4NRTA

Human norovirus polymerase bound to compound 6 (suramin derivative)
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
500
structure length
500
Chain Sequence
GTYCGAPILGPGSAPKLSTKTKFWRSSTTPLPPGTYEPAYLGGKDPRVKGGPSLQQVMRDQLKPFTEPRGKPPKPSVLEAAKKTIINVLEQTIDPPEKWSFTQACASLDKTTSSGHPHHMRKNDCWNGESFTGKLADQASKANLMFEGGKNMTPVYTGALKDELVKTDKIYGKIKKRLLWGSDLATMIRCARAFGGLMDELKAHCVTLPIRVGMNMNEDGPIIFERHSRYKYHYDADYSRWDSTQQRAVLAAALEIMVKFSSEPHLAQVVAEDLLSPSVVDVGDFKISINEGLPSGVPCTSQWNSIAHWLLTLCALSEVTNLSPDIIQANSLFSFYGDDEIVSTDIKLDPEKLTAKLKEYGLKPTRPDKTEGPLVISEDLNGLTFLRRTVTRDPAGWFGKLEQSSILRQMYWTRGPNHEDPSETMIPHSQRPIQLMSLLGEAALHGPAFYSKISKLVIAELKEGGMDFYVPRQEPMFRWMRFSDLSTWEGDRNLAPSFVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural bases of norovirus RNA dependent RNA polymerase inhibition by novel suramin-related compounds.
pubmed doi rcsb
source organism Norwalk-like virus
molecule tags Viral protein/transcription inhibitor
molecule keywords hNV-RdRp
total genus 156
structure length 500
sequence length 500
ec nomenclature
pdb deposition date 2013-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00680 RdRP_1 RNA dependent RNA polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.100 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Arc Repressor Mutant 4nrtA02
1.20.960.20 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 4nrtA04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 4nrtA03
4MIBA 4RW4A 3VQSA 4M94A 4ZP8A 5L1JA 2EC0A 3C6TB 4ID5A 3KHHA 5I42B 4TQRA 4PWDA 3OLBA 4QWEA 3NKYA 4LSLB 2W7OA 5K14B 3Q8PB 1K1SA 3RBDA 4O3RA 2OPPA 4NZ0A 3H59A 3M9OB 5F8MA 4TXSA 2ALZA 2V9WA 5EDWA 2E9ZA 2RF2B 5CYQA 2WB4A 3CIZA 2YNGB 5F9NA 4RW6B 1SH3A 1S1UA 4IG0B 2W9BA 3H2LA 4I2PA 3RAXA 5KFQA 3QLHB 4EBDA 4WYLA 3KK3B 4ZHRA 3EPGA 3T5LA 1N56A 5C24A 3MECA 1FK9A 5C5JA 3DMJA 1S49A 4IFVA 4RUAA 1TL3A 1S1WB 1VRTB 4JV1A 5HP1A 1S6PB 2B43A 5KFUA 4ED6A 1BQMA 1QE1A 3QIDA 1TQLA 5KT7A 3KLGA 1LWFB 1S4FA 3M8PB 2IC3A 4RNHA 3V81B 3SFUA 2C2EA 4QW8A 1S1TB 3M9MB 3Q8RB 3PW5A 1EP4A 4KHMA 4EO6A 3C6TA 3FRZA 5KFJA 4NLGA 3ISND 2V4RA 1EETB 3MEGA 4RUCA 1RT5A 3DLEB 3BSNA 3QGIA 3KK2B 4NLXA 4NRUA 4K4WA 1S9GB 3HVTA 3PHEA 4Q8FA 2XWYA 4H4MB 3RBEA 1C1CB 2BE2A 2ILYA 1RT7B 4ICLA 2O5DA 5KFZA 4WFXA 3BQ0A 4O3SA 5DG7A 3NAIA 3ITHA 1DTTB 3NMAA 2YNIA 1RDRA 1YVFA 1HNVA 2FVCA 3N6MA 2V4QA 3HVAA 4ED0A 2FJVA 2AX0A 1VRUB 5DG8A 2R2RA 1NHUA 3QYYA 2XGQA 2ATLA 3LP0B 3V4IB 3QIPA 1HQUB 3KLEB 3H5UA 1SV5A 4F50A 4NCGB 1JLFA 4RW7B 5DQHA 4YMEA 4XPEA 3KLFB 1RT3A 5DGAA 4J9RA 1TVRB 4FS2A 1C0TB 2YKMA 4H4OB 4K50A 4O4GB 4NLRA 4WFZA 5J1EA 2WK4A 4RZRA 4Q43A 3KHLA 4ZPBA 5HROA 1CSJA 4KB7A 5L1LA 4TYAA 3RB3A 1N4LA 2DPJA 5KFGA 3MEEA 4WXWA 4TYBA 1C0TA 1T03B 3HHKA 5HP1B 1LW2A 3CDWA 1FKPA 1JLFB 3LANA 5KFWA 3V6DA 1KLMA 5C42B 4G3IA 4QW9A 3LP1B 3LALA 5KFIA 1RTDB 4Y2AA 2FJWA 1RT1A 2I5JA 1HYSA 5KFLA 4IR9A 3RAQA 3RB0A 1VRUA 4TY8A 3MR2A 4TLRA 5KFMA 4ZPDA 5EWFA 4RNFA 3OL7A 2RDIA 2WONA 3KMQA 2YKNB 4EEYA 3QGHA 1JLGB 1GX6A 1HQEA 1S1VB 3DM2A 3DYAA 4LSNA 3QZ7A 2AU0A 5KG5A 5KFDA 4QWAA 2HNYB 4XO0A 3IN5A 5HLFA 2R8KA 3E51A 4ICLB 4WZMA 4EBCA 3MR5A 3DLGA 1R0AB 1RT4B 5KG0A 3PW7A 3LAKA 3BJYA 3N6LA 1TL1A 2XC9A 3TAMB 5KFRA 2VG7A 5D3GA 1JLCB 2XI3A 5KFTA 2FVSA 2UVWA 1S9EB 3IGNA 5T14A 2XCPA 4F4YA 4ECSA 1IKVB 4KO0B 3MR6A 1J5OB 5EUHA 3N6NA 2OPSA 4ZVGA 1IKYB 3G6XA 5KT2A 3UQSA 2ASDA 2IM2A 1UWBB 4IFYB 4I7FA 2JC0A 2J6SA 3IG1B 3NAHA 3PJWA 4EO8A 1HMVA 1LWEA 4ZPCA 1QUVA 2HNZB 4ECRA 4WE1B 3UR0A 4ECYA 3V6JA 3GQCA 4DL4A 2BRKA 4ZP6A 5KFCA 1TKTA 2GC8A 4ECWA 1RA7A 3DI6B 4F4ZA 2RKIA 2ASLA 1GX5A 3H5YA 3MTKA 2D3ZA 4ECXA 4EYHB 2BQ3A 1RT3B 3HKWA 3G6VA 4YR3A 1C1BB 4ECZA 1ZTWA 3H5SA 3FFIA 3NGDA 2ZE2B 1TVRA 4ZVEA 5KFPA 5L1IA 4O44B 5KFOA 4Y34A 3C6UA 3KHGA 1S0OA 1TKTB 3T5HA 5F8IA 3OSPA 1BQNB 4JUZA 3KMSA 3I5BA 2R8IA 4ECQA 2RKIB 4YQWA 4IRKA 5CYMB 2ILZA 2B5JA 3QO9A 4FS1A 2R8HA 4WFYA 1N5YA 3JSMA 4OL8A 3E01B 3JYTA 2J6TA 2JEJA 2UVRA 1SH0A 1SV5B 1LWEB 3KLEA 4JV0A 2GIQA 4NLYA 1RT7A 2W7PA 4DL3A 4Q0BB 3DRRA 1QAIA 3OL6A 2YNIB 3MR3A 1IKXB 4KO0A 1TP7A 1JLCA 4NLPA 3KK1A 1FKOA 4IDKB 5C25B 2W9CA 1S9EA 4DL6A 3I0SA 4IRDA 1C0UB 3H4BA 5KT3A 2XGPA 3GIIA 1RT5B 3TQ1A 1R0AA 4HKQA 1DTQB 4K4YA 2IAJB 5I3UB 3RB4A 2QE5A 1KHVA 4X2BA 5CYMA 2IA6A 4JV2A 3DLEA 2ASJA 1S6PA 3T5KA 1VRTA 1SUQA 3KJVA 1TL3B 2B6AA 1BQMB 3OSNA 1D1UA 1HQEB 1S1VA 2W9AA 4Q44A 2FLPA 3V81A 1LWCA 3DI6A 5DLFA 1NNDA 4R8UB 4NLSA 4IR1A 1REVB 2UUWA 3MEDB 5C24B 4RW6A 1W25A 5KFBA 1KLMB 1HMVB 1S1WA 1LW2B 2D3UA 4F4XA 1FK9B 1XR6A 4K4TA 2JEFA 4ZHRB 2YNHA 3BGRB 1ZETA 4LSLA 4NLQA 3KOAA 4ZP9A 1LWCB 3Q8SB 2D7SA 4O4GA 5J1EB 1REVA 1IKVA 3MEDA 3GIKA 2FLNA 2YNGA 3PJXA 2OPSB 3BREA 4QWCA 3GILA 3H5XA 4HYKA 1ZTTA 1S97A 3CJ5A 2BANA 2B6AB 2UVVA 2VG5B 3KJVB 5KG6A 2BR0A 4O3NA 3T19A 3V4IA 2E9RX 4K4UA 1HPZA 1RT4A 2XCAA 1RA6A 2R2SA 4MK8A 3LP2A 4G1QA 4WYWA 2ZD1A 3OL9A 4DG1B 2IMWP 1DTQA 1KHWA 4ED8A 4ED3A 3UDLA 1TKXB 2BQRA 3I0SB 2YKNA 1I6JA 1MMLA 1RTIB 1WNEA 1DTTA 3DM2B 3DYAB 4LSNB 4TY8B 1JLGA 4J9MA 3IS9A 1S1XA 2WONB 4B3OB 4RNOA 4Q0BA 4ZVFA 4R5PB 1U09A 4RW9A 5KG4A 2HMIA 4RU9A 4XPCA 5C42A 3FDSA 1RT2A 5KFNA 4IH5A 2IBKA 3V6DB 4FBUA 2AX1A 2AQ4A 4IG3B 4LQ9A 2YNFA 3H4DA 3JYTB 2W8KA 4TQSA 3KLHA 4WXOA 3M8QB 4IH6A 2IC3B 3QO9B 1IM4A 3KLVA 1JLQA 4URGA 3LAMA 3ICLA 1JX4A 5HROB 3RB6A 1IKWA 4KSEB 2YKMB 4H4OA 4DL7A 2IJFA 5JXSA 4ED7A 3M8PA 5J2PA 5F8LA 4URQU 2VA3A 2WTFA 1N48A 5KFYA 2YNFB 3I5CA 2C28A 2FVPA 4ZVHA 2UVUA 2FJXA 3D5MA 3IG1A 3QLHA 2HNDB 3LP0A 1JXLA 4R0EA 4I7FB 1D0EA 2BQUA 4DL2A 1OS5A 5DG9A 3KNAA 5F9LA 4B3OA 3CJ3A 1QAJA 3V6KA 3CJ4A 3IS9B 4IKAA 4ZP7A 4J9OA 3DLKA 2HWHA 2OPRA 3DRPA 3CJ0A 1HNVB 4DG1A 4NLVA 1TKXA 3CDEA 3LP2B 4G1QB 5KFFA 3PZPA 1S9FA 2D41A 1T05A 3UPFA 4MH8A 4ID5B 2AWZA 2ZD1B 3G6YA 5FDLA 3DLGB 4MKAA 2VG7B 3GIJA 3KK2A 4NLOA 4QWDA 1FKOB 3H40A 2C2RA 3TAMA 1HARA 5EWEA 1HNIB 5J2MA 4I2QA 2R8GA 1LWFA 3IGVA 3MF5A 3PVXA 4Y2CA 3NL0A 1RT6B 4U7CA 3KLGB 1T94A 3GYNA 4MK7A 3GV5B 2WOMB 5HLFB 2OPRB 3DRPB 4ECVA 3LP1A 4QWBA 3FQLA 4IOBA 3BSOA 5KFSA 3KLIA 1RYSA 3KK3A 4F4WA 1HYSB 2B5JB 3H98A 3IRXA 3MECB 4KKOB 3DOKB 3V6HA 4NRTA 1BQNA 4R8UA 2OPQB 3PW0A 2HAIA 2I5JB 4NYZA 1RTJA 3DRSB 1N6QB 1S1UB 4H54A 2OPPB 3BSAA 3FFIB 3GIMA 5KFKA 1RYRA 1JKHA 4MK9A 4WZQA 5I3UA 1FKPB 4ZMMA 4NLTA 3MFIA 1HNIA 5J2MB 5F8JA 3MEEB 1HQUA 4PUOB 1JLQB 4MKBA 3QIPB 2F8EX 3GV7B 4J9KA 4RW4B 4YP3A 2W9CB 1MU2B 2CJQA 5I42A 3KK1B 3DDKA 1RTHB 4PQUB 2XI2A 4RW9B 1IKXA 2HNZA 2HMIB 3PR5B 1C0UA 4O3PA 4KBIA 4KV8B 4RW7A 4IRCA 4IDKA 5C25A 3FQKA 5J2QA 3T5JA 4NLWA 2FVQA 1T05B 3I5AA 2HWIA 5KFVA 5KFEA 2RDJA 1S0NA 3G86A 2WHOA 4KV8A 2WRMA 4MFBB 3CO9A 2V0NA 2IM3A 4EBEA 3ITHB 2C22A 3BQ1A 2IM0A 4ED1A 2AGOA 3SFGA 1C1CA 2BE2B 3BR9A 5KT5A 5KG7A 4KHRA 4J9LA 2WCXA 4H4MA 1S0MA 1N5YB 4RW8B 2UUTA 2VG5A 4IQXA 1JLAA 1JKHB 1K1QA 3GV8B 1MU2A 1DLOA 1C1BA 5KFXA 2GIRA 4K4ZA 3CJ2A 4J9QA 4Q45A 4PUOA 1EP4B 3CVKA 3MEGB 2FVRA 1S1TA 5KFHA 3IRXB 4KKOA 1EETA 4NLDA 1RTJB 4O3OA 2OPQA 2YNHB 3BGRA 4LQ3A 3M8QA 4K4SA 3QGGA 5L1KA 3DOKA 3I0RB 3SI8A 2WOMA 1RT1B 3CWJA 3DRSA 4MIAA 3M9NB 2R2TA 1RTDA 1QE1B 1C2PA 4IFVB 5DQIA 2JEIA 2R2UA 3CDUA 4WE1A 3NBPA 4TN2A 4ECUA 3DOLB 2W9BB 1J5OA 2RF2A 5CYQB 5KG3A 1XR5A 3EPIA 4IG0A 1S48A 3HVWA 1TL1B 1S10A 1JLAB 1JIHA 4NCGA 2JLEA 3BQ2A 1LW0B 1S6QB 4EYIB 3TVKA 5D3GB 4PWDB 5K14A 2W8LA 2IAJA 1T3NA 3OHBA 2QV6A 4K4XA 4Q8EA 2BANB 2BRLA 2JEGA 1LW0A 1S6QA 2VG6B 1Z4UA 4O3QA 2C2DA 5J2NB 2HNYA 3KHRA 3Q8QB 1JLEA 3OL8A 5DLGA 4ZPAA 1JLBA 2DPIA 4TY9A 4J9SA 4URSA 3QZ8A 2CKWA 3ISNC 1SH2A 1TKZB 1NHVA 5HBMB 4KFBA 3NBPB 4RNNA 2J6UA 3DOLA 3DLKB 3T1AA 4O4RA 3D28A 3JSMB 4Y3CA 5KT4A 5J2PB 5KT6A 4GC6A 4K4VA 4ECTA 3I0RA 1RTHA 4J9NA 4GC7A 4PQUA 3PW2A 1TV6A 2HNDA 1RAJA 2OH2A 2IJNA 3C6UB 5KG2A 1T03A 3OHAA 1IKWB 2ZE2A 5KG1A 4DL5A 4QPXA 4IG3A 1TV6B 4KAIA 1SUQB 4O44A 1DLOB 5EWGA 3KLHB 3PW4A 5F8NA 5JUMA 2VA2A 1N6QA 4R5PA 2AGQA 3KLFA 5F8GA 1RT2B 1S1XB 3DMJB 2R8JA 4YR0A 4J9PA 1TKZA 5HBMA 3PR4A 2ZKUA 2AGPA 3OLAA 4RW8A 4U6PA 3KLIB 4I2PB 3MFHA 4IH7A 4IFYA 5DGBA 4NLUA 4FBTA 4KFBB 4M95A 1IKYA 5L9XA 5KFAA 4YR2A 3DRRB 3FSIA 5F8HA 1UWBA 1RT6A 2I1RA 4MFBA 5J2QB 1S9GA 1XR7A 3HVTB 1RTIA 3BSCA 5J2NA 2JC1A 4I2QB 4DEZA 3EZUA 2FLLA 1JLBB 2E9TA 2VG6A 1HPZB 2IM1A 4ED2A 1JLEB 3E01A 4KE5A 4RNMA 5FDLB 5DQGA
chains in the Genus database with same CATH superfamily
4UF4A 4USMA 5A6WA 2HHPA 3BKTA 2ZM6F 5L1JA 3L3CA 1GK8A 1B01A 1Q7YT 2GIFA 5I42B 2F7VA 1L3KA 4M5KA 1WJ9A 2XMVA 1K1SA 3IC1A 1UVIA 3QFWA 4AUKA 2BNZA 1H98A 4FKXA 5ITHA 3RYLA 4O3RA 2OPPA 3MXHP 3MD3A 1YBTA 2ROPA 3M1VA 5EDWA 2FHOB 2IFXA 3HO1A 1FJGF 2PMWA 2WB4A 3CIZA 2OO4A 5F9NA 2FY1A 1UW4A 1YTYA 1HBNA 1YG0A 2RNEA 3MPDA 3MCNA 2IVFB 3P3DA 1WHXA 4WYLA 2XMTA 1WG1A 3PV8A 1RI7A 2BW7A 3GIRA 3O5TB 1N36F 3R3TA 5C24A 1U7LA 5K20B 4ILLA 5C5JA 2QSFA 4IFVA 3CC7S 1RBLA 1TL3A 1S1WB 1W26A 4RWWA 1VRTB 5LSOA 4DV2F 3H7HB 4J37A 4JI1F 1S6PB 5T7LA 4JV1A 1EX8A 3R8YA 1BQMA 4ED6A 3HJVA 4ZA1A 1TQLA 3QWUA 2A2BA 3DKDA 4ZKAA 5LMUF 4RNHA 3PM9A 1OSDA 4ID8A 3U1MA 3SFUA 2VKZG 1D3WA 1S1TB 2HS0A 2Q6BA 2OSQA 3CGIA 1TU0B 3PRVA 3M9MB 1HR0J 4OZ1A 2CQ3A 4EU0A 2AJ2A 2IJRA 2V4RA 2V8DA 2MQPA 2P9GA 4LF9F 5BJRA 1XMOJ 3U7JA 1X4BA 2F3JA 2J7UA 4JI1J 5LOQA 5B08A 4B08A 3M2UB 3SBMA 1IR0A 3G5OA 1R89A 4TKTA 2ZITA 1XTZA 4CH7A 5L9NA 2C2ZB 3OVSA 1RSCA 2J9DA 1C1CB 1X9MA 5F0WA 5KFZA 4WFXA 4U9RA 2G0JA 4CT9A 1TMMA 3MMCA 5JMNA 1KEKA 3PX6A 2IY5B 4QBUA 3BQ0A 2V5HG 2K7KA 3IWXA 3NAIA 1RKJA 1CJKB 1DTTB 5IV4A 2RQKA 2YNIA 3BZQA 4KY3A 3CPWR 1PJ7A 3CCLS 2GX8A 2ZBIA 3VVTA 4KR0B 1G3OA 3HVAA 1JJCB 1OYDA 1VRUB 3WQPA 3CULA 1FD8A 3QYYA 2XGQA 1VQNS 2K3IA 3VVUA 2ZH9A 2XMMA 3CD0A 2XSJB 2JFDA 3H5UA 3BO3A 3HHLA 1VQ9S 1H6KX 2KRRA 4F25A 2GHVC 2HFVA 2YWGA 4KGMA 3W61A 5D77A 2DNZA 2E7XA 3M8ZA 4J9RA 5HSPA 1SQFA 2HQDA 1C0TB 4M5GA 1N33J 2AYEA 4K50A 4LR7A 4WFZA 1WEXA 5J1EA 1AFIA 4LIRA 4DUZF 4ZPBA 1NXIA 1ZA2B 4EGLA 5L1LA 4TYAA 3A8KA 4HACA 1N4LA 3NY0A 4DSJA 2HQCA 1B0TA 1YJTA 3EWGA 4KGZB 2VQFJ 1C0TA 3CDWA 1FKPA 2MZRA 2P5VA 1QVGR 2OLWA 3SMZA 3VF0B 2ZBCA 4RWXA 1KLMA 5C42B 3THTA 2DR6A 3LALA 1Q8LA 2JBVA 2ZJPQ 1RKIA 2HIYA 2WVBA 1R3NA 3IAM9 3M8WA 5LMNJ 2LEAA 2DGSA 3FRYA 4OFZA 3RB0A 4C8LA 1SQEA 2Q43A 3OXFA 4ZPDA 3HD2A 2Q79A 3G9CA 3OL7A 3GMGA 2Y1JA 5CCLA 1FKAF 1JLGB 2LMIA 1GX6A 2AP6A 4MJKA 4RUBA 3DYAA 4LSNA 3SQGB 4MYUA 3QZ7A 3UDEA 3IN5A 1YLXA 4C48A 1BGXT 4XO0A 5HLFA 2AU0A 2J9CA 2RIJA 4HHUA 3GJTB 5I4MA 4QR0A 1GFWB 2FZCB 3E51A 2DK2A 3H8YA 3KYLA 3KNGA 1XMBA 4CO3A 4QR2A 1G2EA 4PKDB 1RT4B 5M2RA 3ZNUA 2VC1A 3IM9A 4MIWA 3DDNA 3ZZTA 7AT1B 2VG7A 1JLCB 1KWMA 1LOUA 1RWKB 3GJSB 3IBWA 3MAAA 4LRDA 5HANA 4DR3F 1DJ0A 3EICA 2FVSA 2ZZMA 5T14A 2LA6A 4W4MA 2XCPA 3SCLE 4F4YA 4ECSA 3NLCA 1YBUA 3PKMA 2E5LF 4J9UE 4EZ9A 4QJVA 1G7CB 5J1NA 4J91A 2DEIA 5IFMA 3Q86A 1H7XA 1NK8A 2NSBA 2OUGA 2CQBA 3PJWA 1TTHB 3MM9B 1LWEA 4ZPCA 3W64A 3J7YU 3C19A 3HZGA 4USJC 3MMBA 3T41A 2VH7A 3LUYA 3FUYA 4F26A 4DL4A 2OFGX 2XZWA 3UW1A 5KFCA 1RHMB 3A13A 3W5YA 2ZHBA 3MEKA 1YWXA 4ECWA 2UU9F 4F02A 1B7YB 2AZ1A 2RKIA 3HHNB 1WC4A 2F4VF 3JAMY 1GXTA 5B0GA 1RCOB 3OTEA 3G6VA 1NPRA 2FZGB 3HD1A 4YR3A 2PT0A 1LFPA 1XNRJ 4DF4A 4WU2A 3CCJS 2YWEA 1C4AA 3DGPA 4OI6A 4O44B 3C6UA 4P7TA 4FXVA 1WI6A 1TKTB 3OR2B 2HEKA 4OYOA 4DR4F 1BQNB 2AKWB 4HT7A 2R8IA 2K9IA 2RKIB 4ENOA 4X4NA 4USWA 3SSQA 1XK8A 1YBAA 3O6QA 1OQ3A 1MROB 4CLSA 4OL8A 3PJ9A 2CZ4A 2VC0A 4HEA9 1SH0A 1FDBA 3D2WA 4P73A 2YH0A 2Y8WA 4JV0A 2GIQA 1HBMB 4ANCA 4NLYA 3GB0A 2GPEA 3M2RA 2FGCA 4DL3A 4L6V3 4Q0BB 4TU9A 2VODA 3TAPA 2DNKA 1TP7A 2GMLA 2LVWA 2NPIA 1RHUB 3KK1A 3BGOP 5A0YA 2DGTA 1S9EA 4FYDA 3I0SA 4IRDA 4I6AA 1YX2A 4K0KF 2Z4PA 4Q7AA 1RACB 3GIIA 2UV8A 3TQ1A 1R8CA 1R0AA 2PI5A 1QVFR 1O51A 4ELTA 3ZTQA 4HKQA 1U8WA 1RU2A 3PIOQ 3BS9A 1VRQC 2U2FA 4A8YA 5CYMA 3WX8A 4JV5F 2W2OP 3QPIA 2DR8A 1WOPA 1F9EB 1S6PA 3JSYA 2AD9A 3UN5A 2YPYA 4PEOA 1TL3B 1T02A 2JSXA 1U24A 3C16A 4DV1F 1HQEB 3PG9A 1Y7PA 4Q44A 3V81A 1P9YA 1RB0A 4G65A 3FCHA 1T95A 3OJSA 1REVB 2UUWA 3K8VA 3MEDB 4RW6A 1SL2A 1W25A 2MEWA 4OIXA 4QR1A 1H7WA 5JJBA 3CJ8A 4W98A 1LW2B 3KWMA 1N88A 2GVZA 2ZC4A 3M32B 2YKPA 4Y0FA 1FK9B 4K4TA 1YIJS 4GVBB 3G6ES 1RWPB 2CJKA 3KOAA 5IOLA 1H2UX 3KJQB 1REVA 3MEDA 4XAKA 1UETA 4X84A 1KSPA 1BAZA 1FE4A 1FCAA 3NOGA 2IA0A 1AROP 2GA7A 3AOAA 2CJXB 2BR0A 2QT7A 3W2WB 5DJBA 2CQ1A 2NSCA 1RA6A 1LFWA 3BN4A 3T1HF 1NK9A 2VU5A 1Q81T 3CW2C 3E3XA 5IS2A 2HVIA 2POKA 2BDPA 1JJ4A 1KHWA 2RT3A 5A0YB 1EA4A 2R7RA 4ED8A 4GKKF 1R7IA 1BY9A 1F6TA 4NMXA 2BQRA 1VDHA 1I6JA 2LQ9A 1RTIB 2HS4A 4ZN1A 3UN3A 1G4CA 3BEGB 4DSIA 4RX6A 1SKUB 3EDRB 1D8ZA 3QAUA 1CQNA 1JQGA 2MY7A 4RNOA 4Q0BA 3SDEA 2DHHA 4R5PB 3FEXB 1LEOA 4FPRA 3ENAA 4ZIWA 5C42A 1IBKF 1RWNB 2Q1LA 3TOQA 1YRUA 3V6DB 4FBUA 1BHNA 3W2VB 4OZ2A 4LF4F 4LFCF 2ZH3A 2CZVC 4LQ9A 2YNFA 2VFVA 2A6OA 1TFWA 3IWNC 3JYTB 4TQSA 4DR7J 4X4RA 5L46A 3H87C 3PYEA 3UN2A 3KLVA 2ZVSA 3OTBA 2XG8A 3BM7A 1IKWA 1OJ4A 4DV1J 1VK3A 2GVDA 4UOHA 4ILMA 4X4QA 2IJFA 4QU6A 3NGSA 4NASA 1TUVA 1X0PA 2WW4A 3BBBA 3N9UC 2DXEA 3WIUA 2FUG9 2V63A 3TYTA 4GKJF 3KFWX 1SL1A 4UQGA 1WKKA 2FVPA 1FRJA 3DN9A 4ZVHA 2UVUA 3BPDA 4FVCA 4WU3A 1ZBTA 2CQ2A 1D0EA 3OVBA 2B8PA 2HHSA 2HHVA 4K0KJ 1UZHA 3ENQA 3KNAA 3MM9A 1TK5A 2DHGA 3JTPA 2L9DA 3UCGA 3CO0P 2BM1A 4NA1A 2HFNA 3D6MB 4PWWA 1K47A 4C7QA 3CJ0A 1HNVB 5E7OB 3MMCB 4EFAC 3POTA 4NLVA 3NO7A 1RAFB 2CWKA 2VPWB 3W3SA 3LA0A 3UCUP 4EZ6A 2D41A 3VV2B 1T05A 3UPFA 4MH8A 4ID5B 2Q6CA 2AWZA 4Z2XA 3CCES 2ZD1B 3R5GA 4NA2A 4B9SA 1WC6A 2K2PA 2W24A 2KTQA 3EXYA 1UP1A 4DR2F 2QYCA 3GIJA 4ER8A 3QRQA 1RWUA 4DI6A 2QL7B 4NLOA 1FKOB 3H40A 2C2RA 3AD7C 5AXMA 3TAMA 1HARA 2V8GA 4DR4J 1HNIB 5J2MA 3IXQA 4I2QA 1DY3A 2KOEA 3QGPA 1RT6B 1AT1B 2MKJA 4ANEA 2HG4A 3UVJA 1R0CB 3L95X 2F8HA 1N5QA 3D9BA 3GYNA 4JI0J 3P49B 2N7CA 4MK7A 2HVHA 2WOMB 5HLFB 3GP9A 2F4VJ 1FWLA 3FQLA 2JJ4D 3EJMA 2MQLA 4P2MA 2MQ8A 5CZVA 1X4AA 1WSRA 2H54B 3KLIA 3OTDA 3UE2A 2E1MC 4CO0A 4F4WA 1PC4A 2X3GA 2K06A 3MECB 4A8WA 1CQMA 1BQNA 2RMLA 3BBFA 4GVLA 2OPQB 3OFHA 5EX0A 7FD1A 3JS9A 4JOUA 2DNQA 2G2OA 3AXMA 1Y3JA 3FFIB 4ZS6A 1JKHA 4MK9A 2HYIB 4WZQA 5G4DA 3DGVA 4ZMMA 2N7YA 2U1AA 3MFIA 1HNWF 1URRA 4LF8J 3PYGA 1P1LA 4IYQA 1ZZFA 1JNZB 2B7BB 3C2PA 4J9KA 3GV7B 3D6FB 1I94F 1MU2B 2CJQA 4DS5A 4DFMA 4NCAA 1MMNA 4PQUB 1K0TA 1CJTB 2HQIA 1X5OA 2DH8A 4LRFA 4RW9B 5E3CA 5JVHQ 4KV8B 1T9WA 1UPPA 3DOMB 4IDKA 2VPXB 5ETTA 1H72C 4RBVA 1Q5YA 3JTOA 2B9EA 3HI9A 4HDGA 2FVQA 1REGX 1SIWA 1CC8A 2LFVA 2Y1RI 5KFEA 1SBRA 2X1BA 2R3VA 2WVDA 4KYZA 2HBZB 4KV8A 4OX6A 1L5UA 1AW0A 1Q1KA 2A6MA 4JI8J 2RJZA 3EDQB 4DFKA 2AYBA 1ICEB 2QC3A 2AJ0A 2L41A 5F0UA 2FPHX 2IYGA 1NZAA 4RKUC 1U2RA 2BE2B 2VFUA 2W1BA 3K5OA 3DCAA 4NZ7A 2BKNA 4PG8A 2WCXA 4F36A 5ETQA 4RW8B 4WP9A 3W63A 1GMWD 2MKHA 2HRYA 2RB7A 3NS7B 4DR1J 2VOPA 2RUGA 4ZN3A 2G13A 2BA3A 1FRMA 4EUVA 1IRQA 1S7HA 1AXQA 3MEGB 1QAXA 1NM2A 1VCTA 2V4JA 4GMKA 4OLPA 5FD1A 4NLDA 1SJ3P 1WELA 1RJJA 1JXEA 2QRRA 1G1XA 3MOJB 3P8BB 3X3UA 5AXNA 3DOKA 2JRSA 3I0RB 3SI8A 2RS2A 2ZJQQ 3CC2S 2WOMA 3CWJA 4MIAA 3DRSA 3PFOA 3R7SB 3K5NA 2V1TA 1C2PA 2ZC3A 4IFVB 5BR8F 4WE1A 4KH1B 3BYRA 5EX3A 2XB2D 1RWMB 4X4TA 2VPYB 1FRXA 5DZ7A 3UNYA 1KTQA 3MMAB 3CJSA 3RRGA 4FDFA 4RBTA 1Y9OA 2OP5A 1HBNB 3VTIA 1T8EA 4ELUA 2GQQA 2B4OA 3VWSA 3TR5A 3EPIA 1FEEA 1S48A 3BPSP 4DR2J 3TZWA 1MMDA 2R9LA 3VHQA 1S10A 2XHCA 1JLAB 2R7XA 5AXLA 3IBCB 1JK9B 1NPPA 1R8HA 3QT6A 2VJUA 4KH0B 3FNNA 1IBKJ 1WTFA 4EYIB 3R2DJ 2XYHB 2DCLA 4F0KA 3PKYA 2RHSB 3MTJA 5K14A 2KFNA 3OHBA 4K4XA 4Q8EA 1UEKA 1OMSA 2DVIA 1TL7B 2WSCC 1LW0A 1S6QA 4MYTA 3TX8A 4EWTA 1V5IB 3X1LB 1U02A 2DR5A 5HVFA 4O3QA 2E29A 9RUBA 4LMZA 2RRAA 3U27A 3KHRA 3AQPA 4XDCA 2E7WA 1PC5A 4P10A 3Q8QB 3DLBA 2VOOA 1WD6A 1JJ2R 3PTWA 4DR1F 2ZH7A 1RADB 2XS5A 3CTRA 1VI7A 1SH2A 1X93A 1V3ZA 4PABA 2K6LA 4KFBA 1SIWB 3C46A 3EVWA 2HFUA 2GQCA 2ZH4A 2OMLA 4NPOA 1EB0A 1NZ8A 3D6HB 5J1PA 2BV3A 2YY3A 4ECTA 3AWRA 2R7UA 3OFFA 1NK0A 1F9FA 2IJNA 3C6UB 4TVAB 4FNIA 3OTOF 3IP0A 4JI6F 2UXBF 3Q0AA 1D9DA 2NYIA 2W4CA 3I6PA 1IN0A 1TV6B 4KAIA 4O44A 1DLOB 3M30B 3KLHB 3D1HA 2RQCA 3W9IA 1FNOA 2CQPA 2RD5C 1F5CA 4Y2KA 5T7LB 1KQKA 4ES2A 2MQQA 4R5PA 2AGQA 4PXDA 3KLFA 4FF1A 4OYWA 1Y3KA 2AT1B 2DGVA 4J9PA 1LXNA 1GMUA 1WEZA 1TKZA 2PC6A 1KFDA 2A10A 4LVOP 2OI2A 2AGPA 1NUEA 3KLIB 5LSRA 4NXNJ 3W65A 1OM2A 1YZ7A 2B8QA 2DISA 2GMHA 2OMOA 2ZKTA 4NI2A 8RUCA 2BKOA 5DGBA 2AF6A 4X62J 1XQIA 2AY0A 1IKYA 2A2CA 3MM7A 4K2XA 4YR2A 3DRRB 3K7RA 3FSIA 4DV0J 3T1HJ 4DBQA 2VHGA 1RT6A 1ARRA 2QFIA 1LQ9A 5IQ6A 5EGYA 1RTIA 5J2NA 2JC1A 1LK5A 3M2UA 3EZUA 3DHWC 2LQJA 2B51A 2QYGA 4I2QB 4L76A 4QIGA 4DEZA 5IV3A 2M7SA 3MAQA 4ED2A 4ELVA 3E01A 4KE5A 3HSGA 3TJ9A 2XULA 4DZDA 2XMUA 4UZBA 4RJVA 1I51B 1VQMS 2XS7A 4ZPTR 4TQRA 2GMJA 2Y9HA 3OLBA 4QWEA 3NP5A 2OHDA 1CBKA 4OHWA 1FFSB 3LO3A 4DWIA 5H9EK 3RBDA 2XY6A 2LKZA 4OHVA 2BJEA 2E66A 4DUYF 4TXSA 4ZCMA 5HJXA 1F60B 4FXDA 1SKSA 4RW6B 1S1UA 1N52B 2J7WA 4AL5A 5KFQA 1IJFB 2ACYA 4AL7A 3EPGA 4UQTA 4DDFA 2CUYA 1RQ0A 2ZZTA 1FK9A 1YJVA 3BB5A 5GVQA 2UUCJ 2GVZB 5CHCB 2KT2A 3ENVA 3H0PA 4NL5A 4PYDA 1OIAA 3AXKA 2F40A 3CT9A 5DRKA 5HP1A 2B43A 2DD8S 1BLUA 1YJRA 3IR6B 4PQAA 3QIDA 4OZ5A 3KLGA 2RQ4A 2H4WB 3M8PB 4X4OA 4DQRA 3KTQA 3V81B 2G2YA 1CJVB 3Q8RB 4QPTA 4EO6A 5KFJA 3FRZA 2HGLA 3MGJA 2EKYA 1EETB 3GYGA 4FZVA 3QT7A 2FTRA 5MAOA 2DBBA 2NXEA 2D3O1 1RT5A 4HTIA 1IBCB 3DLEB 3TEHB 2RU9A 1UJ6A 2ZOFA 3QGIA 2P6TA 3KK2B 2ZJRQ 1UVJA 3ZZPA 2K1RB 4K4WA 2IMOA 3HVTA 4ETXA 1PBUA 2XWYA 2CDQA 1ZM2A 4H4MB 2BE2A 3AB4B 2BOPA 4ICLA 5A8WA 4GRSA 2I38A 4O3SA 1RAOA 1HW8A 3HCXA 3NMAA 5KOXA 1VQ7S 3RW7A 3HK2A 2FVCA 4WFAQ 3CC4S 5K8PA 2DITA 5K8NA 2VBZA 2R2RA 2ATLA 2YPZA 2P9CA 1EZZB 3CCSS 1HBMA 2CWXA 1HQUB 3M4XA 4P9SA 2KFZA 1PG5B 5C2CA 1NSQA 3VAFA 1NHKL 3G8SA 1AUSL 1OHNA 2QTWA 4J7CA 5F41A 2PMZD 3VGTA 5LM7E 4DU7A 5DQHA 4YMEA 3CCRS 1RT3A 1RBAA 3O8WA 1I1GA 4H4OB 4PZVA 3TJ8A 2GS8A 3FSYA 4DUYJ 1PARA 2WK4A 4Q43A 3RB3A 3RW6A 2XMWA 3BO2A 3AJDA 1PO6A 1OO0B 5DO2A 1P27B 1IBMF 1B3TA 3QJLA 4NCBA 1T03B 5HP1B 1LW2A 3BBCA 2Z2YB 3GFZA 4KGVB 3ZZOA 4G1IA 2KKHA 4OQJA 2MQOA 2NXUA 1N32J 1QY7A 1U1KA 5KFIA 1IJEB 3TO8A 4FF3A 1SC6A 2I5JA 5GMEA 4PR6A 1HYSA 1UZDA 4IR9A 2OKQA 1RHRB 3O1LA 4TY8A 5IM0B 1H38A 2DGWA 2CNOB 3FEYB 5EWFA 2RDIA 1TKDA 2YKNB 5BYSA 1HQEA 2DR9A 3EYZA 2EI5A 2AMCB 5KG5A 2DJWA 2NR0A 2EG1A 5CAAA 4UZCA 4EBCA 1QDUB 1U4BA 2D3OR 3DLGA 5KG0A 2RRBA 4OI3A 1KQGB 2VFRA 3N6LA 2V9KA 2XC9A 3FMTA 5B0DA 5GADU 4DV7F 4QIVA 2LXIA 4TU7A 3K58A 3HJFA 1S9EB 2JX2A 2M2BA 2H3EB 2XBPA 2UV8G 3TRGA 4UOGA 2ZEJA 4HV0A 3MR6A 1P6TA 1QD1A 4LF6F 1RXOB 2UUAF 4GO7X 5EUHA 2OPSA 3TUJC 1ZYQA 1NSAA 2HQGA 4ZVGA 1IKYB 2CNLB 3G6XA 4QYZJ 3UQSA 2ASDA 2IM2A 1UTAA 4X64F 4N41A 1WSVA 3M6VA 4RLEA 1N54B 2JC0A 3M2RB 4W92B 2PMHA 3IG1B 2K8GA 2HHQA 3NAHA 1Y5IB 2HGMA 4B3MF 4ECYA 2CG8A 2HNZB 3OXGA 3PRDA 1LV5A 3UR0A 2MZTA 3K5PA 1UA1A 4B9MA 4C98A 2BEFA 2BRKA 2LECA 1CS4B 4B9LA 4ANDA 3SV4A 3DI6B 2DY9A 2LU1A 1R8BA 4XDDA 3ZTSA 4ECXA 3H90A 4EYHB 2JLFA 1X31C 3ETOA 3KG0A 4OZ0A 2LA4A 4PWUA 1VGYA 1YRTA 4EMDA 3FFIA 3M6WA 2ZE2B 1TVRA 3CJTA 4ZOSA 3A8EA 4ZVEA 5L1IA 4MKVA 4Y34A 1O6XA 3GG0A 4BDPA 1IVZA 2M88A 2GV1A 2QX0A 3BDEA 1UVNA 4JUZA 1ZAWA 4YQWA 2KZZA 4NOHA 2B5JA 4CWBA 4NA3A 3BH7B 3Q8UA 1N5YA 4K8RA 1RHQB 2IVYA 3W8PA 2IDLA 4IQMA 1XNRF 1LWEB 1R31A 3KLEA 2ZH5A 2GO9A 2QLJB 1PAEX 4CLPA 5K9FA 3TA1A 3LWLA 1MN7A 5DDRC 4MJWA 1FXDA 1PILA 2GZOA 1KC8T 1H74A 3A3OB 5AT1B 2Y3YA 2FJAB 4O0IA 1QAIA 3OL6A 2YNIB 5C2GA 3F44A 1FVSA 1JLCA 3FMBA 3MAAB 1FKOA 4B3MJ 5C25B 4DR6J 4DL6A 3G82A 3L7UA 1M5OC 3RR8A 3K89A 4C4WA 3H4BA 5KT3A 2APOA 3LPEA 3SQOP 2K1OA 3SIPB 2XTCA 4ZLNA 4CLUA 2XLKA 1B0PA 1HL6A 3I87A 5E3QA 1VS3A 4K4YA 3RB4A 1S12A 2KU7A 3K8WA 4YFUA 2ZH2A 4JV2A 2R7VA 2WSEC 2ASJA 1ZH5A 3C14A 2FHMA 4KIAA 1VRTA 1X4CA 2Y1IA 1K0VA 3J7ZT 1WF0A 5D0RA 1KVKA 1U2CA 1MYLA 2ADBA 4B3TF 3BYPA 3CSKA 1TUGB 3ETMA 5GAEU 2W9AA 4OJHA 3D3BJ 2XYGB 2LQ8A 2LQ5A 3JTNA 4HDHA 4TNOA 2FLPA 1R6YA 3TJAA 4R8UB 5DLFA 4NLSA 4IR1A 1JXVA 4ZVOB 5A8RB 4C8MA 3S6EA 2YQ0A 4LBPA 5KFBA 1KLMB 2GO8A 1YI2S 5B0AA 1S1WA 2DIVA 4X4PA 3CCUS 2I0XA 2H1OE 2QLWA 1XR6A 1FTCA 7FDRA 3VALA 2DNPA 4XIUA 3BGRB 2XQCA 2CPDA 4LT6A 4AT1B 1LWCB 4ZP9A 1WHYA 4FN5A 3Q8SB 2HIQA 4Y2MA 4C9DA 1W7WA 2FLNA 1IKVA 2ZM6J 2AJQA 2IRYA 4OHYA 5D4OA 1S79A 4QWCA 4B9VA 3H2UB 2M0GB 3H5XA 1ZTTA 3PHTA 2R7QA 2BANA 2B6AB 2J9DE 2BX6A 2YQ3A 3J81U 4LFBF 3KJVB 1UCNA 1I94J 2PFFB 3KDOA 1N5TA 2E9RX 3OPKA 1HPZA 2XCAA 1N5SA 1OWXA 1UAWA 2JNJA 4U8VA 4E8UA 2CNNB 4ZLPA 3MCOA 3RUBL 5A2QU 4G1QA 2MZQA 3L7OA 4DG1B 3MM6B 1BWEA 1DRZA 2QMUB 2QFJA 3GR0A 1ELOA 3CD6S 4PAAA 4ZCKA 2GFFA 1CJKA 1DTTA 2DIUA 2FZKB 2HQFA 3A3NB 2QLXA 4F8RA 4I1TA 2AYGA 4DF8A 4B9UA 3C15A 3J7Z5 1NCLA 3B6BA 2JVOA 2VB6A 4B3OB 1IM6A 4NX9A 2VICA 6FD1A 3MPYA 1U09A 1ROFA 4RW9A 4DCJB 3Q24A 5K5MA 4YY3F 4IH5A 4LRBA 5A8KB 2CQIA 1R8PA 5E0OA 2ERRA 1NK6A 1T9XA 1WKJA 4F50A 1XEZA 4IG3B 4IO9Q 4PRFA 1PKUA 2MSTA 2IRUA 2CDRB 3M8QB 4CM0A 5ETMA 3QO9B 1IM4A 1FFGB 1G6BA 3DFEA 2DNNA 2YX4A 3ICLA 4NEZA 4P75A 5HROB 1JX4A 1E6VB 2YKMB 5JXSA 1EKSA 4FKYA 4WIQA 5J2PA 4NXMF 4TU8A 3PEJA 4URQU 4HH0A 1N48A 5ETVA 1DZ5A 2X51A 2LU2A 1F1BB 5HK4A 3I5CA 2MZ1A 1Q5VA 2JWNA 5F3TA 2FJXA 2BSQE 2HNDB 3LP0A 3ZZRA 2FB0A 3CMES 1HD0A 3P5BP 4ES3A 1OS5A 3ULHA 2MSSA 5LMUJ 1Y5NB 2DHAA 3RG6A 1HHQA 2JL9A 3IS9B 3SXLA 3F73A 4C8ZA 3BR8A 3OT9A 3DLKA 3TEGA 2OPRA 5IC6B 5ETKA 4HTJA 5L8RC 2IPOB 1SVDA 3DU5A 1OPZA 2VL1A 3RU0A 2YBVA 3LP2B 2DGOA 2NUUG 4A47A 2KM8B 4PG7A 1NMEB 2KJVA 4I4BA 1Q79A 2QLFB 2BBEA 1LWXA 2JXHA 1JNRB 4CO1A 1Q7LB 1ZM9A 2AEMA 2VG7B 1WKLA 2ZUAA 4MKAA 3MHYA 4NYOA 1SKRA 1J5EF 2MDAA 5H9EJ 2R7TA 1HA1A 4CI0B 3F41A 5U47A 4ZVTB 1ZAVA 4CQ1A 5EWEA 4DV7J 1M5PC 2MMYA 1CULB 2R8GA 2DO4A 3IGVA 2HKEA 2C3PA 4Y2CA 1NDCA 5HMXA 4QIEA 2BE9B 2RSQA 3PYDA 4L72B 3FZ2A 4FYWB 3SQGA 3PIPQ 3IAS9 2O3DA 4A8OA 3GV5B 1U48A 3DRPB 4LF4J 4K7QA 4QWBA 3F56A 1GXUA 3NNHA 4JYAF 3BSOA 3UFCX 3NEKA 1Y11A 1NK5A 5BXIA 4CO4A 5JUMA 3KK3A 1LK7A 1RYSA 3TVZA 2BACA 1PCAA 3LGMA 3M2VA 2IYIA 2NYHA 1PJ5A 2KZMA 4NRTA 5E5NA 4DV6F 2MKSA 4G1PA 1YK9A 4D3HA 4DXLA 4YHHF 2Q66A 2IHR1 3I55S 1K73T 2B4PA 2C3YA 2CQCA 3GIMA 5KFKA 1RYRA 3MZIA 2MZJA 4KC5A 4LVNP 4OJGA 4P52A 3TZYA 4KPYA 5I3UA 4L73A 2KG1A 2UUBF 4O0NA 5F8JA 1FESA 2C2OB 2WSFC 3MEEB 3GFXA 4LFAF 4PUOB 3QIPB 2F8EX 1MWYA 1NSKL 2LEPA 2ZVIA 3AT1B 4LSZB 4RW4B 1I3OB 5E2QA 2HK3A 1WTBA 1RTHB 3P4UB 1GT8A 1Z2LA 1IKXA 2XI2A 3PR5B 1C0UA 4JI2J 4KBIA 4P71A 4RW7A 4BHQA 5KOWA 1FA0A 2CPEA 5C25A 1O0PA 4NLWA 2NQPA 4ZITA 1CJUA 2JZ5A 5BYRA 2GGPA 1J2VA 1SB6A 2AJ1A 3I5AA 4C0HA 6AT1B 1VBYA 4IO1A 2QZ8A 2YWFA 3N4WA 3G8QA 2KH9A 2IM3A 3GLJA 2Y1LB 2WVEA 3D0IE 4DS4A 1UVLA 2X1AA 3LF0A 1Y10A 2AGOA 2KG0A 3SFGA 2V69A 3QNWB 1C1CA 1RUSA 2M9KA 4KHRA 4M5LA 1HBUB 3KUHA 4HT5A 4D3GA 3GYXB 3OTOJ 1N5YB 5ETPA 2UXBJ 1HWUA 2VG5A 1JLAA 5SZTA 1K1QA 2HGNA 1VBZA 4M5DB 3CJKA 2A18A 4AQYJ 3WZ0A 2GIRA 2NUHA 4UT4A 2J0XA 1U0SA 2MJNA 3D3CJ 4OHZA 2FVRA 4A8XA 2XMKA 1S1TA 3Q8VA 5KFHA 3IRXB 1EIYB 3ENWA 1VQ6S 3ZZUA 1RTJB 5CD4A 4U7UD 2Y8YA 3HSJA 3OV7A 2L3MA 4K4SA 2YWKA 3U1NA 1HQ2A 2CIMA 2JVRA 3BKUA 5KT7A 1RT1B 3M9NB 3DRYA 3EVOA 1RTDA 3GFYA 1QE1B 1FRHA 3FCVA 1WHVA 2DRAA 1ZPWX 2YTCA 4B9TA 2HHUA 5H9FK 1RAIB 3HM9A 5KTQA 1HNZJ 4HACB 2ZDPA 5HAOA 2EKNA 2F5GA 2DGQA 2H3AA 3NRBA 1KVJA 1TL1B 2OD4A 1JIHA 4O23A 3W5ZA 4UY8T 4DL0C 2IBOA 2FDNA 2MHNA 5ETLA 1F3FA 1HI1A 1B4SA 2ZUGA 4BC7A 2NS1B 4FYXB 4CM2A 1HNZF 2IAJA 2NLWA 3OFGA 4LR8A 2JEGA 1RHKB 1K8AT 3BGUA 4I56A 1NBEB 3OL8A 1A6LA 2OFHX 4F67A 1JLBA 5DLGA 2DPIA 4J9SA 4FYYB 4URSA 2X3DA 2CKWA 3S01A 2OAUA 3ISNC 4ZVRB 1Q16B 1NHVA 1U6FA 1L3VA 3NBPB 1MNEA 2PD1A 4RNNA 4WIIA 1RWOB 3T1AA 3HHEA 5B09A 1VQ4S 1F9HA 1CPZA 4DV0F 5MLCV 2XO7A 3PO4A 1U6BA 1DFDA 1T0TV 4DLEA 5KT4A 2YQ1A 3VGUA 2MKYA 3RZAA 1DQ8A 4HH1A 2BXJA 3C66A 3PW2A 4P72A 3W9JA 3MM5A 4BBYA 2MY8A 4X66F 3TI0A 1KRPA 1CLFA 2OH2A 2OELA 3ELHA 1T03A 1Z2ZA 3DLLQ 2XWXA 2N4DA 4OZJA 2P2CB 1YKWA 2VFSA 3M8YA 4IOCQ 1KQSR 3IM8A 3TAQA 1WOSA 4LFCJ 2R7OA 1SUQB 1HWJA 3TW0A 4V19X 2BE7D 3Q22A 1FXRA 2VA2A 1HD1A 2G0IA 1N6QA 2GJIA 4AE5A 5F8GA 4DQSA 2W01A 2LXFA 2R8JA 3FMWA 4YR0A 5E41A 1QM9A 3JQKA 3Q8YA 2CPIA 4JI6J 5HBMA 3TUZC 3PR4A 1Q78A 1EJ7L 4RW8A 1KOOA 3L7PA 4I6YA 4I2PB 4U6PA 3MFHA 1V3RA 4M8LA 1CC7A 2FGOA 2EFNA 2V67A 4NLUA 4IH7A 4FBTA 3NWGA 5L9XA 5IWAF 1RCXB 3KJNB 4M5MA 5CQGA 2QGFB 2CRLA 3PYFA 2D68A 3LH2S 2HAFA 1UWBA 5L39A 3HVRA 2I1RA 2CJAA 3NCPA 1DBDA 5J2QB 3I82A 1S9GA 1XR7A 1WDDA 1YRXA 3BSCA 2QEXS 1AA1B 3HSDA 4AXJA 1IR1A 5IT4A 2RS8A 3D4JA 2EFQA 2MTLA 2VG6A 2GNKA 3EVMA 1WC5A 4YS2A 4QIWD 1PJ6A 1U1NA 3IMQJ 3GCWP 4MIBA 4RW4A 3D68A 4BWJA 2WVCA 3VQSA 4F0HA 3C6TB 4M94A 4ID5A 4Y6IA 3KHHA 2CZ9A 3AJ1A 3NKYA 1Y5LB 2EG2A 3D0GE 4ZJQA 2W7OA 4KRWA 3AA8A 4DUZJ 1UJ4A 3H59A 4OZ3A 5F8MA 3VQTA 3CNQP 5C7PA 3M9OB 3PO5A 3FK4A 3W1YC 2E9ZA 2RF2B 5CYQA 1V9OA 2YNGB 3TP2A 1SH3A 4IG0B 2W9BA 3EUNA 4OYPA 3H2LA 2FIUA 2CPGA 3QLHB 2Z2LA 1HNXJ 5AXKA 5EHHA 1S72S 2XY7A 1SJ1A 3MECA 1RK8A 2CJBA 2H5EA 5DDOC 3DMJA 1S49A 4RUAA 2MGZB 1YJ7A 3L09A 4KHPF 2PE8A 2C2MB 5KFUA 1OY6A 3MPVA 4JV5J 1Z1ZA 4OHXA 3KJFB 1LWFB 1S4FA 1Y0HA 3CJKB 3QRPA 1Q86T 2CAJA 2Z57B 2UP1A 2DT9A 4QW8A 1WF2A 3PW5A 3TQEA 2Z2MA 1EP4A 4KHMA 4NLGA 1WC0A 2F4FA 3HFVA 1D8YA 1M1GA 2XMAA 2KYZA 1FDAA 4FVMA 3MM8B 4RUCA 3BSNA 1FDDA 1H2VZ 4NLXA 3ZTPA 4UTGA 1S9GB 2UZAA 1H0HB 2HZAA 3RBEA 1T9UA 1JLEB 4EI2A 1SI9A 5GAHU 4JI3F 2ILYA 4F3QA 1HNXF 1EHWA 2O5DA 2QJ3A 4LF1A 2HHXA 1VYAA 3HULA 4WFNQ 3HF5A 4DV2J 3ITHA 4CH1A 4CH0S 4HR2A 1RDRA 4B3RF 1HNVA 3BV8A 5IXUA 3LPYA 3S8SA 1U1RA 4F4KA 3N6MA 2V4QA 4ED0A 1KFSA 4NXMJ 2AX0A 2MB0B 1ITPA 1YHQS 1FT8A 1RU1A 3W66A 3V5RA 3PCOB 4WFBQ 3CMQA 4V1Ak 4DCPB 2EPIA 2V2KA 3CJRA 1BUXA 4I0WA 5DM7Q 4WK1A 2P6SA 4RL1A 3Q23A 4DMZA 2NZ4A 1JLFA 4XPEA 3AD9C 3KLFB 5DGAA 1RHJB 4F3OA 4FS2A 2YKMA 1UUJA 3DNCA 3AOBA 1KS2A 2G9OA 4RZRA 5E3RA 3PFEA 5HROA 4KB7A 2NXCA 3AA9A 3NS5A 4FXEA 5KFGA 3T6BA 4ALZA 2JLGA 2HVDA 3MEEA 4TYBA 4LFAJ 9ATCB 3GE9A 4DSEA 5IWAJ 4DCOB 1RISA 3LGNA 4DN9A 1JLFB 3LANA 4DPUA 5KFWA 4F3MA 4G3IA 1R8AA 3LP1B 4QW9A 4UOCA 4NYPA 2E5LJ 1VQSA 3N5BA 5KFLA 4LR9A 1KONA 5A2QY 1M0SA 3RAQA 1PIEA 2RU3A 3MR2A 3C16B 4CYUB 2E5GA 3VEBA 3Q89A 5G0RB 4EEYA 1UW9A 1UMJA 1S1VB 4RR5A 1RWWB 5KFDA 1P1TA 2C2KB 4A8MP 1FD2A 4WZMA 4QOTA 4USVA 1MNTA 2Z8QA 1U49A 1R0AB 2HRTA 3PW7A 3BJYA 1RAAB 2J76E 3ET6B 3OR1A 1NU4A 5KFRA 1VJWA 4YB6A 1UJ5A 2XI3A 4OX7A 2YX1A 5KFTA 1ZPVA 3DRXA 5D8HB 3LGHA 1IKVB 1J5OB 1QAYA 3IFEA 2ASYA 5LMNF 3U1LA 3N6NA 2DR7A 3BF4A 2EEYA 4LJMA 5CD4H 2D74B 5KT2A 2QMXA 3GU0A 1UWBB 1UL3A 3VGSA 1W2IA 4I7FA 4A8SA 4ZIVA 4ZVUB 1T11A 2EWHA 2FD2A 2KXFA 3FBCA 2QSWA 4EO8A 2AN7A 4U95A 1HMVA 3VAJA 1QUVA 4OI2A 4DV6J 4ECRA 2I9SA 3RJMB 3K2YA 4N7TA 1HW9A 2FC9A 1X4HA 2L08A 1VQKS 1TKTA 3OR2A 3THPA 1RA7A 1D9AA 1F0XA 2V8VA 5DETA 4D8JA 2FC8A 4F4ZA 2YWHA 2BKPA 3DGPB 4ZJLA 2GJFA 3GPAA 3MTKA 3T1YF 4OYZA 3QT5A 1XNQJ 3FVYA 3HKWA 1H2TZ 1A9NB 1C1BB 2KJWA 4ECZA 2MPUA 3ZTRA 5FLXY 3NGDA 3H42A 4OV6A 2FLOA 4DFJA 1VFJA 4N47A 1GTHA 3A4TA 3KHGA 2VV5A 2M8DB 3B4DA 4R25A 1FI4A 3T5HA 3OSPA 1ZZNA 4Q2MA 4ECQA 1XERA 1XC9A 1EQ0A 2CQGA 1BXNA 2ILZA 2GW8A 3QO9A 2PA3A 4KGXB 2R8HA 3GJRB 5ETOA 3E01B 2J6TA 1X9WA 2UVRA 1SV5B 2VQEJ 1IWAA 2J9EA 2ROGA 3ZTOA 3OXLA 3B4MA 1RT7A 4ZCIA 4K59A 3JAMU 1CJUB 4FXWA 5CYJA 3DRRA 1E6YA 1S76D 1B99A 4YDDB 2LQBA 1FX4A 4MT1A 4RNMA 3B8HA 3MI7X 4KO0A 5ADZA 2NXJA 4IDKB 2W9CA 2KI2A 2KVQE 5HI7A 4K5RA 1C0UB 1H73A 2DRDA 5GAGI 1CJTA 2XGPA 1FWPA 3SZ2A 2R4FA 4OYAA 4B02A 1M5HA 1DTQB 2ZWPA 2M52A 5ETSA 3J81j 2IRXA 2IA6A 4X2BA 5HN0A 3QOQA 2ZHOA 3LJPA 3V2UC 1WEYA 2CQDA 3TWZA 4XTTA 3EM1A 4IUFA 1SUQA 3KJVA 2HSEB 2B6AA 4LBHA 1BMQB 3M2VB 3N28A 3UWTA 2FHJA 4CO2A 3DI6A 2D9OA 4DN0A 8AT1B 3MUVP 1KVIA 1WC1A 5HO4A 4DX5A 1DAXA 1SC1B 1HHSA 3QJJA 1NLAA 4USHA 3R6LB 3HHLD 2GQ2A 1HMVB 1F5AA 1WUUA 1QSLA 3RR7A 1QTNB 2D3UA 3FCWA 5A6PA 1X4EA 5H9FJ 3IR5B 2G4BA 3TUPA 3UO0A 4ZHRB 4LREA 2YNHA 1B0VA 3GSIA 4LSLA 4NLQA 5AE2A 2IVMA 2L9WA 1SJ4P 1UWAA 4NZ6A 3RRKA 4LF8F 2HHWA 5J1EB 4J90A 3GIKA 2W4PA 2YNGA 3R9LA 2KHDA 3B54A 2OPSB 3BREA 3AAWB 3A8IA 2EFVA 4X66J 3GILA 4NMLA 4HYKA 3NNAA 1S97A 3CJ5A 2HFOA 4USKA 2UVVA 1D09B 2R7SA 2HFZA 3IRWP 1FFWB 2DCUB 4OYIA 5KG6A 3T19A 5AJ3J 2VQFF 3K5LA 3J7AN 4K4UA 3RBXA 1BC6A 1L3UA 4BLGA 2VKRA 1FWKA 1M5SA 1R43A 2HLUA 4WYWA 3VAGA 3OL9A 2CADA 1DTQA 2JXGA 3R5AA 4ED3A 4AD6A 1N33F 2C3UA 1T9TA 3G82B 3NMRA 4I6WA 1MMLA 4MMOA 3D67A 4HL9A 2RH3A 2P9EA 4WBFA 4P7VA 3DYAB 3OTCA 1V6HA 4LSNB 5D78A 1JLGA 2XTEA 3IS9A 1S1XA 3SCIE 4YB1P 3TA0A 1ZOTA 3ZNJ1 1BD6A 2WAQD 3G4SS 4RU9A 4DX6A 4DQQA 2RE1A 4E0DA 1KBRA 2CNKB 4Z37A 1FRKA 3E8OA 5IC4B 3CCQS 2AX1A 1RE1B 2L9NA 5CCMA 2AQ4A 4PG5A 5D4PA 3IA0A 1HBOB 3H4DA 2W8KA 4N5SA 4ZVSB 4CZCA 4WXOA 1YJUA 4IH6A 2BOAA 5LXRA 1JLQA 1MYKA 5GADI 1NK4A 3HHDA 3MDFA 2E5JA 2PEHA 3QFHA 1AUDA 1FXLA 1UEVA 1QTGA 4H4OA 1GXLA 3W8GA 5LJ3Y 2KDOA 4DL7A 1NJXA 2KKEA 3ZO7A 5L38A 1NJIT 1FERA 1XBWA 1RAHB 3QSYB 2WTFA 2DHXA 2MKIA 1JJHA 1N34J 3VW4A 2VA3A 1NDKA 5KFYA 2YNFB 2C28A 3UI3A 4U8YA 3J7YI 3QRRA 3MM5B 1LNQA 1V5VA 4R0EA 2HHHJ 1P8GA 4I7FB 4RBUA 2UXDJ 4OX8A 4DL2A 2XMJA 2XSJA 5SUHA 5DG9A 3Q2TC 1MSWD 4B3OA 1QUPA 1QAJA 1MN9A 3CJ4A 1NJWA 4IKAA 1X4GA 2C3OA 2RVJA 1B7FA 4ZP7A 5HQLA 1P9QC 3DRPA 1NKBA 3MR7A 4DG1A 3WC0A 5AE1A 5KFFA 1S9FA 2B3TB 1IQTA 1VR6A 3M6UA 2AJ4A 2AIRB 3Q2SC 2HVEA 4PXCA 4LF5J 2B7CB 2HHHF 1QLNA 2E44A 3G6YA 2NCKL 2HLTA 3DLGB 3WIVA 5HVHA 2D1CA 4K2JA 4G6VB 4PXEA 1N34F 4F2RA 4QYZK 1EARA 3KK2A 4QWDA 2PN6A 2VBYA 3IR7A 2NPFA 3QAEA 4DR3J 4UUXA 1SQGA 4PYAA 4AFFA 3NGRA 1FTRA 1LWFA 2E1CA 1GTEA 1WWHA 3MF5A 3PVXA 1VOMA 4C3MA 3NL0A 2BABA 1KDNA 3A1YG 3TX0A 4WTOB 3KLGB 1T94A 4YUDA 1B64A 3TA2A 3CJQA 2XYPB 3DHXA 1T3OA 3KDNA 4F2SA 1FJGJ 2OPRB 2QA2A 4ECVA 3LP1A 2G1DA 2DGUA 4IOBA 4HVZA 5RUBA 4W90B 2VD3A 4FP9A 3QWPA 4JI5F 2CAXA 3H98A 4KKOB 4Y65A 3R7BB 3AB2B 4R8UA 2DEJA 2LXUA 3MCMA 2V8HA 1RAGB 3PW0A 4NYZA 1RTJA 2C2NA 2G1HA 1U1OA 1N6QB 4HHJA 1S1UB 3AHPA 2R42A 2V94A 1RBOB 3TARA 2A3JA 2CPJA 1VK8A 3FT7A 2HQ3A 4LF2A 4NLTA 4M5DA 3EZOA 4LUBA 2M4MA 4ITSA 2HBRB 3T6JA 4F4AA 2MLZA 1VQOS 1HQUA 3FBBA 3L4BC 1JLQB 2EFPA 4ILRA 1VLOA 4MKBA 1IWGA 3RBZA 4U7UK 4YP3A 3U02A 2W9CB 3EGZA 4CTAA 4X62F 2HMIB 3R27A 1RLCL 2OIHA 3OBIA 4WK3A 4DV3F 3FGVA 3FQKA 4HLBA 5J2QA 4QCLA 1NSPA 2JDJA 2PA8D 4AAIA 1VQ8S 3AQOA 1I5OB 5KFVA 5IZHA 2RDJA 4DV3J 2LYVA 2XZTB 4C3LA 2WRMA 4MFBB 3CO9A 3GTYX 1IQZA 3ITHB 3CD7A 1B28A 2K1RA 3BQ1A 2PIIA 2VDIA 2I6WA 2HFSA 1PAUB 2FY8A 3BR9A 3A12A 5KG7A 1VC0A 1MROA 3AFGA 1S0MA 1OQ6A 4BC9A 1U0HA 3BGLA 3O2IA 4CLLA 2H1YA 4ZPWR 4DHVA 4FNHA 3M7VA 3PRBA 2XM3A 3R5JB 2B56A 4DLGA 2F1FA 3LTOA 1FO1A 3GV8B 1DLOA 1S7IA 1C1BA 3EXCX 1Q8IA 3M30A 4K4ZA 3CJ2A 5BYQA 5LL6d 5KFXA 4J9QA 4ED5A 1WC3A 4Q45A 4PUOA 2N82B 4DR5J 3CVKA 1IBMJ 1KNZA 1O5JA 4KKOA 1EETA 4LF9J 4M1KA 2DHSA 2RUSA 2OPQA 2YNHB 2GCFA 4LQ3A 3M8QA 3QGGA 4LRVA 2AEFA 4PPZA 1BQXA 4ERDA 1C4CA 3PEHA 3CB4A 1S4EA 2MHEA 3MCSA 4JBCA 3EGVA 2KELA 2HRUA 3G87A 1KP6A 4S0MA 3T3FA 1YGYA 2ALYB 4LRAA 1K9MT 1S6OA 3QSIA 3TANA 5AE3A 2J0QD 2R2UA 3CDUA 1VC6A 1OYEA 1UVKA 3IO1A 3ZZYA 3NBPA 4TN2A 2AEJA 4WCEQ 3KKFA 4CP5A 2W9BB 4YB7A 4YDXA 1J5OA 3S1TA 1N36J 4N76A 3PX4A 2N3LA 2RF2A 2W25A 5CYQB 1MG7A 1Q8BA 3HLUA 4I68A 4IG0A 2Z30B 3NG8A 3HVWA 4ZLJA 4LBIA 2CPFA 2ZBPA 2MKKA 3K57A 1OPIA 4EK2A 4OYMA 2RQMA 1F5BA 2B9XA 1UFWA 1X5PA 3L9ZA 2JLEA 4NCGA 3BQ2A 2JHEA 2FHKA 1LW0B 2WVFA 1S6QB 3HT3A 4PWDB 1RTZA 3GXQA 3AX5A 3GG1A 2W8LA 3CCMS 1T3NA 3GR1A 4FF2A 1BWVA 1R27B 4A8KA 3VAHA 3F0NA 3DLHA 1LKZA 2BANB 3FC9A 4P2XA 2C1EB 4PCQA 4A4JA 2VG6B 1DARA 1M1HA 1Z4UA 2DKOB 3RGIA 5BR8J 3J80U 3C3LA 2G0CA 3ILLA 1BE4A 2BW2A 2ZDOA 2G2ZA 4X64J 3G8TA 1XNQF 2GHPA 2DNYA 1EQMA 2BJ1A 4RU2A 3OFEA 1HLWA 5LXYA 1U6ZA 1SJRA 3QZ8A 4DV5J 1KD1T 2LCWA 1JWWA 3WBZA 5HBMB 3VAKA 4AL6A 4DPWA 2QLBB 3DOLA 3PX0A 1M1KT 1Q82T 4O4RA 2AW0A 3JSMB 3EE3A 2ZH8A 4KQZA 3JSBA 4GC6A 2UUCF 3SCJE 1RTHA 4J9NA 3N01A 2Z0GA 1ZM3A 1TV6A 2HNDA 5HMWA 3TZXA 3RAMA 1V3SA 4E98A 1WORA 5IQQA 3LWMA 1B70B 1FEHA 3OHAA 5KG1A 4DL5A 2VZ9A 3MURP 3CF5Q 3BDPA 1T9YA 4QPXA 2DH9A 4IG3A 4MTPA 3HP6A 4P2FA 5LT5A 2LP4A 2UXCJ 2M5YA 3VAIA 1F2GA 2V4JB 2QMWA 2F9DA 1E6VA 5F8NA 1S6UA 2WW8A 3PNIA 4L3KA 2Z58B 2AHOB 4P74A 5T41A 4Y00A 5KAKA 2MGZA 1SL0A 2I2YA 4FF4A 3K0JA 2QIFA 1NH7A 1S1XB 1UKUA 2IDEA 4C3KA 3HHLB 2MXYA 2DNLA 1S0VA 2W2QP 2ZZNA 2P8IA 1Q16A 1Q53A 3BKFA 2PO4A 3OLAA 3A8JA 3THVA 3H25A 2MQMA 4A46A 3WC2A 1UVMA 3VCDA 4IFYA 3VR1A 2HVZA 1DQ9A 4WWSA 1KN6A 4M95A 2YXLA 1UEUA 4HI2A 1JMTA 5DDPC 4NEYA 1U1QA 5F8HA 4DU8A 2V1SA 1MW7A 4JI5J 2KYXA 3HVTB 3FKBA 3Q83A 3PDNA 4DFPA 2R8KA 1U2FA 2QG9B 1JLBB 1OY8A 3D7SB 1HPZB 1HHTP 3AY0A 4NXNF 3OR1B 5FDLB 1UFLA 3P5TL 2HHTA 3CEDA 4ZP8A 2EC0A 4J9VA 2KB2A 4PWDA 4DX7A 3ZXWA 2XZDB 1SPBP 4LSLB 3QMQA 5K14B 3Q8PB 2BJ8A 2N4CA 4C11A 3IBFB 5IT9U 2H9ZA 4JI4F 4FYVB 1DQAA 1ACMB 4NZ0A 3CDAA 3MMAA 2ALZA 2YKOA 2OD6A 5D6GA 2V9WA 2V6AA 1GMVA 5HVGA 3FBFA 3IWLA 2XLJA 4I2PA 4C8NA 4EBDA 1URNA 2CVIA 2A1BA 3KK3B 1SJFA 4ZHRA 3T5LA 4UOFA 5IM0A 5D4NA 2KXHA 2XHWA 3OW2R 1N56A 1NRKA 2V68A 1N0UA 2CPZA 3BO4A 2ZWOA 2J8SA 2J8AA 2BMBA 2KO1A 2D69A 4YN3B 2ZOMA 1QE1A 4C0OC 2E1RA 5ETRA 2V8PA 2ZNZA 3VGVA 2WBMA 2WZ1A 5D0HA 3R97A 3W7BA 2B9YA 2IC3A 2VBXA 2YKQA 2C2EA 3N79A 2UXDF 3QT8A 1SKWA 1KQFB 4QZVB 2ZFHA 4OZNA 2BYCA 3C6TA 4C0BA 3T1YJ 2BJ9A 3ISND 3ILIA 4YB5A 3HMJG 1RWVB 3R2CJ 3D1QA 1TL5A 3MEGA 5THWA 4DV4J 3R5CA 1OY9A 5K8MA 2K29A 5I3QA 1VIXA 3HXMA 2FQQB 2HPUA 4LF7F 2ZH1A 3I4PA 2ZOGA 4NRUA 4L75A 3GSDA 3PHEA 3QATA 4Q8FA 1S59A 1HBUA 4ME7E 2WBRA 4U67Q 1X9SA 4QIFA 3JXOA 2VJVA 4B3SF 1A7GE 1RT7B 2VUGA 2ZBRA 2BZ2A 4DJBA 2UUAJ 2O1PA 5DG7A 4LF6J 1CG2A 1VQPS 4NI2B 2F65A 4C8YA 1NLKL 3MM7B 4I67A 1YVFA 2KM8C 2K5JA 5D4LA 2FJVA 2IIHA 1N0VC 3I31A 4N8NA 4WP3A 1NHUA 5DG8A 1HFEL 3OQ2A 4OX9J 3LP0B 3V4IB 3QIPA 1TAQA 3SCKE 2CYYA 2VASA 3OJUA 1UPMB 3KLEB 4DR7F 1SV5A 1FDNA 1L3TA 1VJQA 3FBEA 2QL9B 4NCGB 2BUNA 2GJ2A 4RW7B 5HJYA 1VIOA 2DNGA 2VIHA 1TVRB 4F04B 2HBYB 3MM8A 1VHFA 4O4GB 4NLRA 4C2MA 3MPWA 3KHLA 1FRLA 3RAXA 4JI4J 1CSJA 2E5IA 2VQEF 2DPJA 4WP8A 3UD4P 4WXWA 3AD8C 4LIWA 1FF2A 1SC4B 4M63A 3UDCA 2B4UA 3HHKA 1U1MA 1TUWA 1N5VA 4AQYF 3ILOA 3BN7A 3V6DA 1PYTA 1FJEB 5HMZA 2MJUA 2QA4S 5JVGQ 4ZJOA 2FHJD 1RTDB 3J80Y 2O66A 4Y2AA 3KG1A 1RT1A 3NGTA 1PSDA 4DPOA 2FJWA 2OJ3A 2H4YB 2BJ3A 3P45B 1YSJA 2ZNYA 1X7VA 1VRUA 5A76A 2FJBB 4TLRA 3M05A 2CPXA 4RNFA 5KFMA 1U1PA 2JXIA 4UUWA 2AZ3A 1EAYC 3KMQA 2WONA 2OEMA 3QGHA 5CA5A 1TFYA 3JSRA 4ETZA 3DM2A 5HQ8A 2J0SD 4QWAA 5D15A 1R6VA 1Y00A 1EKRA 2C42A 2HNYB 4C11B 4CYUA 2EC2A 2CA9A 5M2UA 1U1LA 4ICLB 4JI0F 5A8WB 1UA0A 2XO6A 3MR5A 5DM6Q 2YH1A 1MWQA 3MWBA 3IR7B 4OV1A 3W2WA 3LAKA 1TR0A 2V2QA 2KRBA 3D0HE 1TL1A 4Z7YA 3S7RA 1PBAA 1VHIA 3TAMB 1W2BR 5D3GA 3MUMP 3GZ7A 2UVWA 2GAHC 2EXUA 2Y0BB 3DLJA 3DXSX 3IGNA 2Z2ZA 2F63A 4B3RJ 4KT0C 2H51B 2UXCF 3GCXP 4KO0B 3ZZ0A 1U25A 1XIQA 4H4KC 3ISZA 2KT3A 1TL4A 1XMQF 3DDIA 3KUGA 2MKCA 3HSZA 3G71S 1X4DA 3DU6A 4IFYB 2CPHA 4USIA 4CLKA 2ADLA 1FE0A 1MLAA 2QN6B 3I9ZA 5B7WA 4JI8F 2DGXA 5B0CA 2J6SA 5G0RA 2XS2A 3EX7B 3V6JA 2Q2KA 1WHWA 2MZSA 4WE1B 3GQCA 3OD2A 2GAGC 5B0FA 4ZP6A 4KPCA 2GC8A 5DZ6A 2E1PA 2EFOA 4M5NA 3CIMA 1GX5A 3H5YA 3ILJA 5D0GA 2D3ZA 2NZCA 2QA1A 2ASLA 4V19J 3NCRA 2BQ3A 1RT3B 2BJ7A 4ZK7M 5HATA 1ZTWA 5E3AA 2DO0A 3H5SA 4C6AA 2H5IB 4NWBA 5KFPA 4DR6F 2ATCB 5KFOA 2RBFA 2CPYA 1S0OA 5A8KA 5F8IA 1FVQA 2LLZA 4CNZA 4IRKA 3KMSA 3I5BA 4X4UA 1X4FA 2XEXA 4JI7J 5CYMB 2DNMA 3R5DA 1VLYA 2A0FB 2GHWA 4FS1A 4QQBA 5F3ZA 1RWXB 3TUIC 4WFYA 3JSMA 1J5EJ 3JYTA 3UD3P 2JEJA 1S77D 6FDRA 5ETNA 4QYRA 3UCZP 3EMTA 5FJ4A 4FPIA 1K44A 4JI3J 2W7PA 1Q0NA 2W4DA 3US5A 4CNYA 4L3NA 2H65B 3M8SA 8ATCB 5K8OA 3G96A 1NEEA 3NGUA 4OZLA 3CUNA 3MR3A 1IKXB 2VF3A 2KFYA 3W60A 4NLPA 2M70A 2RRNA 1TAUA 1T9VA 3D66A 1RGVA 2EBGA 2EK6A 4M5JA 2ADCA 3MPUB 5E3PA 1S5ZA 1WDTA 4DZ6A 3VEAA 3D6TB 1QTMA 1RT5B 2JH3A 2KHCA 1DURA 1NK7A 1NKEA 4J5OA 2IAJB 5I3UB 1X60A 2QE5A 1KHVA 3VZHA 2CG4A 2J7KA 2EFGA 3DLEA 3WHIA 2OEJA 3T5KA 4DOZA 3P6YC 3AOCA 1XN9A 1BQMB 3MMJA 5GAGU 3OSNA 1FRIA 1HKAA 1KOHA 1S1VA 2QL5B 3I4HX 2EW9A 1CJVA 4PPDA 2XNRA 2O67A 1KTVA 1LWCA 1YQHA 4ZLLA 1XMQJ 1YITS 1HI8A 1NNDA 2N3OA 5C24B 2X1FA 5IT9Y 3FEZA 4PQUA 2CQ4A 4OYXA 1HI0P 4CLWA 5HMYA 1TZ0A 4Y2IA 4F4XA 4C8OA 3UVJB 1GAOA 4H4KA 5A8RA 1ZAXA 2JEFA 1CEZA 3UR3C 4WKYA 1ZETA 3GJQB 2VBWA 1TMJA 3BGFA 2K7JA 4L74A 4A8QA 2D7SA 4O4GA 3ADAC 4CRJA 1YJ9S 4A8FA 3KUEA 4NE9C 1HNWJ 3PJXA 1NO8A 1QSYA 1LXJA 2Z56B 1AFJA 4AYBD 2J5AA 1F2HA 4GKKJ 1HBOA 2RAQA 3HDSA 4Y28C 2VG5B 2PSZA 3QJPA 1NB2A 2J6UA 4M5IA 4O3NA 3V4IA 3R1HA 1RT4A 1IR2A 3R5BA 3HKZD 2R2SA 3QQCD 4MK8A 4F7VA 4ZVQB 2E7VA 1VBXA 3LP2A 4X4VA 2IMWP 2ZD1A 1Y4ZB 1TELA 2DNOA 3FJ2A 3POTB 2OTLS 3HPOA 3CDBA 2V50A 3I32A 4CLYA 2J0WA 3PACA 1GMWA 3UDLA 2EVZA 1TKXB 1KLNA 1JB0C 3SYZA 3I0SB 2YKNA 1YJNS 3SV3A 1TK8A 2RHQB 4LRCA 1WNEA 2OGUA 2W2PP 3KG4A 3DM2B 1WF1A 2MQNA 4TY8B 4YHHJ 2X7IA 4J9MA 1X8DA 1OSCA 4WJBA 4X4SA 4GO5X 2WONB 3HT0A 2YKAA 4R0JA 4OLOA 2C3MA 4BWMA 2VDHA 4ZVFA 4OX9F 1Q95G 5KG4A 4CTAB 3CMAS 2HMIA 4XPCA 4WTYA 3FDSA 1RT2A 5KFNA 2IBKA 2AV5A 2OEKA 1WI8A 3NNEA 4HI1A 4U96A 3K59A 3NGKA 3R1LA 4MAKA 1WOOA 1NKCA 3PY8A 3A3PB 4OYBA 1S57A 3KLHA 1X0FA 3WX4A 1X5SA 2XNQA 2IC3B 2CXEA 3B78A 5CZXA 3O3LA 4URGA 3LAMA 4X65F 4B3SJ 3RB6A 2DB1A 2V34A 4KSEB 4JI7F 4ED7A 3M8PA 5F8LA 4B17A 1IBLF 4DX8H 3AJ2A 2R7WA 4C97A 4DV4F 1TK0A 1T7PA 3E2EA 2HW3A 4XK8C 1NAQA 3CCTA 1OG7A 2CJ9A 2KT5A 3D1OA 4DPXA 2NREA 3I9V9 2XZ2A 1UFKA 3RRHA 3W5XA 3GWCA 3D5MA 3IG1A 3QLHA 4JP8A 1JXLA 3VAMA 1H3DA 2BQUA 4LF5F 4CLZA 3SDEB 4ATNA 1O8BA 2ABYA 5F9LA 2HBQB 3CJ3A 2FJDB 2D9PA 2V2ZA 3M6XA 1U9PA 4Q2LA 3W62A 5CABA 3V6KA 1Q8KA 3SSSA 4J9OA 4GKJJ 1NDLA 2HWHA 1IBLJ 4I69A 3K5MA 4DSFA 1QJHA 1TKXA 3CDEA 4G1QB 5LJ5Y 4CLFA 3C14B 3PZPA 4C8KA 1PYSB 2CFXA 2MYFA 3CCWA 4Z7CA 4X65J 4Q5VA 2AJFE 2HWTA 3V4MA 2XY5A 4WF9Q 1FHTA 5I3PA 3DOMA 3JB9k 4WPAA 1YZ6A 5FDLA 1ARQA 3MAHA 3MD1A 3PXGa 1U45A 3NNCA 2LEBA 1U47A 1A0OB 2BA9A 2LDIA 1GQEA 3ET6A 4OI1A 2HZVA 1RLDA 4DUTA 4M5HA 2KN4A 3H2VE 4CLTA 3K17A 4ZVPB 1RP5A 1Q4RA 2BNWA 1VQLS 3W9HA 4YOEA 4PXBA 3J7A1 1SXLA 3CCZA 4U7CA 3UNGC 2HZCA 1XWLA 2BM0A 2ROEA 4GVBA 4JI2F 2KL8A 3HFKA 3GFHA 5KFSA 3OUYB 5HL7Q 3QBCA 5D0EA 2KVIA 2MLYA 3NXZA 3SSRA 4CDIA 2B5JB 5DDQC 5LSLA 4N56A 1HYSB 4K5SA 3IRXA 1GEHA 3V6HA 3DOKB 1RAEB 4ZDNA 4RO0A 3I56S 4OI0A 2HAIA 2I5JB 2ZH6A 1DHMA 3DRSB 4ED4A 2OTJS 3HFZB 2OPPB 3BSAA 4H54A 5M2PA 3TVYA 3NS6A 3AH6A 1FKPB 2SXLA 3CCVS 1HNIA 2DXFA 2EK1A 2FYXA 2YWWA 3FSXA 4I64A 4UW2A 5J2MB 4IOAQ 5EN1A 5H1SV 1APSA 3TZZA 5B0BA 2PGCA 1CS4A 5AJ3F 5I42A 3KK1B 3DDKA 2DNRA 2CJYB 2L48A 3NOCA 1FX2A 2HNZA 1J27A 2M8HA 3DXBA 4N77A 3AX3A 4N8OA 5DS7A 5E33A 3EGNA 5B0EA 4O3PA 5GMKa 1NPKA 4IRCA 3ZC4A 3T5JA 2PFDA 1NJYA 2WB1D 1T05B 3EZ5A 3SEOA 2X1GA 3CD5A 5GAEI 2HWIA 1S0NA 2AYMA 3G86A 2WHOA 2E5HA 2V2VA 2V0NA 4KTQA 4EBEA 1ZA1B 2Y0SD 2C22A 4OJ3A 2XTDA 2IM0A 4ED1A 1CVJA 4P6QA 5KT5A 1KR4A 1TL7A 1SC3B 3VZIA 4H4MA 4J9LA 4DV5F 2UUBJ 2O01C 1S99A 3T9ZA 2UUTA 4IQXA 1N32F 1JKHB 1QSSA 1PGZA 4JB8B 1MU2A 1D1UA 2RDDA 5CH7B 1WG5A 3HHLC 4RUHA 4LF7J 4WKRA 1EP4B 5IT0A 4ES1A 2DTJA 5GAHI 1SCJB 1HWLA 1IUJA 1XMOF 4O3OA 1FJ7A 3BGRA 4OMFG 3HZEA 5L1KA 1RABB 2XTJP 1HR0F 1VQ5S 1BDVA 2PDAA 3ZFVA 1KKHA 3MMBB 1NB7A 1NJZA 2FJEB 3RTVA 1U8SA 3N0VA 2R2TA 1NDPA 3J81Y 3OUYA 5DQIA 2JEIA 2Q3PA 3M32A 4DPTA 4BS2A 1R0BG 3C8YA 3JQJA 1VMBA 2JOQA 3JQMA 3M1VB 4CT8A 4B9NA 4ECUA 4DPYA 3DOLB 4CCHA 1VISA 1BDTA 4USUA 5KG3A 4YEAA 1M5VC 1AYEA 1XR5A 4A48A 4PG6A 4F0MA 3H20A 4KJIA 2JFKA 2LDYA 1HIYA 1ZM4A 4BCAA 2QO3A 4HHHA 4JYAJ 4RPFA 4QU7A 2K3KA 1AZSA 4B3TJ 3EGWB 1U26A 3R6GB 5D3GB 3TVKA 2XLIA 4PG4A 2UU9J 4DSKA 2DH7A 3AODA 3NWRA 3UD5A 2QV6A 2DNHA 1FNMA 4DQPA 4DQIA 2RILA 3LW5C 1HWIA 2BRLA 4KGKA 3DC2A 3N5FA 3ZZZA 4ZCLA 1GNKA 3D54A 3CE8A 2C2DA 1VC5A 2F9JA 2HNYA 1E6YB 5J2NB 4DSLA 1JLEA 1RZMA 2GGPB 4ZPAA 3GONA 4TY9A 1YJWS 1VQYA 3I96A 2W2MP 2YX7A 2KXNB 1TKZB 3LOUA 3OVAA 2COLA 2YVSA 2ACMA 3DLKB 3G2XA 4AXIA 4CO5A 2H48B 3D28A 3FZBA 2QA4G 1N8RT 4Y3CA 1L3SA 1SJQA 1ULRA 1WACA 1VBKA 5J2PB 5KT6A 4K4VA 2OSRA 1MWZA 2CVEA 3I0RA 4GC7A 2DRBA 1D9FA 5HQMA 3MOZA 2DY1A 4OI4A 1AB8A 3M8RA 1RAJA 2W2NP 1FJCA 1WG4A 1X5TA 1HWKA 2EBEA 2H5JB 2MLXA 3KXDA 5KG2A 4DR5F 2BJDA 1IKWB 2ZE2A 3ONQA 2VONA 4TLQA 2CQHA 3T9NA 2ZHAA 3WDOA 2DYAA 2VFTA 3UDVA 3O44A 4MKYA 2E1AA 5EWGA 4YY3J 2B9WA 3PW4A 3CXCR 2GVDB 2CQ0A 2XSFA 2VPZB 5FIIA 2NXNA 4KHPJ 1NH8A 5GMDA 2HURA 1PYOB 1RT2B 3B82A 3C15B 3DMJB 3P96A 2M3DA 4CIOA 1IXKA 2HS3A 2I8EA 2ZKUA 1FNXH 4UY85 1U0HB 3W2VA 3AX2A 2ZBQA 2F8MA 4ZPVR 2B0GA 1XJWB 5CXTA 2PEBA 2DXDA 1SIZA 2BVZA 2W7AA 3BH6B 3HX9A 4KFBB 4E2FB 1F3VA 3MM6A 5KFAA 5FLXU 1P94A 3NCQA 1CULA 3R7NB 3LQVA 2PI4A 4MFBA 2HK2A 2B4VA 3MUTP 4LFBJ 2FLLA 1YDLA 4USTA 1M5KC 3TNVA 1GH8A 2E9TA 1M90T 2IM1A 1ZS6A 2A2DA 4OJ1A 4P2SA 1AZSB 5DQGA
chains in the Genus database with same CATH topology
2ZM6F 5A6WA 2HHPA 5L1JA 3L3CA 1Q7YT 5I42B 2F7VA 1L3KA 2XMVA 1K1SA 3IC1A 1UVIA 4AUKA 1H98A 5ITHA 3RYLA 4O3RA 2OPPA 3MXHP 3MD3A 3M1VA 2ROPA 5EDWA 2FHOB 2IFXA 3HO1A 1FJGF 2WB4A 3CIZA 2OO4A 5F9NA 2FY1A 1UW4A 1YTYA 1HBNA 1YG0A 2RNEA 2IVFB 3P3DA 1WHXA 4WYLA 2XMTA 1WG1A 3PV8A 1RI7A 3O5TB 1N36F 3R3TA 5C24A 1U7LA 4ILLA 5C5JA 2QSFA 4IFVA 1TL3A 1S1WB 4RWWA 5LSOA 1VRTB 4JI1F 4JV1A 1URNA 4J37A 1S6PB 5T7LA 4ED6A 1BQMA 4ZA1A 1TQLA 3QWUA 2A2BA 4ZKAA 5LMUF 4RNHA 3PM9A 1OSDA 4ID8A 3U1MA 3SFUA 2VKZG 1D3WA 1S1TB 2HS0A 2Q6BA 2OSQA 3CGIA 3M9MB 4OZ1A 2CQ3A 4EU0A 2V4RA 2V8DA 2MQPA 2P9GA 4LF9F 5BJRA 3U7JA 1X4BA 2F3JA 2J7UA 5B08A 4B08A 3M2UB 1IR0A 3G5OA 1R89A 4TKTA 2ZITA 1XTZA 4CH7A 5L9NA 3OVSA 2J9DA 1C1CB 5F0WA 5KFZA 4WFXA 4U9RA 4CT9A 1KEKA 3MMCA 3PX6A 4QBUA 3BQ0A 2V5HG 2K7KA 3IWXA 3NAIA 1RKJA 1DTTB 3CCLS 3CPWR 2RQKA 2YNIA 3BZQA 2GX8A 2ZBIA 4KR0B 1G3OA 3HVAA 3CULA 1VRUB 1FD8A 3QYYA 2XGQA 1VQNS 2K3IA 2ZH9A 2XMMA 3CD0A 2XSJB 2JFDA 3H5UA 3BO3A 3HHLA 1VQ9S 1H6KX 2KRRA 4F25A 2GHVC 2YWGA 4KGMA 5D77A 2DNZA 2E7XA 4J9RA 1C0TB 2AYEA 4K50A 5J1EA 4WFZA 1WEXA 1AFIA 4LIRA 4DUZF 4ZPBA 1M5VC 5L1LA 4EGLA 1N4LA 4TYAA 4DSJA 1B0TA 1YJTA 1C0TA 3CDWA 1FKPA 2MZRA 2P5VA 1QVGR 2OLWA 3SMZA 3VF0B 2ZBCA 4RWXA 1KLMA 5C42B 3THTA 3LALA 1Q8LA 2JBVA 2ZJPQ 1RKIA 1R3NA 3IAM9 2LEAA 2DGSA 3FRYA 4OFZA 3RB0A 4C8LA 1SQEA 2Q43A 3OXFA 4ZPDA 2Q79A 3G9CA 3OL7A 3GMGA 2Y1JA 5CCLA 1FKAF 1JLGB <