4NRMA

Crystal structure of human alkbh5 in complex with citrate and acetate
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
220
structure length
211
Chain Sequence
EQQLQKEEEARKVKSGIRQMRLFSQDECAKIEARIDEVVSRAEKGLYNEHTVDRAPLRNKYFFGEGYTPGQERLYPPGDVDEIPEWVHQLVIQKLVEHRVIPEGFVNSAVINDYQPGGCIVSHVDPIHIFERPIVSVSFFSDSALCFGCKFQFKPIRVSEPVLSLPVRRGSVTVLSGYAADEITHCIRPQDIKERRAVIILRKTRLDAPRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the human RNA demethylase Alkbh5 reveal basis for substrate recognition
pubmed doi rcsb
molecule keywords RNA demethylase ALKBH5
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 58
structure length 211
sequence length 220
ec nomenclature ec 1.14.11.53: mRNA N(6)-methyladenine demethylase.
pdb deposition date 2013-11-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.590 Mainly Beta Sandwich Jelly Rolls Alpha-ketoglutarate-dependent dioxygenase AlkB-like 4nrmA00
3BTZA 4NJ4A 3O1RA 3RZLA 3I3MA 4NRQA 4QKBA 4ZS2A 2FDHA 4NRMA 3O1UA 3T4VA 3RZHA 4ZHNA 4RFRB 2FDJA 3S57A 4NIGA 4IE0A 2FDKA 3RZGA 5DABA 3BKZA 4NIHA 3BI3A 3KHCA 4IE5A 3BUCA 4IDZA 4IE4A 4CXYA 3LFMA 4MG2A 3BTYA 4JHTA 4MGTA 4OCTA 4NIDA 4NPMA 3H8RA 3O1VA 2FD8A 4ZS3A 4QHOA 5F8PA 3O1PA 2FDIA 3O1MA 3KHBA 2FDGA 3T3YA 4O61A 3RZJA 4QKDA 3I2OA 3H8XA 3RZKA 3I49A 4O7XA 3T4HB 3O1TA 4IE6A 3S5AA 3H8OA 4QKFA 3RZMA 2FDFA 3BTXA 4NIIA 4NROA 4NPLA 4NRPA 3BU0A 4IE7A 3O1OA 3O1SA 3BIEA 4QKNA 4CXXA 2IUWA 3I3QA 4CXWA
chains in the Genus database with same CATH superfamily
2BERA 3VGIA 1HKDA 5FBZA 1CAVB 3KGZA 4AFAA 2E7AA 1K42A 2PHRA 5FZIA 1NQDA 4HETA 3PDQA 2VZQA 5LA9A 4CEWB 3M3IA 3UL2A 4LO4B 3RI8A 1ZZBA 2O8OA 5FZAA 4RSUA 2ZS6B 4BQYA 1ZBA1 2AREA 3Q9OA 3RMYA 4BDVB 1Y3TA 3EXUA 3T4VA 3ZFFA 5CEHA 4FQZA 4B4PA 5BNNB 1UO9A 5K7PA 1KJRA 1HRV3 3ZSKA 5I0RA 2K2SA 2FDJA 1CD3G 2JDPA 1DF0A 1H4HA 4P9XA 2VQTA 2PHDA 4QX5A 1X82A 2EXKA 3OD4A 3E1F1 4S2GA 5FYIA 4NIHA 1F4HA 1ULPA 2C6SA 4GZ9A 5FY0A 3WY6A 5GLVA 3PU8A 2DVFA 3HAGA 1LKNA 3LEGA 2ZX0A 3M3EA 1RVF3 4KGGA 5F6LB 4A3XA 1E5HA 1UY2A 2W92A 3BN6A 2E63A 3AM2A 3DL3A 2DFBA 1SMVA 1YFYA 3KT1A 4L8QA 5LBCA 2O14A 1UOGA 2CL2A 4RHV2 4M3CB 3CJIC 5A7WB 3J26N 5GZGA 1UXXX 1KXGA 3QD6A 4EZHA 2B9UA 1OQ1A 1C1LA 3N9OA 3HN1A 1PMJX 2VXRA 3K51A 3OYWB 2I45A 4AI2A 1D2SA 1OKQA 4YYOA 4NHXA 3THCA 2RJLA 2XUMA 1CJPA 1PHMA 1XSRA 1IKPA 2PHLA 2OQ6A 4QQPA 2JKXA 3POSA 3EBRA 2Q8CA 4AEDA 4ASLA 4EQVA 4HPKA 3I2JA 3GBGA 1H8TA 4GKYA 1AXKA 2WC2A 3IPVB 3EHKA 3ZYRA 3VHPA 5A3MA 4FTBA 2GN7A 1ASJ1 4H7MA 2XVKA 1FPN1 4S2HA 1SBDA 3EQEA 4X8PA 2DU1A 5M0TA 3MV11 1GZCA 2CSGA 3ZFFC 3B69A 3OG2A 4CP9B 1NAEA 4CVUA 4ASMB 2IWGB 4Q8LA 2OX0A 4YGDA 4FPYA 4N53B 3AB0A 1X36A 2GAUA 2VU9A 5BPXA 3VBRB 1RUC2 4XILA 4Y22A 5IAVA 4IGQA 2OIIA 1MZ6A 5FYHA 1W9WA 1RINA 5F3GA 3IB3A 3NV1A 4FFGA 1FT9A 5L9BA 1F8VA 1S0FA 3H7YA 1LECA 1W6NA 2CU5A 3M2MA 2FCVA 1VBA3 2DU0A 4MZUA 2YMZA 5ANQA 3ZR5A 2A75A 2W5FA 1IPKA 3RSJA 3WW2A 4BHPA 4EZ4A 1O4ZA 1PZ8A 1S2EA 1ZM1A 3QACA 1LR5A 4LIVA 4BLJA 1CGPA 5AVPA 2XBO1 3VL8A 4ARXA 5GLUA 3RS6A 1DFQA 4CU9A 2X53S 5FP9A 1GANA 3OBZA 1NLRA 1AR91 4GJYA 2QTWB 4GMP0 1I3HA 4QQHA 3V65A 4FOYA 4CDUB 1O3TA 3E5XA 2R0FA 5IJRA 2ZMNA 4PT6A 2BQPA 2W1QA 1KDKA 1YEWA 4QPWA 1WWYA 2VMEA 2HWB1 3RJ2X 5FYUA 2FBEA 4AEDC 3AZZA 1H8TC 1AR72 1OLRA 1UAIA 3OUHA 2DYCA 2VW0A 4JGZA 5C3PA 4BH9A 1ND2C 1MS1A 2P6CA 1M4WA 2DBNA 3AMMA 1W9FA 3VD4A 3GCWA 5EV7A 3OCPA 2ZGUA 4GH4A 2UWBA 5EJ3A 3WQ1A 4AYUA 5K0UB 4KWLA 3UNPA 5A32B 3POEA 3T1MA 1WMXA 1W3VA 5FZCA 3O1UA 3FZ3A 4LO6B 3KV9A 1C57A 5A7SA 2Q8DA 1SEFA 3I7DA 4FPCA 5EFUA 2ZEYA 5FV3A 1MS4A 1RUD3 4IE0A 3VLBB 2WFPA 4QD2A 4BK4A 4XIOA 1COV2 1SCRA 3N7LA 4OFGA 2GP5A 1G9BA 1AR82 4IEPA 1NKGA 3TNPB 4ISRA 4LBKA 1PGW1 1Y4WA 3HPNA 1OD5A 1A78A 3C3VA 4YM1A 1YFUA 1YC61 4Q4X1 3B5LB 5FYVA 1XE8A 4CPBA 2RS32 1FOD3 4S2FA 3GZTB 5JIUA 2Z4FA 3ACHA 3KB5A 1ZRIA 1CESA 2JDAA 3WOGA 1GWMA 4MV2A 2E32A 3BPZA 4XXPA 2G9FA 1XNCA 3KLSA 2E7QA 2YU1A 2OUHA 5ABJA 1LNSA 5HPOA 4TN7A 2XQXA 2VGDA 3T2PA 1B35B 1QJEA 5FZHA 4XJWA 1R1A2 1QOSA 2J1RA 4V2WA 2XG3A 4GH4C 4YFZA 4ZU7A 1D4VB 4C91A 1ZNPA 5A1FA 2AENA 4INDA 4X8NA 1QMJA 4O7XA 3JBG2 3VB9A 3WF4A 1RUJ1 3K77A 4I30A 3ZKUA 1YFXA 4LO5B 4IGOA 4AL9A 4Q4W3 4COYA 1XNKA 2RMU2 3FUQA 4ZY9A 5F3CA 2EIEA 3N7JA 5LBFA 5J96B 2WAAA 1S0BA 5C7GA 5D2AA 2VZOA 1UYPA 2VUJA 1BBT3 1JMUB 5LRSA 4Q0QA 3E5UA 3HJRA 3USSA 5FWJA 3ZPYA 1BXHA 2LW8A 2Q8OA 5GKAC 1AYN3 2ATFA 3NNGA 5L9VA 4MGKE 3RGBA 4GMP3 4QX1A 2HWF2 1X7NA 2YHJA 4MX3A 1NQJA 2ZZJA 4H2AA 5FO9B 4Q27A 3T1LA 3WXPA 2P34A 3DPRC 2QBXA 2XKPA 5LB6A 1R64A 3VBFB 2Z2SB 3BU0A 3I59A 3K4ZA 3AZVA 1S4CA 1UQXA 4HKLA 1O4TA 1HW5A 4OLLA 3SC7X 1BJQA 2ERFA 1D7PM 2VOVA 1VAMA 4LHLA 2SBAA 3PHMA 3I3BA 4IEVA 3K3OA 1LGBA 2EAAA 5CBLA 2IUWA 2JIGA 3E6BA 1RUI3 2C9KA 5LA1A 4HVOA 5T3NA 4CXWA 2CV6A 1VPHA 4JTNA 1LOAA 1ZYBA 2VVDA 1ZZ8A 1LOBA 2ORZA 5ABJC 3V0AB 4RS5A 5CISA 3BTZA 2XJVA 4LBNA 3RYPA 5JWPA 3N7KA 3P3PA 4NVPA 2IVIB 3FHQA 5C8CA 3SNMA 3CIHA 4D7SA 4K3UA 5ACA2 1UIKA 1ACCA 2OQ7A 2VUCA 1LODA 4LBJA 4AHWA 4XDPA 1SZBA 4Y1YA 2XB6C 3L2HA 3HR9A 1RHI2 2WNEA 4FPJA 1V6IA 4RHV1 1Y7BA 4TYSA 5EP9A 4COZA 1HV0A 1EAH3 2WO2A 3NJZA 3TRSB 1WKYA 3ZFGA 1WA4A 1OA4A 5FKCA 4CEYA 2FHRA 3WNXA 3VHOA 2XH6A 2X5IB 4YRDA 1SLCA 2BGCA 3AP9A 3IDBB 2MEV3 3S57A 1FX5A 4QXKA 1JHJA 2WYSA 1QNWA 3LB9A 3S7IA 4DQAA 2R1DA 2QZ3A 4XFIA 1FNYA 3D0JA 3U07A 3BKZA 4E9KA 5FFOC 2GU9A 3KCXA 3ORJA 2W1WA 4M00A 1BZWA 5F3EA 3MDPA 1WBLA 3H0OA 1UKRA 5JZGB 1JYIA 4I0AA 4BOWA 4IE4A 3LFIA 5LEJA 1POV1 4LUKA 1YCIA 2K0GA 1RUG1 3DXUA 4CZSA 4LK7A 4P02B 2BWAA 3FLRA 4CDWA 4HG6B 2C0ZA 2GZWA 4HFSA 5HI0A 4RR3B 4PDWC 1DG6A 2W46A 1I9RA 2A71A 3HN3A 1TME3 2BNNA 4LOTA 4JHTA 4MGTA 1WW6A 5G05L 1BYHA 1MQTA 1RUC1 4MYEA 1S0JA 1S0IA 2E7TA 1APNA 1SPPA 1V9U1 3WUDA 5CKMA 1RC6A 4RS5C 3FUOA 1YYNA 5BNOA 3VZOA 2PQSA 1N3PA 3VKMA 3O1MA 5JXIA 1XPWA 5EJZB 5KHJA 1UMIA 4V1PA 1LHVA 4LBOA 2RS51 4FVVA 4HANA 1R083 3FWEA 2ZAAA 5TSWA 4B7EA 5DAWA 4K40A 2HWE3 3BODA 4CP1A 3JU9A 2X05A 4J1WA 4UBGA 5FYMA 3H8XA 2JG9B 2B9VA 1CAWA 3ZFGC 4CEYC 4GB33 1UPSA 1PGL2 1A6CA 4QGNA 1HB1A 2JEMA 1CX1A 1AYM2 4ET7A 5IVFA 3UGHA 1QIQA 2X8KA 2XMLA 1GNYA 3AMPA 1DQ0A 2HWC2 3ME2A 2VZUA 3CF6E 2HH9A 2QKDA 1QXJA 1LHOA 1RUE2 1AR71 3ST7A 1AL0G 2VCMA 4QKFA 3ZLIA 1OD3A 1SLIA 1PO13 1PIV2 1SLAA 3M3QA 4GXLA 4WM7B 5J7MA 2OT7A 2ZJCA 4MGIE 5D8AA 3BIWE 4YVSA 2EF6A 1YJKA 5DAXA 2H6BA 3ZMNA 2J22A 4AK3A 5LCWL 1Y9MA 2RS33 3MIBA 4Y33A 1HLCA 4BQ3A 1AXZA 4IE7A 3H42B 1VMHA 3SCGA 3LIHA 3ILRA 3BIEA 3WZ1A 1ZZ6A 1OURA 2ADEA 2ZEXA 4XYXA 4XXAA 1YHFA 2R041 1K12A 3WP3A 1GQHA 3AK0A 2YY1A 1F5JA 5IVJA 4QDSA 1QXPA 2EXIA 4BMEA 4L9BA 3KF3A 4LKFA 5BUVA 2F17A 1W6OB 3POJA 5LW9A 3N3HA 1VBD2 1ULFA 4Q0SA 2CDPA 2R1BA 4XUOA 5B4XA 4UW6A 2QQPA 1YQ5A 1Y43B 2JDUA 5AFEA 2GSYA 2AEZA 1QJZA 1LESA 4AQ2A 3JCIA 1HIXA 4OULA 4UFIA 3IAQA 2WSUA 3MI8A 2DTYA 1ZBE2 1UYZA 2HJIA 2R073 1GZTA 5J3UA 4QWNA 1W6MB 1LEMA 1AR61 4Q29A 2Y6JA 5FBJA 4AI1A 3IDCB 1JUIA 4OQ9A 2WS92 3LA2A 3VHNA 4UI9L 1R1ZA 2HWF3 3QH6A 5FXXA 2C4XA 3T30A 2ZX3A 1PX4A 2GH8A 4DIQA 1NXD1 1W05A 4CTEA 5DABA 2VBDA 5EXOA 4K6BA 1QXRA 4LKEA 2R30A 1JODA 3EB7A 3IIAA 2YFUA 4IERA 4YVSC 5J98B 4YG0A 5H9PA 4ES9A 1SFYA 1R1A1 1X9TA 2AR6A 3IIIA 3ROUA 3S7EA 1AJKA 3KWVA 2RDRA 1NLSA 4LE4A 2A7AA 1O8SA 2PAKA 3VN4A 5C3RA 2JG8A 1DYKA 3VDAA 1WCKA 2JIJA 1K5MA 5A7NA 3UJOA 1UN1A 4OYUA 3TN92 3W5MA 2VQUA 3J7NA 1MS0A 5F5QA 4MG2A 2P6HA 3BVCA 3N9LA 4XFAA 1YIFA 1XQNA 4DZGA 5FLHA 2GC1A 4JKLA 4HXCA 1W2OA 1IG0A 2D3SA 2JD9A 4BM8A 4JGYA 2D6OX 2A3XA 2GNDA 2QQOA 5AC92 1V6OA 4QAWA 5ACA3 4CCDA 2YC0A 2HWD1 4EN9B 5JUVA 2A3WA 4DUVA 4YW6A 1GBGA 5FZLA 5KHIA 3WG1A 1OXCA 2J1EA 1KFUL 4HSJA 4QX3A 4YZ1A 4HPKB 5CAZA 1JW6A 4N53C 3U78A 2BVVA 4IQPA 4KWUA 3HBKA 1CPNA 5GJ6A 1JYCA 2VBPA 5JSPA 1UOBA 5GZDA 5T5JA 3TEWA 2E26A 3NWKA 5CA6A 1HQLA 4LHSA 1U5IA 2UY8A 3FMGA 3G7DA 4ES8A 1F35A 2WZEA 3KV5A 4LA3A 2QQLA 2UURA 2WT2A 4CDXC 4LQRA 3S5AA 4IV3A 1PNFA 4Y22B 1H0BA 3LD8A 4LITA 5DUWA 4AGRA 3PUAA 4ZZ8A 2JDKA 1V6LA 3LEKA 1JTZX 3TEZA 5AVAA 3N9MA 4L0PA 3U75A 3BTXA 1OHFA 1CZSA 4QX0A 2W95A 3D5OA 2JG8C 1S0EA 3OGRA 1VP6A 1K5MC 1RHI1 5FZOB 5FXZA 2BZDA 4JZRA 3PVEA 3NVCA 4MGZE 3VZJA 4A45A 1HDKA 3CKHA 4C1WA 3O1OA 1C5HA 3RWNA 3ON7A 3HT1A 3UV9A 1TMF3 4AVVA 3IM0A 4FP2A 2VZPA 4BQ4A 1REFA 4C0BA 3H1YA 3KF5A 4JGYC 4MGSA 5FYCA 1RUNA 3BYWA 1UU6A 1SFPA 1RUF1 2V4VA 4UF0B 2XDVA 4YM0A 2E33A 2A70A 3H3ZA 3WP5A 1JYVA 1JBCA 1S0CA 4GQ7A 3LEMA 4PBOA 5A70A 1X8MA 1RMU3 4QX8A 3THPA 3RDIA 1US2A 1HRV2 1OBNA 1IZ3A 2RM21 3QBQA 4Y20A 5L7OC 1YJLA 1OUXA 3UKNA 1Q3EA 4YZ5A 3O5SA 1DYPA 1SDWA 2ZGMA 1S0DA 1W8NA 2E51A 4A42A 5KR7A 5C6CA 3NV3A 3POYA 1OFNA 1FXZA 3CZUA 1E57A 2YGMA 4IGPA 1PMIA 1KD7A 1C1FA 4WM8B 1RVF2 5H9QA 5IUQA 4DOUA 1J3RA 1M06G 3MIEA 1IS3A 4MLOA 3PUHA 3PUSA 4N43B 5FK7A 2DUQA 4QMAA 2FDKA 1PK6B 1EUUA 1W06A 2VUAA 3ZSMA 4P14A 2ZAHA 5A7OA 1OOPB 5J36A 1WGPA 1V6MA 3OUIA 4NAMA 2D6LX 2WT0A 2ZMLA 3TAYA 4L2NA 1N1TA 1H2NA 4P9YA 2W94A 3RYRA 5FYZA 3BUCA 1KEXA 1OC1A 2TEPA 4LT5A 2H0VA 3UYJA 2UYAA 4IEZA 1JYXA 3I3DA 3B00A 3ZO0B 1MZEA 2VMDA 4BIFA 3GHNA 3ZN6A 2J1VA 1BKZA 3PUIA 2Y8KA 3FBMA 5FXVA 1EPWA 2MPFA 1S2KA 3I2FA 1Q8VA 4A41A 3RRDA 4QM8A 4M4RA 1ND3A 2HWC1 3ACGA 1AL23 3C8XA 1RUE1 3AYDA 4OHWA 4ATFA 1L7LA 4LE3A 4Y24A 3FE5A 4DRVA 1PIV1 1Q56A 5FPBA 3RZJA 4YARA 1AUYA 1JZ6A 2OZ6A 1DGWA 2PHFA 2WNUB 3ZM8A 4CCOA 4OI4A 4G3YC 3VBOB 4A4AA 4IEYA 4EN8B 3M3OA 3UT0A 2JX9A 1DP0A 1ODMA 1PVC2 2JDHA 1GZWA 3AKQA 4BYYA 3KV6A 1VBA2 4LORA 3J8F3 4FTEA 2I2SA 1PZ7A 3FL7A 4IW3A 4OMCA 4AQTA 2VD7A 5AFBA 1RTVA 3O14A 4XHBA 1J1TA 3ZFEA 2DCZA 2XWBB 4AR2A 1Q8QA 2VG9A 1SFNA 5FUNA 2J1SA 4FPFA 1BHGA 3T08A 1GOFA 3WQBA 4OVEA 3ITQA 4CDQA 5FJKA 5JPNB 3ZN4A 2OZJA 1ZBE1 3A21A 4Q4Y3 1LCLA 1MEC2 2LTNA 1QJY1 2BRTA 3AP5A 4GWJA 5DAPA 1VRH3 2A6YA 4IUGA 5KXCA 2WS91 2DCKA 1BEV1 2P4EA 3AL6A 2QJVA 3ES1A 5A3WA 4LJHA 4XF4A 2XKOA 1I5PA 2WFF3 5FY4A 1GNHA 2HBTA 1KS4A 2R0HA 2WO7A 1G8WA 5JOYA 1IHMA 3WEZA 1JYWA 2LRPA 5DDJ1 5FXWA 2PXJA 2E53A 2VZ1A 5LBBA 1O7FA 1OLMA 4K7JA 2ZX2A 4DUXA 1JYTA 1BVP1 1WLTA 3FHAA 1PO21 1RUD2 3IMNA 5C8CB 3RZLA 3TN91 4NRQA 5HCHA 2DUOA 3JD71 4PF5A 4LNVA 3SEEA 1JYNA 2D43A 4DXZA 4BXFA 4J6GA 2EXHA 3PJQA 1JUHA 4QU2A 4XF1A 1LOCA 2CWMA 3R6SA 1WMEA 2W9XA 2IXKA 5AC91 5DG1A 3VD7A 5C4WB 1Q8SA 3CJIA 3WP6A 4HN0A 2VECA 4TLGA 2X29A 1Q5OA 5ERLA 3ZXDA 3N7MA 4RA0A 3VZMA 1FOD2 3A22A 3HVDA 4AFBA 4C90A 1O59A 5FY9A 4CU8A 1WZXA 4BWOA 4CDQC 5KC6A 3VBSA 1ZREA 3BGAA 4NHLA 3K46A 1UZVA 2UU8A 3CHXA 2BWCA 2ENRA 5I8TA 2Y6LA 5HCFA 2E6VA 4W6XA 3C7EA 2KD7A 3VDDB 2WQ8A 1QDCA 3CU7A 3R4DB 4W8JA 2JXAA 2WLQA 3GZAA 4FPGA 2R6QA 5D21A 5C9AB 2QQWA 4LMFA 4NPMA 1ENQA 4CA9A 3DN7A 1MQTB 4UW4A 4ZXKA 3LKJA 3AZXA 4K8FA 4QB6A 3ZPOA 2RR11 4LBLA 4Q4W2 4FP3A 1VBE1 2JG9C 3KHBA 4DXSA 4N9HA 2X09A 3HEIA 3I97A 4GJZA 3VL9A 1LEDA 1RUH1 4UAPA 3WG2A 1NXMA 2TBVA 2JDZA 2WDBA 4XVHA 1BBT2 1ODNA 4D0QA 3LQCA 4D69A 1QJX1 4ITCA 3KD4A 1QKQA 2YC2A 4GIQA 3WINE 5JCTA 1AYN2 4OHYA 3LEIA 1EV11 4HN1A 4LEJA 1XXNA 2YZ4A 4XFGA 1F5FA 2GMMA 4YW7A 3RI9A 5BNQA 1CAWB 3OBRA 3WHUA 2W1UA 3VKNA 2QQJA 1PVXA 3O1TA 2YPDA 4FTSA 1DCSA 4O65A 1IS5A 1UKGA 3AKRA 4RQPB 4XTPA 1NCQB 2CWSA 3PU3A 4KG0A 5A3OA 3T2OA 4YZ3A 1UOFA 3KMHA 5T54A 3OPTA 2GC0A 1HRV1 3VBSC 2G1MA 5FMBA 1FPN3 4UW3A 1W99A 3J7MA 5IW0A 5FDBA 4F7ZA 3DUIA 1RUI2 2GC3A 4LLOA 2PN5A 1DQ5A 4ZU5A 2BGPA 1NZCA 3FX3A 3MW2A 3POBA 3OB8A 2C1FA 4OUEA 5LA2A 2ET7A 5D1IA 1ND2A 4OI2A 2H6CA 4YVWA 5LK5A 1R091 3H9AA 3FN9A 1GNZA 1YNAA 2VR4A 3ZXLA 3NL1A 5I0DA 1JOPA 4XJUA 1SDDB 4Z2WA 3DYPA 5F2SA 4JCKA 1ZZ9A 5FPVA 4QXHA 4KI5M 1MS8A 5FUPA 1YUDA 5FZMA 2FQPA 3SKVA 2IC1A 4M4PA 1G6NA 3JB8A 1F9KA 4Q2FA 4BIOA 5C33A 5KXEA 1EAH2 4XACA 2DCJA 3T09A 2NM1A 4YSFA 2PQQA 4L97A 5FO8B 5KHKA 2JDYA 4YZ4A 5APAA 2GC2A 1O6UA 3X29B 2MEV2 1PVC3 2P5BA 1Z78A 2XBO3 4TSVA 4XF3A 2IXJA 2VBBA 2TUNA 1JZ7A 4UW5A 3WHTA 1DBNA 2QQVA 3K48A 1HXS2 5IVCA 1VMFA 3W5NA 3ZXKA 2XUEA 1OF3A 5H9RA 2YG0A 4BJ0A 4JDOA 2VE1A 2HWB3 4LHKA 4XEZA 3TEXA 2PLV2 5FR3A 1QGLA 2J7MA 5F5CA 5FREA 2WNOA 4AQ6A 4EJRA 1U5ZA 1LOFA 1VB2A 3B94A 1UU4A 2ORXA 3GCXA 3HQXA 1N1SA 1TME2 2VMFA 2YBSA 4IL7A 5FMDA 2AH2A 5FP8A 4DNYA 1MS3A 4NMIA 1MEC3 2VOTA 3VBUB 2VMCA 4B3NA 4U2AA 5T55A 1SCSA 3NAPB 1WCQA 1ALYA 2P3JA 5CYYA 2WZPP 1G9AA 3MF6A 2KR2A 3P3NA 4YVWC 4NIAA 4AF9A 4FSJA 3U10A 1T6BX 5LASA 2I74A 3NW4A 3ILFA 3PIJA 4ARYA 2AC1A 1R082 4PLMA 4K8RB 5CFDA 5IFTA 2VCCA 1Z7S1 2HWE2 2CTVA 1UY4A 2Y33A 4OCTA 1YO8A 4AEKA 3RMXA 2N7GA 2ZTNA 1V6NA 5GLZA 3NNMA 3SH3A 4YM3A 4GB32 1W6QB 4B1MA 1HRI2 5F8PA 3VBHB 3HQUA 4Q1PA 3WX5A 3NQHA 4XE9A 5GZFA 2FDGA 1YIPA 2P3YA 2VOWA 2YYOA 3LA3A 2P3KA 4CUAA 2Q0AA 2Y64A 4LBQA 3SLIA 4KGQA 4TZDA 1RJ7A 2XONA 1CJDA 3H8UA 3LSDA 3DCQA 1W03A 4K1ZA 1VBB1 2ZPXA 5FZ0A 3ZN5A 3OBAA 1IG3A 3RZKA 1PO12 3DPRA 5A7PA 4X6RB 5FZDA 3LSEA 1QQP2 2B42B 2DVGA 4LKDA 1S55A 1XJAA 4DEVA 1BMV2 4FOVA 2R49A 2GMPA 2WZR3 5A33B 5HXMA 1PMHX 3QLQA 5E88A 1CAUA 4AVBA 5A6ZA 5T50A 1QJU1 1LOFC 5CADA 5JLVA 3TB0A 2ET1A 2QQMA 2EAKA 5LATA 5FPLA 3USUB 1DHKB 3W58A 3WV6A 1L7RA 3OY8A 4RGKA 4Y1ZA 4N8MA 4ATEA 5CFCB 5JDBA 3UJQA 2WQZC 2HYKA 4A44A 4ZZ5A 2RDNA 3MIHA 2DVBA 1CZTA 4PQQA 3WDYA 4E27A 4E4SA 3AYCA 5FIXA 5CFDC 2OA2A 1U0AA 4AVTA 5FZ6A 5FMOS 3KM5A 1LGCA 3WNPA 2D3PA 3K3NA 2YV8A 4FFIA 4P5YA 5FO7B 3H50A 1IPJA 3ZXGA 3ZXAC 4YW3A 3A4UA 4Q26A 5BY5A 5FWEA 2RE9A 4Q0PA 1C8M2 2G9GA 4WZCA 3LIGA 3APBA 1ST8A 3B7MA 3KV4A 1SLLA 3B93A 3SQOA 4TWTA 2R072 5FZ8A 1FOD1 4WVMB 2BEOA 5IT6A 4XFHA 5JR7B 4HT1T 4NJ4A 2ZKLA 3K75B 4XQDA 1K5JA 4Y5SA 4QPIB 1H1IA 4AEJA 1J3QA 4GAZA 5JXJA 1ZRFA 3LF7A 1QHDA 4RFT0 4Y20B 4QPGA 2RJKA 2D3RA 1WLCA 4FPOB 2BOIA 3GF6A 1UPIA 2W3JA 3WW3A 5F9TA 2R7EB 5FY8A 4KQ7A 3OF1A 4PBPA 5LBEA 3WT3A 3RJRA 1UYYA 1W04A 3RZHA 4PDWA 2WLPA 1UL9A 2XVLA 3HNYM 3MIDA 1AHSA 5F7UA 4XUTA 1NG0A 1NCRB 3URFA 3IDEA 5A6XA 1CAXA 1NT0A 3AJZA 4Y1VA 3BOWA 4FXKB 4ASKA 2ZHLA 3LPGA 1HB3A 4R4ZA 3ETPA 4S2DA 4XCAA 3UKTA 4Q0UA 3BALA 4CXYA 3WG4A 3L9JT 2ZCWA 4CCLA 2ZGOA 1H9PA 4B8EA 2ZKNA 2Y6KA 4U36A 5GLTA 3ZN6B 4WBBA 3BTYA 1LJ7A 2D93A 1PZ9A 5EJ1B 2VM9A 2QFEA 3PL0A 3AL5A 1S1AA 3E6CC 2WNUC 1WCUA 3KZ4C 4QHOA 4IV1A 4LKSA 4N7IA 1D0HA 1NA1A 2E9QA 4YGBA 1RJ8A 5CVRA 3VBOC 1RUI1 4LUMA 4HLTA 1HXS3 2UYBA 2WNVB 4QPGC 5FZKA 3O0VA 4D7YA 2A5ZA 3MYXA 3T0DA 1QWRA 2WA4A 3K4DA 4IEOA 2V72A 2WO1A 4P08A 4R9DA 2A3YA 3VKOA 2CGNA 3ZR6A 4AHZA 3FLPA 4AXOA 1OQEA 2PLV3 2BJSA 3NJYA 4QX2A 4B29A 5BNPB 1N3OA 3WG3A 1OFSA 1DZQA 1V9U3 2VO5A 3ACFA 3OEBA 4C0HA 3VV1A 4CE8A 2XVGA 2WABA 1HQNA 2JE8A 3HOBA 3WLUA 3ZSLA 2JD4A 1HJGA 5FZGA 4DEQA 3ZYHA 1EAH1 2BOJA 4K1YA 2RS53 4CCEA 3IMMA 1TMF2 1CAVA 3B9CA 4I2OA 1VE0A 1VLNA 2ZGKA 5FZBA 1TEIA 2IXCA 1W6PB 3F95A 2MEV1 3RG0A 2FDFA 3T0BA 5FP7A 2EALA 4KL1A 4IEUA 1WUVA 4PIYA 3SMHA 5FRAA 1D4M3 1X9PA 1YQCA 3OPZA 1NE4A 1RITA 1LU2A 1U5YA 4PF1A 1XU2A 1RMU2 2BFUL 3U11A 5K9YA 4ISQA 5BNNA 3HWJA 2WRAA 4KBBA 2XR4A 4LA2A 1HRI3 2GN3A 3WVJA 5C8WA 2ZGPA 3WSOA 3LZZA 3J9SA 3SKJE 2JENA 3MW4A 4IV1C 1P8JA 5A3TA 1NA1C 1TME1 1WCSA 2BDRA 1J1LA 1B09A 5A3LA 1UNBA 1AX1A 4FI9A 2XLGA 3NMBA 1UOJA 4AQSA 2ZZQA 5JPMB 2PMWB 5JVVA 2A6VA 4UFJA 1G9DA 3CDZB 4UFMA 2ZGTA 4QPYA 4WVWA 1QQP3 3WQ0A 5LK7B 3AYAA 2VCBA 4YW1A 4BK5A 1W8WA 1JZ5A 1JZ4A 3MZHA 2ZOEB 2R043 1W8TA 2IVJA 3CBNA 1NE6A 2RS12 4IXLA 4LOSA 4M3CA 5DN2A 5FY7A 1BVVA 2WBKA 2B45X 1IS4A 3K2OA 4Q1RA 2HWE1 1LHNA 4CUBA 2YDEA 4F8AA 3OYWA 4NRMA 2AACA 5E16A 3KCYA 4AW7A 2IZWA 5EYYA 2DVAA 4OHZA 1QEXA 4I0WB 4CCMA 2VMIA 2LS6A 1I1EA 1URXA 3F2ZA 3NSTA 3P5BA 3RFRA 1UWWA 3D4KA 4MO3M 5F39A 1WD3A 2PHUA 5HXVA 5DZGA 4CEWC 1COV1 1LOEA 3IPVA 4JDNA 2PYTA 2KXLA 3ZXFA 1JU4A 1AL22 2DCTA 1AR81 5DMYA 1AR63 5LY1A 3RZZA 1RL3A 1CZVA 3A0KA 3BPSA 1H8VA 5BNNC 3L2YA 1C8M3 1DQ2A 2CAVA 1MS9A 2VW1A 3LPFA 3LFMA 4PQ9A 4N53A 4B4RA 2RS31 2TNFA 5JXHA 1XSQA 1D0GA 3RVHA 3VBRA 4COWA 1OF4A 5CU1A 4NIDA 5DZFA 3WR0A 4M3CF 1OVSA 3AP4A 4UT5A 4PLOA 3ZFFB 1UD1A 2FD8A 4LLFA 4IEWA 1NLQA 5J37A 3J8F2 2FDIA 3D8CA 4CDXA 4PJYA 1W0PA 1UX6A 4JDMA 3Q8AA 3NJVA 5DUXA 3A7QA 2YBKA 3FC0A 3I3EA 4K20A 1GUIA 3CJXA 4BPZA 2CAUA 3HBZA 4ONUA 4PIXA 1XYOA 1ONAA 1REEA 2RDQA 2SLIA 2D5HA 3I49A 3JBG1 3P1IA 4CDUA 4URTA 1U12A 1XNAA 2HWD3 2RMU1 1N1VA 5F37A 5JSRA 4DXRA 4CRQA 2R071 2WL1A 1HX6A 4Q4Y2 3VKLA 5HCBA 3ILNA 1MVEA 3NNJA 4AHXA 3T0AA 1VRH2 3M8LA 2VAUA 4BCUA 3H7JA 3TEYA 3H8OA 3GHMA 2GNBA 2HWF1 5C71A 1ZRDA 4P9JA 5T5OA 4H7LA 4E4DX 3VKFC 2OW4A 2WFF2 2G4IA 4XTMA 4AEDB 5K0UA 4NWVA 4ORFA 4XFBA 1O3RA 1H8TB 4XAEA 4CSWA 1FATA 5L7OA 3MUY1 3VBRC 4EV0A 1S2BA 3U37A 5HV0A 3DEMA 5FJHA 2R063 5FZEA 4CCJA 3HT2A 4RGGA 4D8MA 4MH0E 3H3LA 4XFFA 1W39A 1XNTA 2KM2A 1YFWA 1OQDA 1JZ2A 5K4LA 3MEPA 5A80A 2EIBA 1SBEA 1YI7A 5ACA1 2CDOA 3C7OA 4DPNA 4EWDA 3T2TA 2XL9A 1DLLA 3AVRA 3GJAA 4DUWA 2XJTA 1N47A 4CDUC 1W2NA 1W6NB 3POFA 5DZEA 1DZTA 3HNMA 4BQXA 4XABA 3K4AA 5F5IA 3NKTA 1RUF3 3UKVA 1DGWX 3DYMA 4IESA 3GDBA 3HQRA 3GGLA 2A73B 4H3WA 2PAMA 3IBMA 5JMCA 3AFGA 2OPWA 1YQ6A 3HNBM 1GOGA 4DO0A 2FMDA 2RM23 3ALQA 5C4WC 1B35A 4META 4OHVA 4MGYE 1J3PA 2LROA 5K0UC 3GM8A 3U1XA 2O0OA 3I2KA 3Q8BA 4JRAA 3KQRA 4JGZB 4W4ZA 1WW7A 1J83A 2JECA 3H3UA 3R0RA 1ZRCA 4W6WA 4LR4A 5I0TA 2YPJA 1Y9GA 3TNQA 2WA3A 2NPIA 3TWIA 4GH4B 4DB5A 2RDSA 2XJQA 2ZHKA 3KGLA 3H8RA 3ZXEA 1TMF1 2Y60A 1LHWA 2F6BA 4RGAA 2ARBA 2RG4A 2OPKA 4HMZA 1AJOA 2ILMA 2RS13 3OGJA 3WQ7A 1XB9A 1HN0A 1W8UA 2V4AA 2EICA 2V73A 2VOXA 4R9BA 5FUIA 4E8DA 1A8MA 4Q4V3 4QGMA 4XURA 2OXBA 4LBQB 2BGOA 3RWKX 3ZYPA 4A6SA 1WLDA 4HZFA 5FMOL 4CP2A 1MZFA 1FPN2 4HK9A 3OOXA 4XF0A 5KXBA 1PGL1 4DY5A 2D7FA 4NHYA 3GXUA 4LBQD 1AYM1 1FNZA 3MIGA 1ULCA 3DPRB 5FYSA 3T4HB 2PHXA 5FZ4A 4PLNA 4W65A 3WF1A 3AKPA 1QOTA 1T6GC 3POIA 3W9AA 2ARXA 1A34A 2O8QA 1B35C 3LE0A 2K9ZA 3GALA 1DQ1A 4QHZA 1XOYA 1ZA4A 4KWKA 5FLIA 3ZSJA 2XPJA 2HEYF 4CPBD 2LALA 1QF3A 3JUUA 2XJPA 3OY8B 4KNCA 2DBIA 3IAPA 4C1XA 4XAAA 5ABJB 2VH9A 4XJ8A 5F6KA 4NRPA 2AYHA 3LOIA 2BV4A 3NJXA 4HVRA 3NKGA 3SH4A 3O1SA 1GQGA 1VBC3 3SISA 4CUGA 4AGGA 1D2QA 4FPHA 1BLZA 1YLLA 2FCUA 2XBO2 5KWRA 1XE7A 1QH7A 1OPMA 3WDVA 4N90A 3AX4A 3MPBA 2OYZA 4I3PA 1QJFA 1DZRA 1KITA 1OLME 4FOQA 4EN7B 4QU1A 2GDFA 4JKKA 2Q30A 5E6HA 1JZ3A 1QY4A 3D0SA 2HWB2 2VULA 1H6XA 1VBD1 5FYYA 5H9SA 3VBFC 1S0GA 5J48A 5JZGA 2F4PA 3O1RA 2OVUA 3S30A 4DS0A 4L92A 4OUMA 1BEV3 2XLAA 2Z79A 3OSDA 4YG3A 1OUSA 5CB7A 5B4NA 1YQ2A 4RR3A 4QKBA 4CU7A 1K45A 3ZOIA 4B4QA 2BP6A 4Y5Z0 4YM2A 2ZBJA 1VALA 3I59B 4Y4RA 3WDWA 5DDJ3 4F83A 3I54A 4O9GA 4R8HA 4BU2A 5IFPA 1YWKA 2VNOA 1MPXA 3O0WA 4PDWB 1PO23 2VPVA 3J8F1 4YWAA 3WNKA 1F31A 3PVBB 4AAXA 4B7KA 2RVAA 4BZ4A 4D3WA 4OQ8A 3ZX7A 2BBVA 1KDMA 5A1AA 4W50A 4R9CA 4XBLA 4D94A 5GZCA 3BI3A 5CKQA 1PGSA 1OA2A 1UMHA 3CNAA 3NNLA 2DCYA 2GALA 2JG9A 4P9LA 4RS5B 4AVCA 3NO8A 4HONA 5BYNA 3OGGA 5FZFA 4EN6B 3ZMOA 4HBNA 5FYTA 1PGW2 2X5IC 4J1XA 2YFZA 1CR7A 3M1HA 4L11A 4B1LA 3VUOA 4EWAA 1HN1A 2WN2A 2UWAA 1FMD3 2YUEA 2DURA 4XFCA 5ANNA 1BQPA 2AGSA 5L73A 3WW1A 2BFUS 2XHKA 2YROA 1YQ8A 4Q4Y1 3EJKA 2B8MA 2F4LA 3IDAA 3ZFGB 4CEYB 4CCNA 2DFCA 2ZGRA 5DUUA 3MO4A 4Z92B 3KVBA 4DINB 2Z5WA 4BQ5A 5JZGC 3J7HA 3GJBA 2WZR2 2WYFA 5HV4A 4GWIA 4E2SA 5FY1A 4MOAA 4HL0A 3UESA 3EYPA 4NWWA 4MGQA 5FPUA 4RR3C 1ZBA3 1EUTA 2J42A 4QKDA 4XUNA 3MIFA 5B2GB 3MBWA 3IN9A 5GZEA 2QQUA 3C7HA 3WF0A 1J58A 2WO3A 4K21A 3GYDA 4XJAA 1RUJ2 3GBWA 4XOGA 4AHYA 5IVEA 2RR13 4XBQA 5DG2A 4CDWB 5CG8A 2VW2A 3LAGA 1VBE3 5K8SA 1W9TA 2J1AA 2O1QA 2VVFA 4BLIA 5C3SA 1W6OA 1H2MA 4XJZA 4RN5A 3KSCA 3AZWA 3R05A 4ZPIA 4AEMA 3DKWA 1TG7A 2PA7A 1SPPB 3H1WA 5L19A 4A7YA 3CMGA 5BNOB 1EV13 3VD3A 3VDCA 1JU3A 2ZGNA 2CNAA 4F3JA 1VIWB 3AXDA 4D6RA 4NIIA 1W8FA 2VZTA 5LEKA 1CIYA 5E8AA 1W6MA 4A2UA 1ZVFA 3MPPG 4HKWA 4Y3OA 5F5AA 4Z8BA 2CYFA 4EE2A 1W2AX 3WDXA 2NYYA 3AKSA 1ENXA 2BNMA 4UXAA 1O91A 4LULA 1WLWA 4MXWA 2WJSA 4RYDA 5HCAA 2GNMA 1OVPA 1W2UA 2DDUA 3VDBA 5F2WA 5CKNA 4QT6A 5CIRA 5FAXA 1TQ5A 4WM7C 4JTOA 2DWRA 1BCXA 2VNVA 4YGEA 1GR3A 1VAKA 2CHHA 2VOKA 5KHGA 1ASJ3 4NHMA 1AXYA 4OI0A 2BNOA 4QHBA 1SLTA 1FAYA 1QU0A 4N7UA 1R093 2WWJA 4LO7A 4WVVA 5IAXA 2QDRA 3S6PA 1HB2A 4P9WA 1JN2P 3MW3A 4HOOA 5D8AB 4YVSB 3WNMA 3PJYA 2EA7A 1WMDA 3I8TA 4ZS2A 5EYXA 5FK8A 2QUOA 5E89A 4AI3A 1QNYA 1OPOA 4UFKA 1RVF1 4AFCA 4FAHA 3I4IA 3DV8A 5IVVA 1AF9A 1EYBA 4ZHNA 1RB8G 4BQWA 2CGOA 3A0NA 2IFWA 4QB2A 4GWMA 2ZHMA 3ETQA 1H2LA 3ENRA 4E4HA 3I2HA 5C70A 1WCDJ 4Y1XA 3W59A 2IFRA 4Z07A 4JRLA 2ZMKA 2NQYA 4UYBA 4IDZA 4BQ1A 1OSGA 2PFWA 4NAOA 5FY5A 1AR93 1OMIA 4UBHA 1LB2A 3LA7A 4MADA 3J4UH 1RGSA 1RUG2 5FOJB 1E5IA 2VY0A 3EO6A 3VHRA 1V00A 3MLKA 2HBUA 1JZ8A 1GP6A 4PIZA 5A3PA 1GV9A 3PNAA 1XNDA 4YG6A 2Y6GA 4NO4A 3J7LA 1V9U2 2W2IA 2WR9A 2HEVF 4FFHA 2G19A 4BA6A 5JOWA 1XNBA 5FQ0A 5JOXA 1O3SA 5FZOA 1BK1A 1H6YA 3B01A 4CDXB 2RS52 4LK6A 5KC5A 2B4KA 2ZX1A 1UMZA 1Z7S3 3OTFA 3ZYIB 2NMOA 3I2OA 5FYBA 1QH6A 2QNKA 2JKBA 4A7ZA 1PVC1 1VB4A 2EXJA 4QDRA 2G9ZA 2JG8B 1N1YA 3KCCA 1UXZA 1VBA1 1Q8PA 1K5MB 2CY6A 1D4M2 3FFZA 3AZYA 4G9SB 1IPSA 4YW2A 4MUVA 4UF0A 4AG4A 2VCAA 1UIJA 5DUVA 4JC1A 3UGFA 2EIDA 3AMQA 1VAVA 1WMFA 1UX7A 4DRRA 3EMRA 3ZSEA 2XL7A 3PIGA 4IE6A 2Q4SA 1UZ0A 4M01A 4JGYB 2ADDA 1KQRA 5EWSA 1VBB3 5JIAA 1KRIA 3Q8CA 2YU2A 2QZ2A 3DECA 4Q4X3 3Q8EA 1HV1A 3VBUA 2ZEZA 1O3QA 3N36A 2YXSA 2HEWF 1LTEA 3ZDVA 1MEC1 1DDLA 4I02A 1DQ4A 1C3HA 4X6QB 3ASIA 2RV9A 4YLZA 1IS6A 1QJU3 2AEYA 2JDNA 4WM8A 4AOCA 5L7OB 4XHXA 4AWDA 3LGRA 3AC0A 3ZKYA 2DTWA 2Y0IA 1LU1A 1PX3A 4R52A 4RD7A 3OPWA 4N43A 2B7YA 5T5LA 3ZVXA 2NP0A 1POV0 3TBDA 2VUDA 4W6YA 5FPAA 3LDBA 1PK6A 2R042 1RUOA 1RXFA 1X8EA 3ABZA 1OOPA 3AMHA 3ATGA 2DV9A 3INAA 3U4XA 4PCRA 2C5DA 2J1UA 4JVAA 4LO8A 4LTAA 2WINB 3CQOA 1VMJA 2Q5TA 3WCSA 1JOBA 2EVXA 1C4RA 1J84A 3C2UA 4IV3B 1RUD1 5GLWA 5CG9A 2VTXA 3WCRA 5G04L 2ZA9A 5LRRA 1GMMA 5ISLA 1RUJ3 4Z1VA 4HKOA 2W08A 2BVBA 3V0BB 2V09A 2ZGLA 3HD8B 4QB1A 3ECQA 4KG8A 4V2VA 2VTFA 4TLFA 1DGRA 3I2IA 1GFF2 1AR62 2GP3A 5EIYB 3KVAA 4JQTA 1GWKA 3H1MA 3O7OA 1A3KA 2WN3A 4R4XA 5A1LA 3ZYBA 4QQLA 3BB6A 2Q1ZB 5FCCA 1GSLA 1GKBA 1XRUA 2WZR1 5FTTC 1MACA 4JGZC 4FO9A 3AJYA 1ULGA 3ZIWA 1KFXL 2P1BA 2WNUA 3WNLA 4XQ4A 3PTRB 4XUQA 2QQIA 2WAOA 5C5TA 3KHCA 4IE5A 2DVDA 1XYNA 3VBOA 3P6BA 5A3NA 4AZZA 4NHKA 4COVA 5IVBA 1QOOA 3OD0A 1IKQA 1Q43A 2VMGA 4WM8C 4QXBA 5DAVA 2I07B 2C24A 4URAA 4N43C 2Z69A 3O0XA 1H1MA 1UW8A 2BU9A 2PELA 1PK6C 2WKKA 4H14A 1GLHA 1H9WA 1OOPC 1VR3A 4XBNA 5FZ1A 1DGLA 3CO2A 1DLCA 2AUYA 1IQAA 3WDUA 3O1VA 4Q4W1 2DUPA 3CLPA 4PHZA 4Z2AA 3O1PA 2HWD2 3LCPA 3E6DA 4FQ4A 5SV8A 1V6KA 4Q5OA 4E2QA 4YZ2A 5A3UA 5C3OA 3CL1A 5LA0A 2FCTA 1I6XA 4XJ9A 1BBT1 2C9AA 2H0BA 2Y38A 2ZACA 2ZGQA 4RHV3 5FP3A 4AAPA 5A6YA 5LZ6A 4TTGA 1AYN1 1HB4A 4GMP1 4XC9A 5FOBB 2WT1A 4OZXA 4COUA 1OH4A 3M70A 1NY72 1PNGA 4AGVA 1ULEA 1F2NA 5F32A 2VVEA 3WNOA 1KS5A 3PVOA 4E8CA 3FLTA 2YBPA 1ND3B 4Q0VA 3N4MA 2GMEA 3POWA 4XMIA 1W28A 4AI0A 4MVTA 1C5IA 3BOPA 2R062 3RZMA 5FLJA 4GKXA 1YXWA 1ENSA 1POV3 1TNFA 2XOMA 1XYPA 1RUG3 3IT8A 4NUBA 5FP4A 5FKBA 3VD9A 2IXIA 1TNRA 2ARAA 4YFWA 1XU1A 3JQXA 4FT8A 4K9SA 1UCXA 2P37A 3PMSA 4JQRA 5IYYA 4XW3A 4CCKA 3ZXJA 1MS5A 3MUZ1 2JJ6A 3POGA 3QOPA 4G4FA 2JE7A 1RUC3 1BK0A 4EROA 5IK4A 1KGYA 3MLLA 4OMDA 1W8OA 1WBFA 3ZIXA 3G6JB 5C4WA 1GYKA 1LOGA 1TVGA 2JB8A 2JDMA 4JHZA 4GULA 2XGXA 3WD5A 1CVNA 1GZWB 5EPAA 3TYJA 4CXXA 5A7QA 1NYWA 2UY9A 4GWNA 1UZZA 4JAAA 1RUF2 4CP0A 1WW5A 3SXWA 3LDKA 3V64A 1SG3A 4R9AA 2BYVE 3D82A 2QCSB 3ZFEB 2Z42A 4M3CE 3KS7A 4CEWA 2RM22 2NMNA 3IZOA 2PTMA 2ZEWA 3OGVA 1PM4A 1ZX5A 3VDDA 1FV3A 4A6OA 1HXS1 3V0BA 1H30A 1UY0A 1E5SA 5C9AA 4CDQB 2HLEA 1VRBA 2W52A 4NN0A 2Y6HA 4SBVA 2OKXA 1LENA 5I8SA 2FDHA 2QVSB 1AR73 2PLV1 5BXXA 3VD5A 4CU6A 3GNEA 2RJ2A 1OA3A 2D98A 2ES3A 5CZKA 4AI8A 4NIGA 4NPRA 3N9PA 3MFAA 4GALA 4M0HA 3RNSA 4QX7A 5C8CC 4AFMA 1FYUA 2VXJA 2V5YA 3FFQA 5E1RA 5T5PA 3SEPA 2VQ0A 2WSVA 2ZGSA 3DGTA 4IEXA 1JOJA 4HK8A 1X33A 2JICA 1VJ2A 1DGRN 4FPEA 4NE9A 5DXDA 1F15A 5F1RA 4KU8A 1DYOA 4KH9A 3KT4A 2GH2A 5JMOA 4KU7A 4XPVA 1SBFA 1NX9A 3ACIA 3HIFA 1D4M1 1R081 1OLQA 3N9NA 4KBZA 5A7WA 5BV6A 5IATA 3I2DA 1UF2C 4D6QA 4RQPA 4Q4V2 1NCQA 1AX2A 2E31A 2BBAA 5JAXA 1COV3 1EPZA 2NLRA 4GB31 4E4ZA 1GOHA 4E2GA 1AR83 1HRI1 2XHNA 2XJUA 3R4SA 4CCCA 4ZS3A 1TZOA 4Y5TA 2Y6FA 3CJIB 3C7FA 4LIUA 4ZXEA 3WF3A 5JOZA 2NN8A 5IK8A 3T3YA 2W47A 4OHXA 3AXEA 1JH5A 4XZPA 4XETA 1GWLA 1NUKA 3VDDC 4IETA 4DFSA 2A6WA 3LDRA 4YW5A 3AP6A 4CDWC 4XUPA 5C9AC 2QDNA 2WUHA 4Y1UA 3VBSB 1PO11 2MHFA 3QCWA 3V56A 4CP9A 1H4GA 2VZSA 2ZABA 1QQP1 1MQTC 1BMV1 4JV4A 1UZYA 4UWDA 1REDA 2X10A 1K3IA 5EHDA 1ULOA 4I3GA 2D6PA 2VNGA 5BNOC 3AFKA 1DIWA 3JZVA 1VBC2 2XWJB 4XF9A 1R1A3 1XE0A 1GQPA 3BCWA 5L36A 1LULA 1G7YA 4FPLA 4DMIA 3UETA 3JBG3 2V5DA 3OJBA 4XZUG 5DPNA 3UK9A 5JXGA 3SH5A 2B46X 4YGCA 2RMU3 3PMEA 1OKOA 1X50A 4AE2A 4BXSV 4YNIA 4Z82A 4MXVA 5IHRA 2WIIB 3ZYFA 4N9IA 3WF2A 1G9FA 4RQPC 1I5ZA 1QJY2 3B3QE 1NCQC 4A7KA 4Q8KA 2B39A 3A23A 3U0ZA 1BEV2 1C8M1 3E97A 3C7GA 3OBTA 1EY2A 4QXCA 5FPZA 4A3ZA 2L9LA 2Y26A 1CN1A 4MXWB 4ZKTB 3I3QA 3JB4C 4BISA 1FV2A 1RXGA 2AZ5A 4QQ2A 1T2XA 4HSLA 5D8AC 5DDJ2 3NAPA 4OUSA 1O5UA 2P2KA 5SV5A 1H1AA 5EQUA 4EYUA 1PO22 3MF9A 3AP7A 5KHHA 1LAJA 1KJLA 1C8NA 2C26A 1LHUA 2D40A 4GA9A 4L99A 4WV8A 4UFHA 5IVYA 2WWSA 1NZIA 2Q1MA 3AVSA 3JD72 5A32A 2VNRA 2W91A 4PI0A 1Y9QA 5J1XA 1ND2B 1QDOA 2YGLA 4YVWB 4KMQA 1W6QA 1W8HA 3I2GA 4AVSA 4RFRB 3OUJA 3VBHA 2XQRA 3NV4A 4CUCA 5J09A 2XJSA 2ID4A 2HKXA 3KQ4B 1FMD2 1POQA 2WZ8A 3FJSA 3SCHA 1W8ZA 3RZGA 1UU5A 2BUKA 5FZ9A 1RHI3 2EIGA 2RHPA 3VZKA 3CZJA 3AMNA 1ZZ7A 1ZA7A 1NOVA 3B9IA 2VZVA 5FZ7A 4I0BA 3ZYJB 1IQDC 1AX0A 5LWBA 2ZXQA 3LOBA 1JI6A 1NY71 4AVAA 2ZX4A 2D6NA 5A33A 3GZUC 3VZLA 4LPLA 2FMYA 1XC6A 1ZBA2 4UOJA 3PTYA 2DF7A 4KWJA 5JSOA 3USUA 4AFDA 4DY3A 3VBUC 1CX4A 3WP4A 2OUJA 1YI9A 4O9EA 5CFCA 2R061 1HJFA 2Y34A 3MFCA 2K46A 4WVZA 3NAPC 2RR12 1YRZA 3IKWA 4LBMA 1VBE2 4CYDA 2NZ9A 3JXSA 4O61A 5I91A 1O8PA 1ENRA 1UZWA 5FQ0B 1RUH2 4JKMA 3SHRA 3WNNA 3MHZA 4D7TA 2PHTA 1QJX2 1SQ4A 4BE3A 2D6MA 4FAGA 1W0NA 4XQWA 1EV12 2VC9A 2XJRA 3S5QA 4D6SA 2ARCA 3JQWA 2WWUA 1GP4A 3ELNA 2D5FA 2J1TA 3VBHC 3LWCA 1CIWA 3S0MA 4WVMA 1A8DA 5CFDB 4EWEA 1GZ9A 4RL7A 1GICA 1W0OA 2LM3A 2W87A 5I93A 4QPIA 2W68A 2JB4A 5JI7A 4NOTA 5FPXA 5IK5A 1Z0HA 1OH3A 2W0XA 3R4UA 1E5RA 2YB7A 3ZYGA 3M3CA 5A6QA 1TE1B 4H55A 1AYM3 3VBFA 3MLJA 5I0SA 4NROA 1UYXA 1UY3A 4P5HA 4FFFA 1FI2A 1RMU1 1W3XA 1ASJ2 2A6XA 2PAEA 2HWC3 4YW4A 3THDA 1RUE3 2Q1FA 1R092 4M0NA 1GP5A 4XDQA 3DF0A 1SACA 1NCRA 1WA6X 4IV3C 1PIV3 3O12A 5CFCC 4EN0A 2JE9A 4LXLA 2Q8EA 3V0AA 4FXGB 1V70A 1Q8OA 2P17A 5C5UA 1OT5A 1CAUB 1C28A 5DQ0A 4PI2A 2R32A 5FMCA 4YPJA 4C8DA 3FBYA 1CQ9A 1ZRRA 1XBFA 5F3IA 1O4YA 3Q8FA 1DU3D 1V6JA 4WZFA 1CPMA 5IWFA 2R16A 3IWZA 1AZDA 2LUWA 3QH7A 3I3MA 2RS11 3SCFA 1ULDA 4MSVA 4ZONA 1HQWA 2X5IA 3MGUA 4Q4V1 1DQ6A 2VJXA 1GU3A 1LGNA 3BTAA 2GNTA 3PVNA 5JR2A 1G9CA 4MHRA 4FBFA 1VBD3 5JI9A 3T2QA 1AR92 1G86A 3SITA 4FOWA 5I0UA 4BQ2A 4QPIC 2IXLA 2YC4A 2VTXJ 4JX0A 3PLQA 2B5HA 5HBAA 5KXDA 3CEWA 4NR1A 2KA3A 2VL4A 2WNVA 5C3QA 3NRUA 4XMAA 4P9IA 1AL21 2XLFA 1IGOA 1RYYA 1ZBE3 3D6EA 3KT7A 4XDOA 3M4FA 1CWPA 1MZ5A 1F4AA 2WQ4A 1QJY3 3WW4A 3ES4A 2VZRA 3RQ0A 2WS93 5BNPA 2Y0OA 1UY1A 2OS2A 4BMBA 2HYXA 1IOAA 2VZ3A 4QGLA 3DXTA 2XXZA 4QPGB 1STMA 1ZZCA 2BW8A 1NCRC 5EZWA 3M7AA 2W39A 4IEQA 1Z7S2 2D6KA 4QQOA 5T52A 1VBC1 4HVQA 4FCAA 2MNGA 1W6PA 5FZ3A 1RIRA 1O5LA 3E5QA 1U5XA 4Y4YA 5LY2A 5GM0A 4I01A 4AI9A 3TN93 2BTVC 2IXHA 1US3A 2P3IA 1W9YA 3D3AA 3JD73 4QDQA 3GBFA 3FHIB 4OZOA 2QQNA 3PUQA 1CAXB 5L9RA 1W90A 2FZ2A 3NV2A 4XCBA 4FPKA 3DYOA 2W1SA 5I8YA 5GALA 1VBB2 3VZNA 4DXTA 1SHWB 1W9SA 5AC93 1ND3C 4I09A 4ZU4A 4Q4X2 4SLIA 3UGGA 2JWPA 1H2KA 3HMYA 3ACLA 3B02A 4P9GA 2FZ1A 4XIKA 1JXNA 3RPQA 1VRH1 2VMHA 2WNVC 1QJU2 5KBFA 2ZHNA 2CGPA 3N9QA 3OEAA 1OI6A 1L7QA 1W2TA 4BB3A 4TXWA 4P00B 4WM7A 3RYKA 1WD4A 3THTA 2BPA2 3MICA 3N35A 2WFF1 3AKTA 4IV1B 1JS9A 3AYEA 4J25A 1NA1B 5BNPC 2VQAA 1MVQA 1JHNA 3TOJA 3U4SA 4NPLA 2UWCA 4GD4A 1CONA 3OGSA 4MHUA 1N3QA 2D44A 2QQKA 4Y26A 4UFLA 1MR5A 1WW4A 3WDTA 2PHWA 1LRHA 3WUCA 3NNFA 2ETEA 3U14A 1EP0A 2A1XA 4OI1A 3BU7A 5DAQA 2A6ZA 3ZFEC 3ZDSA 3DKQA 3GZEA 4QKNA 1FMD1 2QE3A 3MV01 2D97A 4QM9A 3W21A 1L3JA 1AVBA 3PURA 1RUH3 4LHNA 5CNAA 5IK7A 1SLBA 1J59A 1V0AA 1PM7A 3W20A 1QJX3
chains in the Genus database with same CATH topology
3BTZA 4NJ4A 3O1RA 3RZLA 3I3MA 4NRQA 4QKBA 4ZS2A 2FDHA 4NRMA 3O1UA 3T4VA 3RZHA 4ZHNA 4RFRB 2FDJA 3S57A 4NIGA 4IE0A 2FDKA 3RZGA 5DABA 3BKZA 4NIHA 3BI3A 3KHCA 4IE5A 3BUCA 4IDZA 4IE4A 4CXYA 3LFMA 4MG2A 3BTYA 4JHTA 4MGTA 4OCTA 4NIDA 4NPMA 3H8RA 3O1VA 2FD8A 4ZS3A 4QHOA 5F8PA 3O1PA 2FDIA 3O1MA 3KHBA 2FDGA 3T3YA 4O61A 3RZJA 4QKDA 3I2OA 3H8XA 3RZKA 3I49A 4O7XA 3T4HB 3O1TA 4IE6A 3S5AA 3H8OA 4QKFA 3RZMA 2FDFA 3BTXA 4NIIA 4NROA 4NPLA 4NRPA 3BU0A 4IE7A 3O1OA 3O1SA 3BIEA 4QKNA 4CXXA 2IUWA 3I3QA 4CXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BTZ A;  4NJ4 A;  3O1R A;  3RZL A;  3I3M A;  4NRQ A;  4QKB A;  4ZS2 A;  2FDH A;  4NRM A;  3O1U A;  3T4V A;  3RZH A;  4ZHN A;  4RFR B;  2FDJ A;  3S57 A;  4NIG A;  4IE0 A;  2FDK A;  3RZG A;  5DAB A;  3BKZ A;  4NIH A;  3BI3 A;  3KHC A;  4IE5 A;  3BUC A;  4IDZ A;  4IE4 A;  4CXY A;  3LFM A;  4MG2 A;  3BTY A;  4JHT A;  4MGT A;  4OCT A;  4NID A;  4NPM A;  3H8R A;  3O1V A;  2FD8 A;  4ZS3 A;  4QHO A;  5F8P A;  3O1P A;  2FDI A;  3O1M A;  3KHB A;  2FDG A;  3T3Y A;  4O61 A;  3RZJ A;  4QKD A;  3I2O A;  3H8X A;  3RZK A;  3I49 A;  4O7X A;  3T4H B;  3O1T A;  4IE6 A;  3S5A A;  3H8O A;  4QKF A;  3RZM A;  2FDF A;  3BTX A;  4NII A;  4NRO A;  4NPL A;  4NRP A;  3BU0 A;  4IE7 A;  3O1O A;  3O1S A;  3BIE A;  4QKN A;  4CXX A;  2IUW A;  3I3Q A;  4CXW A; 
#chains in the Genus database with same CATH topology
 2BER A;  3VGI A;  1HKD A;  5FBZ A;  1CAV B;  3KGZ A;  4AFA A;  2E7A A;  1K42 A;  2PHR A;  5FZI A;  1NQD A;  4HET A;  3PDQ A;  2VZQ A;  5LA9 A;  4CEW B;  3M3I A;  3UL2 A;  4LO4 B;  3RI8 A;  1ZZB A;  2O8O A;  5FZA A;  4RSU A;  2ZS6 B;  4BQY A;  1ZBA 1;  2ARE A;  3Q9O A;  3RMY A;  4BDV B;  1Y3T A;  3EXU A;  3T4V A;  3ZFF A;  5CEH A;  4FQZ A;  4B4P A;  5BNN B;  1UO9 A;  5K7P A;  1KJR A;  1HRV 3;  3ZSK A;  5I0R A;  2K2S A;  2FDJ A;  1CD3 G;  2JDP A;  1DF0 A;  1H4H A;  4P9X A;  2VQT A;  2PHD A;  4QX5 A;  1X82 A;  2EXK A;  3OD4 A;  3E1F 1;  4S2G A;  5FYI A;  4NIH A;  1F4H A;  1ULP A;  2C6S A;  4GZ9 A;  5FY0 A;  3WY6 A;  5GLV A;  3PU8 A;  2DVF A;  3HAG A;  1LKN A;  3LEG A;  2ZX0 A;  3M3E A;  1RVF 3;  4KGG A;  5F6L B;  4A3X A;  1E5H A;  1UY2 A;  2W92 A;  3BN6 A;  2E63 A;  3AM2 A;  3DL3 A;  2DFB A;  1SMV A;  1YFY A;  3KT1 A;  4L8Q A;  5LBC A;  2O14 A;  1UOG A;  2CL2 A;  4RHV 2;  4M3C B;  3CJI C;  5A7W B;  3J26 N;  5GZG A;  1UXX X;  1KXG A;  3QD6 A;  4EZH A;  2B9U A;  1OQ1 A;  1C1L A;  3N9O A;  3HN1 A;  1PMJ X;  2VXR A;  3K51 A;  3OYW B;  2I45 A;  4AI2 A;  1D2S A;  1OKQ A;  4YYO A;  4NHX A;  3THC A;  2RJL A;  2XUM A;  1CJP A;  1PHM A;  1XSR A;  1IKP A;  2PHL A;  2OQ6 A;  4QQP A;  2JKX A;  3POS A;  3EBR A;  2Q8C A;  4AED A;  4ASL A;  4EQV A;  4HPK A;  3I2J A;  3GBG A;  1H8T A;  4GKY A;  1AXK A;  2WC2 A;  3IPV B;  3EHK A;  3ZYR A;  3VHP A;  5A3M A;  4FTB A;  2GN7 A;  1ASJ 1;  4H7M A;  2XVK A;  1FPN 1;  4S2H A;  1SBD A;  3EQE A;  4X8P A;  2DU1 A;  5M0T A;  3MV1 1;  1GZC A;  2CSG A;  3ZFF C;  3B69 A;  3OG2 A;  4CP9 B;  1NAE A;  4CVU A;  4ASM B;  2IWG B;  4Q8L A;  2OX0 A;  4YGD A;  4FPY A;  4N53 B;  3AB0 A;  1X36 A;  2GAU A;  2VU9 A;  5BPX A;  3VBR B;  1RUC 2;  4XIL A;  4Y22 A;  5IAV A;  4IGQ A;  2OII A;  1MZ6 A;  5FYH A;  1W9W A;  1RIN A;  5F3G A;  3IB3 A;  3NV1 A;  4FFG A;  1FT9 A;  5L9B A;  1F8V A;  1S0F A;  3H7Y A;  1LEC A;  1W6N A;  2CU5 A;  3M2M A;  2FCV A;  1VBA 3;  2DU0 A;  4MZU A;  2YMZ A;  5ANQ A;  3ZR5 A;  2A75 A;  2W5F A;  1IPK A;  3RSJ A;  3WW2 A;  4BHP A;  4EZ4 A;  1O4Z A;  1PZ8 A;  1S2E A;  1ZM1 A;  3QAC A;  1LR5 A;  4LIV A;  4BLJ A;  1CGP A;  5AVP A;  2XBO 1;  3VL8 A;  4ARX A;  5GLU A;  3RS6 A;  1DFQ A;  4CU9 A;  2X53 S;  5FP9 A;  1GAN A;  3OBZ A;  1NLR A;  1AR9 1;  4GJY A;  2QTW B;  4GMP 0;  1I3H A;  4QQH A;  3V65 A;  4FOY A;  4CDU B;  1O3T A;  3E5X A;  2R0F A;  5IJR A;  2ZMN A;  4PT6 A;  2BQP A;  2W1Q A;  1KDK A;  1YEW A;  4QPW A;  1WWY A;  2VME A;  2HWB 1;  3RJ2 X;  5FYU A;  2FBE A;  4AED C;  3AZZ A;  1H8T C;  1AR7 2;  1OLR A;  1UAI A;  3OUH A;  2DYC A;  2VW0 A;  4JGZ A;  5C3P A;  4BH9 A;  1ND2 C;  1MS1 A;  2P6C A;  1M4W A;  2DBN A;  3AMM A;  1W9F A;  3VD4 A;  3GCW A;  5EV7 A;  3OCP A;  2ZGU A;  4GH4 A;  2UWB A;  5EJ3 A;  3WQ1 A;  4AYU A;  5K0U B;  4KWL A;  3UNP A;  5A32 B;  3POE A;  3T1M A;  1WMX A;  1W3V A;  5FZC A;  3O1U A;  3FZ3 A;  4LO6 B;  3KV9 A;  1C57 A;  5A7S A;  2Q8D A;  1SEF A;  3I7D A;  4FPC A;  5EFU A;  2ZEY A;  5FV3 A;  1MS4 A;  1RUD 3;  4IE0 A;  3VLB B;  2WFP A;  4QD2 A;  4BK4 A;  4XIO A;  1COV 2;  1SCR A;  3N7L A;  4OFG A;  2GP5 A;  1G9B A;  1AR8 2;  4IEP A;  1NKG A;  3TNP B;  4ISR A;  4LBK A;  1PGW 1;  1Y4W A;  3HPN A;  1OD5 A;  1A78 A;  3C3V A;  4YM1 A;  1YFU A;  1YC6 1;  4Q4X 1;  3B5L B;  5FYV A;  1XE8 A;  4CPB A;  2RS3 2;  1FOD 3;  4S2F A;  3GZT B;  5JIU A;  2Z4F A;  3ACH A;  3KB5 A;  1ZRI A;  1CES A;  2JDA A;  3WOG A;  1GWM A;  4MV2 A;  2E32 A;  3BPZ A;  4XXP A;  2G9F A;  1XNC A;  3KLS A;  2E7Q A;  2YU1 A;  2OUH A;  5ABJ A;  1LNS A;  5HPO A;  4TN7 A;  2XQX A;  2VGD A;  3T2P A;  1B35 B;  1QJE A;  5FZH A;  4XJW A;  1R1A 2;  1QOS A;  2J1R A;  4V2W A;  2XG3 A;  4GH4 C;  4YFZ A;  4ZU7 A;  1D4V B;  4C91 A;  1ZNP A;  5A1F A;  2AEN A;  4IND A;  4X8N A;  1QMJ A;  4O7X A;  3JBG 2;  3VB9 A;  3WF4 A;  1RUJ 1;  3K77 A;  4I30 A;  3ZKU A;  1YFX A;  4LO5 B;  4IGO A;  4AL9 A;  4Q4W 3;  4COY A;  1XNK A;  2RMU 2;  3FUQ A;  4ZY9 A;  5F3C A;  2EIE A;  3N7J A;  5LBF A;  5J96 B;  2WAA A;  1S0B A;  5C7G A;  5D2A A;  2VZO A;  1UYP A;  2VUJ A;  1BBT 3;  1JMU B;  5LRS A;  4Q0Q A;  3E5U A;  3HJR A;  3USS A;  5FWJ A;  3ZPY A;  1BXH A;  2LW8 A;  2Q8O A;  5GKA C;  1AYN 3;  2ATF A;  3NNG A;  5L9V A;  4MGK E;  3RGB A;  4GMP 3;  4QX1 A;  2HWF 2;  1X7N A;  2YHJ A;  4MX3 A;  1NQJ A;  2ZZJ A;  4H2A A;  5FO9 B;  4Q27 A;  3T1L A;  3WXP A;  2P34 A;  3DPR C;  2QBX A;  2XKP A;  5LB6 A;  1R64 A;  3VBF B;  2Z2S B;  3BU0 A;  3I59 A;  3K4Z A;  3AZV A;  1S4C A;  1UQX A;  4HKL A;  1O4T A;  1HW5 A;  4OLL A;  3SC7 X;  1BJQ A;  2ERF A;  1D7P M;  2VOV A;  1VAM A;  4LHL A;  2SBA A;  3PHM A;  3I3B A;  4IEV A;  3K3O A;  1LGB A;  2EAA A;  5CBL A;  2IUW A;  2JIG A;  3E6B A;  1RUI 3;  2C9K A;  5LA1 A;  4HVO A;  5T3N A;  4CXW A;  2CV6 A;  1VPH A;  4JTN A;  1LOA A;  1ZYB A;  2VVD A;  1ZZ8 A;  1LOB A;  2ORZ A;  5ABJ C;  3V0A B;  4RS5 A;  5CIS A;  3BTZ A;  2XJV A;  4LBN A;  3RYP A;  5JWP A;  3N7K A;  3P3P A;  4NVP A;  2IVI B;  3FHQ A;  5C8C A;  3SNM A;  3CIH A;  4D7S A;  4K3U A;  5ACA 2;  1UIK A;  1ACC A;  2OQ7 A;  2VUC A;  1LOD A;  4LBJ A;  4AHW A;  4XDP A;  1SZB A;  4Y1Y A;  2XB6 C;  3L2H A;  3HR9 A;  1RHI 2;  2WNE A;  4FPJ A;  1V6I A;  4RHV 1;  1Y7B A;  4TYS A;  5EP9 A;  4COZ A;  1HV0 A;  1EAH 3;  2WO2 A;  3NJZ A;  3TRS B;  1WKY A;  3ZFG A;  1WA4 A;  1OA4 A;  5FKC A;  4CEY A;  2FHR A;  3WNX A;  3VHO A;  2XH6 A;  2X5I B;  4YRD A;  1SLC A;  2BGC A;  3AP9 A;  3IDB B;  2MEV 3;  3S57 A;  1FX5 A;  4QXK A;  1JHJ A;  2WYS A;  1QNW A;  3LB9 A;  3S7I A;  4DQA A;  2R1D A;  2QZ3 A;  4XFI A;  1FNY A;  3D0J A;  3U07 A;  3BKZ A;  4E9K A;  5FFO C;  2GU9 A;  3KCX A;  3ORJ A;  2W1W A;  4M00 A;  1BZW A;  5F3E A;  3MDP A;  1WBL A;  3H0O A;  1UKR A;  5JZG B;  1JYI A;  4I0A A;  4BOW A;  4IE4 A;  3LFI A;  5LEJ A;  1POV 1;  4LUK A;  1YCI A;  2K0G A;  1RUG 1;  3DXU A;  4CZS A;  4LK7 A;  4P02 B;  2BWA A;  3FLR A;  4CDW A;  4HG6 B;  2C0Z A;  2GZW A;  4HFS A;  5HI0 A;  4RR3 B;  4PDW C;  1DG6 A;  2W46 A;  1I9R A;  2A71 A;  3HN3 A;  1TME 3;  2BNN A;  4LOT A;  4JHT A;  4MGT A;  1WW6 A;  5G05 L;  1BYH A;  1MQT A;  1RUC 1;  4MYE A;  1S0J A;  1S0I A;  2E7T A;  1APN A;  1SPP A;  1V9U 1;  3WUD A;  5CKM A;  1RC6 A;  4RS5 C;  3FUO A;  1YYN A;  5BNO A;  3VZO A;  2PQS A;  1N3P A;  3VKM A;  3O1M A;  5JXI A;  1XPW A;  5EJZ B;  5KHJ A;  1UMI A;  4V1P A;  1LHV A;  4LBO A;  2RS5 1;  4FVV A;  4HAN A;  1R08 3;  3FWE A;  2ZAA A;  5TSW A;  4B7E A;  5DAW A;  4K40 A;  2HWE 3;  3BOD A;  4CP1 A;  3JU9 A;  2X05 A;  4J1W A;  4UBG A;  5FYM A;  3H8X A;  2JG9 B;  2B9V A;  1CAW A;  3ZFG C;  4CEY C;  4GB3 3;  1UPS A;  1PGL 2;  1A6C A;  4QGN A;  1HB1 A;  2JEM A;  1CX1 A;  1AYM 2;  4ET7 A;  5IVF A;  3UGH A;  1QIQ A;  2X8K A;  2XML A;  1GNY A;  3AMP A;  1DQ0 A;  2HWC 2;  3ME2 A;  2VZU A;  3CF6 E;  2HH9 A;  2QKD A;  1QXJ A;  1LHO A;  1RUE 2;  1AR7 1;  3ST7 A;  1AL0 G;  2VCM A;  4QKF A;  3ZLI A;  1OD3 A;  1SLI A;  1PO1 3;  1PIV 2;  1SLA A;  3M3Q A;  4GXL A;  4WM7 B;  5J7M A;  2OT7 A;  2ZJC A;  4MGI E;  5D8A A;  3BIW E;  4YVS A;  2EF6 A;  1YJK A;  5DAX A;  2H6B A;  3ZMN A;  2J22 A;  4AK3 A;  5LCW L;  1Y9M A;  2RS3 3;  3MIB A;  4Y33 A;  1HLC A;  4BQ3 A;  1AXZ A;  4IE7 A;  3H42 B;  1VMH A;  3SCG A;  3LIH A;  3ILR A;  3BIE A;  3WZ1 A;  1ZZ6 A;  1OUR A;  2ADE A;  2ZEX A;  4XYX A;  4XXA A;  1YHF A;  2R04 1;  1K12 A;  3WP3 A;  1GQH A;  3AK0 A;  2YY1 A;  1F5J A;  5IVJ A;  4QDS A;  1QXP A;  2EXI A;  4BME A;  4L9B A;  3KF3 A;  4LKF A;  5BUV A;  2F17 A;  1W6O B;  3POJ A;  5LW9 A;  3N3H A;  1VBD 2;  1ULF A;  4Q0S A;  2CDP A;  2R1B A;  4XUO A;  5B4X A;  4UW6 A;  2QQP A;  1YQ5 A;  1Y43 B;  2JDU A;  5AFE A;  2GSY A;  2AEZ A;  1QJZ A;  1LES A;  4AQ2 A;  3JCI A;  1HIX A;  4OUL A;  4UFI A;  3IAQ A;  2WSU A;  3MI8 A;  2DTY A;  1ZBE 2;  1UYZ A;  2HJI A;  2R07 3;  1GZT A;  5J3U A;  4QWN A;  1W6M B;  1LEM A;  1AR6 1;  4Q29 A;  2Y6J A;  5FBJ A;  4AI1 A;  3IDC B;  1JUI A;  4OQ9 A;  2WS9 2;  3LA2 A;  3VHN A;  4UI9 L;  1R1Z A;  2HWF 3;  3QH6 A;  5FXX A;  2C4X A;  3T30 A;  2ZX3 A;  1PX4 A;  2GH8 A;  4DIQ A;  1NXD 1;  1W05 A;  4CTE A;  5DAB A;  2VBD A;  5EXO A;  4K6B A;  1QXR A;  4LKE A;  2R30 A;  1JOD A;  3EB7 A;  3IIA A;  2YFU A;  4IER A;  4YVS C;  5J98 B;  4YG0 A;  5H9P A;  4ES9 A;  1SFY A;  1R1A 1;  1X9T A;  2AR6 A;  3III A;  3ROU A;  3S7E A;  1AJK A;  3KWV A;  2RDR A;  1NLS A;  4LE4 A;  2A7A A;  1O8S A;  2PAK A;  3VN4 A;  5C3R A;  2JG8 A;  1DYK A;  3VDA A;  1WCK A;  2JIJ A;  1K5M A;  5A7N A;  3UJO A;  1UN1 A;  4OYU A;  3TN9 2;  3W5M A;  2VQU A;  3J7N A;  1MS0 A;  5F5Q A;  4MG2 A;  2P6H A;  3BVC A;  3N9L A;  4XFA A;  1YIF A;  1XQN A;  4DZG A;  5FLH A;  2GC1 A;  4JKL A;  4HXC A;  1W2O A;  1IG0 A;  2D3S A;  2JD9 A;  4BM8 A;  4JGY A;  2D6O X;  2A3X A;  2GND A;  2QQO A;  5AC9 2;  1V6O A;  4QAW A;  5ACA 3;  4CCD A;  2YC0 A;  2HWD 1;  4EN9 B;  5JUV A;  2A3W A;  4DUV A;  4YW6 A;  1GBG A;  5FZL A;  5KHI A;  3WG1 A;  1OXC A;  2J1E A;  1KFU L;  4HSJ A;  4QX3 A;  4YZ1 A;  4HPK B;  5CAZ A;  1JW6 A;  4N53 C;  3U78 A;  2BVV A;  4IQP A;  4KWU A;  3HBK A;  1CPN A;  5GJ6 A;  1JYC A;  2VBP A;  5JSP A;  1UOB A;  5GZD A;  5T5J A;  3TEW A;  2E26 A;  3NWK A;  5CA6 A;  1HQL A;  4LHS A;  1U5I A;  2UY8 A;  3FMG A;  3G7D A;  4ES8 A;  1F35 A;  2WZE A;  3KV5 A;  4LA3 A;  2QQL A;  2UUR A;  2WT2 A;  4CDX C;  4LQR A;  3S5A A;  4IV3 A;  1PNF A;  4Y22 B;  1H0B A;  3LD8 A;  4LIT A;  5DUW A;  4AGR A;  3PUA A;  4ZZ8 A;  2JDK A;  1V6L A;  3LEK A;  1JTZ X;  3TEZ A;  5AVA A;  3N9M A;  4L0P A;  3U75 A;  3BTX A;  1OHF A;  1CZS A;  4QX0 A;  2W95 A;  3D5O A;  2JG8 C;  1S0E A;  3OGR A;  1VP6 A;  1K5M C;  1RHI 1;  5FZO B;  5FXZ A;  2BZD A;  4JZR A;  3PVE A;  3NVC A;  4MGZ E;  3VZJ A;  4A45 A;  1HDK A;  3CKH A;  4C1W A;  3O1O A;  1C5H A;  3RWN A;  3ON7 A;  3HT1 A;  3UV9 A;  1TMF 3;  4AVV A;  3IM0 A;  4FP2 A;  2VZP A;  4BQ4 A;  1REF A;  4C0B A;  3H1Y A;  3KF5 A;  4JGY C;  4MGS A;  5FYC A;  1RUN A;  3BYW A;  1UU6 A;  1SFP A;  1RUF 1;  2V4V A;  4UF0 B;  2XDV A;  4YM0 A;  2E33 A;  2A70 A;  3H3Z A;  3WP5 A;  1JYV A;  1JBC A;  1S0C A;  4GQ7 A;  3LEM A;  4PBO A;  5A70 A;  1X8M A;  1RMU 3;  4QX8 A;  3THP A;  3RDI A;  1US2 A;  1HRV 2;  1OBN A;  1IZ3 A;  2RM2 1;  3QBQ A;  4Y20 A;  5L7O C;  1YJL A;  1OUX A;  3UKN A;  1Q3E A;  4YZ5 A;  3O5S A;  1DYP A;  1SDW A;  2ZGM A;  1S0D A;  1W8N A;  2E51 A;  4A42 A;  5KR7 A;  5C6C A;  3NV3 A;  3POY A;  1OFN A;  1FXZ A;  3CZU A;  1E57 A;  2YGM A;  4IGP A;  1PMI A;  1KD7 A;  1C1F A;  4WM8 B;  1RVF 2;  5H9Q A;  5IUQ A;  4DOU A;  1J3R A;  1M06 G;  3MIE A;  1IS3 A;  4MLO A;  3PUH A;  3PUS A;  4N43 B;  5FK7 A;  2DUQ A;  4QMA A;  2FDK A;  1PK6 B;  1EUU A;  1W06 A;  2VUA A;  3ZSM A;  4P14 A;  2ZAH A;  5A7O A;  1OOP B;  5J36 A;  1WGP A;  1V6M A;  3OUI A;  4NAM A;  2D6L X;  2WT0 A;  2ZML A;  3TAY A;  4L2N A;  1N1T A;  1H2N A;  4P9Y A;  2W94 A;  3RYR A;  5FYZ A;  3BUC A;  1KEX A;  1OC1 A;  2TEP A;  4LT5 A;  2H0V A;  3UYJ A;  2UYA A;  4IEZ A;  1JYX A;  3I3D A;  3B00 A;  3ZO0 B;  1MZE A;  2VMD A;  4BIF A;  3GHN A;  3ZN6 A;  2J1V A;  1BKZ A;  3PUI A;  2Y8K A;  3FBM A;  5FXV A;  1EPW A;  2MPF A;  1S2K A;  3I2F A;  1Q8V A;  4A41 A;  3RRD A;  4QM8 A;  4M4R A;  1ND3 A;  2HWC 1;  3ACG A;  1AL2 3;  3C8X A;  1RUE 1;  3AYD A;  4OHW A;  4ATF A;  1L7L A;  4LE3 A;  4Y24 A;  3FE5 A;  4DRV A;  1PIV 1;  1Q56 A;  5FPB A;  3RZJ A;  4YAR A;  1AUY A;  1JZ6 A;  2OZ6 A;  1DGW A;  2PHF A;  2WNU B;  3ZM8 A;  4CCO A;  4OI4 A;  4G3Y C;  3VBO B;  4A4A A;  4IEY A;  4EN8 B;  3M3O A;  3UT0 A;  2JX9 A;  1DP0 A;  1ODM A;  1PVC 2;  2JDH A;  1GZW A;  3AKQ A;  4BYY A;  3KV6 A;  1VBA 2;  4LOR A;  3J8F 3;  4FTE A;  2I2S A;  1PZ7 A;  3FL7 A;  4IW3 A;  4OMC A;  4AQT A;  2VD7 A;  5AFB A;  1RTV A;  3O14 A;  4XHB A;  1J1T A;  3ZFE A;  2DCZ A;  2XWB B;  4AR2 A;  1Q8Q A;  2VG9 A;  1SFN A;  5FUN A;  2J1S A;  4FPF A;  1BHG A;  3T08 A;  1GOF A;  3WQB A;  4OVE A;  3ITQ A;  4CDQ A;  5FJK A;  5JPN B;  3ZN4 A;  2OZJ A;  1ZBE 1;  3A21 A;  4Q4Y 3;  1LCL A;  1MEC 2;  2LTN A;  1QJY 1;  2BRT A;  3AP5 A;  4GWJ A;  5DAP A;  1VRH 3;  2A6Y A;  4IUG A;  5KXC A;  2WS9 1;  2DCK A;  1BEV 1;  2P4E A;  3AL6 A;  2QJV A;  3ES1 A;  5A3W A;  4LJH A;  4XF4 A;  2XKO A;  1I5P A;  2WFF 3;  5FY4 A;  1GNH A;  2HBT A;  1KS4 A;  2R0H A;  2WO7 A;  1G8W A;  5JOY A;  1IHM A;  3WEZ A;  1JYW A;  2LRP A;  5DDJ 1;  5FXW A;  2PXJ A;  2E53 A;  2VZ1 A;  5LBB A;  1O7F A;  1OLM A;  4K7J A;  2ZX2 A;  4DUX A;  1JYT A;  1BVP 1;  1WLT A;  3FHA A;  1PO2 1;  1RUD 2;  3IMN A;  5C8C B;  3RZL A;  3TN9 1;  4NRQ A;  5HCH A;  2DUO A;  3JD7 1;  4PF5 A;  4LNV A;  3SEE A;  1JYN A;  2D43 A;  4DXZ A;  4BXF A;  4J6G A;  2EXH A;  3PJQ A;  1JUH A;  4QU2 A;  4XF1 A;  1LOC A;  2CWM A;  3R6S A;  1WME A;  2W9X A;  2IXK A;  5AC9 1;  5DG1 A;  3VD7 A;  5C4W B;  1Q8S A;  3CJI A;  3WP6 A;  4HN0 A;  2VEC A;  4TLG A;  2X29 A;  1Q5O A;  5ERL A;  3ZXD A;  3N7M A;  4RA0 A;  3VZM A;  1FOD 2;  3A22 A;  3HVD A;  4AFB A;  4C90 A;  1O59 A;  5FY9 A;  4CU8 A;  1WZX A;  4BWO A;  4CDQ C;  5KC6 A;  3VBS A;  1ZRE A;  3BGA A;  4NHL A;  3K46 A;  1UZV A;  2UU8 A;  3CHX A;  2BWC A;  2ENR A;  5I8T A;  2Y6L A;  5HCF A;  2E6V A;  4W6X A;  3C7E A;  2KD7 A;  3VDD B;  2WQ8 A;  1QDC A;  3CU7 A;  3R4D B;  4W8J A;  2JXA A;  2WLQ A;  3GZA A;  4FPG A;  2R6Q A;  5D21 A;  5C9A B;  2QQW A;  4LMF A;  4NPM A;  1ENQ A;  4CA9 A;  3DN7 A;  1MQT B;  4UW4 A;  4ZXK A;  3LKJ A;  3AZX A;  4K8F A;  4QB6 A;  3ZPO A;  2RR1 1;  4LBL A;  4Q4W 2;  4FP3 A;  1VBE 1;  2JG9 C;  3KHB A;  4DXS A;  4N9H A;  2X09 A;  3HEI A;  3I97 A;  4GJZ A;  3VL9 A;  1LED A;  1RUH 1;  4UAP A;  3WG2 A;  1NXM A;  2TBV A;  2JDZ A;  2WDB A;  4XVH A;  1BBT 2;  1ODN A;  4D0Q A;  3LQC A;  4D69 A;  1QJX 1;  4ITC A;  3KD4 A;  1QKQ A;  2YC2 A;  4GIQ A;  3WIN E;  5JCT A;  1AYN 2;  4OHY A;  3LEI A;  1EV1 1;  4HN1 A;  4LEJ A;  1XXN A;  2YZ4 A;  4XFG A;  1F5F A;  2GMM A;  4YW7 A;  3RI9 A;  5BNQ A;  1CAW B;  3OBR A;  3WHU A;  2W1U A;  3VKN A;  2QQJ A;  1PVX A;  3O1T A;  2YPD A;  4FTS A;  1DCS A;  4O65 A;  1IS5 A;  1UKG A;  3AKR A;  4RQP B;  4XTP A;  1NCQ B;  2CWS A;  3PU3 A;  4KG0 A;  5A3O A;  3T2O A;  4YZ3 A;  1UOF A;  3KMH A;  5T54 A;  3OPT A;  2GC0 A;  1HRV 1;  3VBS C;  2G1M A;  5FMB A;  1FPN 3;  4UW3 A;  1W99 A;  3J7M A;  5IW0 A;  5FDB A;  4F7Z A;  3DUI A;  1RUI 2;  2GC3 A;  4LLO A;  2PN5 A;  1DQ5 A;  4ZU5 A;  2BGP A;  1NZC A;  3FX3 A;  3MW2 A;  3POB A;  3OB8 A;  2C1F A;  4OUE A;  5LA2 A;  2ET7 A;  5D1I A;  1ND2 A;  4OI2 A;  2H6C A;  4YVW A;  5LK5 A;  1R09 1;  3H9A A;  3FN9 A;  1GNZ A;  1YNA A;  2VR4 A;  3ZXL A;  3NL1 A;  5I0D A;  1JOP A;  4XJU A;  1SDD B;  4Z2W A;  3DYP A;  5F2S A;  4JCK A;  1ZZ9 A;  5FPV A;  4QXH A;  4KI5 M;  1MS8 A;  5FUP A;  1YUD A;  5FZM A;  2FQP A;  3SKV A;  2IC1 A;  4M4P A;  1G6N A;  3JB8 A;  1F9K A;  4Q2F A;  4BIO A;  5C33 A;  5KXE A;  1EAH 2;  4XAC A;  2DCJ A;  3T09 A;  2NM1 A;  4YSF A;  2PQQ A;  4L97 A;  5FO8 B;  5KHK A;  2JDY A;  4YZ4 A;  5APA A;  2GC2 A;  1O6U A;  3X29 B;  2MEV 2;  1PVC 3;  2P5B A;  1Z78 A;  2XBO 3;  4TSV A;  4XF3 A;  2IXJ A;  2VBB A;  2TUN A;  1JZ7 A;  4UW5 A;  3WHT A;  1DBN A;  2QQV A;  3K48 A;  1HXS 2;  5IVC A;  1VMF A;  3W5N A;  3ZXK A;  2XUE A;  1OF3 A;  5H9R A;  2YG0 A;  4BJ0 A;  4JDO A;  2VE1 A;  2HWB 3;  4LHK A;  4XEZ A;  3TEX A;  2PLV 2;  5FR3 A;  1QGL A;  2J7M A;  5F5C A;  5FRE A;  2WNO A;  4AQ6 A;  4EJR A;  1U5Z A;  1LOF A;  1VB2 A;  3B94 A;  1UU4 A;  2ORX A;  3GCX A;  3HQX A;  1N1S A;  1TME 2;  2VMF A;  2YBS A;  4IL7 A;  5FMD A;  2AH2 A;  5FP8 A;  4DNY A;  1MS3 A;  4NMI A;  1MEC 3;  2VOT A;  3VBU B;  2VMC A;  4B3N A;  4U2A A;  5T55 A;  1SCS A;  3NAP B;  1WCQ A;  1ALY A;  2P3J A;  5CYY A;  2WZP P;  1G9A A;  3MF6 A;  2KR2 A;  3P3N A;  4YVW C;  4NIA A;  4AF9 A;  4FSJ A;  3U10 A;  1T6B X;  5LAS A;  2I74 A;  3NW4 A;  3ILF A;  3PIJ A;  4ARY A;  2AC1 A;  1R08 2;  4PLM A;  4K8R B;  5CFD A;  5IFT A;  2VCC A;  1Z7S 1;  2HWE 2;  2CTV A;  1UY4 A;  2Y33 A;  4OCT A;  1YO8 A;  4AEK A;  3RMX A;  2N7G A;  2ZTN A;  1V6N A;  5GLZ A;  3NNM A;  3SH3 A;  4YM3 A;  4GB3 2;  1W6Q B;  4B1M A;  1HRI 2;  5F8P A;  3VBH B;  3HQU A;  4Q1P A;  3WX5 A;  3NQH A;  4XE9 A;  5GZF A;  2FDG A;  1YIP A;  2P3Y A;  2VOW A;  2YYO A;  3LA3 A;  2P3K A;  4CUA A;  2Q0A A;  2Y64 A;  4LBQ A;  3SLI A;  4KGQ A;  4TZD A;  1RJ7 A;  2XON A;  1CJD A;  3H8U A;  3LSD A;  3DCQ A;  1W03 A;  4K1Z A;  1VBB 1;  2ZPX A;  5FZ0 A;  3ZN5 A;  3OBA A;  1IG3 A;  3RZK A;  1PO1 2;  3DPR A;  5A7P A;  4X6R B;  5FZD A;  3LSE A;  1QQP 2;  2B42 B;  2DVG A;  4LKD A;  1S55 A;  1XJA A;  4DEV A;  1BMV 2;  4FOV A;  2R49 A;  2GMP A;  2WZR 3;  5A33 B;  5HXM A;  1PMH X;  3QLQ A;  5E88 A;  1CAU A;  4AVB A;  5A6Z A;  5T50 A;  1QJU 1;  1LOF C;  5CAD A;  5JLV A;  3TB0 A;  2ET1 A;  2QQM A;  2EAK A;  5LAT A;  5FPL A;  3USU B;  1DHK B;  3W58 A;  3WV6 A;  1L7R A;  3OY8 A;  4RGK A;  4Y1Z A;  4N8M A;  4ATE A;  5CFC B;  5JDB A;  3UJQ A;  2WQZ C;  2HYK A;  4A44 A;  4ZZ5 A;  2RDN A;  3MIH A;  2DVB A;  1CZT A;  4PQQ A;  3WDY A;  4E27 A;  4E4S A;  3AYC A;  5FIX A;  5CFD C;  2OA2 A;  1U0A A;  4AVT A;  5FZ6 A;  5FMO S;  3KM5 A;  1LGC A;  3WNP A;  2D3P A;  3K3N A;  2YV8 A;  4FFI A;  4P5Y A;  5FO7 B;  3H50 A;  1IPJ A;  3ZXG A;  3ZXA C;  4YW3 A;  3A4U A;  4Q26 A;  5BY5 A;  5FWE A;  2RE9 A;  4Q0P A;  1C8M 2;  2G9G A;  4WZC A;  3LIG A;  3APB A;  1ST8 A;  3B7M A;  3KV4 A;  1SLL A;  3B93 A;  3SQO A;  4TWT A;  2R07 2;  5FZ8 A;  1FOD 1;  4WVM B;  2BEO A;  5IT6 A;  4XFH A;  5JR7 B;  4HT1 T;  4NJ4 A;  2ZKL A;  3K75 B;  4XQD A;  1K5J A;  4Y5S A;  4QPI B;  1H1I A;  4AEJ A;  1J3Q A;  4GAZ A;  5JXJ A;  1ZRF A;  3LF7 A;  1QHD A;  4RFT 0;  4Y20 B;  4QPG A;  2RJK A;  2D3R A;  1WLC A;  4FPO B;  2BOI A;  3GF6 A;  1UPI A;  2W3J A;  3WW3 A;  5F9T A;  2R7E B;  5FY8 A;  4KQ7 A;  3OF1 A;  4PBP A;  5LBE A;  3WT3 A;  3RJR A;  1UYY A;  1W04 A;  3RZH A;  4PDW A;  2WLP A;  1UL9 A;  2XVL A;  3HNY M;  3MID A;  1AHS A;  5F7U A;  4XUT A;  1NG0 A;  1NCR B;  3URF A;  3IDE A;  5A6X A;  1CAX A;  1NT0 A;  3AJZ A;  4Y1V A;  3BOW A;  4FXK B;  4ASK A;  2ZHL A;  3LPG A;  1HB3 A;  4R4Z A;  3ETP A;  4S2D A;  4XCA A;  3UKT A;  4Q0U A;  3BAL A;  4CXY A;  3WG4 A;  3L9J T;  2ZCW A;  4CCL A;  2ZGO A;  1H9P A;  4B8E A;  2ZKN A;  2Y6K A;  4U36 A;  5GLT A;  3ZN6 B;  4WBB A;  3BTY A;  1LJ7 A;  2D93 A;  1PZ9 A;  5EJ1 B;  2VM9 A;  2QFE A;  3PL0 A;  3AL5 A;  1S1A A;  3E6C C;  2WNU C;  1WCU A;  3KZ4 C;  4QHO A;  4IV1 A;  4LKS A;  4N7I A;  1D0H A;  1NA1 A;  2E9Q A;  4YGB A;  1RJ8 A;  5CVR A;  3VBO C;  1RUI 1;  4LUM A;  4HLT A;  1HXS 3;  2UYB A;  2WNV B;  4QPG C;  5FZK A;  3O0V A;  4D7Y A;  2A5Z A;  3MYX A;  3T0D A;  1QWR A;  2WA4 A;  3K4D A;  4IEO A;  2V72 A;  2WO1 A;  4P08 A;  4R9D A;  2A3Y A;  3VKO A;  2CGN A;  3ZR6 A;  4AHZ A;  3FLP A;  4AXO A;  1OQE A;  2PLV 3;  2BJS A;  3NJY A;  4QX2 A;  4B29 A;  5BNP B;  1N3O A;  3WG3 A;  1OFS A;  1DZQ A;  1V9U 3;  2VO5 A;  3ACF A;  3OEB A;  4C0H A;  3VV1 A;  4CE8 A;  2XVG A;  2WAB A;  1HQN A;  2JE8 A;  3HOB A;  3WLU A;  3ZSL A;  2JD4 A;  1HJG A;  5FZG A;  4DEQ A;  3ZYH A;  1EAH 1;  2BOJ A;  4K1Y A;  2RS5 3;  4CCE A;  3IMM A;  1TMF 2;  1CAV A;  3B9C A;  4I2O A;  1VE0 A;  1VLN A;  2ZGK A;  5FZB A;  1TEI A;  2IXC A;  1W6P B;  3F95 A;  2MEV 1;  3RG0 A;  2FDF A;  3T0B A;  5FP7 A;  2EAL A;  4KL1 A;  4IEU A;  1WUV A;  4PIY A;  3SMH A;  5FRA A;  1D4M 3;  1X9P A;  1YQC A;  3OPZ A;  1NE4 A;  1RIT A;  1LU2 A;  1U5Y A;  4PF1 A;  1XU2 A;  1RMU 2;  2BFU L;  3U11 A;  5K9Y A;  4ISQ A;  5BNN A;  3HWJ A;  2WRA A;  4KBB A;  2XR4 A;  4LA2 A;  1HRI 3;  2GN3 A;  3WVJ A;  5C8W A;  2ZGP A;  3WSO A;  3LZZ A;  3J9S A;  3SKJ E;  2JEN A;  3MW4 A;  4IV1 C;  1P8J A;  5A3T A;  1NA1 C;  1TME 1;  1WCS A;  2BDR A;  1J1L A;  1B09 A;  5A3L A;  1UNB A;  1AX1 A;  4FI9 A;  2XLG A;  3NMB A;  1UOJ A;  4AQS A;  2ZZQ A;  5JPM B;  2PMW B;  5JVV A;  2A6V A;  4UFJ A;  1G9D A;  3CDZ B;  4UFM A;  2ZGT A;  4QPY A;  4WVW A;  1QQP 3;  3WQ0 A;  5LK7 B;  3AYA A;  2VCB A;  4YW1 A;  4BK5 A;  1W8W A;  1JZ5 A;  1JZ4 A;  3MZH A;  2ZOE B;  2R04 3;  1W8T A;  2IVJ A;  3CBN A;  1NE6 A;  2RS1 2;  4IXL A;  4LOS A;  4M3C A;  5DN2 A;  5FY7 A;  1BVV A;  2WBK A;  2B45 X;  1IS4 A;  3K2O A;  4Q1R A;  2HWE 1;  1LHN A;  4CUB A;  2YDE A;  4F8A A;  3OYW A;  4NRM A;  2AAC A;  5E16 A;  3KCY A;  4AW7 A;  2IZW A;  5EYY A;  2DVA A;  4OHZ A;  1QEX A;  4I0W B;  4CCM A;  2VMI A;  2LS6 A;  1I1E A;  1URX A;  3F2Z A;  3NST A;  3P5B A;  3RFR A;  1UWW A;  3D4K A;  4MO3 M;  5F39 A;  1WD3 A;  2PHU A;  5HXV A;  5DZG A;  4CEW C;  1COV 1;  1LOE A;  3IPV A;  4JDN A;  2PYT A;  2KXL A;  3ZXF A;  1JU4 A;  1AL2 2;  2DCT A;  1AR8 1;  5DMY A;  1AR6 3;  5LY1 A;  3RZZ A;  1RL3 A;  1CZV A;  3A0K A;  3BPS A;  1H8V A;  5BNN C;  3L2Y A;  1C8M 3;  1DQ2 A;  2CAV A;  1MS9 A;  2VW1 A;  3LPF A;  3LFM A;  4PQ9 A;  4N53 A;  4B4R A;  2RS3 1;  2TNF A;  5JXH A;  1XSQ A;  1D0G A;  3RVH A;  3VBR A;  4COW A;  1OF4 A;  5CU1 A;  4NID A;  5DZF A;  3WR0 A;  4M3C F;  1OVS A;  3AP4 A;  4UT5 A;  4PLO A;  3ZFF B;  1UD1 A;  2FD8 A;  4LLF A;  4IEW A;  1NLQ A;  5J37 A;  3J8F 2;  2FDI A;  3D8C A;  4CDX A;  4PJY A;  1W0P A;  1UX6 A;  4JDM A;  3Q8A A;  3NJV A;  5DUX A;  3A7Q A;  2YBK A;  3FC0 A;  3I3E A;  4K20 A;  1GUI A;  3CJX A;  4BPZ A;  2CAU A;  3HBZ A;  4ONU A;  4PIX A;  1XYO A;  1ONA A;  1REE A;  2RDQ A;  2SLI A;  2D5H A;  3I49 A;  3JBG 1;  3P1I A;  4CDU A;  4URT A;  1U12 A;  1XNA A;  2HWD 3;  2RMU 1;  1N1V A;  5F37 A;  5JSR A;  4DXR A;  4CRQ A;  2R07 1;  2WL1 A;  1HX6 A;  4Q4Y 2;  3VKL A;  5HCB A;  3ILN A;  1MVE A;  3NNJ A;  4AHX A;  3T0A A;  1VRH 2;  3M8L A;  2VAU A;  4BCU A;  3H7J A;  3TEY A;  3H8O A;  3GHM A;  2GNB A;  2HWF 1;  5C71 A;  1ZRD A;  4P9J A;  5T5O A;  4H7L A;  4E4D X;  3VKF C;  2OW4 A;  2WFF 2;  2G4I A;  4XTM A;  4AED B;  5K0U A;  4NWV A;  4ORF A;  4XFB A;  1O3R A;  1H8T B;  4XAE A;  4CSW A;  1FAT A;  5L7O A;  3MUY 1;  3VBR C;  4EV0 A;  1S2B A;  3U37 A;  5HV0 A;  3DEM A;  5FJH A;  2R06 3;  5FZE A;  4CCJ A;  3HT2 A;  4RGG A;  4D8M A;  4MH0 E;  3H3L A;  4XFF A;  1W39 A;  1XNT A;  2KM2 A;  1YFW A;  1OQD A;  1JZ2 A;  5K4L A;  3MEP A;  5A80 A;  2EIB A;  1SBE A;  1YI7 A;  5ACA 1;  2CDO A;  3C7O A;  4DPN A;  4EWD A;  3T2T A;  2XL9 A;  1DLL A;  3AVR A;  3GJA A;  4DUW A;  2XJT A;  1N47 A;  4CDU C;  1W2N A;  1W6N B;  3POF A;  5DZE A;  1DZT A;  3HNM A;  4BQX A;  4XAB A;  3K4A A;  5F5I A;  3NKT A;  1RUF 3;  3UKV A;  1DGW X;  3DYM A;  4IES A;  3GDB A;  3HQR A;  3GGL A;  2A73 B;  4H3W A;  2PAM A;  3IBM A;  5JMC A;  3AFG A;  2OPW A;  1YQ6 A;  3HNB M;  1GOG A;  4DO0 A;  2FMD A;  2RM2 3;  3ALQ A;  5C4W C;  1B35 A;  4MET A;  4OHV A;  4MGY E;  1J3P A;  2LRO A;  5K0U C;  3GM8 A;  3U1X A;  2O0O A;  3I2K A;  3Q8B A;  4JRA A;  3KQR A;  4JGZ B;  4W4Z A;  1WW7 A;  1J83 A;  2JEC A;  3H3U A;  3R0R A;  1ZRC A;  4W6W A;  4LR4 A;  5I0T A;  2YPJ A;  1Y9G A;  3TNQ A;  2WA3 A;  2NPI A;  3TWI A;  4GH4 B;  4DB5 A;  2RDS A;  2XJQ A;  2ZHK A;  3KGL A;  3H8R A;  3ZXE A;  1TMF 1;  2Y60 A;  1LHW A;  2F6B A;  4RGA A;  2ARB A;  2RG4 A;  2OPK A;  4HMZ A;  1AJO A;  2ILM A;  2RS1 3;  3OGJ A;  3WQ7 A;  1XB9 A;  1HN0 A;  1W8U A;  2V4A A;  2EIC A;  2V73 A;  2VOX A;  4R9B A;  5FUI A;  4E8D A;  1A8M A;  4Q4V 3;  4QGM A;  4XUR A;  2OXB A;  4LBQ B;  2BGO A;  3RWK X;  3ZYP A;  4A6S A;  1WLD A;  4HZF A;  5FMO L;  4CP2 A;  1MZF A;  1FPN 2;  4HK9 A;  3OOX A;  4XF0 A;  5KXB A;  1PGL 1;  4DY5 A;  2D7F A;  4NHY A;  3GXU A;  4LBQ D;  1AYM 1;  1FNZ A;  3MIG A;  1ULC A;  3DPR B;  5FYS A;  3T4H B;  2PHX A;  5FZ4 A;  4PLN A;  4W65 A;  3WF1 A;  3AKP A;  1QOT A;  1T6G C;  3POI A;  3W9A A;  2ARX A;  1A34 A;  2O8Q A;  1B35 C;  3LE0 A;  2K9Z A;  3GAL A;  1DQ1 A;  4QHZ A;  1XOY A;  1ZA4 A;  4KWK A;  5FLI A;  3ZSJ A;  2XPJ A;  2HEY F;  4CPB D;  2LAL A;  1QF3 A;  3JUU A;  2XJP A;  3OY8 B;  4KNC A;  2DBI A;  3IAP A;  4C1X A;  4XAA A;  5ABJ B;  2VH9 A;  4XJ8 A;  5F6K A;  4NRP A;  2AYH A;  3LOI A;  2BV4 A;  3NJX A;  4HVR A;  3NKG A;  3SH4 A;  3O1S A;  1GQG A;  1VBC 3;  3SIS A;  4CUG A;  4AGG A;  1D2Q A;  4FPH A;  1BLZ A;  1YLL A;  2FCU A;  2XBO 2;  5KWR A;  1XE7 A;  1QH7 A;  1OPM A;  3WDV A;  4N90 A;  3AX4 A;  3MPB A;  2OYZ A;  4I3P A;  1QJF A;  1DZR A;  1KIT A;  1OLM E;  4FOQ A;  4EN7 B;  4QU1 A;  2GDF A;  4JKK A;  2Q30 A;  5E6H A;  1JZ3 A;  1QY4 A;  3D0S A;  2HWB 2;  2VUL A;  1H6X A;  1VBD 1;  5FYY A;  5H9S A;  3VBF C;  1S0G A;  5J48 A;  5JZG A;  2F4P A;  3O1R A;  2OVU A;  3S30 A;  4DS0 A;  4L92 A;  4OUM A;  1BEV 3;  2XLA A;  2Z79 A;  3OSD A;  4YG3 A;  1OUS A;  5CB7 A;  5B4N A;  1YQ2 A;  4RR3 A;  4QKB A;  4CU7 A;  1K45 A;  3ZOI A;  4B4Q A;  2BP6 A;  4Y5Z 0;  4YM2 A;  2ZBJ A;  1VAL A;  3I59 B;  4Y4R A;  3WDW A;  5DDJ 3;  4F83 A;  3I54 A;  4O9G A;  4R8H A;  4BU2 A;  5IFP A;  1YWK A;  2VNO A;  1MPX A;  3O0W A;  4PDW B;  1PO2 3;  2VPV A;  3J8F 1;  4YWA A;  3WNK A;  1F31 A;  3PVB B;  4AAX A;  4B7K A;  2RVA A;  4BZ4 A;  4D3W A;  4OQ8 A;  3ZX7 A;  2BBV A;  1KDM A;  5A1A A;  4W50 A;  4R9C A;  4XBL A;  4D94 A;  5GZC A;  3BI3 A;  5CKQ A;  1PGS A;  1OA2 A;  1UMH A;  3CNA A;  3NNL A;  2DCY A;  2GAL A;  2JG9 A;  4P9L A;  4RS5 B;  4AVC A;  3NO8 A;  4HON A;  5BYN A;  3OGG A;  5FZF A;  4EN6 B;  3ZMO A;  4HBN A;  5FYT A;  1PGW 2;  2X5I C;  4J1X A;  2YFZ A;  1CR7 A;  3M1H A;  4L11 A;  4B1L A;  3VUO A;  4EWA A;  1HN1 A;  2WN2 A;  2UWA A;  1FMD 3;  2YUE A;  2DUR A;  4XFC A;  5ANN A;  1BQP A;  2AGS A;  5L73 A;  3WW1 A;  2BFU S;  2XHK A;  2YRO A;  1YQ8 A;  4Q4Y 1;  3EJK A;  2B8M A;  2F4L A;  3IDA A;  3ZFG B;  4CEY B;  4CCN A;  2DFC A;  2ZGR A;  5DUU A;  3MO4 A;  4Z92 B;  3KVB A;  4DIN B;  2Z5W A;  4BQ5 A;  5JZG C;  3J7H A;  3GJB A;  2WZR 2;  2WYF A;  5HV4 A;  4GWI A;  4E2S A;  5FY1 A;  4MOA A;  4HL0 A;  3UES A;  3EYP A;  4NWW A;  4MGQ A;  5FPU A;  4RR3 C;  1ZBA 3;  1EUT A;  2J42 A;  4QKD A;  4XUN A;  3MIF A;  5B2G B;  3MBW A;  3IN9 A;  5GZE A;  2QQU A;  3C7H A;  3WF0 A;  1J58 A;  2WO3 A;  4K21 A;  3GYD A;  4XJA A;  1RUJ 2;  3GBW A;  4XOG A;  4AHY A;  5IVE A;  2RR1 3;  4XBQ A;  5DG2 A;  4CDW B;  5CG8 A;  2VW2 A;  3LAG A;  1VBE 3;  5K8S A;  1W9T A;  2J1A A;  2O1Q A;  2VVF A;  4BLI A;  5C3S A;  1W6O A;  1H2M A;  4XJZ A;  4RN5 A;  3KSC A;  3AZW A;  3R05 A;  4ZPI A;  4AEM A;  3DKW A;  1TG7 A;  2PA7 A;  1SPP B;  3H1W A;  5L19 A;  4A7Y A;  3CMG A;  5BNO B;  1EV1 3;  3VD3 A;  3VDC A;  1JU3 A;  2ZGN A;  2CNA A;  4F3J A;  1VIW B;  3AXD A;  4D6R A;  4NII A;  1W8F A;  2VZT A;  5LEK A;  1CIY A;  5E8A A;  1W6M A;  4A2U A;  1ZVF A;  3MPP G;  4HKW A;  4Y3O A;  5F5A A;  4Z8B A;  2CYF A;  4EE2 A;  1W2A X;  3WDX A;  2NYY A;  3AKS A;  1ENX A;  2BNM A;  4UXA A;  1O91 A;  4LUL A;  1WLW A;  4MXW A;  2WJS A;  4RYD A;  5HCA A;  2GNM A;  1OVP A;  1W2U A;  2DDU A;  3VDB A;  5F2W A;  5CKN A;  4QT6 A;  5CIR A;  5FAX A;  1TQ5 A;  4WM7 C;  4JTO A;  2DWR A;  1BCX A;  2VNV A;  4YGE A;  1GR3 A;  1VAK A;  2CHH A;  2VOK A;  5KHG A;  1ASJ 3;  4NHM A;  1AXY A;  4OI0 A;  2BNO A;  4QHB A;  1SLT A;  1FAY A;  1QU0 A;  4N7U A;  1R09 3;  2WWJ A;  4LO7 A;  4WVV A;  5IAX A;  2QDR A;  3S6P A;  1HB2 A;  4P9W A;  1JN2 P;  3MW3 A;  4HOO A;  5D8A B;  4YVS B;  3WNM A;  3PJY A;  2EA7 A;  1WMD A;  3I8T A;  4ZS2 A;  5EYX A;  5FK8 A;  2QUO A;  5E89 A;  4AI3 A;  1QNY A;  1OPO A;  4UFK A;  1RVF 1;  4AFC A;  4FAH A;  3I4I A;  3DV8 A;  5IVV A;  1AF9 A;  1EYB A;  4ZHN A;  1RB8 G;  4BQW A;  2CGO A;  3A0N A;  2IFW A;  4QB2 A;  4GWM A;  2ZHM A;  3ETQ A;  1H2L A;  3ENR A;  4E4H A;  3I2H A;  5C70 A;  1WCD J;  4Y1X A;  3W59 A;  2IFR A;  4Z07 A;  4JRL A;  2ZMK A;  2NQY A;  4UYB A;  4IDZ A;  4BQ1 A;  1OSG A;  2PFW A;  4NAO A;  5FY5 A;  1AR9 3;  1OMI A;  4UBH A;  1LB2 A;  3LA7 A;  4MAD A;  3J4U H;  1RGS A;  1RUG 2;  5FOJ B;  1E5I A;  2VY0 A;  3EO6 A;  3VHR A;  1V00 A;  3MLK A;  2HBU A;  1JZ8 A;  1GP6 A;  4PIZ A;  5A3P A;  1GV9 A;  3PNA A;  1XND A;  4YG6 A;  2Y6G A;  4NO4 A;  3J7L A;  1V9U 2;  2W2I A;  2WR9 A;  2HEV F;  4FFH A;  2G19 A;  4BA6 A;  5JOW A;  1XNB A;  5FQ0 A;  5JOX A;  1O3S A;  5FZO A;  1BK1 A;  1H6Y A;  3B01 A;  4CDX B;  2RS5 2;  4LK6 A;  5KC5 A;  2B4K A;  2ZX1 A;  1UMZ A;  1Z7S 3;  3OTF A;  3ZYI B;  2NMO A;  3I2O A;  5FYB A;  1QH6 A;  2QNK A;  2JKB A;  4A7Z A;  1PVC 1;  1VB4 A;  2EXJ A;  4QDR A;  2G9Z A;  2JG8 B;  1N1Y A;  3KCC A;  1UXZ A;  1VBA 1;  1Q8P A;  1K5M B;  2CY6 A;  1D4M 2;  3FFZ A;  3AZY A;  4G9S B;  1IPS A;  4YW2 A;  4MUV A;  4UF0 A;  4AG4 A;  2VCA A;  1UIJ A;  5DUV A;  4JC1 A;  3UGF A;  2EID A;  3AMQ A;  1VAV A;  1WMF A;  1UX7 A;  4DRR A;  3EMR A;  3ZSE A;  2XL7 A;  3PIG A;  4IE6 A;  2Q4S A;  1UZ0 A;  4M01 A;  4JGY B;  2ADD A;  1KQR A;  5EWS A;  1VBB 3;  5JIA A;  1KRI A;  3Q8C A;  2YU2 A;  2QZ2 A;  3DEC A;  4Q4X 3;  3Q8E A;  1HV1 A;  3VBU A;  2ZEZ A;  1O3Q A;  3N36 A;  2YXS A;  2HEW F;  1LTE A;  3ZDV A;  1MEC 1;  1DDL A;  4I02 A;  1DQ4 A;  1C3H A;  4X6Q B;  3ASI A;  2RV9 A;  4YLZ A;  1IS6 A;  1QJU 3;  2AEY A;  2JDN A;  4WM8 A;  4AOC A;  5L7O B;  4XHX A;  4AWD A;  3LGR A;  3AC0 A;  3ZKY A;  2DTW A;  2Y0I A;  1LU1 A;  1PX3 A;  4R52 A;  4RD7 A;  3OPW A;  4N43 A;  2B7Y A;  5T5L A;  3ZVX A;  2NP0 A;  1POV 0;  3TBD A;  2VUD A;  4W6Y A;  5FPA A;  3LDB A;  1PK6 A;  2R04 2;  1RUO A;  1RXF A;  1X8E A;  3ABZ A;  1OOP A;  3AMH A;  3ATG A;  2DV9 A;  3INA A;  3U4X A;  4PCR A;  2C5D A;  2J1U A;  4JVA A;  4LO8 A;  4LTA A;  2WIN B;  3CQO A;  1VMJ A;  2Q5T A;  3WCS A;  1JOB A;  2EVX A;  1C4R A;  1J84 A;  3C2U A;  4IV3 B;  1RUD 1;  5GLW A;  5CG9 A;  2VTX A;  3WCR A;  5G04 L;  2ZA9 A;  5LRR A;  1GMM A;  5ISL A;  1RUJ 3;  4Z1V A;  4HKO A;  2W08 A;  2BVB A;  3V0B B;  2V09 A;  2ZGL A;  3HD8 B;  4QB1 A;  3ECQ A;  4KG8 A;  4V2V A;  2VTF A;  4TLF A;  1DGR A;  3I2I A;  1GFF 2;  1AR6 2;  2GP3 A;  5EIY B;  3KVA A;  4JQT A;  1GWK A;  3H1M A;  3O7O A;  1A3K A;  2WN3 A;  4R4X A;  5A1L A;  3ZYB A;  4QQL A;  3BB6 A;  2Q1Z B;  5FCC A;  1GSL A;  1GKB A;  1XRU A;  2WZR 1;  5FTT C;  1MAC A;  4JGZ C;  4FO9 A;  3AJY A;  1ULG A;  3ZIW A;  1KFX L;  2P1B A;  2WNU A;  3WNL A;  4XQ4 A;  3PTR B;  4XUQ A;  2QQI A;  2WAO A;  5C5T A;  3KHC A;  4IE5 A;  2DVD A;  1XYN A;  3VBO A;  3P6B A;  5A3N A;  4AZZ A;  4NHK A;  4COV A;  5IVB A;  1QOO A;  3OD0 A;  1IKQ A;  1Q43 A;  2VMG A;  4WM8 C;  4QXB A;  5DAV A;  2I07 B;  2C24 A;  4URA A;  4N43 C;  2Z69 A;  3O0X A;  1H1M A;  1UW8 A;  2BU9 A;  2PEL A;  1PK6 C;  2WKK A;  4H14 A;  1GLH A;  1H9W A;  1OOP C;  1VR3 A;  4XBN A;  5FZ1 A;  1DGL A;  3CO2 A;  1DLC A;  2AUY A;  1IQA A;  3WDU A;  3O1V A;  4Q4W 1;  2DUP A;  3CLP A;  4PHZ A;  4Z2A A;  3O1P A;  2HWD 2;  3LCP A;  3E6D A;  4FQ4 A;  5SV8 A;  1V6K A;  4Q5O A;  4E2Q A;  4YZ2 A;  5A3U A;  5C3O A;  3CL1 A;  5LA0 A;  2FCT A;  1I6X A;  4XJ9 A;  1BBT 1;  2C9A A;  2H0B A;  2Y38 A;  2ZAC A;  2ZGQ A;  4RHV 3;  5FP3 A;  4AAP A;  5A6Y A;  5LZ6 A;  4TTG A;  1AYN 1;  1HB4 A;  4GMP 1;  4XC9 A;  5FOB B;  2WT1 A;  4OZX A;  4COU A;  1OH4 A;  3M70 A;  1NY7 2;  1PNG A;  4AGV A;  1ULE A;  1F2N A;  5F32 A;  2VVE A;  3WNO A;  1KS5 A;  3PVO A;  4E8C A;  3FLT A;  2YBP A;  1ND3 B;  4Q0V A;  3N4M A;  2GME A;  3POW A;  4XMI A;  1W28 A;  4AI0 A;  4MVT A;  1C5I A;  3BOP A;  2R06 2;  3RZM A;  5FLJ A;  4GKX A;  1YXW A;  1ENS A;  1POV 3;  1TNF A;  2XOM A;  1XYP A;  1RUG 3;  3IT8 A;  4NUB A;  5FP4 A;  5FKB A;  3VD9 A;  2IXI A;  1TNR A;  2ARA A;  4YFW A;  1XU1 A;  3JQX A;  4FT8 A;  4K9S A;  1UCX A;  2P37 A;  3PMS A;  4JQR A;  5IYY A;  4XW3 A;  4CCK A;  3ZXJ A;  1MS5 A;  3MUZ 1;  2JJ6 A;  3POG A;  3QOP A;  4G4F A;  2JE7 A;  1RUC 3;  1BK0 A;  4ERO A;  5IK4 A;  1KGY A;  3MLL A;  4OMD A;  1W8O A;  1WBF A;  3ZIX A;  3G6J B;  5C4W A;  1GYK A;  1LOG A;  1TVG A;  2JB8 A;  2JDM A;  4JHZ A;  4GUL A;  2XGX A;  3WD5 A;  1CVN A;  1GZW B;  5EPA A;  3TYJ A;  4CXX A;  5A7Q A;  1NYW A;  2UY9 A;  4GWN A;  1UZZ A;  4JAA A;  1RUF 2;  4CP0 A;  1WW5 A;  3SXW A;  3LDK A;  3V64 A;  1SG3 A;  4R9A A;  2BYV E;  3D82 A;  2QCS B;  3ZFE B;  2Z42 A;  4M3C E;  3KS7 A;  4CEW A;  2RM2 2;  2NMN A;  3IZO A;  2PTM A;  2ZEW A;  3OGV A;  1PM4 A;  1ZX5 A;  3VDD A;  1FV3 A;  4A6O A;  1HXS 1;  3V0B A;  1H30 A;  1UY0 A;  1E5S A;  5C9A A;  4CDQ B;  2HLE A;  1VRB A;  2W52 A;  4NN0 A;  2Y6H A;  4SBV A;  2OKX A;  1LEN A;  5I8S A;  2FDH A;  2QVS B;  1AR7 3;  2PLV 1;  5BXX A;  3VD5 A;  4CU6 A;  3GNE A;  2RJ2 A;  1OA3 A;  2D98 A;  2ES3 A;  5CZK A;  4AI8 A;  4NIG A;  4NPR A;  3N9P A;  3MFA A;  4GAL A;  4M0H A;  3RNS A;  4QX7 A;  5C8C C;  4AFM A;  1FYU A;  2VXJ A;  2V5Y A;  3FFQ A;  5E1R A;  5T5P A;  3SEP A;  2VQ0 A;  2WSV A;  2ZGS A;  3DGT A;  4IEX A;  1JOJ A;  4HK8 A;  1X33 A;  2JIC A;  1VJ2 A;  1DGR N;  4FPE A;  4NE9 A;  5DXD A;  1F15 A;  5F1R A;  4KU8 A;  1DYO A;  4KH9 A;  3KT4 A;  2GH2 A;  5JMO A;  4KU7 A;  4XPV A;  1SBF A;  1NX9 A;  3ACI A;  3HIF A;  1D4M 1;  1R08 1;  1OLQ A;  3N9N A;  4KBZ A;  5A7W A;  5BV6 A;  5IAT A;  3I2D A;  1UF2 C;  4D6Q A;  4RQP A;  4Q4V 2;  1NCQ A;  1AX2 A;  2E31 A;  2BBA A;  5JAX A;  1COV 3;  1EPZ A;  2NLR A;  4GB3 1;  4E4Z A;  1GOH A;  4E2G A;  1AR8 3;  1HRI 1;  2XHN A;  2XJU A;  3R4S A;  4CCC A;  4ZS3 A;  1TZO A;  4Y5T A;  2Y6F A;  3CJI B;  3C7F A;  4LIU A;  4ZXE A;  3WF3 A;  5JOZ A;  2NN8 A;  5IK8 A;  3T3Y A;  2W47 A;  4OHX A;  3AXE A;  1JH5 A;  4XZP A;  4XET A;  1GWL A;  1NUK A;  3VDD C;  4IET A;  4DFS A;  2A6W A;  3LDR A;  4YW5 A;  3AP6 A;  4CDW C;  4XUP A;  5C9A C;  2QDN A;  2WUH A;  4Y1U A;  3VBS B;  1PO1 1;  2MHF A;  3QCW A;  3V56 A;  4CP9 A;  1H4G A;  2VZS A;  2ZAB A;  1QQP 1;  1MQT C;  1BMV 1;  4JV4 A;  1UZY A;  4UWD A;  1RED A;  2X10 A;  1K3I A;  5EHD A;  1ULO A;  4I3G A;  2D6P A;  2VNG A;  5BNO C;  3AFK A;  1DIW A;  3JZV A;  1VBC 2;  2XWJ B;  4XF9 A;  1R1A 3;  1XE0 A;  1GQP A;  3BCW A;  5L36 A;  1LUL A;  1G7Y A;  4FPL A;  4DMI A;  3UET A;  3JBG 3;  2V5D A;  3OJB A;  4XZU G;  5DPN A;  3UK9 A;  5JXG A;  3SH5 A;  2B46 X;  4YGC A;  2RMU 3;  3PME A;  1OKO A;  1X50 A;  4AE2 A;  4BXS V;  4YNI A;  4Z82 A;  4MXV A;  5IHR A;  2WII B;  3ZYF A;  4N9I A;  3WF2 A;  1G9F A;  4RQP C;  1I5Z A;  1QJY 2;  3B3Q E;  1NCQ C;  4A7K A;  4Q8K A;  2B39 A;  3A23 A;  3U0Z A;  1BEV 2;  1C8M 1;  3E97 A;  3C7G A;  3OBT A;  1EY2 A;  4QXC A;  5FPZ A;  4A3Z A;  2L9L A;  2Y26 A;  1CN1 A;  4MXW B;  4ZKT B;  3I3Q A;  3JB4 C;  4BIS A;  1FV2 A;  1RXG A;  2AZ5 A;  4QQ2 A;  1T2X A;  4HSL A;  5D8A C;  5DDJ 2;  3NAP A;  4OUS A;  1O5U A;  2P2K A;  5SV5 A;  1H1A A;  5EQU A;  4EYU A;  1PO2 2;  3MF9 A;  3AP7 A;  5KHH A;  1LAJ A;  1KJL A;  1C8N A;  2C26 A;  1LHU A;  2D40 A;  4GA9 A;  4L99 A;  4WV8 A;  4UFH A;  5IVY A;  2WWS A;  1NZI A;  2Q1M A;  3AVS A;  3JD7 2;  5A32 A;  2VNR A;  2W91 A;  4PI0 A;  1Y9Q A;  5J1X A;  1ND2 B;  1QDO A;  2YGL A;  4YVW B;  4KMQ A;  1W6Q A;  1W8H A;  3I2G A;  4AVS A;  4RFR B;  3OUJ A;  3VBH A;  2XQR A;  3NV4 A;  4CUC A;  5J09 A;  2XJS A;  2ID4 A;  2HKX A;  3KQ4 B;  1FMD 2;  1POQ A;  2WZ8 A;  3FJS A;  3SCH A;  1W8Z A;  3RZG A;  1UU5 A;  2BUK A;  5FZ9 A;  1RHI 3;  2EIG A;  2RHP A;  3VZK A;  3CZJ A;  3AMN A;  1ZZ7 A;  1ZA7 A;  1NOV A;  3B9I A;  2VZV A;  5FZ7 A;  4I0B A;  3ZYJ B;  1IQD C;  1AX0 A;  5LWB A;  2ZXQ A;  3LOB A;  1JI6 A;  1NY7 1;  4AVA A;  2ZX4 A;  2D6N A;  5A33 A;  3GZU C;  3VZL A;  4LPL A;  2FMY A;  1XC6 A;  1ZBA 2;  4UOJ A;  3PTY A;  2DF7 A;  4KWJ A;  5JSO A;  3USU A;  4AFD A;  4DY3 A;  3VBU C;  1CX4 A;  3WP4 A;  2OUJ A;  1YI9 A;  4O9E A;  5CFC A;  2R06 1;  1HJF A;  2Y34 A;  3MFC A;  2K46 A;  4WVZ A;  3NAP C;  2RR1 2;  1YRZ A;  3IKW A;  4LBM A;  1VBE 2;  4CYD A;  2NZ9 A;  3JXS A;  4O61 A;  5I91 A;  1O8P A;  1ENR A;  1UZW A;  5FQ0 B;  1RUH 2;  4JKM A;  3SHR A;  3WNN A;  3MHZ A;  4D7T A;  2PHT A;  1QJX 2;  1SQ4 A;  4BE3 A;  2D6M A;  4FAG A;  1W0N A;  4XQW A;  1EV1 2;  2VC9 A;  2XJR A;  3S5Q A;  4D6S A;  2ARC A;  3JQW A;  2WWU A;  1GP4 A;  3ELN A;  2D5F A;  2J1T A;  3VBH C;  3LWC A;  1CIW A;  3S0M A;  4WVM A;  1A8D A;  5CFD B;  4EWE A;  1GZ9 A;  4RL7 A;  1GIC A;  1W0O A;  2LM3 A;  2W87 A;  5I93 A;  4QPI A;  2W68 A;  2JB4 A;  5JI7 A;  4NOT A;  5FPX A;  5IK5 A;  1Z0H A;  1OH3 A;  2W0X A;  3R4U A;  1E5R A;  2YB7 A;  3ZYG A;  3M3C A;  5A6Q A;  1TE1 B;  4H55 A;  1AYM 3;  3VBF A;  3MLJ A;  5I0S A;  4NRO A;  1UYX A;  1UY3 A;  4P5H A;  4FFF A;  1FI2 A;  1RMU 1;  1W3X A;  1ASJ 2;  2A6X A;  2PAE A;  2HWC 3;  4YW4 A;  3THD A;  1RUE 3;  2Q1F A;  1R09 2;  4M0N A;  1GP5 A;  4XDQ A;  3DF0 A;  1SAC A;  1NCR A;  1WA6 X;  4IV3 C;  1PIV 3;  3O12 A;  5CFC C;  4EN0 A;  2JE9 A;  4LXL A;  2Q8E A;  3V0A A;  4FXG B;  1V70 A;  1Q8O A;  2P17 A;  5C5U A;  1OT5 A;  1CAU B;  1C28 A;  5DQ0 A;  4PI2 A;  2R32 A;  5FMC A;  4YPJ A;  4C8D A;  3FBY A;  1CQ9 A;  1ZRR A;  1XBF A;  5F3I A;  1O4Y A;  3Q8F A;  1DU3 D;  1V6J A;  4WZF A;  1CPM A;  5IWF A;  2R16 A;  3IWZ A;  1AZD A;  2LUW A;  3QH7 A;  3I3M A;  2RS1 1;  3SCF A;  1ULD A;  4MSV A;  4ZON A;  1HQW A;  2X5I A;  3MGU A;  4Q4V 1;  1DQ6 A;  2VJX A;  1GU3 A;  1LGN A;  3BTA A;  2GNT A;  3PVN A;  5JR2 A;  1G9C A;  4MHR A;  4FBF A;  1VBD 3;  5JI9 A;  3T2Q A;  1AR9 2;  1G86 A;  3SIT A;  4FOW A;  5I0U A;  4BQ2 A;  4QPI C;  2IXL A;  2YC4 A;  2VTX J;  4JX0 A;  3PLQ A;  2B5H A;  5HBA A;  5KXD A;  3CEW A;  4NR1 A;  2KA3 A;  2VL4 A;  2WNV A;  5C3Q A;  3NRU A;  4XMA A;  4P9I A;  1AL2 1;  2XLF A;  1IGO A;  1RYY A;  1ZBE 3;  3D6E A;  3KT7 A;  4XDO A;  3M4F A;  1CWP A;  1MZ5 A;  1F4A A;  2WQ4 A;  1QJY 3;  3WW4 A;  3ES4 A;  2VZR A;  3RQ0 A;  2WS9 3;  5BNP A;  2Y0O A;  1UY1 A;  2OS2 A;  4BMB A;  2HYX A;  1IOA A;  2VZ3 A;  4QGL A;  3DXT A;  2XXZ A;  4QPG B;  1STM A;  1ZZC A;  2BW8 A;  1NCR C;  5EZW A;  3M7A A;  2W39 A;  4IEQ A;  1Z7S 2;  2D6K A;  4QQO A;  5T52 A;  1VBC 1;  4HVQ A;  4FCA A;  2MNG A;  1W6P A;  5FZ3 A;  1RIR A;  1O5L A;  3E5Q A;  1U5X A;  4Y4Y A;  5LY2 A;  5GM0 A;  4I01 A;  4AI9 A;  3TN9 3;  2BTV C;  2IXH A;  1US3 A;  2P3I A;  1W9Y A;  3D3A A;  3JD7 3;  4QDQ A;  3GBF A;  3FHI B;  4OZO A;  2QQN A;  3PUQ A;  1CAX B;  5L9R A;  1W90 A;  2FZ2 A;  3NV2 A;  4XCB A;  4FPK A;  3DYO A;  2W1S A;  5I8Y A;  5GAL A;  1VBB 2;  3VZN A;  4DXT A;  1SHW B;  1W9S A;  5AC9 3;  1ND3 C;  4I09 A;  4ZU4 A;  4Q4X 2;  4SLI A;  3UGG A;  2JWP A;  1H2K A;  3HMY A;  3ACL A;  3B02 A;  4P9G A;  2FZ1 A;  4XIK A;  1JXN A;  3RPQ A;  1VRH 1;  2VMH A;  2WNV C;  1QJU 2;  5KBF A;  2ZHN A;  2CGP A;  3N9Q A;  3OEA A;  1OI6 A;  1L7Q A;  1W2T A;  4BB3 A;  4TXW A;  4P00 B;  4WM7 A;  3RYK A;  1WD4 A;  3THT A;  2BPA 2;  3MIC A;  3N35 A;  2WFF 1;  3AKT A;  4IV1 B;  1JS9 A;  3AYE A;  4J25 A;  1NA1 B;  5BNP C;  2VQA A;  1MVQ A;  1JHN A;  3TOJ A;  3U4S A;  4NPL A;  2UWC A;  4GD4 A;  1CON A;  3OGS A;  4MHU A;  1N3Q A;  2D44 A;  2QQK A;  4Y26 A;  4UFL A;  1MR5 A;  1WW4 A;  3WDT A;  2PHW A;  1LRH A;  3WUC A;  3NNF A;  2ETE A;  3U14 A;  1EP0 A;  2A1X A;  4OI1 A;  3BU7 A;  5DAQ A;  2A6Z A;  3ZFE C;  3ZDS A;  3DKQ A;  3GZE A;  4QKN A;  1FMD 1;  2QE3 A;  3MV0 1;  2D97 A;  4QM9 A;  3W21 A;  1L3J A;  1AVB A;  3PUR A;  1RUH 3;  4LHN A;  5CNA A;  5IK7 A;  1SLB A;  1J59 A;  1V0A A;  1PM7 A;  3W20 A;  1QJX 3; 
#chains in the Genus database with same CATH homology
 3BTZ A;  4NJ4 A;  3O1R A;  3RZL A;  3I3M A;  4NRQ A;  4QKB A;  4ZS2 A;  2FDH A;  4NRM A;  3O1U A;  3T4V A;  3RZH A;  4ZHN A;  4RFR B;  2FDJ A;  3S57 A;  4NIG A;  4IE0 A;  2FDK A;  3RZG A;  5DAB A;  3BKZ A;  4NIH A;  3BI3 A;  3KHC A;  4IE5 A;  3BUC A;  4IDZ A;  4IE4 A;  4CXY A;  3LFM A;  4MG2 A;  3BTY A;  4JHT A;  4MGT A;  4OCT A;  4NID A;  4NPM A;  3H8R A;  3O1V A;  2FD8 A;  4ZS3 A;  4QHO A;  5F8P A;  3O1P A;  2FDI A;  3O1M A;  3KHB A;  2FDG A;  3T3Y A;  4O61 A;  3RZJ A;  4QKD A;  3I2O A;  3H8X A;  3RZK A;  3I49 A;  4O7X A;  3T4H B;  3O1T A;  4IE6 A;  3S5A A;  3H8O A;  4QKF A;  3RZM A;  2FDF A;  3BTX A;  4NII A;  4NRO A;  4NPL A;  4NRP A;  3BU0 A;  4IE7 A;  3O1O A;  3O1S A;  3BIE A;  4QKN A;  4CXX A;  2IUW A;  3I3Q A;  4CXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...