4NRWA

Mvnei1-g86d
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
285
structure length
285
Chain Sequence
PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTDMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genome and cancer single nucleotide polymorphisms of the human NEIL1 DNA glycosylase: Activity, structure, and the effect of editing.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase, lyase/dna
molecule keywords formamidopyrimidine-DNA glycosylase
total genus 68
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2013-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nrwA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 4nrwA01
5ITYA 1HNZM 4LF8M 4DV1M 4GKKM 3T1YM 1KFVA 4MB7A 3GQ3A 3U6MA 5BR8M 4DR1M 4NXMM 5LMUM 2UUBM 2ZBKB 3SBJA 2OPFA 4CISA 4B3RM 1R2ZA 4DR3M 1N32M 3OTOM 4G4RA 4DR6M 4X62M 3U6SA 3W0FA 2EA0A 4B3MM 5LMNM 3J81S 2F5NA 1TDHA 3GPUA 4DR2M 3U6QA 3J80S 4DV6M 4OX9M 3U6EA 3SAWA 4JI6M 3SAUA 4LF9M 2UU9M 3U6OA 1IBLM 1HR0M 1I94M 1L1ZA 2UXBM 5IWAM 4JI0M 4PDGA 4JI4M 4DV2M 1Z59A 3GP1A 2F5QA 1Q3BA 3JR4A 3DOAA 3A46A 2VQFM 3GO8A 4JI3M 2HKJA 3GPXA 4PD2A 4X64M 3T1HM 2F4VM 2UXDM 1R2YA 4GKJM 4DV5M 1Z5BA 1L2DA 4JI1M 3GQ4A 1IBMM 3U6CA 3J7AS 3TWLA 2UUAM 4G4QA 4DV7M 5ITUA 3A42A 3U6LA 3A45A 3GPPA 3GPYA 4G4NA 1L2CA 2XZUA 4LF4M 2VQEM 4LFCM 1L2BA 4X66M 1K82A 1FJGM 4DV4M 4B3TM 2XZFA 1K3WA 4LF5M 1HNXM 3SARA 1XNRM 4NRVA 3VK8A 1N36M 5ITQA 4JI8M 1N33M 5A2QS 4PDIA 2F5PA 4JI2M 2F5SA 4G4OA 2OQ4A 3U6PA 2ZM6M 2F5OA 4NXNM 3TWMA 4KHPM 4DUZM 2Q2EB 1HNWM 4PCZA 3SASA 3JAMS 1Q39A 1XNQM 3JR5A 4B3SM 5ITRA 4NRWA 4LF6M 1Z5AA 1L1TA 3SATA 1XMOM 1XMQM 1K3XA 4ITQA 1Z5CA 3C58A 3GQ5A 4JYAM 4X65M 3SAVA 4DR5M 5FLXS 4DV0M 4LFBM 4LF7M 1MX0A 4DR7M 1PJIA 4K0KM 1XC8A 3U6DA 1N34M 2E5LM 1EE8A 4YY3M 4DUYM 4JV5M 4YHHM 1J5EM 1IBKM 2UUCM 4DR4M 3TWKA 1MU5A 1TDZA 5ITTA 4JI7M 5IT9S 4DV3M 2UXCM 5ITXA 1PJJA 2HHHM 1Q3CA 5ITXE 4AQYM 3VK7A 1PM5A 4JI5M 4LFAM 1NNJA
chains in the Genus database with same CATH superfamily
2KXEA 3KW6A 4QHTA 5F3WA 4QHSA 2DWLA 1SXJA 1KFVA 2C9CA 3FTEA 3LCUA 4NOOB 1HQYE 1QQWA 2QPAA 2D7EA 1L8QA 4DR1M 4OU7A 2C98A 4GHAA 2LXEA 4B7GA 2QBYB 4FCVA 4QOSA 2KZUA 1R2ZA 1YE9A 4GKJM 3HHXA 4G4RA 4DR6M 4X62M 3U6SA 1E9RA 3W0FA 3J81S 3AOEA 5GKNA 1OFIA 1OIPA 4DR2M 3U6QA 3J80S 4DV6M 4OX9M 3D8BA 4IBCA 2MROB 3T38A 4LCBA 5KQDA 4MGHA 4GITA 1WHCA 1NNUC 3UGJA 1IBLM 2UXBM 2QSFX 4CHTB 2CRUA 1TF0B 1KSFX 1NV9A 1HJPA 1Q3BA 3K8ZA 2KNAA 4Z6YA 2ZANA 1SXJC 3K9PA 4D82A 2N35A 3GRRA 1VEGA 4JI3M 3SFZA 2KW0A 2L4FA 4AG6A 1GL6A 4X64M 3GPXA 3T1HM 2EO2A 1DGHB 2OO9A 2Z4RA 2K47A 3I01M 1MJGM 2LTUA 3HU3A 3L2AA 1W5TA 2VDBB 1E9SA 4I5SA 4IBDA 3VDUA 1QAQA 5DYIA 7CATA 2DXIA 1IBMM 4AKHA 4LJ4A 3U6CA 1J7KA 3H4JA 4MM3B 3TWLA 4II7A 1GLNA 3L29A 2ZAMA 1XWIA 1R5LA 2DI0A 4IBBA 3GPYA 3T15A 4TUWA 3L28A 2X49A 4X66M 3U60A 4FWHA 1FJGM 4IJEA 3TL4X 1X37A 2ZTCA 2DWNA 4IBIA 3KFUG 4FCTA 1ZAEA 1GO5A 1GL7A 3ZH9B 3FTFA 2V1CA 4ANRA 3VKGA 1WGLA 1N36M 2WZJA 4LRSA 1N33M 1D0MA 2JZ0A 4AG5A 3GLGB 2LVPC 2O25A 5FSWA 5EXXA 3UMMA 4HLQA 4F2LA 1V34A 3U61B 1E32A 4LJ8A 2JY5A 3KOXE 2F5SA 4G4OA 3NWLA 4XGIA 4FCWA 2L09A 3TWMA 3R8FA 2KRUA 3LCVB 5KPZA 1Y8GA 4DUZM 4QNRA 3KVWA 3SASA 1Q39A 2ERCA 3Q8GA 3GLHB 5FTKA 2X8AA 3QYBA 5C1BA 4LF6M 1N75A 1L1TA 3CF2A 1ORYB 4M0DA 1K3XA 1N77A 2B3TA 2LHGA 3VDPA 4JYAM 2H1RA 4JXJA 5FLXS 3ZQJA 2C5RA 2KEBA 4LF7M 1MX0A 4K0KM 1PJIA 1IM2A 3FUUA 2HL7A 1N34M 1LTMA 3AOEC 5EP1A 4IBGA 3I04M 1PJQA 1J5EM 4QOZC 2O01F 4L6V6 4UN2B 4DV5M 1HT1E 3TWKA 3GRVA 1TGUA 1YUBA 2R44A 4LY6A 4LGMA 3SMPA 3LMMA 4B08A 2JUJA 4M0WA 1VQ1A 4LF8M 4GKKM 2MR9A 4FWGA 4MGIE 5E26A 2L7HA 3U5ZA 3KSJA 2EUCA 2R4EA 4LZZA 3WHLA 1GJSA 3MK6A 2W82A 3TE6A 3U6MA 2RGOA 2EKFA 2CHVA 4LJ9A 5BR8M 1S3SA 2I7NA 5LMUM 2ZBKB 4HL4A 2OPFA 3SBJA 2CV2A 2QBYA 4CISA 2CP8A 1N32M 4L16A 2I7PA 4MGKE 1GKIA 2YR0A 1TH4A 1QANA 1G71A 5LMNM 4F1IA 2F5NA 3LVVA 1G3IA 3E9SA 4M9ZA 4HEOA 4JI6M 2CUZA 2VF8A 4W5WA 4OVZB 2QZ4A 3M6AA 1HR0M 2DZNB 4MH0E 5FTJA 3HJSA 4AKGA 1QZEA 2JY6B 1W5SA 4WP2A 3GP1A 5KQ8A 3JR4A 3FRHA 3DOAA 3A46A 3ILKA 3PFIA 4A3VB 1XXHE 2DZOB 2XSZD 3GO8A 2LNHC 2HKJA 3KXEC 1VG5A 3D8LA 2X4AA 1NJGA 2CEAA 2R45A 3K92A 2F4VM 3PXGA 1PM5A 5L8RF 2DKLA 1Z5BA 4GEWA 4KODA 1L2DA 3L26A 5EP4A 1D0KA 2CHGA 3A98B 5EQTA 2G5GX 2VF7A 1UFZA 1VDDA 2QNJA 4QNMA 1IXSB 5DFLA 3GQ4A 4Y28F 2WSCF 4DV7M 5C18A 3A42A 3GPPA 2CV1A 1H6UA 5IREB 1JR3A 2BNKA 2Y21A 3C3EA 1TTEA 2KDLA 4DV4M 2KNVA 4NC6A 2XZFA 1K3WA 4GC5A 4RF0A 5FTLA 2CHQA 3FYCA 3VK8A 3FKEA 2ZTDA 4WW0A 5ITQA 4JI8M 2DAEA 2Y0TA 3GLGE 2JWSA 3C3DA 3C9PA 2JXNA 1ZV1A 3U61A 2HWJA 4PDIA 1GJTA 3PNYA 2F5PA 3Q8XA 1CUKA 4L15A 1YLAA 4S12A 3I4YA 2OQ4A 4NXNM 1OJLA 1V92A 2D7HA 2M5ZA 3L25A 4KHPM 1IY2A 2DWMA 2QENA 2LH0A 1NSFA 3JAMS 2EJSA 3HJ8A 1T6OA 3GLHE 1XNQM 2KNZA 5ITRA 2P5TA 4P17A 3R9XB 2L6OA 3IG8A 4WURA 3THGA 1QUSA 1TR8A 1XMOM 3HWSA 2KHHA 3MJ5A 3HKPA 3TQSA 3EIEA 1TH2A 3C58A 1DO2A 4GC9A 1ZQ9A 2C96A 3KOYE 1G41A 2RRUA 3FYDA 4AZFA 2FH0A 3MMPA 3AOGA 4REZA 4DR7M 2DHRA 1XXHB 3FUXA 2ZAOA 3I4VA 4YY3M 3AFHA 5EJCA 1NHWC 3FE3A 3H4MA 4P16A 1D0LA 1IBKM 1OTRA 4LG2A 1QYRA 1MU5A 4L78A 1TDZA 5ITXA 1PJJA 2FNAA 2APLA 4RF1A 3UZUA 5ITXE 3VLFB 2D7GA 3E4RA 4LRTA 4I8OA 2L4EA 2Z7JA 1GABA 2YNMD 2RGHA 2BJWA 4MB7A 5KPRA 1DGBA 4GMQA 2C99A 3LQRA 2O5RA 3GQ3A 2JY8A 3HHYA 1DV0A 1E94E 3M7GA 3HZJA 3K9OA 1G4AE 1NV8A 3B7QA 4NL4H 2UUBM 1YSYA 4B3RM 1UM8A 2LVAA 2J7OA 2K0BX 4IBJA 5FTNA 4DR3M 3OTOM 2DVWB 4DBGB 1WXQA 2J7NA 4AW4A 2R62A 2JY7A 3FTDA 1G8PA 3LQQA 4LZJA 1IN5A 3NBXX 5EXPA 1XB2B 3IECA 1V33A 3UJNA 2CFOA 2V6ZM 2H5XA 4PT5A 3U6EA 4Q7JA 1XXHA 4B7FA 2UU9M 2DZLA 3PNVA 1NVMA 3KP1E 2CV0A 3AKZA 2FOIC 3GLIA 1OFHA 3B9PA 3FTCA 2XSZA 4KT0F 3GLIE 3KSXA 2VQFM 4XBOA 3MHVC 2XGNA 2HCBA 2LVQD 2OOAA 4LJAA 2L2DA 4IBFA 1DO0A 2AHMA 3CGWA 3LVWA 2UXDM 2M60A 2RKOA 3IG5A 3KS8A 3QWLA 4LJ6A 1JR3E 4JI1M 1GVNA 3J7AS 1F4IA 3KOZE 4G3OA 4G4QA 4BLCA 4LGYA 2KA6B 1DGHA 3HU1A 4G4NA 2R0IA 2C9OA 4ZPXA 2XZUA 1N78A 1DGFA 2BWEA 4EIWA 1R7RA 2YQZA 3J7BA 4RNAA 3J2PB 1IY1A 1OKSA 2JA2A 3SYKA 4NRVA 1ZMUA 4R7GA 3W0LB 3HHZA 1T3TA 1ZMWA 2JNHA 4I4LA 4G6ZA 3BOSA 5IZ7D 1FNNA 4JI4M 2Z3XA 3FUTA 1XHBA 2DAKA 2XH9A 3SHGB 1IQPA 4FVMA 2DWZB 3GRYA 2Y20A 3W68A 3FUWA 2XEPA 4I81A 3DFZA 1QVRA 2ZM6M 3U6PA 4AI6A 3L27A 3SC3A 3AJIB 2K6BA 3LW5F 3NBIA 1HNWM 1BVSA 4GH9A 4PCZA 2VIIA 2DHYA 4B3SM 1RU3A 5KPTA 4NRWA 1IN6A 3RFWA 4AKIA 3SHFA 2R18A 3GLFA 3SATA 2LWXA 1Z5CA 1NJFA 4IJFA 3GQ5A 2Z8YM 4X65M 1IXZA 3SAVA 1VEKA 4DR5M 1OIZA 4CGYB 1PGYA 4BBAA 2R6FA 4M9XA 3U60B 1XC8A 3AV0A 3M0EA 1IXRC 4DUYM 4JV5M 2OOBA 1NY6A 1I4WA 2V1UA 1LV7A 2QHOB 1EIJA 5EXSA 3QAUA 1DGGA 2WSFF 2CWBA 3CF0A 5FTMA 3RGSA 3SYLA 1PRBA 1NHGC 4IBEA 4M9SA 3HGIA 3UK6A 5ITTA 1TH3A 4MGZE 1Q02A 1KYIA 1Q3CA 2K9DA 1J09A 2DENA 2NQ8C 4JI5M 4LFAM 5EP3A 5BPVA 1AUAA 1NNJA 2BWBA 4CJ6A 5ITYA 1HNZM 2DNAA 4DV1M 4GIPA 1C1KA 3T1YM 3F92A 2WSEF 2J5YA 4FW9A 5DNYA 4NXMM 4R3DA 2MGWA 1G59A 1QDRA 2FS1A 3HHWA 4B7HA 2QQ8A 1C7YA 2KZSA 2XFTA 4OVZA 3ZCBB 1IFYA 1JB0F 3CTWB 2EA0A 4B3MM 1WIVA 1TDHA 1VDLA 4BB9A 3KS4A 3GPUA 4GHLA 4R71A 3SAWA 1EFUB 4NSOB 1JQJC 3SAUA 4LF9M 3B74A 3U6OA 5JI3E 1I94M 2FE8A 1L1ZA 3SMSA 2JP7A 3HJQA 5IWAM 4JI0M 4PDGA 1WR1B 5H37D 3DA1A 1Z59A 4D81A 1IN8A 1SXJE 3FUVA 2A5YB 4DV2M 1NY5A 2F5QA 3AL0C 4XK8F 2HAKA 1QZMA 3GLFB 3BXWA 3T6PA 3KP0E 3WHKA 3B7ZA 2FFJA 4PD2A 3E21A 3KOWE 3B89A 3FD9A 4FD2A 2LBCA 3CF6E 1NO1A 5DYGA 1PJSA 3KDSE 2GNOA 5JI2E 2QP9X 1R2YA 2XF3A 3RE8A 3ZC7B 3U5ZB 2LVNC 2UUAM 5ITUA 3K2LA 3HU2A 3A45A 3U6LA 4RKUF 2LHCA 3QYEA 1L2CA 4LF4M 2VQEM 4LFCM 1L2BA 2LVOC 1SXJB 1K82A 4OW0A 3GLFE 1HQCA 1PJTA 2CE7A 1SG9A 2YFQA 3DZDA 4B3TM 4LF5M 1AIPC 4FWDA 1HNXM 1T43A 3SARA 2MH8A 1XNRM 2G8LA 4CIZA 2KRKA 3TPZA 2R4JA 5A2QS 1IN4A 3GLGA 1QAOA 1OAOC 2R65A 1Z6TA 3V76A 2JZ1A 1R4GA 4JI2M 1P3QQ 2R46A 1QUTA 2F5OA 4NSRA 2Q2EB 4KLNA 3W67A 2XFSA 5EXTA 4L4UA 8CATA 1QDTA 2DAMA 4KO8A 1A5TA 3GRUA 4MGYE 3JR5A 1HT2E 3RGPA 3GLHA 4Z8XA 1D2NA 1R6BX 1MN3A 1ZMVA 1Z5AA 4LJ5A 1QAMA 2EKKA 3VFDA 1XMQM 1WJ7A 1IY0A 1IXSA 1OQYA 4ITQA 1VEJA 3K1JA 2DAGA 2XLJA 4LJ7A 4DV0M 4LFBM 3FRIA 3U6DA 2E5LM 1EE8A 3E46A 3VKHA 1OAIA 1WGNA 2GQFA 4GRIA 5E6JA 5EP2A 4YHHM 3GLIB 1JR3D 2UUCM 4DR4M 5KO3A 3HY5A 4IBKA 2DAIA 3BBZA 4D80A 4JI7M 2QCUA 2BJVA 3B7NA 1SXJD 5IT9S 3IHPA 3EIHA 4DV3M 4L8RC 2UXCM 2MJ5B 2HHHM 2Z4SA 3I51A 4AQYM 3VK7A 1IN7A 2G3QA 2Y0QA 2L7IA 4IIWA 3J27B 4JN6A 3HX3A 3PVSA
chains in the Genus database with same CATH topology
2KXEA 3KW6A 4QHTA 5F3WA 4QHSA 2DWLA 1SXJA 1KFVA 2C9CA 3FTEA 4NOOB 1HQYE 1QQWA 2QPAA 2D7EA 1L8QA 4DR1M 4OU7A 2C98A 4GHAA 2LXEA 4B7GA 2QBYB 4FCVA 4QOSA 2KZUA 1R2ZA 1YE9A 3HHXA 4G4RA 4DR6M 4X62M 3U6SA 1E9RA 3W0FA 3J81S 3AOEA 5GKNA 1OFIA 4DR2M 3U6QA 3J80S 4DV6M 4OX9M 3D8BA 4IBCA 3T38A 4LCBA 5KQDA 4MGHA 4GITA 3UGJA 1NNUC 1IBLM 2UXBM 4CHTB 1KSFX 1Q3BA 3K8ZA 4Z6YA 2ZANA 1SXJC 4D82A 3GRRA 4JI3M 3SFZA 4AG6A 2KW0A 3GPXA 1GL6A 4X64M 3T1HM 2EO2A 1DGHB 2Z4RA 4GKJM 2K47A 3L2AA 4I5SA 4DV5M 3HU3A 1W5TA 3VDUA 1E9SA 4IBDA 7CATA 2DXIA 1QAQA 5DYIA 1IBMM 4AKHA 4LJ4A 3U6CA 1J7KA 4MM3B 3TWLA 4II7A 1GLNA 3L29A 2ZAMA 1XWIA 4IBBA 3GPYA 3T15A 4TUWA 3L28A 2X49A 4X66M 3U60A 4FWHA 1FJGM 4IJEA 3TL4X 1X37A 2DWNA 4IBIA 3KFUG 4FCTA 1ZAEA 1GL7A 3ZH9B 3FTFA 2V1CA 3VKGA 1N36M 4LRSA 1N33M 4AG5A 3GLGB 5FSWA 5EXXA 3UMMA 4HLQA 3U61B 1E32A 4LJ8A 3KOXE 2F5SA 4G4OA 3NWLA 4XGIA 4FCWA 2L09A 3TWMA 3R8FA 2KRUA 5KPZA 4DUZM 4QNRA 3KVWA 3SASA 1Q39A 2ERCA 3GLHB 5FTKA 2X8AA 5C1BA 4LF6M 1N75A 1L1TA 3CF2A 1ORYB 4M0DA 1K3XA 1N77A 3VDPA 4JYAM 2H1RA 4JXJA 5FLXS 2C5RA 2KEBA 4LF7M 1MX0A 4K0KM 1PJIA 1IM2A 3FUUA 2HL7A 1N34M 3AOEC 5EP1A 4IBGA 1J5EM 4QOZC 1HT1E 3TWKA 3GRVA 1TGUA 1YUBA 4LY6A 4LGMA 3SMPA 3LMMA 4B08A 4M0WA 4LF8M 4GKKM 4FWGA 4MGIE 5E26A 2L7HA 3U5ZA 3KSJA 2EUCA 2R4EA 4LZZA 3WHLA 3MK6A 2W82A 3TE6A 3U6MA 2RGOA 2CHVA 4LJ9A 5BR8M 1S3SA 2I7NA 5LMUM 2ZBKB 4HL4A 2OPFA 3SBJA 2CV2A 2QBYA 4CISA 1N32M 4L16A 2I7PA 4MGKE 1GKIA 2YR0A 1TH4A 1QANA 5LMNM 2F5NA 3LVVA 1G3IA 3E9SA 4M9ZA 4JI6M 2CUZA 4W5WA 4OVZB 2QZ4A 3M6AA 1HR0M 2DZNB 4MH0E 5FTJA 3HJSA 4AKGA 3GP1A 1W5SA 5KQ8A 3JR4A 3DOAA 3A46A 3ILKA 3PFIA 4A3VB 2DZOB 2XSZD 3GO8A 2LNHC 2HKJA 3KXEC 3D8LA 2X4AA 1NJGA 2CEAA 2R45A 3K92A 2F4VM 3PXGA 1Z5BA 4KODA 1L2DA 3L26A 5EP4A 2CHGA 3A98B 5EQTA 2G5GX 3GQ4A 1VDDA 4QNMA 1IXSB 4DV7M 5C18A 3A42A 3GPPA 2CV1A 1H6UA 5IREB 1JR3A 2BNKA 2Y21A 4DV4M 2XZFA 1K3WA 4GC5A 4RF0A 5FTLA 2CHQA 3FYCA 3VK8A 3FKEA 4WW0A 5ITQA 4JI8M 2Y0TA 3U61A 4PDIA 3PNYA 2F5PA 3Q8XA 4L15A 4S12A 3I4YA 2OQ4A 4NXNM 1OJLA 2M5ZA 2D7HA 3L25A 4KHPM 1IY2A 2DWMA 2QENA 2LH0A 1NSFA 3JAMS 3HJ8A 1XNQM 5ITRA 2P5TA 3R9XB 2L6OA 3IG8A 4WURA 3THGA 1XMOM 3HWSA 3MJ5A 3HKPA 3TQSA 3EIEA 1TH2A 3C58A 1DO2A 4GC9A 1ZQ9A 2C96A 3KOYE 1G41A 3FYDA 4AZFA 3AOGA 4REZA 4DR7M 2DHRA 1XXHB 3FUXA 2ZAOA 3I4VA 4YY3M 3AFHA 5EJCA 1NHWC 3H4MA 4P16A 1IBKM 4LG2A 1QYRA 1MU5A 4L78A 1TDZA 5ITXA 1PJJA 2FNAA 4RF1A 3UZUA 5ITXE 3VLFB 2D7GA 3E4RA 4LRTA 4I8OA 2Z7JA 2YNMD 2RGHA 2BJWA 4MB7A 5KPRA 1DGBA 4GMQA 2C99A 3LQRA 2O5RA 3GQ3A 3HHYA 1E94E 3M7GA 1G4AE 2UUBM 4NL4H 1YSYA 4B3RM 1UM8A 2J7OA 4IBJA 5FTNA 4DR3M 3OTOM 2DVWB 1WXQA 2J7NA 4AW4A 2R62A 3FTDA 3LQQA 1G8PA 4LZJA 1IN5A 5EXPA 3UJNA 2CFOA 2V6ZM 4PT5A 3U6EA 1XXHA 4B7FA 2UU9M 3PNVA 1NVMA 3KP1E 2CV0A 3AKZA 2FOIC 3GLIA 1OFHA 3B9PA 3FTCA 2XSZA 3KSXA 2VQFM 4XBOA 3MHVC 2XGNA 2HCBA 4LJAA 4IBFA 1DO0A 2AHMA 3LVWA 2UXDM 2M60A 2RKOA 3IG5A 3KS8A 3QWLA 4LJ6A 4JI1M 1GVNA 3J7AS 3KOZE 4G4QA 4BLCA 4LGYA 2KA6B 1DGHA 3HU1A 4G4NA 2C9OA 4ZPXA 2XZUA 1N78A 1DGFA 4EIWA 1R7RA 2YQZA 3J7BA 4RNAA 3J2PB 1IY1A 2JA2A 3SYKA 4NRVA 4R7GA 3W0LB 3HHZA 1T3TA 4I4LA 4G6ZA 3BOSA 5IZ7D 1FNNA 2Z3XA 3FUTA 1XHBA 2XH9A 3SHGB 1IQPA 4FVMA 2DWZB 3GRYA 2Y20A 3FUWA 2XEPA 4I81A 3DFZA 1QVRA 2ZM6M 3U6PA 4AI6A 3L27A 3SC3A 3AJIB 3NBIA 1HNWM 4GH9A 4PCZA 2VIIA 4B3SM 5KPTA 4NRWA 1IN6A 3RFWA 4AKIA 3SHFA 2R18A 3GLFA 3SATA 1Z5CA 2LWXA 1NJFA 4IJFA 3GQ5A 4X65M 1IXZA 3SAVA 4DR5M 4CGYB 4BBAA 4M9XA 3U60B 1XC8A 3AV0A 3M0EA 1IXRC 4DUYM 4JV5M 1NY6A 1I4WA 2V1UA 1LV7A 5EXSA 3QAUA 1DGGA 3CF0A 5FTMA 3RGSA 3SYLA 1NHGC 4IBEA 4M9SA 3HGIA 3UK6A 5ITTA 1TH3A 4MGZE 1KYIA 1Q3CA 4JI5M 1J09A 2NQ8C 4LFAM 5EP3A 5BPVA 1NNJA 5ITYA 1HNZM 4DV1M 4GIPA 1C1KA 3T1YM 4FW9A 5DNYA 4NXMM 4R3DA 1G59A 3HHWA 4B7HA 2KZSA 2XFTA 4OVZA 3ZCBB 3CTWB 2EA0A 4B3MM 1TDHA 4BB9A 3GPUA 3KS4A 4GHLA 3SAWA 4NSOB 1JQJC 3SAUA 4LF9M 3U6OA 5JI3E 1I94M 2FE8A 1L1ZA 3SMSA 3HJQA 5IWAM 4JI0M 4PDGA 5H37D 4JI4M 3DA1A 1Z59A 4D81A 1IN8A 1SXJE 3FUVA 2A5YB 4DV2M 1NY5A 2F5QA 3AL0C 3GLFB 1QZMA 3KP0E 3WHKA 4PD2A 2FFJA 3KOWE 4FD2A 3FD9A 5DYGA 3CF6E 3KDSE 5JI2E 2QP9X 1R2YA 2XF3A 3RE8A 3ZC7B 3U5ZB 2UUAM 5ITUA 3K2LA 3HU2A 3A45A 3U6LA 1L2CA 4LF4M 2VQEM 4LFCM 1L2BA 1SXJB 1K82A 4OW0A 1HQCA 2CE7A 2YFQA 3DZDA 4B3TM 4LF5M 4FWDA 1HNXM 3SARA 1XNRM 2G8LA 2KRKA 3TPZA 2R4JA 5A2QS 1IN4A 3GLGA 1QAOA 2R65A 1Z6TA 4JI2M 2R46A 2F5OA 4NSRA 2Q2EB 4KLNA 2XFSA 5EXTA 4L4UA 8CATA 4KO8A 3GRUA 4MGYE 3JR5A 1HT2E 3RGPA 3GLHA 4Z8XA 1D2NA 1R6BX 1Z5AA 4LJ5A 1QAMA 3VFDA 1XMQM 1IY0A 4ITQA 3K1JA 2XLJA 4LJ7A 4DV0M 4LFBM 3U6DA 2E5LM 1EE8A 3VKHA 4GRIA 5E6JA 5EP2A 4YHHM 3GLIB 1JR3D 2UUCM 4DR4M 5KO3A 4IBKA 4D80A 4JI7M 2QCUA 2BJVA 5IT9S 1SXJD 4DV3M 3EIHA 2UXCM 4L8RC 2HHHM 2Z4SA 3I51A 4AQYM 3VK7A 1IN7A 4IIWA 2Y0QA 2L7IA 4JN6A 3J27B 1PM5A 3PVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ITY A;  1HNZ M;  4LF8 M;  4DV1 M;  4GKK M;  3T1Y M;  1KFV A;  4MB7 A;  3GQ3 A;  3U6M A;  5BR8 M;  4DR1 M;  4NXM M;  5LMU M;  2UUB M;  2ZBK B;  3SBJ A;  2OPF A;  4CIS A;  4B3R M;  1R2Z A;  4DR3 M;  1N32 M;  3OTO M;  4G4R A;  4DR6 M;  4X62 M;  3U6S A;  3W0F A;  2EA0 A;  4B3M M;  5LMN M;  3J81 S;  2F5N A;  1TDH A;  3GPU A;  4DR2 M;  3U6Q A;  3J80 S;  4DV6 M;  4OX9 M;  3U6E A;  3SAW A;  4JI6 M;  3SAU A;  4LF9 M;  2UU9 M;  3U6O A;  1IBL M;  1HR0 M;  1I94 M;  1L1Z A;  2UXB M;  5IWA M;  4JI0 M;  4PDG A;  4JI4 M;  4DV2 M;  1Z59 A;  3GP1 A;  2F5Q A;  1Q3B A;  3JR4 A;  3DOA A;  3A46 A;  2VQF M;  3GO8 A;  4JI3 M;  2HKJ A;  3GPX A;  4PD2 A;  4X64 M;  3T1H M;  2F4V M;  2UXD M;  1R2Y A;  4GKJ M;  4DV5 M;  1Z5B A;  1L2D A;  4JI1 M;  3GQ4 A;  1IBM M;  3U6C A;  3J7A S;  3TWL A;  2UUA M;  4G4Q A;  4DV7 M;  5ITU A;  3A42 A;  3U6L A;  3A45 A;  3GPP A;  3GPY A;  4G4N A;  1L2C A;  2XZU A;  4LF4 M;  2VQE M;  4LFC M;  1L2B A;  4X66 M;  1K82 A;  1FJG M;  4DV4 M;  4B3T M;  2XZF A;  1K3W A;  4LF5 M;  1HNX M;  3SAR A;  1XNR M;  4NRV A;  3VK8 A;  1N36 M;  5ITQ A;  4JI8 M;  1N33 M;  5A2Q S;  4PDI A;  2F5P A;  4JI2 M;  2F5S A;  4G4O A;  2OQ4 A;  3U6P A;  2ZM6 M;  2F5O A;  4NXN M;  3TWM A;  4KHP M;  4DUZ M;  2Q2E B;  1HNW M;  4PCZ A;  3SAS A;  3JAM S;  1Q39 A;  1XNQ M;  3JR5 A;  4B3S M;  5ITR A;  4NRW A;  4LF6 M;  1Z5A A;  1L1T A;  3SAT A;  1XMO M;  1XMQ M;  1K3X A;  4ITQ A;  1Z5C A;  3C58 A;  3GQ5 A;  4JYA M;  4X65 M;  3SAV A;  4DR5 M;  5FLX S;  4DV0 M;  4LFB M;  4LF7 M;  1MX0 A;  4DR7 M;  1PJI A;  4K0K M;  1XC8 A;  3U6D A;  1N34 M;  2E5L M;  1EE8 A;  4YY3 M;  4DUY M;  4JV5 M;  4YHH M;  1J5E M;  1IBK M;  2UUC M;  4DR4 M;  3TWK A;  1MU5 A;  1TDZ A;  5ITT A;  4JI7 M;  5IT9 S;  4DV3 M;  2UXC M;  5ITX A;  1PJJ A;  2HHH M;  1Q3C A;  5ITX E;  4AQY M;  3VK7 A;  1PM5 A;  4JI5 M;  4LFA M;  1NNJ A; 
#chains in the Genus database with same CATH topology
 2KXE A;  3KW6 A;  4QHT A;  5F3W A;  4QHS A;  2DWL A;  1SXJ A;  1KFV A;  2C9C A;  3FTE A;  3LCU A;  4NOO B;  1HQY E;  1QQW A;  2QPA A;  2D7E A;  1L8Q A;  4DR1 M;  4OU7 A;  2C98 A;  4GHA A;  2LXE A;  4B7G A;  2QBY B;  4FCV A;  4QOS A;  2KZU A;  1R2Z A;  1YE9 A;  4GKJ M;  3HHX A;  4G4R A;  4DR6 M;  4X62 M;  3U6S A;  1E9R A;  3W0F A;  3J81 S;  3AOE A;  5GKN A;  1OFI A;  1OIP A;  4DR2 M;  3U6Q A;  3J80 S;  4DV6 M;  4OX9 M;  3D8B A;  4IBC A;  2MRO B;  3T38 A;  4LCB A;  5KQD A;  4MGH A;  4GIT A;  1WHC A;  1NNU C;  3UGJ A;  1IBL M;  2UXB M;  2QSF X;  4CHT B;  2CRU A;  1TF0 B;  1KSF X;  1NV9 A;  1HJP A;  1Q3B A;  3K8Z A;  2KNA A;  4Z6Y A;  2ZAN A;  1SXJ C;  3K9P A;  4D82 A;  2N35 A;  3GRR A;  1VEG A;  4JI3 M;  3SFZ A;  2KW0 A;  2L4F A;  4AG6 A;  1GL6 A;  4X64 M;  3GPX A;  3T1H M;  2EO2 A;  1DGH B;  2OO9 A;  2Z4R A;  2K47 A;  3I01 M;  1MJG M;  2LTU A;  3HU3 A;  3L2A A;  1W5T A;  2VDB B;  1E9S A;  4I5S A;  4IBD A;  3VDU A;  1QAQ A;  5DYI A;  7CAT A;  2DXI A;  1IBM M;  4AKH A;  4LJ4 A;  3U6C A;  1J7K A;  3H4J A;  4MM3 B;  3TWL A;  4II7 A;  1GLN A;  3L29 A;  2ZAM A;  1XWI A;  1R5L A;  2DI0 A;  4IBB A;  3GPY A;  3T15 A;  4TUW A;  3L28 A;  2X49 A;  4X66 M;  3U60 A;  4FWH A;  1FJG M;  4IJE A;  3TL4 X;  1X37 A;  2ZTC A;  2DWN A;  4IBI A;  3KFU G;  4FCT A;  1ZAE A;  1GO5 A;  1GL7 A;  3ZH9 B;  3FTF A;  2V1C A;  4ANR A;  3VKG A;  1WGL A;  1N36 M;  2WZJ A;  4LRS A;  1N33 M;  1D0M A;  2JZ0 A;  4AG5 A;  3GLG B;  2LVP C;  2O25 A;  5FSW A;  5EXX A;  3UMM A;  4HLQ A;  4F2L A;  1V34 A;  3U61 B;  1E32 A;  4LJ8 A;  2JY5 A;  3KOX E;  2F5S A;  4G4O A;  3NWL A;  4XGI A;  4FCW A;  2L09 A;  3TWM A;  3R8F A;  2KRU A;  3LCV B;  5KPZ A;  1Y8G A;  4DUZ M;  4QNR A;  3KVW A;  3SAS A;  1Q39 A;  2ERC A;  3Q8G A;  3GLH B;  5FTK A;  2X8A A;  3QYB A;  5C1B A;  4LF6 M;  1N75 A;  1L1T A;  3CF2 A;  1ORY B;  4M0D A;  1K3X A;  1N77 A;  2B3T A;  2LHG A;  3VDP A;  4JYA M;  2H1R A;  4JXJ A;  5FLX S;  3ZQJ A;  2C5R A;  2KEB A;  4LF7 M;  1MX0 A;  4K0K M;  1PJI A;  1IM2 A;  3FUU A;  2HL7 A;  1N34 M;  1LTM A;  3AOE C;  5EP1 A;  4IBG A;  3I04 M;  1PJQ A;  1J5E M;  4QOZ C;  2O01 F;  4L6V 6;  4UN2 B;  4DV5 M;  1HT1 E;  3TWK A;  3GRV A;  1TGU A;  1YUB A;  2R44 A;  4LY6 A;  4LGM A;  3SMP A;  3LMM A;  4B08 A;  2JUJ A;  4M0W A;  1VQ1 A;  4LF8 M;  4GKK M;  2MR9 A;  4FWG A;  4MGI E;  5E26 A;  2L7H A;  3U5Z A;  3KSJ A;  2EUC A;  2R4E A;  4LZZ A;  3WHL A;  1GJS A;  3MK6 A;  2W82 A;  3TE6 A;  3U6M A;  2RGO A;  2EKF A;  2CHV A;  4LJ9 A;  5BR8 M;  1S3S A;  2I7N A;  5LMU M;  2ZBK B;  4HL4 A;  2OPF A;  3SBJ A;  2CV2 A;  2QBY A;  4CIS A;  2CP8 A;  1N32 M;  4L16 A;  2I7P A;  4MGK E;  1GKI A;  2YR0 A;  1TH4 A;  1QAN A;  1G71 A;  5LMN M;  4F1I A;  2F5N A;  3LVV A;  1G3I A;  3E9S A;  4M9Z A;  4HEO A;  4JI6 M;  2CUZ A;  2VF8 A;  4W5W A;  4OVZ B;  2QZ4 A;  3M6A A;  1HR0 M;  2DZN B;  4MH0 E;  5FTJ A;  3HJS A;  4AKG A;  1QZE A;  2JY6 B;  1W5S A;  4WP2 A;  3GP1 A;  5KQ8 A;  3JR4 A;  3FRH A;  3DOA A;  3A46 A;  3ILK A;  3PFI A;  4A3V B;  1XXH E;  2DZO B;  2XSZ D;  3GO8 A;  2LNH C;  2HKJ A;  3KXE C;  1VG5 A;  3D8L A;  2X4A A;  1NJG A;  2CEA A;  2R45 A;  3K92 A;  2F4V M;  3PXG A;  1PM5 A;  5L8R F;  2DKL A;  1Z5B A;  4GEW A;  4KOD A;  1L2D A;  3L26 A;  5EP4 A;  1D0K A;  2CHG A;  3A98 B;  5EQT A;  2G5G X;  2VF7 A;  1UFZ A;  1VDD A;  2QNJ A;  4QNM A;  1IXS B;  5DFL A;  3GQ4 A;  4Y28 F;  2WSC F;  4DV7 M;  5C18 A;  3A42 A;  3GPP A;  2CV1 A;  1H6U A;  5IRE B;  1JR3 A;  2BNK A;  2Y21 A;  3C3E A;  1TTE A;  2KDL A;  4DV4 M;  2KNV A;  4NC6 A;  2XZF A;  1K3W A;  4GC5 A;  4RF0 A;  5FTL A;  2CHQ A;  3FYC A;  3VK8 A;  3FKE A;  2ZTD A;  4WW0 A;  5ITQ A;  4JI8 M;  2DAE A;  2Y0T A;  3GLG E;  2JWS A;  3C3D A;  3C9P A;  2JXN A;  1ZV1 A;  3U61 A;  2HWJ A;  4PDI A;  1GJT A;  3PNY A;  2F5P A;  3Q8X A;  1CUK A;  4L15 A;  1YLA A;  4S12 A;  3I4Y A;  2OQ4 A;  4NXN M;  1OJL A;  1V92 A;  2D7H A;  2M5Z A;  3L25 A;  4KHP M;  1IY2 A;  2DWM A;  2QEN A;  2LH0 A;  1NSF A;  3JAM S;  2EJS A;  3HJ8 A;  1T6O A;  3GLH E;  1XNQ M;  2KNZ A;  5ITR A;  2P5T A;  4P17 A;  3R9X B;  2L6O A;  3IG8 A;  4WUR A;  3THG A;  1QUS A;  1TR8 A;  1XMO M;  3HWS A;  2KHH A;  3MJ5 A;  3HKP A;  3TQS A;  3EIE A;  1TH2 A;  3C58 A;  1DO2 A;  4GC9 A;  1ZQ9 A;  2C96 A;  3KOY E;  1G41 A;  2RRU A;  3FYD A;  4AZF A;  2FH0 A;  3MMP A;  3AOG A;  4REZ A;  4DR7 M;  2DHR A;  1XXH B;  3FUX A;  2ZAO A;  3I4V A;  4YY3 M;  3AFH A;  5EJC A;  1NHW C;  3FE3 A;  3H4M A;  4P16 A;  1D0L A;  1IBK M;  1OTR A;  4LG2 A;  1QYR A;  1MU5 A;  4L78 A;  1TDZ A;  5ITX A;  1PJJ A;  2FNA A;  2APL A;  4RF1 A;  3UZU A;  5ITX E;  3VLF B;  2D7G A;  3E4R A;  4LRT A;  4I8O A;  2L4E A;  2Z7J A;  1GAB A;  2YNM D;  2RGH A;  2BJW A;  4MB7 A;  5KPR A;  1DGB A;  4GMQ A;  2C99 A;  3LQR A;  2O5R A;  3GQ3 A;  2JY8 A;  3HHY A;  1DV0 A;  1E94 E;  3M7G A;  3HZJ A;  3K9O A;  1G4A E;  1NV8 A;  3B7Q A;  4NL4 H;  2UUB M;  1YSY A;  4B3R M;  1UM8 A;  2LVA A;  2J7O A;  2K0B X;  4IBJ A;  5FTN A;  4DR3 M;  3OTO M;  2DVW B;  4DBG B;  1WXQ A;  2J7N A;  4AW4 A;  2R62 A;  2JY7 A;  3FTD A;  1G8P A;  3LQQ A;  4LZJ A;  1IN5 A;  3NBX X;  5EXP A;  1XB2 B;  3IEC A;  1V33 A;  3UJN A;  2CFO A;  2V6Z M;  2H5X A;  4PT5 A;  3U6E A;  4Q7J A;  1XXH A;  4B7F A;  2UU9 M;  2DZL A;  3PNV A;  1NVM A;  3KP1 E;  2CV0 A;  3AKZ A;  2FOI C;  3GLI A;  1OFH A;  3B9P A;  3FTC A;  2XSZ A;  4KT0 F;  3GLI E;  3KSX A;  2VQF M;  4XBO A;  3MHV C;  2XGN A;  2HCB A;  2LVQ D;  2OOA A;  4LJA A;  2L2D A;  4IBF A;  1DO0 A;  2AHM A;  3CGW A;  3LVW A;  2UXD M;  2M60 A;  2RKO A;  3IG5 A;  3KS8 A;  3QWL A;  4LJ6 A;  1JR3 E;  4JI1 M;  1GVN A;  3J7A S;  1F4I A;  3KOZ E;  4G3O A;  4G4Q A;  4BLC A;  4LGY A;  2KA6 B;  1DGH A;  3HU1 A;  4G4N A;  2R0I A;  2C9O A;  4ZPX A;  2XZU A;  1N78 A;  1DGF A;  2BWE A;  4EIW A;  1R7R A;  2YQZ A;  3J7B A;  4RNA A;  3J2P B;  1IY1 A;  1OKS A;  2JA2 A;  3SYK A;  4NRV A;  1ZMU A;  4R7G A;  3W0L B;  3HHZ A;  1T3T A;  1ZMW A;  2JNH A;  4I4L A;  4G6Z A;  3BOS A;  5IZ7 D;  1FNN A;  4JI4 M;  2Z3X A;  3FUT A;  1XHB A;  2DAK A;  2XH9 A;  3SHG B;  1IQP A;  4FVM A;  2DWZ B;  3GRY A;  2Y20 A;  3W68 A;  3FUW A;  2XEP A;  4I81 A;  3DFZ A;  1QVR A;  2ZM6 M;  3U6P A;  4AI6 A;  3L27 A;  3SC3 A;  3AJI B;  2K6B A;  3LW5 F;  3NBI A;  1HNW M;  1BVS A;  4GH9 A;  4PCZ A;  2VII A;  2DHY A;  4B3S M;  1RU3 A;  5KPT A;  4NRW A;  1IN6 A;  3RFW A;  4AKI A;  3SHF A;  2R18 A;  3GLF A;  3SAT A;  2LWX A;  1Z5C A;  1NJF A;  4IJF A;  3GQ5 A;  2Z8Y M;  4X65 M;  1IXZ A;  3SAV A;  1VEK A;  4DR5 M;  1OIZ A;  4CGY B;  1PGY A;  4BBA A;  2R6F A;  4M9X A;  3U60 B;  1XC8 A;  3AV0 A;  3M0E A;  1IXR C;  4DUY M;  4JV5 M;  2OOB A;  1NY6 A;  1I4W A;  2V1U A;  1LV7 A;  2QHO B;  1EIJ A;  5EXS A;  3QAU A;  1DGG A;  2WSF F;  2CWB A;  3CF0 A;  5FTM A;  3RGS A;  3SYL A;  1PRB A;  1NHG C;  4IBE A;  4M9S A;  3HGI A;  3UK6 A;  5ITT A;  1TH3 A;  4MGZ E;  1Q02 A;  1KYI A;  1Q3C A;  2K9D A;  1J09 A;  2DEN A;  2NQ8 C;  4JI5 M;  4LFA M;  5EP3 A;  5BPV A;  1AUA A;  1NNJ A;  2BWB A;  4CJ6 A;  5ITY A;  1HNZ M;  2DNA A;  4DV1 M;  4GIP A;  1C1K A;  3T1Y M;  3F92 A;  2WSE F;  2J5Y A;  4FW9 A;  5DNY A;  4NXM M;  4R3D A;  2MGW A;  1G59 A;  1QDR A;  2FS1 A;  3HHW A;  4B7H A;  2QQ8 A;  1C7Y A;  2KZS A;  2XFT A;  4OVZ A;  3ZCB B;  1IFY A;  1JB0 F;  3CTW B;  2EA0 A;  4B3M M;  1WIV A;  1TDH A;  1VDL A;  4BB9 A;  3KS4 A;  3GPU A;  4GHL A;  4R71 A;  3SAW A;  1EFU B;  4NSO B;  1JQJ C;  3SAU A;  4LF9 M;  3B74 A;  3U6O A;  5JI3 E;  1I94 M;  2FE8 A;  1L1Z A;  3SMS A;  2JP7 A;  3HJQ A;  5IWA M;  4JI0 M;  4PDG A;  1WR1 B;  5H37 D;  3DA1 A;  1Z59 A;  4D81 A;  1IN8 A;  1SXJ E;  3FUV A;  2A5Y B;  4DV2 M;  1NY5 A;  2F5Q A;  3AL0 C;  4XK8 F;  2HAK A;  1QZM A;  3GLF B;  3BXW A;  3T6P A;  3KP0 E;  3WHK A;  3B7Z A;  2FFJ A;  4PD2 A;  3E21 A;  3KOW E;  3B89 A;  3FD9 A;  4FD2 A;  2LBC A;  3CF6 E;  1NO1 A;  5DYG A;  1PJS A;  3KDS E;  2GNO A;  5JI2 E;  2QP9 X;  1R2Y A;  2XF3 A;  3RE8 A;  3ZC7 B;  3U5Z B;  2LVN C;  2UUA M;  5ITU A;  3K2L A;  3HU2 A;  3A45 A;  3U6L A;  4RKU F;  2LHC A;  3QYE A;  1L2C A;  4LF4 M;  2VQE M;  4LFC M;  1L2B A;  2LVO C;  1SXJ B;  1K82 A;  4OW0 A;  3GLF E;  1HQC A;  1PJT A;  2CE7 A;  1SG9 A;  2YFQ A;  3DZD A;  4B3T M;  4LF5 M;  1AIP C;  4FWD A;  1HNX M;  1T43 A;  3SAR A;  2MH8 A;  1XNR M;  2G8L A;  4CIZ A;  2KRK A;  3TPZ A;  2R4J A;  5A2Q S;  1IN4 A;  3GLG A;  1QAO A;  1OAO C;  2R65 A;  1Z6T A;  3V76 A;  2JZ1 A;  1R4G A;  4JI2 M;  1P3Q Q;  2R46 A;  1QUT A;  2F5O A;  4NSR A;  2Q2E B;  4KLN A;  3W67 A;  2XFS A;  5EXT A;  4L4U A;  8CAT A;  1QDT A;  2DAM A;  4KO8 A;  1A5T A;  3GRU A;  4MGY E;  3JR5 A;  1HT2 E;  3RGP A;  3GLH A;  4Z8X A;  1D2N A;  1R6B X;  1MN3 A;  1ZMV A;  1Z5A A;  4LJ5 A;  1QAM A;  2EKK A;  3VFD A;  1XMQ M;  1WJ7 A;  1IY0 A;  1IXS A;  1OQY A;  4ITQ A;  1VEJ A;  3K1J A;  2DAG A;  2XLJ A;  4LJ7 A;  4DV0 M;  4LFB M;  3FRI A;  3U6D A;  2E5L M;  1EE8 A;  3E46 A;  3VKH A;  1OAI A;  1WGN A;  2GQF A;  4GRI A;  5E6J A;  5EP2 A;  4YHH M;  3GLI B;  1JR3 D;  2UUC M;  4DR4 M;  5KO3 A;  3HY5 A;  4IBK A;  2DAI A;  3BBZ A;  4D80 A;  4JI7 M;  2QCU A;  2BJV A;  3B7N A;  1SXJ D;  5IT9 S;  3IHP A;  3EIH A;  4DV3 M;  4L8R C;  2UXC M;  2MJ5 B;  2HHH M;  2Z4S A;  3I51 A;  4AQY M;  3VK7 A;  1IN7 A;  2G3Q A;  2Y0Q A;  2L7I A;  4IIW A;  3J27 B;  4JN6 A;  3HX3 A;  3PVS A; 
#chains in the Genus database with same CATH homology
 2KXE A;  3KW6 A;  4QHT A;  5F3W A;  4QHS A;  2DWL A;  1SXJ A;  1KFV A;  2C9C A;  3FTE A;  4NOO B;  1HQY E;  1QQW A;  2QPA A;  2D7E A;  1L8Q A;  4DR1 M;  4OU7 A;  2C98 A;  4GHA A;  2LXE A;  4B7G A;  2QBY B;  4FCV A;  4QOS A;  2KZU A;  1R2Z A;  1YE9 A;  3HHX A;  4G4R A;  4DR6 M;  4X62 M;  3U6S A;  1E9R A;  3W0F A;  3J81 S;  3AOE A;  5GKN A;  1OFI A;  4DR2 M;  3U6Q A;  3J80 S;  4DV6 M;  4OX9 M;  3D8B A;  4IBC A;  3T38 A;  4LCB A;  5KQD A;  4MGH A;  4GIT A;  3UGJ A;  1NNU C;  1IBL M;  2UXB M;  4CHT B;  1KSF X;  1Q3B A;  3K8Z A;  4Z6Y A;  2ZAN A;  1SXJ C;  4D82 A;  3GRR A;  4JI3 M;  3SFZ A;  4AG6 A;  2KW0 A;  3GPX A;  1GL6 A;  4X64 M;  3T1H M;  2EO2 A;  1DGH B;  2Z4R A;  4GKJ M;  2K47 A;  3L2A A;  4I5S A;  4DV5 M;  3HU3 A;  1W5T A;  3VDU A;  1E9S A;  4IBD A;  7CAT A;  2DXI A;  1QAQ A;  5DYI A;  1IBM M;  4AKH A;  4LJ4 A;  3U6C A;  1J7K A;  4MM3 B;  3TWL A;  4II7 A;  1GLN A;  3L29 A;  2ZAM A;  1XWI A;  4IBB A;  3GPY A;  3T15 A;  4TUW A;  3L28 A;  2X49 A;  4X66 M;  3U60 A;  4FWH A;  1FJG M;  4IJE A;  3TL4 X;  1X37 A;  2DWN A;  4IBI A;  3KFU G;  4FCT A;  1ZAE A;  1GL7 A;  3ZH9 B;  3FTF A;  2V1C A;  3VKG A;  1N36 M;  4LRS A;  1N33 M;  4AG5 A;  3GLG B;  5FSW A;  5EXX A;  3UMM A;  4HLQ A;  3U61 B;  1E32 A;  4LJ8 A;  3KOX E;  2F5S A;  4G4O A;  3NWL A;  4XGI A;  4FCW A;  2L09 A;  3TWM A;  3R8F A;  2KRU A;  5KPZ A;  4DUZ M;  4QNR A;  3KVW A;  3SAS A;  1Q39 A;  2ERC A;  3GLH B;  5FTK A;  2X8A A;  5C1B A;  4LF6 M;  1N75 A;  1L1T A;  3CF2 A;  1ORY B;  4M0D A;  1K3X A;  1N77 A;  3VDP A;  4JYA M;  2H1R A;  4JXJ A;  5FLX S;  2C5R A;  2KEB A;  4LF7 M;  1MX0 A;  4K0K M;  1PJI A;  1IM2 A;  3FUU A;  2HL7 A;  1N34 M;  3AOE C;  5EP1 A;  4IBG A;  1J5E M;  4QOZ C;  1HT1 E;  3TWK A;  3GRV A;  1TGU A;  1YUB A;  4LY6 A;  4LGM A;  3SMP A;  3LMM A;  4B08 A;  4M0W A;  4LF8 M;  4GKK M;  4FWG A;  4MGI E;  5E26 A;  2L7H A;  3U5Z A;  3KSJ A;  2EUC A;  2R4E A;  4LZZ A;  3WHL A;  3MK6 A;  2W82 A;  3TE6 A;  3U6M A;  2RGO A;  2CHV A;  4LJ9 A;  5BR8 M;  1S3S A;  2I7N A;  5LMU M;  2ZBK B;  4HL4 A;  2OPF A;  3SBJ A;  2CV2 A;  2QBY A;  4CIS A;  1N32 M;  4L16 A;  2I7P A;  4MGK E;  1GKI A;  2YR0 A;  1TH4 A;  1QAN A;  5LMN M;  2F5N A;  3LVV A;  1G3I A;  3E9S A;  4M9Z A;  4JI6 M;  2CUZ A;  4W5W A;  4OVZ B;  2QZ4 A;  3M6A A;  1HR0 M;  2DZN B;  4MH0 E;  5FTJ A;  3HJS A;  4AKG A;  3GP1 A;  1W5S A;  5KQ8 A;  3JR4 A;  3DOA A;  3A46 A;  3ILK A;  3PFI A;  4A3V B;  2DZO B;  2XSZ D;  3GO8 A;  2LNH C;  2HKJ A;  3KXE C;  3D8L A;  2X4A A;  1NJG A;  2CEA A;  2R45 A;  3K92 A;  2F4V M;  3PXG A;  1Z5B A;  4KOD A;  1L2D A;  3L26 A;  5EP4 A;  2CHG A;  3A98 B;  5EQT A;  2G5G X;  3GQ4 A;  1VDD A;  4QNM A;  1IXS B;  4DV7 M;  5C18 A;  3A42 A;  3GPP A;  2CV1 A;  1H6U A;  5IRE B;  1JR3 A;  2BNK A;  2Y21 A;  4DV4 M;  2XZF A;  1K3W A;  4GC5 A;  4RF0 A;  5FTL A;  2CHQ A;  3FYC A;  3VK8 A;  3FKE A;  4WW0 A;  5ITQ A;  4JI8 M;  2Y0T A;  3U61 A;  4PDI A;  3PNY A;  2F5P A;  3Q8X A;  4L15 A;  4S12 A;  3I4Y A;  2OQ4 A;  4NXN M;  1OJL A;  2M5Z A;  2D7H A;  3L25 A;  4KHP M;  1IY2 A;  2DWM A;  2QEN A;  2LH0 A;  1NSF A;  3JAM S;  3HJ8 A;  1XNQ M;  5ITR A;  2P5T A;  3R9X B;  2L6O A;  3IG8 A;  4WUR A;  3THG A;  1XMO M;  3HWS A;  3MJ5 A;  3HKP A;  3TQS A;  3EIE A;  1TH2 A;  3C58 A;  1DO2 A;  4GC9 A;  1ZQ9 A;  2C96 A;  3KOY E;  1G41 A;  3FYD A;  4AZF A;  3AOG A;  4REZ A;  4DR7 M;  2DHR A;  1XXH B;  3FUX A;  2ZAO A;  3I4V A;  4YY3 M;  3AFH A;  5EJC A;  1NHW C;  3H4M A;  4P16 A;  1IBK M;  4LG2 A;  1QYR A;  1MU5 A;  4L78 A;  1TDZ A;  5ITX A;  1PJJ A;  2FNA A;  4RF1 A;  3UZU A;  5ITX E;  3VLF B;  2D7G A;  3E4R A;  4LRT A;  4I8O A;  2Z7J A;  2YNM D;  2RGH A;  2BJW A;  4MB7 A;  5KPR A;  1DGB A;  4GMQ A;  2C99 A;  3LQR A;  2O5R A;  3GQ3 A;  3HHY A;  1E94 E;  3M7G A;  1G4A E;  2UUB M;  4NL4 H;  1YSY A;  4B3R M;  1UM8 A;  2J7O A;  4IBJ A;  5FTN A;  4DR3 M;  3OTO M;  2DVW B;  1WXQ A;  2J7N A;  4AW4 A;  2R62 A;  3FTD A;  3LQQ A;  1G8P A;  4LZJ A;  1IN5 A;  5EXP A;  3UJN A;  2CFO A;  2V6Z M;  4PT5 A;  3U6E A;  1XXH A;  4B7F A;  2UU9 M;  3PNV A;  1NVM A;  3KP1 E;  2CV0 A;  3AKZ A;  2FOI C;  3GLI A;  1OFH A;  3B9P A;  3FTC A;  2XSZ A;  3KSX A;  2VQF M;  4XBO A;  3MHV C;  2XGN A;  2HCB A;  4LJA A;  4IBF A;  1DO0 A;  2AHM A;  3LVW A;  2UXD M;  2M60 A;  2RKO A;  3IG5 A;  3KS8 A;  3QWL A;  4LJ6 A;  4JI1 M;  1GVN A;  3J7A S;  3KOZ E;  4G4Q A;  4BLC A;  4LGY A;  2KA6 B;  1DGH A;  3HU1 A;  4G4N A;  2C9O A;  4ZPX A;  2XZU A;  1N78 A;  1DGF A;  4EIW A;  1R7R A;  2YQZ A;  3J7B A;  4RNA A;  3J2P B;  1IY1 A;  2JA2 A;  3SYK A;  4NRV A;  4R7G A;  3W0L B;  3HHZ A;  1T3T A;  4I4L A;  4G6Z A;  3BOS A;  5IZ7 D;  1FNN A;  2Z3X A;  3FUT A;  1XHB A;  2XH9 A;  3SHG B;  1IQP A;  4FVM A;  2DWZ B;  3GRY A;  2Y20 A;  3FUW A;  2XEP A;  4I81 A;  3DFZ A;  1QVR A;  2ZM6 M;  3U6P A;  4AI6 A;  3L27 A;  3SC3 A;  3AJI B;  3NBI A;  1HNW M;  4GH9 A;  4PCZ A;  2VII A;  4B3S M;  5KPT A;  4NRW A;  1IN6 A;  3RFW A;  4AKI A;  3SHF A;  2R18 A;  3GLF A;  3SAT A;  1Z5C A;  2LWX A;  1NJF A;  4IJF A;  3GQ5 A;  4X65 M;  1IXZ A;  3SAV A;  4DR5 M;  4CGY B;  4BBA A;  4M9X A;  3U60 B;  1XC8 A;  3AV0 A;  3M0E A;  1IXR C;  4DUY M;  4JV5 M;  1NY6 A;  1I4W A;  2V1U A;  1LV7 A;  5EXS A;  3QAU A;  1DGG A;  3CF0 A;  5FTM A;  3RGS A;  3SYL A;  1NHG C;  4IBE A;  4M9S A;  3HGI A;  3UK6 A;  5ITT A;  1TH3 A;  4MGZ E;  1KYI A;  1Q3C A;  4JI5 M;  1J09 A;  2NQ8 C;  4LFA M;  5EP3 A;  5BPV A;  1NNJ A;  5ITY A;  1HNZ M;  4DV1 M;  4GIP A;  1C1K A;  3T1Y M;  4FW9 A;  5DNY A;  4NXM M;  4R3D A;  1G59 A;  3HHW A;  4B7H A;  2KZS A;  2XFT A;  4OVZ A;  3ZCB B;  3CTW B;  2EA0 A;  4B3M M;  1TDH A;  4BB9 A;  3GPU A;  3KS4 A;  4GHL A;  3SAW A;  4NSO B;  1JQJ C;  3SAU A;  4LF9 M;  3U6O A;  5JI3 E;  1I94 M;  2FE8 A;  1L1Z A;  3SMS A;  3HJQ A;  5IWA M;  4JI0 M;  4PDG A;  5H37 D;  4JI4 M;  3DA1 A;  1Z59 A;  4D81 A;  1IN8 A;  1SXJ E;  3FUV A;  2A5Y B;  4DV2 M;  1NY5 A;  2F5Q A;  3AL0 C;  3GLF B;  1QZM A;  3KP0 E;  3WHK A;  4PD2 A;  2FFJ A;  3KOW E;  4FD2 A;  3FD9 A;  5DYG A;  3CF6 E;  3KDS E;  5JI2 E;  2QP9 X;  1R2Y A;  2XF3 A;  3RE8 A;  3ZC7 B;  3U5Z B;  2UUA M;  5ITU A;  3K2L A;  3HU2 A;  3A45 A;  3U6L A;  1L2C A;  4LF4 M;  2VQE M;  4LFC M;  1L2B A;  1SXJ B;  1K82 A;  4OW0 A;  1HQC A;  2CE7 A;  2YFQ A;  3DZD A;  4B3T M;  4LF5 M;  4FWD A;  1HNX M;  3SAR A;  1XNR M;  2G8L A;  2KRK A;  3TPZ A;  2R4J A;  5A2Q S;  1IN4 A;  3GLG A;  1QAO A;  2R65 A;  1Z6T A;  4JI2 M;  2R46 A;  2F5O A;  4NSR A;  2Q2E B;  4KLN A;  2XFS A;  5EXT A;  4L4U A;  8CAT A;  4KO8 A;  3GRU A;  4MGY E;  3JR5 A;  1HT2 E;  3RGP A;  3GLH A;  4Z8X A;  1D2N A;  1R6B X;  1Z5A A;  4LJ5 A;  1QAM A;  3VFD A;  1XMQ M;  1IY0 A;  4ITQ A;  3K1J A;  2XLJ A;  4LJ7 A;  4DV0 M;  4LFB M;  3U6D A;  2E5L M;  1EE8 A;  3VKH A;  4GRI A;  5E6J A;  5EP2 A;  4YHH M;  3GLI B;  1JR3 D;  2UUC M;  4DR4 M;  5KO3 A;  4IBK A;  4D80 A;  4JI7 M;  2QCU A;  2BJV A;  5IT9 S;  1SXJ D;  4DV3 M;  3EIH A;  2UXC M;  4L8R C;  2HHH M;  2Z4S A;  3I51 A;  4AQY M;  3VK7 A;  1IN7 A;  4IIW A;  2Y0Q A;  2L7I A;  4JN6 A;  3J27 B;  1PM5 A;  3PVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...