3L06A 5KU1A 1PR9A 3I62A 5FHQA 1TNDA 1S89A 3THXA 2GN9A 2IDJA 4IIXA 3PFIA 1SXPA 2HYIC 2DTEA 1VGVA 2ZRFA 1KJ8A 1WL8A 3BK7A 2BDUA 3MCAA 1N78A 1FSFA 2VDMB 4B82A 2HTFA 4XEHA 4O02B 2DPXA 3FUCA 2G1AA 2AS0A 3G0OA 3OQVA 1XD9A 4ENRA 2MINA 3ROXA 4HTFB 3C74A 4HTFA 1SCAA 5AIAA 3U9SA 1PU2A 2B4RO 3E22B 4RD1A 2C7VA 3EWNA 3JVIA 1JKJA 2XVXA 4MB6A 3LC7O 4OGFA 2ID7A 1ZFNA 1Z5WA 4G0XA 5JTUA 3KCQA 1X6VA 3LF2A 1DKLA 3FETA 3QU5A 5K3EA 5ALVA 2FW1A 1N5JA 2ZYVX 1A95A 4BYGA 5F3DA 3HB5X 1R6BX 4HDRA 4WCFC 2VHQA 3DE1X 5KTPA 2HJRA 3L7JA 1JPUA 2LRHA 3C1AA 4UNSA 3NBUA 2A30A 2BBWA 1DS6A 5LNK1 3O8DA 1GNTA 1Y6RA 4EYGA 1NBWB 2B30A 4HZIA 5EIBD 4KPUA 1R9JA 3LPCA 3ZXYA 1O9GA 4MUXA 2ODBA 4OI4A 1GA1A 2VUUA 3VC1A 3P52A 4BMOB 4B35A 4CM7A 2F64A 1DPGA 4DUZB 1EBBA 2H54A 2LUOA 2ZRGA 3CEJA 3PUIA 5GM2A 1LTHR 5KQLA 1VPVA 1CVLA 2YWRA 3JWGA 3JZMA 3E9CA 4IYJA 3WBBA 4P0QB 1J5XA 2HDHA 1A1SA 5I3ZA 4FIDA 4BP1A 1JECA 1K08A 2OB2A 4JLWA 4IZ6A 3D6FA 1E58A 1HDOA 1U3GA 3FWKA 4IMIB 5BUZA 1JLKA 2A6PA 4PLHA 3Q0TA 1OYOA 4ZYYA 3PJRA 1P5ZB 4IILA 4G1VA 3N8NA 1A97A 4FFPA 4ND2A 3WQHA 1ZRSA 3R1IA 1Z08A 2FF5A 4ITRC 2C2HA 3ZHSA 4HDNA 3FJOA 4HH1A 3C85A 4ERXA 1E7YA 2GOYA 2CBGA 1ZESA 5M7EA 3PTZA 5K3CA 5CDFE 3IAFA 5A5DA 3K1AA 3U49A 4II3A 2OENG 3OJOA 4WLOA 1A71A 3FW1A 2R5FA 1C0EA 3VJMA 2ZYIA 4Q7EA 2ZKLA 4LCBA 3E84A 4WKNA 3KXDA 5FADA 4KITB 3PDHA 1GU0A 2GARA 1EB8A 5M34A 2CNLA 1PGPA 5CHEA 3DMFA 5ALPA 2W4MA 4R41A 3HP7A 4C76A 1WKVA 5GIOE 3H2KA 3M83A 1H1LB 1K6MA 2VYND 2Y76A 4X24A 4KWTA 1TA4A 3AC0A 3HP4A 3O3OB 4HAWA 4K9MA 1KFCB 4RD3A 3GDFA 1NJFA 1JU3A 3EB9A 2FP4B 4QHTA 1ISMA 1NUPA 3N58A 3U26A 3PWZA 1GRVA 4R01A 3LO8A 3NJRA 4AMVA 4QTUB 3QBTA 3ZLUA 4HZUA 3UH0A 1QLHA 3U48A 2ZIAA 1W52X 3WGYA 3D5TA 1Z6AA 2OQVA 1IZYA 2WP8J 4W1SA 4LF6B 5HK8A 2EKLA 1Y6GA 1TO2E 3L7BA 3QNWA 3LOUA 5EVCA 2IOFA 1KXZA 4J0IA 2OPBA 3AM1A 5IRCD 4G0VA 3NBXX 2BM8A 4YPFA 4PC6A 4ZD6A 1GYQA 1ONSA 4HNVA 2XR1A 3OOEA 2VJAA 5FFNA 6YASA 5CB8A 1UZMA 1NOIA 5KHAA 1MDFA 4PYOA 3JQGB 3ETGA 3ZQ6A 4LJ9A 2GK6A 2GF9A 2Q1WA 5FORA 4DR5B 3HLYA 5KYYA 1IRIA 4ETNA 1PDOA 3K2IA 2OHXA 1OHHD 5ALWA 4DG5A 4TX1A 4YWJA 5KYNA 4TMKA 1DKNA 1MOSA 1GUAA 2VRBA 1S7GA 1VDMA 3HM2A 4RE5A 2FAXA 2P0AA 2EL9A 1DAMA 1RRCA 2IZ6A 2PGXA 5CEJA 1AKWA 1X7WB 4AROA 1N57A 3QE9Y 4FDMA 3NJ4A 3JPYA 3VR5A 4R1OA 1XWIA 1RI3A 2HCJB 1MNQA 4P4LA 4WXRA 1KDZA 4AS1A 4OQNA 3L0DA 3ROMA 4CMIA 2B94A 2R2GA 5C1BA 1H8ED 2IGBA 3IV6A 4FKMA 3P97A 2ZRLA 2BIFA 1FDTA 1MXFA 1ZG3A 1ZHFA 3LSYA 4K40A 2ERCA 4QDJA 1IN5A 3ROTA 4UVEA 3ZIUA 4BTLA 1XAGA 4B4KA 2VJDA 3ZHZA 1GFZA 4OFBA 1NW7A 2YFYA 2YVQA 4UATA 1T4CA 4JSTA 3HKDB 4D4JA 2YVLA 2Z3VA 4NK5A 4BMPB 9GPBA 2I4OA 2JAOA 1LLUA 3ITEA 2AC7A 4J3JA 2YQZA 3I92A 3QUSA 2IFTA 2XKKA 1K1EA 2XQIA 1LKZA 1M2OA 3AEZA 1CY6A 1KOJA 1ZIOA 4MLPA 2WTUA 3O9VA 1LS6A 1Y3BE 2AA3A 1VIYA 4WLUA 1J20A 1UK9A 4LC1A 4ZYTA 1BQ3A 4EG6A 3GRYA 1LTQA 1Q44A 1YL6A 3EFBA 3PD7A 4M53A 4PX3A 3ORQA 2H7XA 2CE7A 1A2OA 1KO7A 2Y3IA 2FN8A 2XB6A 4TTAA 3MFYA 3X1JA 4GLBA 4CDNA 1EFTA 1CWUA 4CLEA 5CYPA 2PM8A 8OHMA 3SDBA 2ZT5A 3IMKA 5B53A 2B2CA 4B3XA 1UK8A 3GC6A 3WLKX 4XIFA 3U37A 3EPHA 2QAGB 1G2OA 3GVCA 1EJ0A 1CULC 3N05A 3RIEA 3FSGA 4OBEA 4IICA 4ZZ2A 3EXIB 3TL2A 5A62A 3THXB 2C07A 2BKXA 2OHOA 3BMNB 4QUGA 4OX9Y 1E2FA 3SEZA 4HGYA 3SF8A 5COBA 3RKRA 5IABA 1PVOA 3L07A 1TZCA 1Z0SA 5EGNA 4CF7A 2FUKA 2BE7A 3QEMA 1AQNA 4LBWA 3TLZA 1RC8A 2ZI4A 5A5VA 1KJWA 4Q02A 1LU9A 5KOJB 2WTXA 4R2XA 5A3SA 3WK4A 2IHKA 1PLJA 1J1UA 3WMFA 2YJ3A 2P11A 5KJCA 3P9NA 2E2WA 2QGFA 3C1OA 3H5OA 4Q3OA 1HRDA 4URZR 1BD3A 1DO8A 1R8YA 4HSEA 3VSCA 2Z6VA 1GKKA 4D0RA 3G13A 5AW1A 5BWNA 1EMDA 2AH5A 3UJAA 4F6RB 4D25A 4BWVA 1GG2A 1ZEJA 1YB5A 5J4YA 1ZGAA 1TGYA 1H93A 2CHGA 4B17A 4F7WA 4D46A 4PYJA 2NU9B 3ZDZB 3WTBA 1HDYA 4XGRA 4Z9YA 3PGLA 4MWSA 2Q4BA 5DYNA 4P22A 4B75A 2FPUA 5F1KA 3TQTA 1VMIA 2GK7A 4IKEA 1KFKB 2P77A 2ZJ7A 4I55B 2X4GA 4CQMB 3IE2A 1RZUA 4DA7A 2IXAA 3OPVA 2FWPA 3RF6A 2P1RA 4LVUA 4MYCA 2B5VA 5IBPA 4HAXA 4X6YA 3AZPA 1AUXA 3FTCA 2RGEA 4NCJA 1CY7A 1EVZA 1Y7HA 1THGA 3FPJA 4KBGA 2ASVA 2ZB3A 2YVKA 2C1XA 1O94D 3TSAA 1DIAA 2X6TA 1JP7A 2IV7A 4O4IB 2Q6VA 3F7MA 3PP8A 4LOIA 5JS1A 4PV7A 1AJEA 2GNPA 2QU8A 3F6EX 2D4AA 3RUCA 2V54A 3TM4A 3L0YA 1MC8A 1JQBA 3BCRA 5AVUA 3IEIA 4FB4A 3AT1A 3GNTA 1DC7A 4Y6LA 1CQPA 2RSLA 3A2MA 3A1UA 1VCMA 5TPZA 3ZD9A 4ZHQF 5J47A 4QC2A 4Q9NA 2IGTA 3KP1A 4K6CA 4YXFA 3WHIA 1PT9A 4PSKA 3QG5A 3LC1O 1ZA1A 1PUXA 3L92A 3BTOA 3FGPA 3LO5A 4RKEA 4PYMA 1Z4KA 4BX2A 5CA0B 1B7GO 2COUA 5ALZA 1DNPA 1V5WA 2XTMA 4DSAA 1ZK3A 3S2UA 3SR3A 3D4PA 4N5NA 1JJ7A 4FUTA 2HZBA 3HNOA 1O89A 2ANCA 2PZAA 2XNHA 3D2BA 3MRXA 3RFUA 4TL6A 4Q1FA 4N7MA 3K8ZA 4WA7A 4ARSA 3P9PA 1RWWA 1ECCA 2LR0A 5AM5A 4X71A 2BGUA 4EG1A 4O3FA 3TSZA 1NUHA 2Q0XA 4G65A 1YIOA 2Q07A 4L9SA 4NZPA 3F5DA 3DHVA 4BQIA 5HRUA 1CUEA 2R97A 1MGOA 2WLTA 1Y63A 2YC2C 3A1EA 4V24A 2OBXA 3NO4A 2RGAA 4LHVA 1K68A 4LXIA 2AMVA 2MIIA 2P78A 3O4HA 4LKRA 1GRQA 5EJFA 1VMDA 4BMNA 4C05A 1EGAA 5G0WA 3ZE9A 3HKCA 3RBAA 1ZMOA 4DLYA 1VG9B 3OQPA 4U6NA 1XZDA 1M8JA 4PR3A 1QKJA 2CUNA 2ECQA 5EFZA 3SY8A 5K8VA 3OIFA 5JASA 1HTTA 3SVLA 1EFVB 4OQZA 3CN7A 3EVAA 3MJCA 2J45A 2OMEA 1DMRA 3COWA 3ZK8A 2PMDA 1XU7A 2I3GA 3DEZA 1ZJWA 3KR1A 2W6NA 4Q3KA 5ECGC 3RADC 4QT4A 3DVLA 4NMWA 4GLOA 4TV9B 5KQMA 2OORA 3A1SA 3M81A 1Y82A 5I4BA 2VCHA 2Q46A 3ZHOA 2DFTA 4EHAA 2FPWA 5TGDA 1JLRA 4AF6A 5H3CA 2Q3FA 4MOWA 4J2OA 5JATA 4K6MA 5MFZA 1U9IA 1QH1B 4CMKA 3ANTA 2NWQA 2Y99A 5J5VA 3E4DA 3IUSA 4UNRA 2RHRA 3F4KA 4XAQA 5IG2A 1VGRA 2E48A 3KVOA 5IMBA 2AC2A 2O8FA 1JR2A 3TW0A 4F97A 1W1UA 5B6JA 2WG0A 3JRWA 2YL2A 2Z0MA 3ELYA 4XLLA 4X20B 4YPOA 2H0QA 2EX1A 1JQDA 4PZLA 4G4SP 1VJRA 2W4QA 1VL8A 4I4IA 1U0HC 1PSDA 4FKZA 2K7FA 4KQFA 5EESA 1Z5PA 3T5TA 4N8DA 3VZQA 1FRQA 1YRHA 3TWOA 5JI3E 3EX7C 2ZI5A 5DN6A 1PNQA 3GAAA 4XD2A 1VMEA 3K31A 3O0DA 5SV2A 4V0KA 3GG9A 3PXAA 5E7QA 1IJEA 5BVHA 5K0FA 3BM5A 4IWXA 4TVOA 1W85A 3RU3A 1M2GA 3I9JA 3QVJA 1YS4A 4KO4S 1M0TA 3F4BA 5LIRA 2OD7A 2EKBA 3GB9A 5JD3A 4HWPA 3R9IA 5FUMA 3B78A 1QQ7A 3INRA 5LP6A 3I8SA 4ZCQA 2TMKA 3WYEA 2BR5A 1ZP6A 3MD0A 4IDQA 4O0MA 3BJZA 4QPDA 4JHXA 4CKBB 3MJVA 4Z5XA 2NMVA 1J22A 1J2TA 1K2WA 2VDQB 4MWBA 3RSQA 3K2EA 2Y68A 3CC8A 3WLMA 4I50F 1Y0BA 2H4XA 1U31A 4ZOCA 3Q88A 3ZV4A 1WIWA 5SYMA 4E33A 4EY6A 5HILA 1KBZA 1XDUA 1RTKA 1QORA 4WT7A 3ZWAA 2YV1A 1O8CA 4C03A 2WAXA 3CM0A 1Z4NA 3K9BA 4C43A 5HUJA 5HG0A 1OIVA 1ORIA 1EGHA 5LA6F 4FXOA 4CLHA 1DBVO 2V4UA 4AMZA 2VZ0A 3M2PA 1IBLB 2ENUA 2FP3A 5AW8A 1JDVA 4H4DA 2YHIA 3LGSA 1Z16A 2W2NA 3H9EO 4J0QA 4JBXA 3TZ6A 5LOVF 3CW2A 3FMFA 3CKMA 2JGKA 2JARA 2VPXA 2F17A 4M0KA 1ZVKA 3PHCA 3CX3A 1GZVA 5B2EA 4YCMA 3ANSA 4UBKA 1FJGB 2PX2A 2Z08A 4ZT6A 4R8SA 5K3AA 3N2KA 4NZMA 1XTQA 4HXEB 2PX8A 5CT5A 1KVQA 3ZKAA 1WMBA 1G66A 3SKXA 3LUKA 4NMLA 2H48A 4U7TB 2O8BB 1KI7A 4RGYA 4TYPA 1C4WA 5HW0A 4WZAE 2VNAA 1NU8A 4L2IA 3JQ7A 1G6HA 4RZHA 4CIXA 3RTAA 1A9TA 4II7A 1KJJA 2QVGA 1XCBA 3ZGNA 1G6OA 5CDHA 1UOQA 3CSUA 4CMBA 1QCZA 1FZQA 3FFBA 4LQLA 2W0MA 1V3QE 2OPHA 2P7IA 3LVQE 3NYIA 3AIOA 4IX9A 4D0GA 5ALGA 2EEZA 3GCDA 4BLQA 4A27A 4C08A 2JJ1D 2JH3A 3QUAA 1U2RA 4WZBA 5B4TA 3I4FA 3GR6A 1NI3A 1XLUA 1JS1X 1AV7A 3NAGA 4JAVC 4RMGA 1QRRA 1KYQA 3CRNA 3KYDB 1DRWA 4Z4FA 1J0DA 1GPAA 4WCVA 3UUFA 1Q50A 1DDIA 5SY4A 4K2AA 1TU4A 3QELB 4IDPA 4BCDA 4CU2A 5GPBA 1W6RA 1NZDA 3L4BA 4ZVKA 1T5BA 5A0VA 3QPUA 3BHIA 4LK2A 3M9WA 3Q12A 3PRHA 4B71A 4LXUA 1CIVA 1KHHA 3IIMA 3KSMA 4AI6A 3OCYA 4QTYA 4N5HX 2YNMD 2VO1A 3UMJA 2XUFA 3C1TA 3QA3E 1QCYA 4JA2A 2I2WA 2AN4A 2IDMA 2QHXA 3KVNA 1SIBE 2CDNA 2VYVD 5EEGA 4GL2A 3JRXA 4M0CA 1RZVA 5AO9A 3WDMA 1IWBB 1DBRA 1CEXA 2LE0A 3ZS8A 4B6EA 3HO6A 5EMKA 1L4FA 1SOVA 1L7EA 5K6AC 1F9EA 3AKEA 3IJ5A 4G6ZA 4B73A 4E2FA 2NXWA 1W5FA 3CQ9A 3D7MA 4TLCA 2AYYA 3FB4A 3BF8A 3ZWYA 3GD7A 4MMZB 3WAKA 3KEGA 3VBEA 1CQWA 2PNJA 2F4NA 3FPKA 4J0FA 1Y8RA 2I71A 1LBQA 3H5NA 3NCTA 3JYNA 3V32A 5KOHA 3PCXA 4NIMA 5DOVA 2XOKD 4BLWA 5J2UA 1C0IA 3K1JA 2V4ZA 1MTOA 3ZIDA 3RPEA 3UJHA 5ARBA 1YS2X 4FCVA 1EUDA 2F1KA 1WU7A 4LVCA 3R40A 2H16A 4LQDA 1L7DA 4H0FA 3RASA 3X2EA 5ERXA 4YRIA 2WQ6A 4OJKA 1GTSA 3H05A 2P9QA 2JAUA 4PHHA 3WS7A 4R8VA 1TRKA 3OZVA 4RKYA 1C2YA 4B6SA 5IMSA 2NG1A 5FBHA 2H3EA 2IBMA 3HCBA 1KQNA 3E7PA 1EK5A 1NN3A 2C92A 3D5QA 3G9XA 3LXUX 2X0DA 1FDOA 1MPTA 3K09C 4F21A 1N36B 1TD9A 3A9CA 5BWBA 1R6AA 3P9ZA 4NP6A 1QG6A 3U4QA 1G4HA 3AFOA 1Z9BA 1SKYB 1AY0A 1ZJYA 1CUZA 4YV0A 3N7TA 3CG0A 3JS5A 3LLUA 1RI5A 4B2IA 2F9LA 3ESRA 1W1IA 5AM3A 2RAUA 2YIDA 1RPNA 4FFOA 3D8RA 2O8EA 2RE8A 1M67A 1RC0A 2EW1A 4PC7A 5EP2A 5TQ2B 3X1WA 2R86A 5TT1A 5FIUA 3DNPA 3RIGA 3HBMA 1SB9A 5BR1A 4OK5A 1KKLA 3IDZA 4QUJA 1P44A 1E79D 2G9RA 1V8DA 3M4NA 2GQ0A 2J09A 4GRDA 2JF0A 4WAUA 3EZ7A 4BC1A 3SQMA 2WWYA 1JFRA 4HEA1 1MEEA 2GEJA 2ILVA 3TUJC 4EG5A 5JEEA 2FX3A 3B3AA 4XVRA 4B7UA 3JTEA 3UY4A 4RSGA 3IQGX 4EZIA 3K9LA 3NHZA 3ADPA 1UFKA 1N75A 4RTOA 5GZ3A 1I2ZA 3FRJA 1TMOA 2ORIA 1F60A 2R48A 3RC1A 4RPIA 2C2BA 4DMUB 2BFEA 5ITWA 2NVUA 1Z3CA 1VL6A 5ALEA 3CA8A 2KBEA 5EZ6B 4DQXA 4Q4AB 1XEAA 1NLFA 1D1QA 1TYDE 4ROTA 3KFVA 5DTIA 2YRFA 1VHQA 2ODQA 4NBUA 1E79A 2G83A 3GH1A 1LGYA 1VYTA 1SIWA 5FBKA 2O2HA 5D3KA 3TYXA 3UMSA 2CFOA 3V2IA 3ZDBA 1BA2A 2X22A 2VOEA 4RK6A 5CXXA 2Q21A 3WL6A 1H8HA 2A1IA 2WA2A 3RSLA 1QHXA 1JEAA 3UFXA 2PRKA 3H5VA 3NEPX 2QLMA 2O1SA 1GPH1 2VA9A 3NG1A 2NO1A 5DVZA 1RRKA 4U7WA 4E5KA 5CFMA 4FYKA 3LRTA 4DWWA 1XPOA 5KYGA 2JIOA 2I3BA 3IXLA 5C5DA 1Y6JA 4EY5A 3DNMA 4NPCA 5DI3A 3KQOA 4D96A 3B6IA 1KAMA 4AQYB 1XCGB 3BZWA 2ZJ0A 4M9XA 4ZYUA 1WTCA 3WKBA 1V5GA 2QROA 4Y2XA 2O1EA 3B2QA 3TAXA 1P3Y1 1I5EA 2XMCA 2PH7A 2UUBB 1S8OA 4DIEA 3OQHA 3ZWOA 5LD2C 1KK0A 1DQPA 3E3OA 4Y2UA 2EL7A 2XQKA 3TAUA 5FPSA 1JIIA 1IWOA 2PUHA 3T3GA 2H1WA 2QPOA 3RU2A 3DWFA 3QE0A 4GPTA 4E2ZA 3OURA 5DNUA 2TRSB 3AVPA 1V41E 5IYZF 2SKEA 5HMLA 1RMQA 2WUDA 4BNMA 1HZZA 1JWBB 3FPEA 3JAWB 1HEYA 3ENKA 4RO0A 2QR2A 4DEVA 1L3CA 2F3QA 3OIVA 1OI4A 4MULA 3KQKA 1KOFA 3BA6A 2FN4A 1Y42X 3HCAA 2Q0HA 4NZZA 1XMIA 3TD6A 4JB3A 3N0WA 3UQZA 5L53A 2PE5A 4DDMA 1Z6QA 3MIIA 4JLOA 1CZLA 2ONYA 1GUDA 3OCWA 1SU6A 1H0HA 5JS2A 3FYCA 1T5SA 3TTUA 3IILA 3VVLA 3DHWC 4HDSA 4IIYA 1NBHA 2W2LD 4R7TA 4D8UA 4C7VA 5JVDF 3GIWA 4FEEA 3F6PA 1A88A 4Z4IA 1A8PA 1W96A 1CY1A 1FNCA 1X7ZA 1XQ9A 3DVAA 4KW7A 3CX6A 2OV4A 4G23A 2CMFA 2BM0A 4LI3X 1B1AA 1Z0JA 3N74A 5TC4A 1WVGA 3CUWA 2GHRA 2IU4A 2I3DA 4CV3A 2NSLA 4F4HA 3FOEC 2AG8A 3Q8MA 2VHCA 1KMIY 5HIMA 4FKBA 3SR0A 1E8DA 1PSZA 4XM0A 1DQNA 2M9MA 4XRRA 4ZMRA 4XWWA 1NQUA 2VG8A 2ZYWX 3EIFA 4K86A 2ZIFA 4DJTA 4TMTA 3PL1A 3KE9A 4EHIA 5ICGA 3O73A 4M1OA 4XWGA 1LNQA 3VNUA 5BQXA 4I4TB 2DUMA 4KO1S 1PN3A 3L2OB 5JLAA 4CFSA 4JU8A 4YDQA 4UC0A 1P1IA 4XASA 5ALQA 4DV3B 1XAHA 2V0CA 1J8QA 3S1AA 2XIJA 1BFDA 3T3PB 3JQEA 2ZYDA 2N47A 2GD2A 2QN3A 4ZXPA 2AVDA 1MOZA 2PZGA 1LTKA 5F52A 3C1UA 1E2JA 1U1FA 1ORTA 3LX5A 3TMYA 3LC0A 1E6KA 1SXHA 3TTXA 1X9HA 1EINA 2WPDD 4PYQA 1JTEA 2W6ID 3N0VA 4MZXA 4PN7A 3MM4A 4X91A 1E20A 4KDEA 1BZYA 1M6VB 3Q7QA 3A6KA 4EI8A 2BCGY 3LKBA 1QU3A 5JJBA 3A0RB 4Q1BA 3IB3A 1M66A 1JKMA 2GRJA 3OOYA 3GNQA 4GBJA 4I5GA 4KQEA 2AMJA 4XDGA 1L4NA 4Z7JA 1U8AA 5ITSA 1NJ8A 2QMYA 3GQBB 1BE8A 4W5NA 4TZ0A 1Z83A 2I2FA 4UASA 2HF9A 1XTJA 3RSCA 3C3KA 2ABWA 5J4KA 4EATA 2AN3A 3AHHA 3DOUA 4UTOA 1E2HA 4A3SA 3LL4A 2RHCA 2ZRDA 4IIDA 3JYHA 3MBOA 1QRDA 4JGIA 1W36D 2C7OA 5CK4A 5KVAA 1EWKA 2CLOB 2GVNA 5E6RA 3L77A 1WZ2A 2IJGX 1ZOSA 5J4LA 1JPVA 3GXOA 5KQRA 1OFTA 3MQFA 4HNAB 4IUDS 3P0RA 4OHPA 1G21B 4U2BA 4AN0A 2A59A 1L5SA 4JNKA 1EUDB 2G25A 4QXPA 3RC3A 1TGVA 3MAGA 3PQ5A 4MRMB 1RKXA 4V1CB 1HSOA 2VP5A 1MB9A 4ESEA 2YTZA 2YZKA 2RH5A 4X1IB 4JLDA 3X1YA 3F74A 3G23A 2FKNA 5CGQB 3STXA 3MGCA 4HEJA 1QSGA 4XYMA 1IUKA 3NFYA 4PR0A 4UUBA 3VPSA 4UAVA 5DO9A 1AGXA 3C24A 1SPBS 3HA5A 2X2FA 4NNPA 4WKPA 4XGQA 4FLEA 3MIZA 4L6CA 1JFTA 4GSYA 1KETA 5FOVA 3HTXA 4OLAA 5HDQA 1S2DA 1WP9A 4QOGA 1M2NA 2MHCA 4UUOA 5CDYA 3H3XA 1JEJA 1K5PA 1V6CA 1M1NB 2QORA 3FRIA 1FVHA 3GBSA 3D3WB 2JGJA 2Y0CA 3CJTA 3V4SA 3I9MA 5CFNA 3O91A 3OIGA 2WSYB 1ESEA 2RGUA 1DOZA 4S3MA 3SU8A 4INOA 1G3QA 1Z8DA 3AR7A 4ARIA 8GPBA 2DLNA 2JASA 3DAHA 3OPYI 2IODA 1H42A 3WBFA 1UFVA 3DLCA 4BAUA 1XNQB 1TF5A 3Q15C 4RVHA 1HPLA 4MRSA 3ZBPA 1XL0A 1NI4A 3P2IA 3DMHA 3AR3A 3P27A 2WF7A 3A05A 3E9NA 1UMDB 3HJGA 1PTKA 4UOQA 2C2YA 4RHFA 1PDWA 3SIPA 3WRVA 2ODPA 1JF8A 4Y98A 3C45A 3TH5A 2YMLA 1O58A 4HV4A 5LP6C 4L0MA 2F3SA 3KOUA 1NBIA 4BZXA 4F3NA 1T2CA 2IHNA 1OA1A 3CLVA 5A5EA 4BNUA 5IBCA 3QBDA 2ZJBA 3A3YA 1FOEB 3IBSA 4XARA 4D3ZA 1BN6A 5FWXA 2WK1A 2FK7A 4D92A 2PX4A 1GRRA 4I2NA 5D84A 2ZYAA 3FWHA 3SDZA 1TF7A 1JVNA 2HWXA 3NTXA 3UCFA 1MB4A 3MJTA 4BRUA 5IXYA 3BDIA 2RGGA 2PVCA 2J32A 4KQCA 4X0EA 1DKRA 3KKPA 2IQ5A 3VV3A 4IUBS 4QGHA 1GSHA 1VDZA 2XA1A 4Q82A 5NLLA 4Y9DA 1CUIA 4Q7QA 1GDTA 2VDOB 3GFQA 1Z5NA 1PG5A 2CF5A 4HC4A 4E7PA 1KVUA 2HJVA 4E6EA 1RHKA 3JCZA 1RIFA 5EY5B 1XZEA 4V03A 4IBOA 2VT3A 4YRTA 2UVQA 5AM1A 3QF4B 2QD2A 3OPMA 1A9RA 2GJSA 3MT8A 5CM8B 3ER8A 1R18A 2HFJA 2QRKA 3ET4A 1NOKA 1ZD3A 3KYCA 1QH9A 4G5SA 4IVQA 4MW7A 3WOHA 4MKGA 3B89A 1VG8A 4IJQA 3DCNA 5BR4A 2C2MA 2Y2UA 5IXSA 4CJXA 1E3JA 3BF7A 2XCSB 2C77A 2DXIA 5LMNB 1E69A 1JEYB 3PZRA 2IZ5A 1NQWA 2PQMA 4BLPA 2W6CX 1Y1PA 2IKSA 1XCPA 4LE0A 3P19A 5EIHA 5FPTA 1KYVA 4CR8A 3EXEA 2FPOA 4BE9A 1QP8A 3NHYA 4HWRA 2EZTA 1C1HA 1AK2A 4ZREA 2I1WA 1RU3A 1UXOA 5EE0A 3V8QA 3MQ2A 4BNKA 4BVFA 3V1MA 5EZYF 3T0GA 1OBHA 2H65A 1JI3A 2W6OA 3ZZNA 5T6MA 1GQOA 2HMYB 3MUNA 3ZYCA 2I7DA 1XDGA 1GSIA 3QE2A 1K88A 3FAZA 3H2JA 4W7SA 5CM2Z 3TSWA 3COZA 1JWAB 1Z36A 1X0XA 2H1CA 1RRVA 2QD3A 2QNBA 2WTBA 1W25A 1B76A 3R3SA 5FR2A 5SZJA 3E61A 3C6YA 4KK4A 1QMGA 4YQEA 3H99A 4DWOA 2G5CA 2O8EB 1JSRA 4FTWA 4OTZA 1TADA 3DOIA 1NT2A 3NV9A 1S0UA 2RK6A 1O08A 5IW8A 2A0FA 2FSVA 3RHFA 5JAMA 1GTRA 3TLXA 3AEQA 3WNZA 2B7BA 1KMHB 3PQ2A 2C96A 3EZLA 4D5GA 1V1RA 2O48X 1JG7A 3FPAA 1YJXA 1DV1A 1SQSA 1Z73A 4FOTA 1CX9B 2YCBA 5ALHA 1G5PA 2K87A 4BNZA 5CXUA 4J16C 1I6LA 1UK6A 3ND7A 4PVCA 3TF5A 1F0NA 4JDUA 1A9PA 1EI9A 4LYGA 4A0QA 4E4RA 3T5CA 2ZBFA 4OKSA 4FMDF 3T7DA 1B14A 3Q5GA 4AJOA 3V3KA 3KWFA 3IGFA 4RU1A 2HSGA 4GZ5A 3KHSA 1AZSC 2VWGA 2AFRA 1OXXK 1XB2A 3QMMA 1G5QA 2XRYA 3CZ4A 1GIAA 5J2UB 4R9NA 4XOUA 1YB2A 3JWPA 1UKEA 4DCSA 3I2FA 3QEKA 2UYQA 2XSZA 2CKMA 4DWJA 4EO7A 1L4EA 2HDOA 3F6YA 3DXXA 1EP3B 3KQSA 3LC2O 4KMOA 3WISA 3MHTA 4HLUC 4RFSB 4KYIB 2Q50A 2XUJA 3DAFA 3IULA 1K8YB 4JC4A 1IOVA 1AE1A 1T2EA 4ZAVA 4H3HB 3IQFA 4QQNA 3P1JA 1XFAA 2ON6A 4DV5B 1SEPA 2B83A 1N2JA 4MV4A 3EUEA 2VEOA 3FDXA 1YR8A 1N2ZA 2BFPA 3N39C 3OEWA 4Q47A 4K28A 1UBTS 1K3TA 1G18A 1XA4A 2OC4A 4NHOA 4Z2YA 2YXBA 3AB8A 2FUG1 3NBAA 4R2JA 3UENA 5KYTA 4DUGA 3ZVNA 1TM5E 5ALYA 3JD0A 2FYTA 4MRNA 1FPQA 3K0AB 2RGNC 1UFQA 3KOWA 1D0IA 4FQ7A 5E2AA 2JD0A 1CV2A 3M7IA 1LK7A 4N12A 2PT9A 2UYCA 2G40A 3GL9A 5AVWA 4BFLA 2BUAA 1XIVA 2C2OA 4Z1MA 3HMKA 4RGVA 4BEVA 3A3OA 1WF6A 3EPJA 5I9TA 2AD1A 4UAGA 4XYBA 4HUQA 3N8GA 2AR9A 4DDVA 3NHJA 1NN5A 5LKAA 2O2CA 3WZ2A 2A58A 3OT5A 4YV1A 1TUIA 4GW3A 4R31A 2IXDA 5DASA 3NTQA 4PG7A 4F4IA 2V59A 4IL5A 1T6YA 1RWMA 5BN4A 4BL5A 4GPIB 3QBVA 4RELA 3LLVA 1ZHHA 4I8IA 5GOZA 3PWTA 4L07A 1U5BA 1SCDA 2V6IA 5IJWA 3H4TA 4BGVA 1NZFA 1E5LA 3E35A 3DBIA 4BZZA 2VQSA 3HI4A 5DH9A 4EW1A 4HVAA 3I2KA 5FAXA 1QZXA 1HQDA 2YASA 4ZJZA 3VM6A 2O54A 1E3DA 1US8A 1EVIA 1FMCA 4KU4A 4ZU1X 3UFBA 1BU5A 4C1BA 5LMUB 1OVGA 1QYXA 1OC4A 5IANA 1LSJA 2JLQA 5FNVB 3EEOA 5KSWB 5F2KA 1W8DA 3SIRA 4FYJA 2IPNA 4F5YA 3U4HA 1BH2A 2VH1A 3S44A 1XYGA 4C21A 1U2GA 4V0SA 3AUFA 1OTXA 1S2IA 3AERB 2BKUA 3B2EA 2JK1A 1AHIA 1HDCA 3MRVA 3SQLA 4NNJA 5BSVA 2GR9A 1TU3A 3OF2A 2F1IA 3VR2D 2J30A 1QH8B 4A2WA 3I6QA 3T1YB 2H06A 3OEYA 2BFBA 1V7PC 3OIDA 3PDJA 3ZQUA 2GM9A 1LBHA 2PL5A 1Y3CE 3EGVA 1RMTA 5JMPA 5U9CA 4ZYLA 2AKAB 5CBPA 4L4UA 2OXTA 2H5LA 5B4VA 4BRSA 4PNHA 2PKRA 3STUA 4I50B 3Q2OA 2ZKIA 4J90A 4XIGS 4TV8B 2IDZA 5EMLA 3WLEA 2PLFA 2G7MC 1VB3A 2ZSBA 3HVIA 1U4OA 1U2DC 1ZS9A 1GV1A 3OE7D 1R5NA 5FI1B 1KEEA 2L42A 1RI1A 3FSJX 4G2TA 1UH5A 4GMHA 1UFRA 1TUBB 2P6RA 4O3MA 3E5NA 1SU8A 5GJCA 3NUQA 2QVBA 3JRNA 2CJYA 2AUTA 2BFWA 5LOVB 4RHUA 3GMDA 3D1LA 3EXIA 1ZCZA 3V4OA 3NTVA 1Y3HA 1KI8A 3RVDA 4QVIA 3R9WA 1V7QA 3GEDA 5TARA 4H35A 1OI7A 1LLCA 1QF9A 3VX4A 3KHUA 3IS3A 3S4YA 7REQB 3CSSA 5IFLA 3KBBA 3B38A 4JX9A 3ZZUA 2QN6A 3U7GA 2PTHA 3MXOA 3TUIC 3PX3A 4Q7KA 3RS0A 1Z2NX 1RKBA 2WU0A 3HN6A 3OM1A 5TR9A 1Q0PA 1PR1A 3GT4A 1RABA 3BFPA 3BWMA 4ND4A 4CG0A 4YCSA 1JAZA 1R10A 3Q7TA 3VH3A 2FQWA 2O0HA 3BVPA 4J6EA 1RM3A 5FYQA 5I6DA 2XX3A 4GI3A 5KJ1A 2IZ0A 2H2GA 4JD5A 2ZJAA 1A5BB 3C3XA 2J6BA 3ZK9A 2P0EA 3ORSA 1KGDA 1NVMB 2QQFA 1T6ZA 4OL0A 1YVPA 4FNAA 3TZKA 1I4LD 1P39A 1CY4A 2FQXA 3EIWA 4LJ6A 5K3OA 1QIMA 2V7VA 3I9V1 3T99A 3VAZA 3ZHQA 1QRSA 1C8LA 1Q5PA 3K1YA 1I1QB 2POQX 4O4JF 2YR0A 5ERYA 1Z6PA 5LB2A 2OGUA 1UQRA 3QZUA 2CXXA 4JUBA 2UYGA 1GKYA 2BMVA 2H3HA 4ZVPA 3MT7A 1ZJJA 2IKQA 1T1JA 2Q1XA 2V6JA 4HUQB 1QK3A 1XZMA 1KQPA 2Z9DA 4I99A 4R0NA 5JQGA 1SCKA 5KIAA 3RYCA 3OOWA 4JBNA 4JI7B 4CMCA 1BMQA 2W6IA 3R7SA 2ZR9A 1JJAA 1YU6A 1EFVA 4DQDA 3TZHA 1UAYA 3M3PA 3CJQA 1P62B 5LWQA 1KPHA 4MIEA 3OLWA 1UM8A 3EIEA 4JC5A 1YACA 1ADBA 3Q10A 4A6EA 3RVSA 1FK8A 1O97D 1OXTA 1SVMA 2CY0A 2JAHA 5C80A 4RJTA 2OAEA 4US1R 4YVFA 3IR5A 4LHXA 5FHRA 1OLXB 5JS6A 5KJFA 5EMNA 2SICE 1UPAA 1Q21A 2WMOB 3FCOA 4NCXA 1WABA 3ICOA 4YV7A 1TQDA 3EQ9A 3OOHA 3K4HA 4W1QA 5F5NA 2GPNA 2R66A 1LSSA 4GO1A 4RCYA 5KEIA 1Q7CA 4W9NC 1EH5A 4YHHB 4IAOA 5I01A 4EPRA 1KI4A 3S27A 2JBWA 2ISQA