4NR0A

Crystal structure of the pseudomonas aeruginosa enoyl-acyl carrier protein reductase (fabi) in complex with nad+ and triclosan
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
259
structure length
259
Chain Sequence
GFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPELCFPCDVADDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRNVTIEEVGNAGAFLCSDLASGISGEILYVDGGFNTTAMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
publication title Crystal Structures of Pseudomonas aeruginosa Enoyl-ACP Reductase (FabI) in the Presence and Absence of NAD+ and Triclosan
doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 90
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4nr0A00
4C4OA 2GZ3A 2I99A 3G3EA 4CR6A 3HG7A 5ICMA 3CMCO 2NVUB 1IY8A 3ANMA 1H0KA 1ARZA 1PWXA 4BOYA 1NM5A 1ID1A 3D4NA 5COAA 3D4OA 2FMUA 4IDGA 3O4RA 4RL6A 4HFNA 2EXXA 1MX3A 1KC3A 5DBFA 2FHSA 1FJHA 3EYWA 4PZCA 2C2YA 4B3IA 1H2BA 4DC0A 3CEAA 1DJQA 3G0OA 3RFTA 1YH3A 2QZZA 3BMQA 3PJFA 3QY9A 4MP8A 4W7HA 5CDYA 1PGJA 3GVHA 2Y68A 2VZ0A 3CZMA 1NVTA 1E1LA 3LYLA 1A7KA 1IZ9A 1Y1PA 3LF1A 1XCBA 1P1RA 3PZBA 2J5KA 4DLBA 4D46A 2QW8A 4OOEA 3UH1A 4D41A 2NQTA 4XGNA 4YA6A 1ONOA 4DPLA 4UAGA 4ZA2A 4GQAA 4MDHA 2AE1A 3SLGA 4DQVA 2PTGA 4ND1A 4J1TA 3L07A 2HU2A 3OQ6A 4ROSA 1NPTO 4XIYA 1DC5A 1UXJA 1YB5A 3JQGA 3MJSA 3WTCA 3G49A 4BO7A 4L74A 4FOSA 1GUYA 1LBEA 2G17A 3ZI0A 4PLYA 4IJUA 3AFMA 1T2CA 1OFGA 1R16A 5THQA 1XU7A 3C1OA 4TMFA 2O48X 2P4QA 3B70A 3JQ8B 4WKGA 1KEUA 2YV1A 2P4HX 4L76A 3MTJA 1G0NA 4AJ1A 2FOIA 2OL4A 4GLLA 3CINA 1F17A 5TRTA 5EPOA 4J7CA 5JC8A 3PI7A 4MVJE 4D44A 1E5QA 4RV9A 3ZHBA 3C7AA 3ON5A 4K28A 4BNWA 2X9GA 3LZ6A 4U6QA 4ALMA 4GX5A 1F0YA 3BMOA 1IE3A 2IYOA 4GKBA 4NU6A 3F4BA 4MJLA 1ISGA 4BO1A 1HYHA 1J4AA 3RJ5A 3S2EA 2NTNA 1YS4A 1Y5MA 3JCZA 3ZU5A 1XLTA 2IEDA 4C7JA 4PRKA 2CVQA 5ER6A 1EDZA 2ZB3A 1EE9A 4ID9A 4CM6A 5I7SA 1B0AA 1MC5A 2FR0A 3GLQA 4XR9A 1HDRA 1AGNA 3U0BA 3WLEA 2QZ9A 1A27A 4BV9A 5IN5A 5TJ9A 2RH8A 3ZN2A 1ISIA 1Y8RB 2WTBA 4NQZA 4PLHA 4AJIA 2C0CA 4ESOA 4FIZA 1DIBA 1ZXBA 2C54A 1PX0A 1QYCA 4KTVE 4WGGA 1GQQA 1HRDA 2VWHA 3NRCA 4DIOA 1LDBA 1K0UA 3PHGA 1E7YA 4DPKA 2WYWA 1BMDA 4BNXA 1XWFA 2XAAA 1PU2A 2VYND 5A05A 1W8DA 4E5NA 1I3NA 1UZNA 1RM3A 2V6GA 2YHIA 3K5PA 4L4RA 2PA3A 3JQGB 4HFMA 3S1LA 3O03A 1O89A 3MJTA 4HX5A 1JWAB 1R0SA 1RPNA 3DZGA 3FBGA 2VZ9A 2FR8A 2Q50A 4FN4A 3RUHA 1DFHA 3SC4A 1Q2XA 4OOFA 2NVWA 4ND3A 1DEHA 1AE1A 2ZYDA 4KOAA 3O8QA 4KDEA 3OBBA 1K89A 3QVWA 4DGSA 1Z74A 5DZSA 1FXSA 2EKLA 3VPGA 3HJAA 2OXIA 2DC1A 4D3FA 3GEGA 2C5AA 1ZSNA 3RU7A 3K92A 3WGQA 4CMHA 1UZLA 1WLYA 4NPCA 5B4TA 3M2TA 1C1XA 4PG7A 3E82A 5JMWA 3QWIA 4JQCA 4M54A 5CDSA 3JD2A 3BMOB 4U7WA 3ROQA 2CY0A 3NJ4A 1VRWA 2UV8A 3LC2O 5JY6A 4XJSA 5L40A 3ZWCA 2WWRA 1C1DA 2YDXA 1I2CA 3TFOA 3BTUA 3W4IA 4MOWA 3DZHA 1J5PA 4PLZA 1P44A 1H2HA 3VKVA 1GYRA 2EW2A 1MFPA 3HDQA 3DXFA 3ZWAA 4E4YA 4FW8A 4OIMA 3M1LA 3AWDA 1NR1A 4IMRA 4M8SA 3BHJA 5FI3A 4KQWA 1VSUA 4LRTB 3ZWMA 1ZUD1 4M89A 3ZV3A 4MP3A 1T2AA 2OZPA 3WGYA 3CIFA 5JYEA 1B8UA 2NTJA 5JAQA 3WQSB 4GX0A 3UXYA 3KYDA 3KUXA 4J3FA 3MTGA 2VUSA 1QR6A 4MVJP 1Z7BA 1TXGA 3MCVA 2DBQA 4L0QA 4PLFA 4DPMA 4R1NA 5GZ6A 5A9SB 1HDCA 3Q9NA 2VHZA 3DMYA 4LN1A 4RVGA 1E3LA 2ZYGA 1PGPA 2E6UX 2YHIB 4J1QA 4BKOA 3ZU4A 2XXJA 3PTZA 3EY4A 5JC1A 4RVHA 2CF6A 3OIDA 4PVCA 4P4GA 4WLEA 5BSEA 1RWBA 2NU6A 2P91A 4NFHA 2X23A 2YUTA 4R3WA 2YYYA 5I7EA 3FCOA 3O8QB 3AU9A 3PJGA 1U9JA 2Y1EA 4AJ4A 3H9QA 2P9EA 1R0KA 3WWZA 2OBNA 3GMSA 4HBGA 1JU9A 4CM7A 4F46A 3FNEA 1H9BA 1VKNA 4IDEA 1WDLA 1YL7A 1LRKA 3GDGA 4B3HA 3KYBA 1NQAO 1EBFA 3PHJA 1ISFA 4Y67A 3ZNPA 2Y05A 4M55A 3JQEA 5JBIA 3D64A 1Y81A 2IXAA 3T7CA 5DCUA 4OAQA 2LDBA 3GUYA 1QXSA 2QQ5A 3V5NA 1E3WA 2PKQP 3NGLA 4BKUA 1B2LA 3E8XA 3PQEA 4N18A 2X0NA 3KBOA 1PJ4A 1QP8A 2W2KA 4QTZA 1NBOA 5C37A 3CKYA 4J9VA 3I1JA 3WG9A 4Q39A 4EEZA 1MG0A 1CIVA 1LRLA 1TB4A 4XYLA 3WDSA 3IDSA 3JQCA 4EUEA 4QX6A 3K6JA 1A5ZA 1U28A 1P31A 4BNKA 1B3RA 5T64A 1R66A 1M76A 3TFQA 4D3SA 5GZ1A 2OO5A 1AXGA 4IIUA 2Q4BA 2V6BA 5KJFA 4Y6SA 2IRWA 3U4IA 4E33A 4UVIA 2GD1O 4HNGA 3ZNOA 5KVQA 3IOYA 3SJ7A 1W0CA 4DMMA 3PJEA 3DAFA 4J2HA 3IL2A 3QP9A 1UXKA 4GBJA 4OL9A 4BV8A 4CLOA 1LLCA 1WMAA 4QFDA 3UICA 4J1SA 4R54A 4B8WA 4QXMA 1LQTA 4DQUA 4U0KA 1QKIA 4GGPA 2DT5A 1HT0A 1R6DA 3N58A 1KVQA 1M75A 4H3VA 4XYMA 3OA2A 8LDHA 2HMWA 3R3JA 5IAAA 4N5MA 3GT0A 3W8EA 5MDHA 4UUPA 1T4BA 4YDRA 4YQZA 1ZFNA 1PJSA 3HN2A 5LC1A 1YJ8A 2ZIZA 1ZBQA 3UCFA 4LCEA 2O2SA 2HK9A 4XYEA 2DVMA 1MGOA 3GHHA 2Y1OA 1PSDA 4CLEA 2HJSA 4BNMA 2CF5A 3VOSA 4D45A 3VPXA 2A35A 2FR1A 1UJMA 3R1IA 1KC1A 2IEBA 4MVJF 4W4TA 5A3JA 5JE8A 3H9JA 3D4PA 1HDGO 4RDHA 3LT0A 4L9RA 4M86A 4MO2A 5KKAA 4GSKA 4LVUA 5IZCC 4QEDA 3PZRA 1NPYA 2CMDA 1IPFA 2BRUA 4PLTA 3TZ6A 2HO5A 2WD7B 3HDHA 4BGEA 2ZB8A 3L6DA 3AFNA 3L77A 1SBYA 5AOVA 4E21A 1ADCA 4LK3A 4CMIB 3GH3A 4GWKA 1YB1A 4QO7A 2EP7A 1IHYA 2RBEA 3PDJA 4GSLA 4HXYA 5B37A 4ALNA 3RUAA 3C7CB 2I9PA 1EVZA 4YPOA 1XU9A 1SO8A 2YJZA 3BMNA 3U9LA 3H2ZA 2X86A 2XXBA 1X1EA 4J2OA 3KYCA 1JTVA 4CLOB 1X15A 1D1TA 3Q9UA 1GDHA 4GL4A 5BQFA 3UCEA 3WJAA 5CAEA 3DFZA 4R69A 2RIRA 3OH8A 3MEQA 3ZWBA 1BVUA 4HNHA 3JYOA 5I9MA 1BDMA 3DHNA 3K8ZA 2O50A 4TRMA 3R6DA 2GUGA 2WE7A 4J7XA 4YRAA 3ZU2A 1Y5RA 2EERA 4EUHA 3PPIA 1CEQA 4HKTA 3ZZNA 1XHLA 1P0CA 3D1LA 4MVJG 4NH4A 4B79A 4BKRA 1Z82A 3AI2A 3MJVA 1U8FO 4IJKA 5G4LA 2Q1WA 5U1PA 2VWPA 4TRNA 1F12A 1YKFA 2IDZA 2VUUA 4IQ0A 3JQFC 3OJ0A 3ORFA 4FGWA 4PVDA 4CUKA 4G5HA 2I3GA 1MA0A 2J5QA 4WJZA 1ZKMA 3AY3A 1ZVMA 4WLFA 3ZWOA 4O1MA 1E3EA 3BHIA 1CYDA 4XX0A 3Q6IA 2Q45A 4MPDA 4IJVA 3HDYA 3TOXA 5L9AA 1MG5A 1N2SA 3DONA 2E37A 4ND2A 4EGFA 2FRDA 3WGGA 5A5FA 1X7HA 2VNAA 3H4VA 4RF3A 3GC6A 5KJCA 2Y1FA 3JD3A 1UR5A 2X58A 5BT9A 5L95A 3VH1A 4CV2A 1E6WA 2OGUA 4N5NA 1BXGA 3EHEA 4E31A 4DQXA 1U2GA 1I2BA 2DUUA 4CM4A 3H6KA 3TOZA 5JO9A 3QHAA 1NYTA 4BNNA 3VZPA 1WDKA 1JVBA 4CMKA 4GVXA 3NUGA 4JBIA 3W4KA 1GV0A 2HMVA 3DZKA 3E5RA 1EFKA 2CDBA 2DTEA 3FN4A 3L4BA 4FBGA 4KDFA 4TKLA 3NYWA 4B8ZA 1Y9AA 2NADA 4CQLB 4RPJA 1N9GB 2PZMA 3DMTA 3NTQA 4CLRB 2WD8A 3GN2A 4EJMA 1MXHA 2GO1A 4YVFA 1DIHA 3Q11A 1GYQA 4E2WA 1JAYA 1FMCA 4CL8A 4XRRA 4DMLA 3FWNA 1XG5A 5A02A 2C7VA 3IUPA 3I4FA 1PR9A 4M87A 4QFCA 1NASA 1UDAA 3GUCA 4LRSB 2FSSA 1V3UA 1HDXA 1UP6A 3DBVO 2HRZA 1Z7EA 2FPGA 3TQHA 3AY6A 1Q0QA 1YB4A 5J23A 2AE2A 3L6OO 1A72A 5I9LA 1EUDA 4YYZA 3CPSA 1R4NA 1GEEA 4JBGA 2SCUA 1OBFO 4E0BA 4W7IA 3VHRA 4D7AA 2OHXA 1TI7A 4XGIA 5DCYA 1Z6ZA 4WOKA 1BXZA 5IF3A 4JP3A 3QWFA 5T6BA 2V7PA 1UH5A 4A03A 5JDIC 4DUPA 3AI1A 5JDCA 2FP4A 2GLXA 3GZ4A 4Q9NA 1Q7GA 1PGQA 1RM5A 3CTMA 2Q99A 2A94A 2YV2A 3RIHA 4R4JA 4A27A 3VTZA 2HMUA 1X0VA 1C0KA 4YJFB 3RBZA 5CEJA 2VRBA 2NVUA 4M49A 3RWBA 2FN7A 2WM3A 3W8DA 2PR2A 2OOSA 3GFBA 3ONEA 4UVDA 5JW6A 2C07A 2QRLA 2Y0CA 3NTOA 5LDHA 4CQMB 1DAOA 4BNTA 4E6PA 1N7GA 1Q7CA 4OH1A 1WW8A 2YQ4A 1VJTA 3O9ZA 2HDHA 5BSGA 4DBZA 3DHEA 4GPD1 4Q3NA 6ADHA 2VHVA 4BKPA 3VZSA 2YW9A 1AUPA 3HFSA 1Q0LA 7ADHA 2PGLA 3OM9A 3IKVA 5KJEA 2QRJA 4JJGA 1NHGA 1A4IA 3M1AA 3GEDA 3I83A 4P38A 4PG5A 3VH2A 4CLHA 3LT1A 1Y7TA 2VT2A 1YO6A 2I5PO 3RC1A 4FB5A 1SEPA 3EAGA 2PZJA 1CDOA 4WCDA 4YRBA 1JAXA 1U5CA 3P7MA 2BFPA 4YAKA 2EKPA 4TVOA 4WPGA 5EESA 4AJOA 3D7LA 1VI2A 4NBWA 1LA2A 1SC6A 3UVEA 5ILOA 4ZQEA 4I08A 5FWNA 3JSAA 3FD8A 2CSUA 3TNLA 2BKAA 1C0LA 1V8BA 3WR5A 5A1TA 1NX6A 1ZK3A 1DFGA 5L7TA 3P2YA 1NQOA 2DPHA 4D79A 2EJWA 2JCVA 3LU1A 3JQ8A 1EE2A 3QWBA 4LGVA 4Y8VA 3ROMA 4NFYA 3A9WA 4RPLA 5HTOA 1SCUA 4L4SA 3VPHA 1H9AA 1T2FA 3F5SA 1N1EA 3HQ4O 5ER9A 2JFHA 4XR4A 2AEJA 3WTBA 4FSHA 3BIOA 4CLDA 4D43A 1X7GA 4ONEA 3ETGA 5C5IA 5JS6A 1EVYA 4PN3A 3HADA 2VWGA 1CERA 3JYPA 3P19A 1MUUA 4E13A 2JFFA 3D3WB 2H63A 4GVLA 1JN0A 4PLWA 5TIIA 3VH4A 4J0FA 3SBOA 5I8WA 4K6CA 3KV3O 4FS3A 5C7LO 4XRGA 4YBZA 4JX8A 1HTBA 4RCVA 4ZRNA 3PWKA 2B4QA 1XKQA 4LMPA 3DOOA 3FPLA 4TSKA 2XPCA 2BHLA 2B4RO 3MZ0A 1SB9A 1QLHA 7MDHA 4EJ0A 4M1QA 4OKIA 1N5DA 3HUDA 2X0RA 2Q49A 4YB8A 1X14A 1Z45A 2OP0A 2VOEA 4RGBA 1M6WA 2IE0A 4MVJA 1Y8RA 3RAJA 2EG9A 3QJ5A 2NLOA 1DO8A 2JL1A 1G0OA 5F3RA 3H65A 5L4SA 1KYQA 3KXDA 3W8FA 3X2FA 1PZEA 4JNKA 5B4UA 3ENNA 2NU7A 3TSCA 3UW3A 1LEHA 4J43A 1I36A 2RAFA 3GY0A 4MVJM 2PY6A 2B0JA 3COSA 4XQEA 4XQCA 4II2A 3UGKA 4G81A 1EK5A 2F00A 5L4LA 2VYVD 1CETA 1NQTA 1P1FA 4RQUA 3PLNA 3AY7A 1K6IA 2YFQA 1XQ1A 3WICA 5G4KA 3ETEA 4XZ3A 3G17A 1KS9A 4NMHA 3RSHA 4TZKA 4DWVA 4B7UA 5EJ2A 5HWSA 3TJRA 4H16A 1WZIA 2H1SA 1I5RA 1AN9A 2V6FA 3RD5A 1ML3A 4YJHB 3K2EA 4E5PA 4JROA 4RO0A 4DTIA 1PJ2A 2DFVA 2EHDA 1ZMOA 5EQFA 4ITUA 3KEQA 4MINA 3GNQA 1BHSA 3WGOA 1RKXA 2DU8A 3PWSA 4FCCA 1DDOA 1YBAA 4XJTA 1QMGA 4IJWA 4Q3BA 4IIVA 2Q4EA 1GL3A 1HKUA 2Q1TA 4IXTA 2B5VA 3I6QA 3ZDFA 5A3VA 1GQYA 3VVCA 3ZV4A 3ENKA 3FR7A 1PJ3A 3AOEA 4BO0A 3DC2A 3H3JA 3EW7A 3I9KA 1I3MA 5HRUA 3JQAB 1HE5A 3ZNQA 3KHUA 3BTOA 4BNVA 1XSEA 2PFGA 3Q3CA 4YT5A 3AM4A 1PJTA 2J8ZA 5EINA 3JYLA 3DO5A 3OIFA 4ALLA 4PIVA 1UDBA 4OQZA 4W82A 3QVSA 3I52A 1W4ZA 4BO4A 3TL2A 4I5GA 1U8XX 1UXHA 1SOVA 4OO3A 5DCWA 4WLUA 1NNUA 3Q2KA 3BTVA 3WIDA 1YONA 3G1TA 4GLOA 5TSDA 5K6AC 3DWFA 3PGJA 1EBUA 1DJNA 4OHUA 5AVOA 1I0ZA 4K1LA 5BNTA 1UAYA 2B69A 4JJIA 3GGOA 3DZBA 3GNTA 4CM9A 2VRCD 4TROA 5A9SA 3HB5X 4PG6A 5IDXA 3VDRA 1IHXA 1WMBA 3DL2A 4Z9XA 5AXBA 5G4KB 3SXPA 3BAZA 5K9ZA 3SEFA 1JDJA 3WS7A 1CJCA 1T4DA 3IS3A 2DUWA 2A92A 4I5EA 1ONNA 4MIYA 2B5WA 2D0IA 4IBOA 5TLSA 4NJOA 5CDUA 2BELA 3FR8A 1CQIA 4EW6A 4FFRA 4J9UE 2ZB4A 3B1KA 1WPQA 3Q1LA 4E32A 1J49A 2CD9A 1FDWA 1V0JA 1HYGA 3JQDA 3KVOA 5EN4A 3RFXA 4DA9A 2PZLA 1B8VA 2G76A 4LVCA 3BMCB 4PLGA 1GUFA 1EZ4A 4IQ8A 3VH3A 2WYUA 4R1SA 1DHTA 1MLDA 2Z1MA 4ZU3A 5I7FA 1EMDA 2JAPA 5JY1A 1DIRA 5AXDA 5A4DA 1ISMA 1PS0A 1YQGA 3LVFO 4O59O 2OUIA 2P5UA 1ZJZA 2D1YA 4YTEA 5G0VA 1HE3A 5C3MA 4KQXA 2HK7A 3QWAA 4Z0PA 2PD4A 3JYNA 3WLFA 5G0SA 3FWZA 3H8VA 3UKOA 2ILTA 3ZWWA 2C29D 2QRKA 1MB4A 2NV6A 1GZ4A 4S3MA 5JFOA 2X5OA 3GPDG 1PWZA 1WZEA 3I23A 4FD3A 1U7HA 2X0IA 4CMBA 3NAQA 3E1KA 4Z3KA 1GV1A 3UOGA 5ES3A 3ZH2A 1R12A 1B15A 1PQWA 1BVRA 1EK6A 3LSYA 1CF2O 1PZFA 1U3VA 5GZ3A 1MFZA 1Y8QB 3JYQA 1GFSA 4OXKA 5CPBA 4CMEA 1GY8A 4RPKA 2UYYA 2EIHA 1TLTA 1XELA 3EDMA 4GX1A 4BNJA 1LC0A 4BNYA 2GN4A 4PRLA 2C5EA 2PGDA 3F9IA 1KVUA 3JQBA 4JIGA 3DTTA 5CPFA 1DSSG 5JCJA 1KVSA 4J7UA 3DBRB 1JA9A 2VYNA 5HS6A 2AMFA 1NWCA 1OOEA 4DREA 2Q2WA 4NNJA 1K6JA 2VHYA 4H15A 1J6UA 3I9MA 2VHXA 3BXXA 2G1UA 5CG1A 2EEZA 4DIFA 1ENYA 2BFMA 2O7QA 2GGSA 5EMHA 4KTTE 3DTYA 3ZHZA 1SNYA 3F3SA 2BMAA 2VUTA 2O3RA 3B1JA 4WCFB 1KEVA 5KKCA 2JD1A 5I9NA 2PNFA 4KZPA 2BH9A 3AUUA 2NQ8A 5H83A 3FTNA 3AU8A 3LT4A 4ZQGA 2JFGA 4DLAA 1B7GO 4E2XA 1O0SA 1EFLA 2Q2VA 2WEKA 3GVXA 3NT2A 4U5QA 3KETA 4B4UA 4RVDA 4AG3A 5ITWA 1WP4A 2J3KA 1XQ6A 2R6JA 2DQ4A 1KVTA 4J90A 4DRYA 5TNXA 3WWYA 4XQGA 3OP4A 1G6KA 4NZ9A 4LW8A 1H6AA 4K6FA 4AL4A 3GQVA 1DIGA 5COBA 1AHHA 5A5EA 2UUPA 4WASA 3RFVA 1Y9EA 3HFGA 2NVBA 4HY3A 4OGWA 4ZQBA 2JD2A 4NBTA 5L53A 3ITDA 3GGPA 3E9QA 2WD7A 1ZW1A 1YOVB 1F8GA 1FDVA 3EVNA 3SC6A 4OYRA 3ZV6A 3BZUA 1HZZA 1LDYA 1ZMTA 2UVDA 3LQFA 3M6IA 4WLVA 4CMIA 1FDSA 3V2GA 2XF8A 3LK7A 3KOUA 4XYGA 1HWYA 1KEPA 1T1SA 3HZZA 1LSUA 4L8VA 3WNQA 4E5YA 5BNIA 4J91A 4BQRA 4KUEA 4CODB 1IYZA 4XYBA 2FPIA 3DAGA 1E6EA 1I2ZA 3ROPA 1P74A 1SMKA 4R41A 2XOXA 1G1AA 4ND5A 4R01A 2UDPA 4R5HA 3TZKA 3WGIA 2WJPA 3EC7A 1YWGO 3LC7O 3GMDA 4FGSA 4A10A 4FR5A 4YAIA 1LSOA 2I3AA 4GX2A 4PG8A 3IQDB 3WIEA 5T8KA 3AM3A 4BO3A 3OFSA 1DHRA 2Y67A 2Y0DA 3GR6A 5FI5A 1QYVA 2HLPA 2ZJ1A 5DT9A 5EL0A 4CM8B 1LDEA 1T1RA 5IG2A 3D5QA 1LC3A 1P3DA 1PZHA 4YWJA 1P9LA 2EJVA 1RYEA 5C7IO 3HHPA 3INRA 4U0JA 4F6CA 1N7HA 3OQ1A 1QYXA 2ZQYA 3GFGA 1YL6A 1JVSA 2W2LA 3B6ZA 4IPTA 1V35A 1BG6A 2UAGA 4IXWA 1E77A 3NT5A 5G0UA 3WYBA 3OJFA 2HK8A 5L45A 3MJ4A 1D8AA 3GEMA 1U7TA 4RF2A 4CUJA 1R0LA 3C7DB 2RH4A 4INAA 3IKTA 2AW5A 5JO0A 3H5NA 2ZQZA 2I65A 5EIOA 4AJNA 2D4AA 1EVJA 3D0OA 3NX4A 1AHIA 3QE3A 4W9NA 1HLPA 1DRUA 1WNTA 3DZFA 1XEAA 4X54A 5HS4A 1SZJG 5L7YA 2A9FA 2ZKLA 4HFJA 4IQGA 4CQLA 1NXQA 1N9GA 4OJNA 3WMXA 4G65A 5JXWA 2PH3A 9LDTA 3IUSA 4W6ZA 5TGDA 2GERA 3I5MA 4CLRA 3MOIA 1RJWA 3IP1A 3OECA 1ZO8A 2X0JA 3S2FA 1DC4A 1I24A 4PLVA 1BSVA 3U62A 1UDCA 3MWEB 2RCYA 4YRDA 3WSVA 3JQBC 1GEGA 4ZHSA 4PLPA 1NQ5A 3ABIA 5A9RA 2JAHA 4P4LA 5CFZA 4MIOA 2GF2A 1DAPA 3F4LA 1T2EA 1KERA 4CL3A 1X0XA 4EI2A 5LCXA 4XKJA 1E3JA 2QG4A 3QA9A 1C3VA 4GH5A 1JKJA 4R68A 1VJ1A 4AJKA 3DFUA 2BLLA 1LLUA 1R15A 5HM8A 1E7WA 1P1HA 3DHYA 5KCZA 5T5QA 3ICPA 1HEUA 1YE3A 3RC2A 1ISHA 5DN9A 3OICA 2RHCA 3QV1A 1OZAA 1UZMA 2VZ8A 2HJRA 4CV3A 1ZJYA 3DBHA 2I6TA 2VCYA 1O6ZA 3AK4A 3GVPA 1PGNA 2FZWA 3BHMA 4FFLA 5U4QA 1ADFA 4ZD6A 3TL3A 4BO9A 1ZIDA 2JCYA 4WNCA 3NDRA 1IUKA 4A2CA 2AHRA 3KSDO 2X6TA 3PIDA 4Q3DA 1P33A 3LC1O 4Q3CA 3NDJA 5A04A 3S2GA 3S2IA 1YBMA 1E6UA 4JJFA 3A4VA 1Z73A 1B16A 4RZIA 1M6HA 4YJFA 2CNBA 4D42A 4YAGA 5EQDA 2VT3A 3UUWA 3SJUA 1SPXA 4JGBA 4NDNE 3WMWA 5BNFA 1D7OA 1B14A 5KOIA 4Y98A 2EW8A 3O38A 4E30A 4CQMA 4JN6B 4YAJA 1JWBB 2WE8A 3H2SA 4ZRMA 5FEUA 4NR0A 4O63O 4IDCA 3DR3A 1GZ3A 4RF5A 2DM6A 4A0SA 2ZB7A 4IGFA 3F1KA 4OSPA 3D5TA 5T57A 1I10A 1TT5B 1NWHA 2ZTMA 4JBHA 4XB1A 1A9YA 5B1YA 2AG5A 1DRWA 4YQYA 3UAGA 1QYWA 4RVFA 4O0LA 4Z0TA 1KETA 4KMSA 3V1YA 3F6YA 4FJ1A 1LDGA 1O94A 4J16A 4KP7A 1B26A 1U4OA 2H5LA 4XIJA 1PEDA 5K0ZA 2W98A 2OORA 3GZNB 1GAEO 3DOJA 4FJ2A 4BS9A 4JP2A 3NJ8A 2ZCUA 3R3SA 3AJRA 1ZH8A 4RLHA 3ZWVA 4CR8A 4RVUA 4EDFA 9LDBA 1HF3A 4EUFA 1E3IA 3WFIA 1BTOA 1ZZEA 1I33A 3ZW9A 4IZHA 1K5HA 1XGKA 3DDNA 1VL6A 2OFPA 3T4EA 3DBHB 4PGFA 5JAIA 5JAZA 3FNFA 5G2OA 4YT2A 3V1TC 3WNVA 2GDZA 6LDHA 4PZDA 3QVXA 4Q3EA 3G1UA 3RBVA 3A1NA 1EQUA 4UULA 2PKRA 3W6UA 3WBFA 3ZWNA 2D5AA 1H94A 4QQRA 2O3QA 3CH6A 4PLCA 1LSJA 3JQ7A 1BW9B 3Q0EA 1DRVA 3D3WA 5F5LA 2OP1A 2EGGA 3VVBA 2I76A 1H93A 1LTHR 4OKNA 4RZHA 1L7EA 2BGKA 4O6VA 5C7OO 4Y9DA 3IP3A 4E5MA 4P4NA 4EZBA 1DC6A 1EVIA 1NAHA 1P1KA 2Y0EA 3EUWA 4H7PA 4UUMA 3R0IA 2PKQO 3RBXA 4GAEA 3ONDA 4W9NC 3CXRA 1Y6JA 2J3IA 1ENOA 2H9IA 3NV9A 3PIIA 4CPDA 1OC4A 3D3EA 4BNGA 2FSVA 2JJYA 4IUYA 2E82A 2GCGA 4Z6KA 2C7GA 3PJDA 1N1GA 2CVOA 2D5CA 3RUIA 3KLMX 2X7HA 2Z95A 1H6BA 3OJLA 1QLJA 3ICCA 1NFRA 3JD1A 4BB5A 2X1HA 1I3KA 1T24A 5ENDA 4KWHA 1HDZA 5GY7A 2WSBA 3U4DA 3ZGYA 1DC3A 1FF9A 4JLWA 2Q1SA 1E0DA 4E2ZA 3UHAA 4MKZA 1Q7BA 2FWMX 3NTRA 2GPTA 4TRRA 4AJLA 1GYPA 3RROA 2P9GA 4MVJD 1N8KA 1E7RA 1U1IA 4RPHA 4LMRA 4C7KA 2YQ5A 3IC5A 3L9XA 5JLAA 5B4VA 1XR3A 5AQ1A 1VSVA 4I5FA 5TF4A 3VZQA 4RJTA 3DOCA 1KOLA 1E1NA 3AUAA 3BYZA 3IIEA 3RUEA 3TZCA 4B4VA 2DPGA 1RM4A 3AUTA 5H81A 1R4MB 2J6IA 3H5AA 1CQJA 3UFXA 4YJHA 1C0IA 2C2XA 2CZCA 3GF4A 4BO6A 5TT1A 1PS9A 2ZTUA 1D3AA 3RUDA 2Z5LA 2G82A 1I32A 2AEFA 5IXYA 5TT0A 5B12A 3OIGA 2NWQA 3WXBA 3JQ7B 5MGBA 1YQDA 5JPIA 1QV6A 1U2DA 3JQAA 2V6MA 2R00A 3LDHA 1VLLA 4XB2A 1K6XA 1M66A 5BSFA 4OM8A 5AYVA 1M67A 4FFOA 1CWUA 4YT8A 4F6LA 4I8XA 2W8ZA 3L4BC 3ASUA 1Q1NA 4BMSA 1DFIA 2YFHA 3KO8A 1QORA 3AW9A 3DMTC 3ZV5A 1GD1O 1NR7A 3VDQA 3H9EO 1P1JA 1EQ2A 1U4SA 2Y66A 2O3SA 3JQ9A 3TF5A 1QV7A 3CSDA 4XEHA 3E48A 5JNLA 2X8LA 4ALIA 1U5AA 1E7MA 3RUCA 4LISA 3SLKA 1GUZA 4EYEA 4NI5A 1WVGA 2UUOA 1E5LA 4A5OA 2CDAA 2EV9A 1HSZA 3MOGA 4IS3A 5CEFA 2Y1DA 2NSDA 2PD3A 3FPCA 2CUKA 1YJQA 4WEOA 2QYTA 3KZVA 4XWYA 2VTEA 1MV8A 2GN6A 1PIWA 2QYSA 4XGKA 1UP4A 3RCBA 4I5DA 4CM9D 1QG6A 4OQYA 4BB6A 1GADO 1VC2A 3L9WA 4U6SA 1QRRA 2X4GA 3PDUA 4J0EA 4BHTA 4R51A 1LJ8A 2CDCA 5JDCC 1JQBA 4HUJA 2ZATA 4CM1A 1LLQA 4TQGA 4B4OA 4WLOA 4ZICA 3BMCA 2Y1GA 1GZ6A 1TEHA 1H6CA 4R5MA 1E1MA 3U5TA 3HB4X 1PGOA 4RF4A 2DLDA 3KB6A 2RHRA 3QW2A 1X13A 2AA3A 3Q2IA 2AQ8A 2NNLD 4O5OA 1DOHA 3OF2A 4P8RA 5DBIA 4NK4A 4MKXA 3B1FA 1NVMB 4BNUA 4DVJA 2DBVO 3I3OA 2GRAA 4WLNA 3PHIA 3NKLA 1V3VA 1B8PA 2QX7A 3NT4A 4IM7A 3WGTA 3DBLB 3IMFA 1F06A 2GR9A 3RU9A 4U8GA 3T4XA 3EZYA 4DC1A 2H6EA 1A4UA 2HRBA 4QT0A 2CFCA 4IZIA 2X9NA 4YJGA 1ZEJA 1P45A 1VL0A 1E1KA 4CM5A 3E6AA 1YGYA 1XDWA 4Z9YA 3F1LA 5EERA 2NM0A 5KVCA 1BDBA 3ST7A 3WYEA 5COQA 4II3A 4RORA 2CVZA 2HMSA 3PEFA 2GNAA 1Y8QA 4FDAA 4F45A 2PLAA 3WQRA 2C20A 1K3TA 1BRMA 2C59A 2EF1A 1GQ2A 1ISJA 2X5KO 1U3TA 3GAFA 3GPIA 1A9ZA 3OSUA 4B3JA 2Q2QA 3RASA 1PQUA 1K2WA 2V65A 5DULA 3BMQB 4UVGA 1U3WA 3HE3A 1ULUA 4XD2A 1ZSYA 4RVSA 3I9JA 2X22A 3DBRA 4FPXA 1V9LA 2VYVA 4IY1A 4B7XA 1DB3A 2O2YA 1XIVA 5DOZA 5DP1A 3WSWA 4D3DA 2Y99A 5KNLA 1AXEA 2Y93A 3ITKA 1PZGA 3CZRA 2DTXA 1YDWA 3GAZA 1PQPA 5GMOA 2TMGA 5JCJD 4DYVA 5BR7A 1LI4A 1PR3A 1SEVA 2P2SA 4WCFA 4IINA 5TX7A 2WDZA 4Z0HO 1J0XO 4E5KA 4UVHA 1BGVA 1HL3A 2BFOA 1E7SA 1V6AA 3MJCA 2W4QA 3TZHA 8ADHA 2E48A 1JW9B 4OMUA 3HN7A 3EGOA 4AVYA 1MC4A 1MP0A 4HP8A 4R1UA 2R00C 4K9DA 1ENZA 4YACA 4OXNA 3ULKA 4EEXA 1GPJA 5JAMA 3VPFA 3DZIA 1YL5A 5ITVA 4FFMA 4ILKA 1C0PA 2TMDA 3H7AA 4BO5A 5I7VA 1WWKA 2OMEA 1SB8A 1LQUA 1ZK0A 3ZU3A 5L7WA 4BGIA 1U3UA 3L0DA 4GKVA 3ROKA 1GPDG 3AOGA 3ASVA 1Z75A 3FNGA 2DBRA 3RJ9A 3A14A 4YJGB 1FDUA 1ZK1A 4IDBA 1GCUA 4R9SA 1YOVA 5IDYA 2WYVA 2Q1UA 2JKVA 3JQ9C 4AICA 2NU8A 2R2GA 4FQ8A 2VNSA 3U4HA 3BA1A 3PLRA 4KUGA 1B3BA 2IXBA 4MP6A 2BGLA 4MVJI 4WNIA 3FSRA 4IGEA 2HUNA 1PJQA 3ANNA 4Z9FA 3PRJA 3PWZA 4G2NA 4BGVA 4BNHA 5U9CA 3JV7A 1KVRA 1UXGA 5IZCA 3E5MA 1GCOA 1EEHA 4JK3A 2IZ0A 2PK3A 3EZLA 4BGUA 3ZWPA 4CM3A 4J4HA 1DLJA 3C1TA 1X7DA 2VRCA 4FOOA 5F1OA 1YXMA 4GI2A 1DBVO 3WBBA 1GU7A 3T7EA 1PL8A 1TVEA 1NFQA 2P9CA 1PJBA 5CG2A 3GHYA 2Y1CA 4PFJA 1V3TA 4CMAA 2F1KA 4W99A 2GN9A 4L73A 5F21A 1SOWA 5T67A 3GRKA 4MIEA 1T2DA 4CM8A 4LSWA 3WQQA 3E9MA 1NHWA 3HWRA 4IMPA 3BTSA 3GRPA 4N54A 4CLXA 4LSMA 1DIAA 3TN7A 3OA0A 3PFWO 1ZSVA 5IZ4A 3AOEC 3KEOA 2AQKA 3NGXA 1CRWG 4I1IA 4EJ6A 2VTDA 1QSGA 3WGZA 2D3TA 3QVOA 2PWZA 1SAYA 2IYPA 3C8MA 3DZJA 3H3FA 3K96A 2HSDA 1NP3A 2NACA 4TVBA 3IJPA 2IODA 4IDDA 3QIVA 2PD6A 2AEMA 2YZ7A 3C85A 5TC4A 3ZWYA 4QECA 4XDZA 4J1NA 2W2LD 2WMDA 5BSHA 2YHUA 2G5CA 4TRJA 2JCXA 2FPPA 3JQFA 5HBRA 3KLPX 1C1XB 1OMOA 3K9QO 5H82A 4ZJUA 2DKNA 1F14A 2PGJA 1O5IA 2JHFA 2O3JA 2DBZA 2P5YA 1HZJA 1C1DB 2DTDA 1LSSA 1OAAA 2DAPA 4BO8A 4IS2A 1YBVA 4J49A 4MKRA 4DLLA 3VC7A 3A06A 4S1VA 4L75A 4UEOA 1RM0A 3OQBA 1IB6A 3WOHA 4YR9A 1I30A 4J4TA 1ZK4A 3GDOA 3UCXA 4BIIA 1LXCA 1MXFA 3OEYA 4K26A 2LDXA 2HQ1A 4EBFA 2O3TA 3PQDA 1EDOA 4HWKA 1XYGA 1ZCJA 4J6FA 3RKRA 3TDKA 4A26A 1IL0A 2GZ2A 3PYXA 4WECA 3TWOA 1LDNA 3QRWA 5G0TA 5KIAA 4UEKA 3RI3A 4E3ZA 3KYDB 3MWDB 4AJ2A 4BUCA 3O26A 2AG8A 3KSZO 1W73A 5ICSA 3SVTA 4QUKA 2EGHA 5CDGA 5I8ZA 4WCFC 5KJ1A 1GTMA 3KSUA 1LU9A 2DFDA 3IAHA 1LUAA 4JCOA 2W90A 3CUKA 2P68A 1L7DA 1VE9A 1GR0A 5JCXA 5ENVA 4GMFA 1IZ0A 2BF7A 1KY5A 3I9LA 2HMTA 3FNHA 1HE4A 2ZJ0A 4F3YA 4Z3DA 1DLIA 3TPCA 3ZHYA 2J3JA 3VAZA 1P1IA 3FHLA 2B4TO 4Q3AA 5DDIP 2I67A 4GWGA 3EK2A 3GNSA 3H5RA 3ZWXA 3ADPA 3PP8A 5A9TA 1QYDA 3F5QA 1PS8A 3AM5A 1KIFA 1DXYA 2AXQA 4N5LA 3RC9A 1YRLA 2NU9A 5FFFA 4YAEA 1NPDA 3FF4A 5A06A 2EWMA 4WK6A 3MJEA 4FC6A 1H5QA 1ZXLA 5JDIA 3W1VA 3WFJA 3I9OA 2Q3EA 3OHSX 1XA0A 5JYDA 1I01A 1YDEA 5CDTA 5DP2A 1E3WB 1PJLA 1HXHA 1R37A 3ADOA 3K2BA 3NDIA 4WE3A 4CQMD 2W2KB 5AXAA 4CMEC 3U09A 1TT5A 2D8AA 5KVSA 2B36A 2OBYA 3FTPA 1NFFA 2G0TA 1UXIA 1X1TA 4XQ9A 4CV1A 1S6YA 3FI9A 4ALKA 4B4WA 3UF0A 1NVGA 3ANLA 3QSGA 3QWHA 1ADBA 5G0WA 1FK8A 3C1AA 2HAEA 3VZRA 2B37A 3F47A 3GG2A 4HADA 1YQXA 5DNAA 4KWIA 4A7PA 5THKA 2BD0A 3FBTA 3OEWA 4N7RA 1VJ0A 4NFSA 2I66A 4UVEA 3VKUA 2BGMA 4DXHA 3GZNA 4ZQFA 4CV0A 1JLLA 4D0RA 5ADHA 3PYMA 3P5SA 1HSOA 4QSMA 3DQPA 4E2YA 5CEEA 3GN1A 4I9NA 1KBZA 2A4KA 3U49A 1E3SA 1ZNQO 5L4NA 4MVJH 1H6DA 4UUOA 4AJPA 1VM6A 3QVTA 1TT7A 2VWQA 2GZ1A 4YEDA 1N92A 1ENPA 1NTOA 5F5NA 4UUNA 1A71A 1T25A 1EUZA 4AJJA 2YV3A 5IJZA 1F8FA 4DYDA 3KRTA 1IULA 3ZNNA 2HKIA 1BWSA 3VTFA 1D1SA 1M2WA 1UAGA 1JKIA 1P0FA 3I6IA 1TA4A 3IJRA 3U3XA 5FYDA 1BW9A 2ET6A 4GMGA 3STHA 5HA5A 2ZK7A 3GVIA 3K73O 3GDFA 3PHLA 1RYDA 4HFRA 1IPEA 1OC2A 2J5RA 1ULSA 1WXDA 4BKQA 4JXKA 4NJMA 3E9NA 4BQPA 5LDGA 4QO8A 2O3UA 2O4CA 3NEPX 3SX2A 2GSDA 4RDIA 3CMMA 2PZKA 5IDWA 2X5JO 2O7SA 5AXCA 3P2OA 1UUFA 2EKQA 3GGGA 4WOJA 4BMNA 4ZVVA 4P22A 4OSOA 3N74A 2QHXA 3JQ6A 1HETA 3ZHXA 5KTKA 4OXYA 1NAIA 2IZ1A 4RQTA 4DBVO 3PFFA 4NG5A 5IXSA 3C3XA 3DAPA 4ZGWA 1PL7A 4DIBA 1KEWA 3HSKA 4NBRA 3PQFA 3EMKA 4XA8A 1O95A 3GA0A 2BFAA 2GASA 3V1UA 3GOHA 4GGOA 4I9HA 4BMVA 3PVZA 2O23A 3WYCA 4AJEA 1C14A 3PGXA 1PJCA 5TJHA 4CMJA 3OETA 2HCTA 2C82A 5TQVA 3CE6A 5T8KC 1HYEA 4I9UA 1IOLA 1A7AA 1LLDA 3GG9A 4IDAA 3U4CA 3E03A 4CMCA 5IFLA 3BMNB 1PTJA 1ZEMA 5KJ6A 3JD4A 2FY8A 1HDYA 1VL8A 3OMLA 3HNPA 4A73A 4NBVA 2E49A 1S7CA 1R4MA 2VN8A 4URFA 4B7CA 3KYCB 4AFNA 1O9BA 4BO2A 4YJDA 3WX0A 3ETDA 3AI3A 5DF1A 2AQHA 1WAMA 2ZTLA 3M2PA 3K30A 4BNLA 2VHWA 4BNIA 3RC7A 1ZK2A 4CMGA 3GK3A 3JD0A 4IDFA 3L6EA 3S55A 1LRJA 3LLSA 2YY7A 4UEJA 1FDTA 2NTVA 4RPGA 5TS3A 3WB9A 2Z1NA 3OJEA 4R1TA 3EVTA 3INGA 2VOJA 2B83A 3L4SO 3INTA 4TKMA 2FZEA 4R3NA 4NJMB 4BL5A 5A03A 2JD0A 3V8BA 3ZW8A 3LF2A 3AUSA 2YDYA 1E7QA 2IZZA 3RVDA 2POQX 4Y6RA 1WDMA 4FFPA 4BVAA 2VQ3A 5L51A 1YVEI 4WEQA 3S8MA 4NIMA 5IDQA 4EITA 3PYLA 2E4AA 4ND4A 1PL6A 4BNZA 3N7UA 3VPSA 3OJOA 1OI7A 1D4FA 4ZN6A 3JQAD 3V2UA 3W4JA 3G79A 3RQSA 3WGHA 2AQIA 4TZTA 5F1KA 1I3LA 3K31A 5CHEA 2D2IA 2J3HA 2BI8A 2ZYAA 1ADGA 4XDYA 1HLDA 5JMPA 3FRJA 3X2EA 5IN4A 3H9UA 1BXGB 2PV7A 3QLJA 4L4XA 4CM4B 4E12A 5ILGA 1DPGA 3W6ZA 1LDMA 4D0SA 3I9NA 1Q0HA 2GN8A 4ALJA 4R9RA 2JHGA 4DL9A 3A28A 5F1PA 4FC7A 3V2HA 4CJXA 1ONPA 3C24A 4CUZA 1KY4A 2NUAA 2ZTVA 3GVCA 4NK5A 3TZQA 2ZCVA 3PK0A 2B35A 2QIOA 4FJ0A 3RKUA 5FF9A 3RUFA 4WUVA 3TRIA 2GYYA 4PZEA 1T26A 4UREA 3QQPA 3HDJA 3B20A 1ORRA 2BI7A 5K6AA 1E92A 4PG4A 5KVVA 1BXKA 4FFNA 4PCVA 3I4CA 4RLSA 3F46A 1HE2A 5L3ZA 1W6UA 5JSFA 3E18A 4BNFA 4LCJA 1LNQA 4HV4A 3LT2A 4XCVA 4NU5A 2D59A 2PH5A 3WJ7A 3KTDA 1LX6A 5DOVA 1VKOA 4Y6PA 4YXFA 4AJHA 5KWEA 4R16A 3KM0A 2EP5A 4ZQHA 1R4NB 3LLVA 4NHEA 3ZCXA 1L1FA 2X9VA 3ONFA 4J4BA 4YCAA 2Q46A 1VPDA 4YT4A 3PXXA 1HDOA 3PHHA 1I8TA 2O4UX 3JTMA 4NBUA 1JKFA 3DB2A 3DEYX 5DBGA 3H9GA 3DBLA 4KUHA 3UN1A 4CR7A 1O8CA 4TWRA 5CP8A 1EUCA 1P77A 1UP7A
chains in the Genus database with same CATH superfamily
1CY8A 2GZ3A 3C1UA 4C4OA 2PLFA 2E9SA 2ZRFA 3M83A 4MWCA 5DHPA 1H0KA 2PPLA 1ARZA 5EWLB 2L0XA 2Q8NA 2KM1A 4WZBB 1NM5A 5IM4A 1ID1A 3EZ2A 4LJ7A 1FUIA 2AR7A 3T3PB 2RJ3A 1UMBB 4KLZA 4IIEA 3DLCA 4UHEA 2HWUA 1IHDA 3LYHA 3BE8A 3PNBA 1JJAA 1MNAA 4PFSA 4A9AA 4FDVA 2G6BA 1KC3A 2H51A 3NOVA 4GR5A 3WL4A 2JA1A 1S9DA 1XJ5A 2FHSA 5DBFA 3IBFA 1CR1A 1FJHA 3EYWA 3INYA 3M4NA 3OPXA 4DKJA 1EJ6A 3F96A 3FFWA 2C2YA 1IK4A 3E3NA 4DC0A 4DS3A 1GNQA 3ACDA 2PL1A 3G0OA 3T3GA 3KJNA 3RFTA 1YH3A 2QZZA 2QTHA 3BMQA 3QY9A 3OZCA 2HHJA 3DD5A 3AIIA 2IPNA 3EXFB 1E1LA 4KI0A 5HJ5A 1A7KA 4JGGA 4V0QA 3U4GA 1R1DA 5HDBB 1Y1PA 3MQFA 4XIGS 3IHLA 5DO9A 4AP5A 3PZBA 1AG9A 2HBYA 2J5KA 1NMZA 2AUMA 4DLBA 4POOA 4X65B 2JI8A 2OKGA 4K6OA 4ZVMA 2HDNB 5G53C 1WB6A 1XROA 4QOGA 4XGNA 3VNAA 4NECA 1DDIA 1DKOA 2I4RA 3NOQA 4HN9A 3H16A 1JDSA 1MJGM 2WHYA 5JZMA 2REOA 1CHDA 2AE1A 2H92A 2FW7A 4GQAA 4P3NA 3FROA 2PTGA 4W1RA 1O7JA 2K6GA 4TYNA 2D5IA 4J1TA 4ZANA 1QFYA 2AVNA 3ZS9A 1ZM7A 4EG3A 3OQ6A 4QREA 4DCJA 5FKJA 1NPTO 3EY9A 5CA1B 1F2TB 2O8EA 4I5IA 4JLKA 3HRKA 3WTCA 4AC9A 3HSYA 2FW1A 1J99A 2N1BA 1JG6A 4JC5A 1KU6A 5JI3E 1YZTA 1YVUA 1BO6A 1XTKA 1YHNA 3A6DA 3JWIA 4IJUA 4PLYA 3REQA 1MCZA 5BO5A 1M7HA 4NG4A 2CJWB 2O48X 1U7XA 2P4QA 1UKBA 3IDFA 3R3VA 1BHO1 2F67A 3H42B 2GVNA 5LOVF 2G72A 2C5GA 4JKIA 3HXTA 4AY2A 1XTUA 2WU4A 3ELUA 3CPHA 3I37X 3STYA 1XAHA 1QIJA 2P4HX 3E1GA 1ECGA 3NFYA 1G0NA 4L76A 3DEHA 4O2BB 4AJ1A 1G17A 3GEPA 1NI4A 2EJCA 2FW8A 5TRTA 4J7CA 2QX6A 4AO8A 5GPBA 1DJOA 5EVJA 4ZT3A 3A3OA 4QUBA 4CKWB 1FVXA 2VDRB 5JNVA 1QO0D 4A92A 2H48A 3ZHTA 3RYFA 4BNWA 1APBA 1UM8A 1JDZA 4U6QA 4GX5A 3U44A 1FFGA 1K66A 3C5CA 2GA8A 4RSGA 2R96A 3FVTA 4PPYA 2IYOA 1U9IA 2GBGA 4NU6A 3F4BA 4MJLA 1CP2A 2C61A 2W11A 1L4GA 4DDUA 1HYHA 1ESDA 3V3KA 1BD3A 3L7LA 1YS4A 3K6RA 4KX5A 3CF4A 4YLGA 1N6PA 4WDQA 3TLXA 1TYZA 4C7JA 5D7BA 3ZQUA 4JYZA 2A5YB 2PCJA 4TZ0A 5FIUA 2DF8A 3EDCA 4ID9A 1ITZA 1O97C 4WINA 3P8ZA 1MC5A 2FR0A 2FWPA 3U0BA 5CFPA 5IKXA 3D3NA 1WZUA 2QZ9A 2JFNA 1A27A 3PC8C 5K8UA 3O8CA 5TJ9A 1Y9JA 2B7BA 1OPRA 4FDMA 4H7DA 3QKRA 3ZN2A 1ISIA 1RRGA 2V7XA 3DCYA 4ESOA 4ZAYA 3C3AA 1DIBA 1NVAA 4BE4A 4YV2A 2R60A 1AKWA 2UZ1A 3GLUA 2NTEA 1XZBA 3TSAA 4WGGA 3FPSA 1GQQA 1XCMA 2VWHA 3K0AA 2Z6UA 3W5UA 1LDBA 1TU0A 1N77A 1P9RA 1QQ7A 4JR2A 2OAQ1 1DINA 1GPUA 1MAAA 1DQRA 2J4DA 2N75A 4DMFA 2D4HA 4LSGA 2WYWA 1K8QA 1IWBB 3PU6A 1MQAA 1GU1A 2XMCA 4MROA 5AJUA 1ZGAA 4E5NA 1J9EA 1RM3A 2GARA 2PA3A 1COWD 3MJDA 4HFMA 3UMMA 1RPZA 2R7MA 3IPCA 4M60A 4HX5A 4C2UA 2F3PA 5BURA 4UPEA 1Z68A 2Q50A 5KYXA 3KLOA 2BGNA 5AM0A 1KJIA 1Y3DE 3QZUA 1BCRA 3ZX4A 1G7CA 1Q2XA 3LOQA 4OOFA 1UDXA 3RTAA 2NO6A 1UMDB 1UWLA 4G09A 1B1CA 1L7NA 4FFBA 4ND3A 3QGMA 4RIFA 4B1FA 4C89A 5IYZB 3E0QA 4KOAA 2QOEA 4TTIA 3VKWA 4BVGA 2PX2A 3U3MA 1GA6A 1NKVA 1K89A 3M9WA 2YWGA 1EPUA 2P4EA 3F3MA 3KKEA 3R7WB 1JE1A 3UJ8A 3VOTA 1FXSA 1QVRA 1XPOA 1KI4A 4J3NA 2AX3A 3WGQA 3K92A 1JIXA 2ONKA 1F1BA 1UZLA 4XOIA 3D4IA 4B7AA 2C8JA 2WM9B 1NZDA 3FSJX 3WDLA 3M2TA 4PG7A 2PCLA 9MHTA 2JCSA 2AZDA 1SRQA 3SBEA 1NU8A 2W83A 4HDAA 1AX9A 4D0GA 2B4AA 4O2AB 1Z4OA 2DG2A 4ZYLA 5BRAA 2VHCA 2GYWA 1SKYE 3ROQA 4FGKA 1VGRA 1PYOA 1Y9ZA 3ZZUA 4XJSA 5BN3A 2Q4RA 3ZWCA 1JWLA 1F9EA 2ZLBA 2YDXA 1MT3A 3LCJA 4DIMA 1ZU5A 1RACA 3BTUA 5E6RA 5EP1A 1OYYA 1CR2A 4IILA 4O0MA 3DBIA 1H2HA 1G8HA 4TT8A 3N3AC 1YB7A 3DXFA 2P9QA 2H8KA 5E1DA 3LUJA 1B6RA 1IVSA 1F0NA 3AWDA 1NR1A 3GLRA 4N7MA 4L2IB 4Z8YA 4IMRA 1ZVVA 2ANBA 4P83A 1NQXA 4Q9LA 2G71A 1JYSA 3QVJA 2RKOA 4M89A 1J23A 4QNNA 2A5FA 1E8NA 1BQEA 2OPBA 4UHBA 1C9KA 2ZM5A 3PEYA 5LJIA 5JYEA 3CIFA 1TZ2A 3VSCA 2P3QA 3NC4A 3WQSB 4GX0A 3KTAA 4MS3B 3CJRA 3K9NA 1IIRA 2IOYA 2VO1A 2QGFA 2VLBA 1HL7A 2VUSA 1Z7BA 3A37A 1TXGA 3MCVA 2DBQA 4JT9A 4MVJP 1NJ1A 1Z83A 4RTPA 1Z6GA 1KKUA 1WTAA 2JC3A 5E9JA 3ICEA 4WZAB 1U2RA 2E7ZA 3AX6A 2P2YA 4LN1A 2AG0A 3C0KA 4N6NA 2ZYGA 2IEZA 2IF2A 5IC6A 2QL9A 3VHXB 4KDRA 2XV1A 3ANXA 3O3OB 4N9QA 5DSZA 2WUWE 1UEJA 1BN6A 2XXJA 5JC1A 4OBXA 2CF6A 1XAGA 5GOTA 2P77A 3M6VA 4TTQA 4CEHA 5CD9A 3FIUA 3KR9A 2GMWA 2I7TA 4P4GA 4WLEA 3V46A 1ZA1A 4NFHA 3G88A 2X23A 5M7EA 3BORA 4R3WA 4FFBB 4Z4FA 2HLHA 1CQIB 1QVVA 5I7EA 3SQOA 1BQ4A 2I29A 1BJRE 3PJGA 4QDTA 5TEWA 1W29A 3PQ8A 4AJ4A 4KIUA 3H9QA 2Q6LA 1J33A 4DCPA 3OQMA 3WWZA 1SCJA 2FX3A 3KQMA 1C4WA 1V11B 2V7QD 1JEJA 3S7ZA 4F46A 1OLXB 4F5ZA 2BFWA 4ARCA 2FXVA 1NQAO 4RIGA 1EBFA 1NR5A 3O94A 2Y05A 1H2FA 3C3EA 4LXTA 2H4HA 5FR1A 2QNRA 1JHXA 2GNOA 3DMDA 5DCUA 4UM9B 1FUEA 3GUYA 3F5MA 4ZO8A 1QXSA 3FW1A 4EHHA 5CB4A 4A91A 4D1YA 1ZD2P 3AETB 3FCAA 4FZJA 5DW3A 5DHQA 4URVR 5AHXA 3V5NA 2PKQP 4BKUA 3E8XA 2RHMA 2WWIA 4N18A 2X0NA 4RTSA 5F9HA 4JB8A 1SUWA 3PGLA 5GGXA 2ZWVA 4UCWA 5CYOA 3UJ9A 5C37A 2HJVA 2G09A 2DHQA 4Q39A 4WFKA 3N0VA 3WWCA 4YRGA 2ZANA 3VFDA 1LRLA 5CX1A 2FN8A 4XYLA 3WDSA 2B20A 2QRHA 3O31A 2RHBA 4TTJA 3EDRA 5FOXA 1ILEA 3RANA 1MRZA 2MYPA 4F0JA 3NBAA 1MTOA 1A5ZA 2B8TA 2V6JA 3GCWA 3P5BA 1U28A 1P31A 4RHEA 1B3RA 3PGA1 3MFQA 4X92A 4IKOA 5CD1A 2J0VA 3IO3A 4ZCTA 5IMSA 2V6BA 4YRFA 2BYTA 3OHPA 4XUGB 2JFYA 4H3SA 5IBQA 2Y92A 1Y1QA 4HAVA 5HKKD 4JUAA 5KVQA 3NDPA 1BZYA 1WXWA 1AUQA 4FBLA 5IASA 1MT0A 1SD5A 4ZMBA 1W0CA 4DMMA 3V2IA 3VR6D 1C9MA 3MLAA 3AJ8A 4LE0A 7GPBA 1UXKA 4GBJA 4CLOA 2ZRMA 4QFDA 2QTBA 2C7OA 5LQKA 4FFSA 3UICA 1JSRA 4J1SA 4OY3A 4LF5B 3OLYA 4I1OA 1LQTA 5IVIA 4JNCA 1JTFA 2EWWA 3P0RA 5EE0A 4X6XA 1ECPA 1M1UA 1AVTA 4W5RA 5TF0A 1IHPA 1ODJA 1R6DA 3BCSA 2CBXA 1N75A 4H3VA 1GT6A 2FEAA 1EKXA 4XYMA 3SYLA 1ODIA 4F91B 4JKYA 1XZMA 2HMWA 1CQZA 2MCFA 5IAAA 1MAVA 1LFAA 3K2QA 2F55A 3W5CA 4N1AA 4LYJA 4EFMA 4YQZA 1DNPA 3HCRA 1OTHA 5TE9A 4KHPB 1NKSA 1J7KA 1VA4A 1H8HA 2A84A 4US0R 2P8JA 3RRYA 1DRKA 1YJ8A 4RZUA 4DZTA 5IKEA 1J56A 1ZBQA 2G4CA 1RWNA 4GUAA 4XYEA 3W6OA 3U39A 4TKVB 2J48A 2H1LA 1IVYA 4UDYX 5JMOA 2XYVA 2HJSA 5DN6A 2MYUA 4A5SA 4BNMA 2CF5A 2Y2UA 3IHTA 4M37A 1U8TA 4D45A 5CB4B 1P2BA 3FMIA 5LZ8A 1UJMA 1NXWA 3O8NA 2HPAA 2WUDA 4LOIA 4LRXA 4BXOA 4O5AA 2LD4A 3LFUA 5JE8A 5A3JA 4XOUA 4PN7A 3H9JA 4H7FA 1HDGO 4RSMA 4KSYA 4B8YA 4ZYTA 4KX3A 1G5QA 3WB2A 5IP5A 1OAOA 5KKAA 4GSKA 4LVUA 1CUDA 3KKKA 4FCVA 3WGLA 2CUNA 5IZCC 5B1DA 4EPXA 1IMJA 1X1CA 4HO1X 3SPXA 3BVPA 1IPFA 3SFZA 1LKZA 5SICE 3X0DA 3TZ6A 2IU6A 3FCXA 4DB2A 1GFWA 4HWRA 1H9CA 3HV0A 3TGLA 3OI7A 4XLLA 4E03A 4Y6QA 3L77A 5AOVA 4X1IA 4E21A 1MW9X 8GPBA 1ADCA 1ZWKA 5H02A 3SQXA 4UMEA 2CEAA 2GKOA 3HDVA 4HQFA 4CMIB 3T7SA 4DFDA 3PDJA 4WN9B 4ALNA 5FBHA 2H16A 2QMEA 4BLTA 3DV0A 3C7CB 4YCSA 3OZWA 3GLKA 5FFMA 2I6XA 3VX4A 1JPUA 3BMNA 4L50A 2WUFA 2FPIB 6REQA 1JQDA 3NAMA 1WU7A 2JBAB 3SZRA 2NXEA 3AXSA 3E27A 5DX8A 2G88A 4CLOB 3OUTA 4IOJA 1D1TA 4DDMA 1GDHA 2I2AA 4GL4A 1XMSA 3K72B 4NC9A 3DFZA 2JB9A 3WJAA 5IDVA 1KFCB 1J22A 5EKSA 1XRQA 3LE8A 2P9YA 2XE8A 3MUOA 3RU3A 3BJIC 1Q1EA 5I9MA 1AMOA 3EC2A 3K8ZA 2AF4C 4NH0A 5M04A 1SG0A 4LK2A 4KR3A 2H65A 2J7PD 4KO2S 1OXTA 1Y5RA 4CDGA 1JNYA 2QTVB 4HKTA 4DA7A 3ZZNA 1XHLA 1P0CA 3P9CA 3D1LA 5CVCA 4BKRA 1GPNA 3HCBA 3AI2A 1FFWA 2QPAA 3MJVA 1ZD5A 1P17A 4FILA 4BRUA 4JLBA 2AYZA 5GJBA 3PCTA 1BQ3A 1UC5B 1JP7A 3GJ3A 2VWPA 2JEZA 4TV8B 3STVA 1BRTA 2IDZA 1AS3A 2O57A 4QULA 4FYIA 3NS7A 1E1CB 3PKIA 3OJ0A 3Q1KA 4FGWA 3K94A 1EXWA 4G5HA 1SWWA 2I3GA 3DUWA 1ZKMA 2Z8ZA 3GEHA 4AQDA 1ZJJA 5KKNB 3Q6IA 3GJ4A 2IU3A 2VI5A 1FXWA 4MPDA 2VPIA 3HDYA 1E58A 2AOTA 4ND2A 3OZXA 2BEUB 1J97A 3H4VA 2R9VA 3IBCA 4RF3A 1JQLB 5LIRA 3F71A 3FZYA 1M2OA 2WHPA 2Y1FA 3JD3A 1UR5A 2X58A 3DG9A 1V6CA 4Y2QA 5ENZA 3KTFA 2OYCA 1FZTA 3DZ8A 3L6CA 2FZVA 2PSEA 2CV0A 1P7ZA 3HDGA 4G4GA 5JJBA 2QUHA 3LQQA 1O8BA 1E6WA 2WFMA 4AX4A 4OU5A 3A1DA 4ITVA 2X5XA 5DRYA 1U7OA 3P71T 1U2GA 2QY9A 4DQXA 5MN4A 4HB4A 2EZTA 2GD6A 2IHKA 2QUJA 2CUTA 3QIAA 2WC1A 4X8LA 2QQEA 4YK7A 4GVXA 4UPVA 1RYBA 3MELA 2AC4A 3L4BA 1SU7A 2QWXA 4B8ZA 1FW8A 1Y9AA 2NADA 1IG3A 4XTCS 1XA4A 4I3FA 1M72A 2ZM6B 4MPPA 4PRYA 1RCFA 3RHZA 2CNKA 2HCJB 3DDZX 3HYLA 2ESRA 4NE2A 2O0JA 5K1ZA 1O9HA 4NNPA 1N2CB 4YVFA 4RZQA 4J76A 3TTUA 1DIHA 3LVRE 3WYGA 1CZKA 3S27A 5FWYA 2MDTA 4AKHA 4HTFA 4TLEA 4ZCLA 4AY3A 5DYNA 1Z7WA 3BH6A 3CW9A 4KWTA 4CL8A 1AHPA 3FWNA 3I42A 3IT1A 2C7VA 2ZSKA 4Q05A 3DDSA 3SHFA 1ZLXA 2QN2A 4M8LA 3X1MA 1PR9A 1VIMA 1G8MA 1NASA 3GUCA 2QX8A 1HO3A 2AN5A 3KXPA 4A16A 1Y37A 2WT8A 4JB0A 1V96A 1HDXA 3NHZA 2GM5A 3DBVO 3LUDA 4WNYA 5K3FA 2XB8A 5C1PA 3T3HA 1P2DA 3WRWA 1LZKA 2M6RA 4ZI7A 3Q7QA 1Z47A 3AY6A 1VLQA 4NOMA 2PT6A 4UUAA 2X6QA 3ESXA 5I9LA 2YMLA 3F78A 2E89A 4TQ9A 1ORVA 4TTAA 3V8RA 5EXSA 4M0LA 1R4NA 4V38A 4JBGA 1PBTA 1RAAA 3O8LA 1GGNA 4W7IA 1K98A 2AV6A 4LBWA 3T99A 2C5HA 3G8YA 1TKCA 5IF3A 4CRWB 3HA7A 1U1EA 2J0QA 2FN4A 3I2FA 2V7PA 4DUPA 4YAUA 2XUIA 5HQJA 2HTEA 3GZ4A 4Q9NA 1L8LA 5F7OA 1RM5A 3RIHA 4R4JA 4DE5A 5LIPA 3NTUA 4DCNA 3IQHX 1C0KA 4OF4A 3URKA 4YJFB 5CEJA 2Q9BA 4M49A 1JX6A 3BZBA 4EJSA 2GX6A 2OOSA 5KYVA 3UMGA 3ONEA 1SY7A 3W1EA 4JOBA 2QRLA 5H0IA 4N3GA 3FFXA 4GZ6A 2AJDA 2PLWA 3W2IA 4BNTA 4E6PA 1N7GA 1DCMA 1G19A 2YQ4A 1YZUA 2WG1A 2HDHA 5I4CA 1IWOA 3KCQA 3CF0A 1AK9A 4Q3NA 1OILA 1QHXA 2VHVA 2OQ2A 3NVMB 4E4TA 4FDTA 3OM8A 1XX6A 3A2MA 3BGIA 3O4JA 1Q0LA 1U5BB 3O95A 4GPEA 4LCBA 1A9PA 1SVNA 4G6ZA 5F51A 4C04A 4DCCA 5C4IA 4HRYA 7ABPA 7ADHA 1L4NA 5IFKA 1VZ2A 3M1AA 1GG2A 2CHVA 4OP1A 5CTAA 2G4VA 3T7RA 3OP1A 4PG5A 4CLHA 5CLFA 3LT1A 3ZBTA 2VT2A 1N2GA 4HTFB 4XDHA 1CV2A 3HWX1 3EAGA 2ZT5A 4INPA 3D6MA 3FCSB 1Y5IA 4YRBA 5HUHA 3P9NA 3P9YA 2CV1A 1JIVA 3TEFA 1U5CA 3PX2A 2A8YA 1YHYA 2ID9A 2XB4A 1Z18A 3ILSA 3ENQA 2WJ6A 3EN0A 4P3PA 5AOAA 1MB3A 1FSSA 5FBZA 3HBNA 3AHJA 1GKIA 3BPSA 3UVEA 4ZQEA 4FZ5A 1KSGA 3JSAA 4HAZA 3E4DA 1RLJA 5FWNA 4BVHA 1CQWA 2IOFA 3LOPA 5I6DA 1DUVG 2HSJA 1V8BA 5A1TA 5D7NA 4KMOA 1CEYA 1C30A 3FLAA 3NIDB 2FH5B 1ST2A 3X3HA 4GBED 5A0VA 1AHNA 1NQOA 3BK1A 4EOGA 3DL4A 1DG9A 1FU8A 1W35A 3HEBA 1CG6A 4QBIA 3A9WA 4QPDA 4RPLA 1C5KA 3ROMA 3DVQX 4L4SA 5CLHA 1P5JA 1H9AA 1PX2A 2IYAA 2VBGA 3ZZ0A 7AT1A 1U8AA 4B35A 2HV8A 4GKKB 4F38A 1FRNA 2PGIA 1PLLA 1RIFA 2H2DA 3RNLA 3SZLA 1N2OA 3WTBA 3HPQA 4D43A 3QYFA 5K03A 4QPPA 1GGFA 4YUXA 5LQUA 4ONEA 4YJ3A 5FI1B 1K08A 2PGAA 3ETGA 2HWYA 3LTEA 4IXNA 4JJEA 3RTDA 1T9GS 3ZI7A 5C5IA 2JEYA 3JYPA 4KAXA 4EY7A 4L7QA 4PO8A 5HGXA 4D9IA 3WAGA 2AXNA 2RHTA 5TPWB 4V2IA 3WE7A 1D2HA 4EJSB 2CWWA 3VH4A 3OEHD 3I04M 4J0FA 4K6CA 4KXMA 3E9RA 3KV3O 4FS3A 2GEFA 4URZR 1JJBA 1HFEL 2BJWA 4I1YA 3CCCA 1VLHA 4E46A 3DC7A 4IDNA 4YRSA 3DOEA 4ZVPA 1HTBA 3R5JA 1TF7A 2PXAA 2ZBRA 1D4OA 2FW0A 3WLPA 5K3EA 3OZDA 1QH0A 4LWPA 2DUNA 1A2KC 1AZLA 1ZNWA 2XPCA 2WTAA 3BKXA 2CDNA 2HA7A 2BHLA 2JATA 3VPAA 4RTQA 1OXMA 1SB9A 4S05A 1QLHA 7MDHA 2NO9A 1GLNA 3OCJA 4MSUA 3HUDA 4I6JA 3I3SR 3MW8A 2E55A 2HA6A 2GM3A 3G2OA 2IVFA 4H4EA 4QRIA 2TSYB 2EJBA 1UPCA 3UHJA 4BQOA 5K0SA 1DBPA 2QG6A 3LPMA 3NHMA 5DBOA 5LBTA 2JL1A 3TUIC 4JUIA 3H65A 1KYQA 3FYUC 3DTVD 4G5SA 3W8FA 2D54A 5B4UA 5IVPA 2AFRA 4RA6B 5KEIA 3TSCA 5PNTA 10MHA 3VPGA 1LEHA 5IH7A 3RS2A 3TD9A 3L8HA 2C7QA 4PHFA 4BPBA 2JAUA 1B1AA 2PY6A 2B0JA 3M9XA 5HFAA 2YR0A 2GLUA 2ZRIA 4XQCA 4II2A 2ZEJA 3ECCA 4JI0B 1XLWA 1J2RA 5CFRA 4DILA 4GXQA 2VYVD 1ORWA 1AUXA 3COWA 2PANA 4TQAA 4RXMA 2JA2A 1D5WA 1LF0A 5HZMA 3DFKA 4IVRA 3UAZA 1CS0B 3D59A 1K63A 4RQUA 2D1FA 3R0QA 2H0QA 4NNOA 4PGMA 2Q7DA 4C6RA 3WICA 3OTQA 3ZCRA 3G17A 4UXIA 5I8WA 5BR8B 3RSHA 1EFDN 4TZKA 1WCV1 3EFOB 3G9UA 5JPCA 4H35A 5B7GA 5DGTA 5HWSA 2BZ0A 3B5JA 4GE0A 4N5IX 1Q0UA 4RA9A 3UCFA 4BDSA 4IX9A 5ADWA 1VRCA 3LQ4A 2V6FA 3UFXB 1FSFA 3EPPA 2GJKA 4JROA 4NKRA 5E8JA 2I0FA 2EHDA 3CNEA 1LBSA 4MWOA 2YL2A 5EQFA 2FSPA 3GNQA 2R1UA 3E4CA 4YIHA 3WGOA 1HY3A 2A9VA 3CGGA 2ZB2A 3U3ZA 2FFHA 1RWQA 4FCCA 5LWQA 4Q3BA 3FTFA 4FOLA 4I3HA 3H86A 3CLSC 1QGUB 4HAIA 2B5VA 2BISA 3I6QA 2GK4A 4HMOA 4Y0AA 2NMVA 1H0HA 1R00A 3DVAA 3KV1A 2JS7A 3IH5A 4J0KA 5I7RA 2ZRGA 3H3JA 1TQ4A 1TEZA 3LBFA 2PZGA 2WFZA 4R0VA 1E0JA 4U2BA 2B5OA 4F8YA 1LPNA 3HCDA 3A4YA 3ZI4A 4ZEXA 1FL9A 2QW1A 4ATNA 4CT0A 4A6XA 4HYYA 4NESA 5ITZA 1HFJA 4BNVA 3QA3E 3AM4A 5LLDA 4DLUA 3LRPA 2WAYA 3TLZA 2W58A 1CPYA 2Z2IA 3BE4A 3DLHA 2MT9A 2OB2A 2YXDA 1M2VB 1SHZA 3U19A 3I52A 3QLUA 2BMFA 2R62A 4NS4A 2IYNA 4ISCA 2E3JA 2HOQA 4NOLA 4YRPA 3T9CA 1P19A 4W5TA 4IAOA 4GMKA 3TL2A 1U8XX 1UXHA 1SOVA 1K3FA 3S68A 4EHIA 4MWTA 3ND8A 3DPIA 3DKKA 5TSDA 3VSAA 2NP6A 4A2QA 1W5AA 4LX8A 3WIBA 3PGJA 5AVOA 1DJNA 4YJ2F 1I0ZA 2VNHA 4HSGA 2B69A 2R4TA 2ZE7A 4UTZA 5FX2A 2IW3A 3GNTA 2JI4A 1I7SB 4TROA 4WZ6A 1E2QA 4Y9UA 4OJQA 4ACAA 1KK0A 2HX1A 4HDSB 4DM7A 3PHCA 4EL5A 1Y4UA 1TIKA 4J07A 3V8EA 3ZY2A 4AD8A 1FRFS 2ZBQA 5B55A 1NBHA 1WMBA 4KODA 5AXBA 4QDKA 1OGYA 2FF7A 1V7QA 4DIDA 4AKIA 3OWOA 3IS3A 2EG5A 5BMOA 3EA4A 2A92A 1AOXA 1S4MA 5J1TB 2B5WA 2D0IA 5TLSA 5EC8A 2Q3FA 3FR8A 4M4SA 3VR6H 2HNBA 4NS1A 3ZK8A 4J9UE 4V3BA 3H6HA 4DWOA 4LFBB 1YSCA 4KEAA 3TI9A 3ZJYA 2CD9A 1OXSC 1V0JA 1XWWA 3P9XA 4DA9A 2R68A 3ZG6A 4UD2A 3ZD8A 2ZIXA 4PLGA 1F20A 2ZRNA 4AX8A 1XCJA 1CUZA 3BXPA 3D2AA 3ASYA 5CH8A 4IQ8A 3PPYA 4QE3A 3A26A 5JXHA 2H3EA 3UOWA 5JS1A 5I7FA 1EMDA 1NM5C 1WKBA 4TV9A 2BKUA 3W8RA 3EULA 4M1WA 1PS0A 1YQGA 2WYIA 3Q3EA 1ACMA 4DSOA 4D9JA 2O6HA 2UVPB 1GZ5A 5JQGB 5JZBA 3JR3A 5C3MA 5TVGA 1OBHA 4AKEA 2OENG 1PW7A 1SQ5A 2PD4A 3BJZA 1X7WA 2E21A 2P0YA 3NWJA 3WLFA 5K3BA 3WMRA 3OTWA 3PL5A 5K8IA 2ILTA 2DULA 5HIMA 1E32A 1XB2A 3QUAA 2L17A 3CB4A 2A88A 4B2IA 2B9VA 2GCOA 4JP1A 4JLPA 1GPWB 2E4ZA 3L0OA 1KARA 2I8LA 2VAPA 3GPDG 1UMKA 2XTMA 4JLJA 2RHJA 2X0IA 3HYCA 4ICIA 3F73A 2AB0A 2WAMA 2UZ0A 3FPGA 4TL7A 3OT1B 3UFBA 4DQLA 3S1SA 1HORA 5C4GB 3GJ6A 3TCNA 1N32B 2NPFA 1YVDA 4MQFB 5SZKB 1BVRA 1XTPA 2X8BA 2G28A 1SQ0A 4MB6A 4CCYB 1MFZA 3FLEA 2C4TA 4BMCA 3K53A 3LQ2A 3C8HA 1MQ8B 4RVCA 5T4BA 3OUZA 1RP1A 3O0DA 4RPKA 3TUZC 1OY1A 4J1TC 3SKVA 1TLTA 4E5VA 2YXBA 4WGFA 1MB2A 4BNJA 3LT5A 2HIMA 4E1BA 3Q87B 3J80A 5H8WA 1NDUA 4JIGA 5LM3A 1CDEA 2DQZA 1KDYA 4Z2YA 5CPFA 5KSOA 5JCJA 4XIFA 1FYXA 3VJRA 1P29A 3DMHA 4NZZA 3BRWA 1YDHA 2AMFA 4DREA 1JAIA 1JXMA 1O5OA 1CF4A 1N0HA 1QV9A 1AMNA 4CMHA 1UT5A 2JK0A 1J8VA 1HFKA 1N2IA 2QRUA 4Y7CA 5FQNA 4EP1A 4JI4B 1TM4E 1ENYA 3WLKX 2O7QA 2GGSA 3KJXA 3ZHSA 4WHMA 1XDZA 1SNYA 1JBKA 3JWJA 1QTIA 3BDIA 3T5MA 1G20B 1II8B 3L0PA 4LYEA 4RTLA 5B64A 4WCFB 5ADUS 5KKCA 3D8TA 5DNCA 3PUIA 2QJOA 2HHHB 2ONYA 4KZPA 2QPOA 3NWBA 4R7ZA 1S3GA 1KI8A 2Y76A 3A04A 1JILA 1G8FA 3R75A 3AUUA 1RYFA 2IYFA 1KMHA 2NQ8A 3RLFA 9GPBA 1YZHA 3FTNA 1GN9A 4WWHA 4E2XA 3NANA 2PSFA 4H18A 3L41A 4LDQA 4TV9B 4S2EA 5ITWA 1XDBA 1WP4A 1ZISA 5KNCA 4HLUA 4Y2VA 2C0PA 4J90A 1B41A 2X1VA 4AMZA 2OVFA 1L5FA 1H1LA 3JZIA 3OP4A 1W2HA 2W22A 1K0FA 1X7WB 3RIMA 2FEWB 1X3LA 2E18A 3GEEA 2A4MA 3HU2A 4U5XA 5SZJA 4FMCF 4L7VA 1AHHA 1Z6AA 2IX9A 4QSHA 4JUBA 5TEVA 2UUPA 3HCWA 1E5VA 3RHTA 3VV2A 2XNHA 5JROA 1JEDA 1T3TA 2CMGA 5HDQA 3M6FA 1L5NA 2HREA 5LBUA 3EAFA 1HA3A 2YCBA 1D2EA 2JI6A 2NV0A 4K87A 1FDVA 1LBQA 5H68A 4QJBA 3BZUA 4PYOA 1XRPA 1TM1E 2EOAA 3B7GA 2F43B 3B85A 2YTZA 2IFTA 2ZS7A 4Q00A 1FDSA 4QU5A 4DJAA 2XF8A 3D9QX 3LUGA 4LZOA 3KOUA 4WXMA 5K99A 4DR1B 3QFCA 1KEPA 5BMVF 1QX3A 2B8WA 3WNQA 1XXHE 2VAVA 5CUQA 1YS1X 3GUUA 3FSEA 5JYBA 4ZT2A 4Q19A 3HY4A 5AKIA 3A6GA 3ZE2B 2X8JB 1SMKA 3D2BA 3C5VA 3EE6A 4RANA 2YBDA 4ND5A 4R01A 2UDPA 2OV3A 5D6NA 3MCUA 5DX0A 1L5KA 1J0CA 2WJPA 1TJYA 1NZFA 4LUCA 1JEEA 1H66A 3EC7A 4NAHA 1NUTA 1M83A 4TTRA 4PINA 4C07A 4E51A 4A10A 3MN1A 2BEWB 1Q92A 3PIRA 3KT8A 4FR5A 4G0YA 3VHLB 2GXSA 2QXUA 4YAIA 2I3AA 4DV0B 5JEEA 1DWUA 2RKBA 4KXLA 4UBNA 2OK8A 4M0CA 4BO3A 1UJBA 3AHGA 4L28A 4POAA 2H85A 3ZTWA 3N8DA 4MKGA 4CYMA 4UD6A 3HYSA 3SBXA 4PEVA 5ALOA 1N7JA 3KOYA 3SK0A 2IS6A 2I54A 4C9BA 5HK8A 1F4PA 3I6YA 1GZHB 1P9LA 4OB6A 4Y9TA 1RYEA 4F6CA 1WIWA 2XD4A 1EX6A 1A9XA 2HXYA 1YR7A 3F49S 4X44A 3VKFA 4DKXA 4EENA 2J6HA 4IPTA 4EUSA 1OTXA 2DH6A 2F1HA 2J87A 3ZHVA 2JDIA 1BG6A 4EELA 1Z34A 1IC6A 3G89A 4TXJA 1GRRA 1ZX1A 3WYBA 1TKAA 3MJ4A 2M1XA 1N5OX 4AZ0A 5L45A 1AUVA 1D8AA 1U7TA 1VE5A 1A2OA 4A8JA 1PP4A 2RH4A 3M1IA 1OE0A 1XTVA 4INAA 4JYBA 4UBMA 4E2FA 4G1BA 1U90A 5D01A 4PV7A 2ZQZA 3LFHA 2AZ4A 4W63A 4Y2JA 4HPJB 3SKYA 2BUCA 4S0ZA 5K2MA 2ZZNA 1SKMA 3EGDB 1R0RE 4KPUA 5KX5A 1FBTA 4Q47A 1YFLA 5EKDA 4E07A 4JLNA 3NX4A 3Q98A 3BREA 2HU8A 3QE3A 3SF8A 1HLPA 1N5MA 4FMDB 4X6YA 1Y7LA 3HXLA 4K8OA 5J9FA 3TLBA 1L7XA 1Q19A 2BFEB 3HKDB 4LYAA 4Y2PA 3V8QA 2IKSA 4PAMA 4D3XA 4F2HA 3USZA 4IQGA 2ZYIA 2FETA 4OJNA 4G65A 4KNWA 2VT7A 4KQIA 2PH3A 3GUHA 1L5GB 4C03A 4W6ZA 2G4LA 5TGDA 2GERA 3B51X 3I5MA 3G02A 1RJWA 5C8VA 3IP1A 1MOQA 2BM9A 4QM7A 2CFSA 4QXRA 1ZQ1A 1V8ZA 1G18A 4P3KA 1KL7A 1BSVA 3U62A 4YCDA 5E0KB 1UDCA 4F7DA 4YRDA 4DQKA 3JQBC 1YRYE 1IOZA 5B3LA 1H3NA 2VF4X 1GCAA 1CU1A 2WV9A 4MCIA 5A9RA 2PBRA 3DKPA 3B13B 4BJ3A 3TUJC 3QTBA 4URYR 2ARKA 4RNDB 4N8DA 1M7GA 4IV8A 4WXPA 5AKKA 2NZUG 4LXQA 5AIAA 5EZYF 3JAKB 2QG4A 1PZXA 4R68A 2G07A 1JKJA 4GH5A 1VJ1A 4AJKA 5BSKA 3I5YA 4OKSA 1XD8A 2Z30A 4PONA 1LLUA 1R15A 2G83A 1I14A 3UH0A 3CF6R 1Y34E 4TKUB 3P94A 2VFAA 3OT5A 2HPHA 2HQOA 1Z07A 4PXAA 2DGDA 3V4OA 4RMGA 5IJ9A 1ISHA 2UYCA 2GDJA 4H77A 3OICA 1YQEA 4X7PA 5EKXA 2VZ8A 5ALQA 3I28A 1WD7A 2HJRA 3C5WP 4CV3A 5DFAA 5M5BA 2XMGA 2VQEB 2ZBVA 4J7AA 4KI7A 2EC5A 3C6MA 1K4KA 3RIYA 3UA4A 4KSBA 2AZXA 1LK7A 2SKDA 4L8YA 4BO9A 1YC5A 1FTQA 1ZIDA 2JCYA 2H1OA 2P3LA 5K0GA 3NDRA 1IUKA 1T0JB 3PIDA 1P33A 2W48A 4B31A 5M2QA 2IHBA 2PZEA 2ZUDA 3NDJA 1AGXA 4ARBA 3K9WA 5A04A 2BM0A 1UBEA 3V6MA 1FQKA 3I5UA 4JJFA 5CJJA 2V1UA 4RZIA 2AWNA 1L5RA 5IYZA 3KQYA 1TUGA 2WIBA 5EQDA 4D42A 4YAGA 3SJUA 4OU4A 4WBNB 4JGBA 4TLLB 3HO8A 4FU0A 1AGYA 2FKAA 3MUFA 4NCNA 1A95A 2PZAA 1L5LA 3WMWA 4A8JB 1TUBA 1WMDA 4W9RA 3SYTA 2B98A 4KFSA 4UFNA 3O38A 2AC7A 4ZAZA 4BTEA 1JR3A 2BJHA 1A8IA 3MLBA 4X20A 2WE8A 2XD9A 1U28C 3MNFA 4ZRMA 3SDSA 3IBYA 1Y6ZA 3MB8A 3BB3A 2FSUA 4QBGB 3SS7X 1WNFA 4O63O 3SF8B 1XZKA 1W34A 3E9CA 4WFQA 1K6MA 4F4IA 1GZ3A 1WX1A 2DM6A 3LX5A 3LDAA 3RPEA 3ZLTA 5IAOA 2C1XA 4E94A 1VXOA 4G25A 4DLTA 2ZTMA 1NWHA 1QNLA 4JBHA 4QPCA 4YCBA 5KSPA 4DR5B 3H19A 1OV4A 3NIFB 2C84A 4P4TA 1A9YA 1N7IA 2AG5A 2BSXA 1S96A 3ENVA 3LUHA 5TVKA 2O2IA 2HW8A 1P0MA 1KDVA 4GPAA 3ZJ5A 4LF6B 4RVFA 5FPPA 1K6EA 3E22A 5FPHA 1WCYA 4LZZA 2Z9DA 4BY9E 5AM4A 1KETA 2HRRA 3FCEA 3FCYA 3OLVA 1PF7E 1RXIA 4KMSA 2A9KA 3OUUA 4JITA 4QTXA 1O94A 4J16A 3HDTA 1B26A 1M6VA 1SZPA 1H3FA 1PR4A 4EHNA 4X93A 2MSEB 3ZXXA 2XXAB 1MNQA 4D74A 4FJ2A 4UU1A 4A23A 3A9UA 5AK5A 3D1VA 2KLBA 4YDSA 1DO0A 4DJEC 4N8EA 4RVUA 3EVGA 5EJ8A 1YQQA 3GFPA 1E3IA 3O1JC 2WSYB 2QTAA 4P7GA 5IJ9B 3WXMA 4IZHA 3X1ZA 5HF8A 1T5DX 1K5HA 1O87A 3ZIDA 1M3SA 2XWBF 3BXGA 1VL6A 2OFPA 1ML4A 2C8KA 4CG1A 2QTCA 4KCGA 5JAIA 2IGTA 4Q3KA 3FNFA 4H6XA 4N4AA 4YT2A 1I6LA 2WHEA 3D43A 3MAJA 3C7TA 4MUMA 5FADA 1Z4QA 2PWYA 4FT4A 4PZDA 3V7WA 1EGHA 2RHOA 3QVXA 1B42A 3G1UA 5JD3A 1RKBA 1V5WA 3P52A 4J0HA 3DCNA 4ZZIA 3W6UA 3WBFA 1NW4A 1H94A 2DLNA 2ID4A 3CISA 3FPBA 4JSTA 1T43A 3F98A 1JEQB 1KAHA 1U2ZA 4GPZA 3BL6A 4OMDA 4JUCA 4WA8A 2HCRA 1P2SA 1DRVA 1SVKA 3Q0EA 2FJUA 4G5RA 1M34A 2OO7A 1JU4A 2OP1A 4R2WA 1OAOC 4Y30A 2M6KA 4W5WA 2I76A 1H93A 1E63A 1G21E 1MB9A 2O2ZA 2Z43A 4O6VA 1A0OA 1ELOA 1SPBS 2O1XA 3IX7A 1WV1A 2Q7XA 4HJXA 5FPTA 5BW4A 3DO8A 3R9WA 3PT5A 4D0LB 1DC6A 1EVIA 2V45A 2Y0EA 2Q0QA 4GPTA 1YQWA 3R0IA 3MS2A 1W49A 4MRNA 3RBXA 1Y6JA 3PIIA 1L4HA 1OC4A 2AOVA 2GHIA 2KBEA 3AB8A 3D3EA 4II7A 1ZN7A 4KXWA 1O6FA 1CNMA 2P11A 3I01M 3NXSA 2GCGA 2C7GA 2PLRA 2D5CA 3PJDA 3SQDA 2ODWA 4IVNA 1O03A 2X7HA 3FTCA 2G36A 3QLVA 4ZTUB 4DT1B 5J4HA 1H23A 1RYNA 1W87A 4WUTA 1NFRA 4KHZA 1WL8A 4HRVA 3JD1A 1HFWA 1I3KA 2X1HA 4NJEA 3N8NA 2JAOA 4KWHA 3RARA 5EQJB 5GY7A 2ZCJA 1DKQA 2WSBA 3BFKA 4HB2A 4CTJA 1T2VA 4HQ0A 4P7FA 1T0IA 3K0FB 1X42A 2IF0A 2UVQA 1E0DA 3QU4A 5DEOA 1X86B 1PFVA 3QQ5A 5AI8A 5KTNA