4NRWA

Mvnei1-g86d
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
285
structure length
285
Chain Sequence
b'PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTDMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords formamidopyrimidine-DNA glycosylase
molecule tags Hydrolase, lyase/dna
source organism Acanthamoeba polyphaga mimivirus
publication title Genome and cancer single nucleotide polymorphisms of the human NEIL1 DNA glycosylase: Activity, structure, and the effect of editing.
pubmed doi rcsb
total genus 68
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2013-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nrwA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 4nrwA01
4DR7M 3VK8A 3VK7A 3GPYA 2OQ4A 1K3WA 2VQFM 4DV2M 3J81S 2UXCM 3SAUA 3A45A 1Z5BA 4DV6M 1PJJA 4LF5M 2ZM6M 4DUYM 1NNJA 5ITRA 4B3TM 2VQEM 1PJIA 4MB7A 1Q39A 3J80S 1XNRM 5A2QS 5ITXA 3SAVA 2OPFA 4DR1M 2F4VM 2UU9M 3GQ5A 4JI8M 3SARA 4LF4M 3GQ4A 1IBMM 1L2BA 4B3SM 1N34M 3TWLA 2E5LM 4G4QA 3A42A 3DOAA 3OTOM 4DR5M 2F5PA 1KFVA 5ITUA 3T1HM 3U6PA 4ITQA 1MU5A 1J5EM 4CISA 4JI6M 5ITQA 5ITYA 1FJGM 3GPPA 1Z59A 1HNZM 1EE8A 4LFAM 2HKJA 1XMOM 2ZBKB 4DV0M 4LFBM 4G4OA 5BR8M 4NXMM 4JI5M 3C58A 5LMUM 1TDZA 4K0KM 1TDHA 3W0FA 4YY3M 4JI0M 4OX9M 3SBJA 2UXDM 3JR5A 4G4NA 2HHHM 1I94M 4LFCM 1XC8A 2UUCM 4DR6M 4DV7M 4X66M 3GO8A 4X65M 1Z5CA 1R2YA 4DV3M 1L2DA 3U6LA 3U6SA 5IWAM 3U6EA 4B3MM 4PDGA 1XNQM 2UUBM 3U6QA 4JI3M 2F5OA 4PDIA 3U6CA 2XZFA 1R2ZA 3GPXA 4JI1M 1HR0M 2F5SA 5FLXS 3JR4A 4DV5M 4LF9M 3JAMS 4JV5M 3SAWA 4KHPM 1MX0A 2XZUA 2UUAM 1XMQM 3GPUA 4DUZM 3U6DA 4JYAM 4PD2A 1IBKM 3SASA 4JI4M 4GKJM 5IT9S 4DV1M 1N36M 4NRVA 4GKKM 2UXBM 2F5NA 3T1YM 3SATA 1Q3CA 1K3XA 4LF6M 2EA0A 1PM5A 4DR4M 1N32M 3A46A 4NRWA 1L1TA 4X62M 4B3RM 3U6OA 1K82A 4JI2M 1IBLM 4JI7M 5LMNM 3TWKA 3GQ3A 1HNWM 3J7AS 4DR2M 2Q2EB 3U6MA 4DR3M 3GP1A 4DV4M 3TWMA 4AQYM 4PCZA 5ITXE 1N33M 5ITTA 4NXNM 1Z5AA 1L2CA 1HNXM 1Q3BA 4X64M 4YHHM 1L1ZA 4LF8M 4G4RA 2F5QA 4LF7M
chains in the Genus database with same CATH superfamily
3HJ8A 3VK8A 1G8PA 5EQTA 2A5YB 3M6AA 1OQYA 1D0KA 3AFHA 2UXCM 4LJ4A 3SAUA 2LVAA 5E6JA 1G59A 3LCVB 3FYCA 3W68A 2CRUA 4GH9A 1NNJA 3PNYA 2QHOB 3J27B 4I8OA 2GNOA 2O01F 1Q39A 3FUXA 5ITXA 3CF2A 2R18A 2G5GX 2FFJA 4A3VB 2J5YA 3SAVA 2M5ZA 3AOGA 1QDTA 4QOSA 3GRRA 1XXHA 2KNAA 3PXGA 2DVWB 3T6PA 4HLQA 2MGWA 2CHGA 3FUWA 2X8AA 3L26A 1ZMWA 3LW5F 2DENA 4KODA 2Y20A 1NVMA 4AQYM 4ITQA 4WURA 1OAIA 5ITQA 3VDUA 1QVRA 3UJNA 4XK8F 4AKHA 4OVZA 3KSXA 1HNZM 1EE8A 2R44A 2XSZD 1UFZA 2HKJA 3HHWA 3R8FA 4Z6YA 3HU2A 4IBEA 5EXTA 2N35A 3SMPA 3U61A 4QNRA 2Z8YM 4LY6A 3LQQA 3C58A 4WW0A 3GLHE 1TDZA 3PVSA 1TDHA 4JXJA 4MGIE 1ORYB 1XWIA 2X4AA 3W0FA 4LJ7A 2VDBB 4L78A 4IBIA 1WXQA 2LHCA 4OU7A 2CE7A 3JR5A 3FRIA 4M9ZA 3EIEA 3SHFA 4LJ8A 2HWJA 3HX3A 4RKUF 3AKZA 4FVMA 2XFTA 5KQ8A 2QBYA 3U6EA 1T3TA 1P3QQ 4LJ9A 2HAKA 5DYGA 4PDGA 3L2AA 7CATA 1QZEA 4I5SA 3U6CA 2K47A 1NO1A 2OO9A 4II7A 1R2ZA 1L8QA 4OVZB 1HR0M 4D81A 4AG6A 3LVWA 3JR4A 1XXHE 2KNZA 4LF9M 1OFIA 1HQCA 3SAWA 5JI3E 1PRBA 2JWSA 4QOZC 4FWDA 4FW9A 5H37D 5F3WA 1H6UA 1VG5A 3SMSA 3RGSA 1QAMA 2C9OA 2L7HA 3QWLA 4JN6A 4PD2A 5KPRA 1VEKA 3B7QA 4NRVA 1J7KA 3IG8A 3QYEA 2F5NA 1WGLA 3FUTA 3SATA 1OKSA 3BXWA 1QAQA 1N78A 1K3XA 2DAEA 2QENA 1QUTA 1PM5A 2CV1A 4LF6M 4DR4M 3A46A 3GLFB 4B7GA 2QQ8A 2Z7JA 1VEGA 4AW4A 3C9PA 2MR9A 3RFWA 4LRTA 1TGUA 2QCUA 1WHCA 4JI7M 3E9SA 1HNWM 4D80A 5C18A 1NY6A 1PJSA 2YR0A 3AV0A 4RF0A 3GP1A 1G41A 1T43A 5EP4A 5EXXA 3NWLA 4P17A 3TWMA 4LZZA 3T38A 2K0BX 2KNVA 4Q7JA 2V6ZM 3TL4X 1PGYA 2VIIA 1V33A 3TE6A 4GHLA 4GRIA 1Q3BA 2DAIA 4YHHM 1L1ZA 4LF8M 1SG9A 1DV0A 4G4RA 3ZH9B 2BJWA 5IZ7D 2FNAA 2OQ4A 3UGJA 2DZOB 4B08A 1D0LA 3GLHB 4L16A 2VQFM 2MH8A 1BVSA 1MJGM 2XSZA 3KOXE 2R6FA 4P16A 4DBGB 4DV6M 4RF1A 2ZM6M 4IBFA 2XLJA 4TUWA 1WIVA 4LGYA 1PJIA 1UM8A 3K92A 1NJFA 3KOWE 4MB7A 3J80S 2OPFA 1C1KA 3L27A 3B7ZA 2UU9M 4JI8M 3I4YA 3SARA 1GKIA 5DNYA 1L2BA 4B3SM 2XEPA 1NHGC 1QYRA 1IN6A 2QP9X 3TWLA 2E5LM 2LVOC 4MM3B 3HHYA 3UK6A 4G4QA 3DOAA 2M60A 1GO5A 3ILKA 3T1HM 3U6PA 4GHAA 1TH4A 3B7NA 4M9SA 4WP2A 1F4IA 2B3TA 1LTMA 2JP7A 3GLIB 2FH0A 3K2LA 3U60A 4MGZE 4M0DA 2C98A 4CHTB 3PNVA 1MN3A 1Z59A 1OIPA 2NQ8C 2DWMA 1XMOM 2ZBKB 4DV0M 1HJPA 4G4OA 1Y8GA 3DZDA 2DWZB 5KPTA 3GLGE 2LNHC 4YY3M 1Z6TA 1QAOA 1DGHA 2AHMA 1GL6A 3VFDA 1ZV1A 1ZMUA 2HHHM 2YFQA 4MGHA 2BJVA 2KRUA 3THGA 1QQWA 1TR8A 2KRKA 2XGNA 4CIZA 3E46A 3GO8A 1Z5CA 2EJSA 2LTUA 4PT5A 4B3MM 1GJTA 1XNQM 2UUBM 3D8BA 3B74A 4JI3M 4F1IA 4Z8XA 4PDIA 2RRUA 2F5OA 2XZFA 4JI1M 3GPXA 2JXNA 3E21A 2APLA 3WHKA 2F5SA 3FTEA 8CATA 5FLXS 4DV5M 1AIPC 3JAMS 1N77A 2YNMD 3J2PB 3FRHA 4KHPM 3VKGA 1MX0A 4UN2B 2UUAM 1TH2A 3KP1E 4AKGA 4DUZM 4NC6A 2LVQD 4LJ5A 3SASA 4GKJM 5IT9S 1IN8A 5E26A 1DO0A 4GC5A 4GMQA 4GKKM 2J7OA 3T1YM 2Z4SA 1NHWC 1PJQA 2L09A 4BBAA 2EA0A 2CWBA 2O5RA 4FCTA 5FTLA 3I01M 1DGGA 4IIWA 1JR3A 5EXPA 3B89A 1X37A 4X62M 2VF8A 2ERCA 1WR1B 1YSYA 5LMNM 4LRSA 4EIWA 2C5RA 3J7AS 4L8RC 3Q8GA 4DR2M 2DAGA 1IXSB 4DR3M 3VLFB 3W67A 3KVWA 4KO8A 1QZMA 3H4MA 3GRYA 2XFSA 4QHSA 3I51A 3IHPA 2QPAA 1SXJE 2JY5A 4IBGA 4LJAA 5JI2E 5ITTA 1Z5AA 2LHGA 1N33M 4X64M 2QBYB 2DAMA 2Z4RA 1EIJA 2DHYA 2F5QA 3KOYE 1WJ7A 3K9OA 4DR7M 1XXHB 2RGOA 3C3DA 3I4VA 3VK7A 1IY1A 1WGNA 2V1CA 2X49A 1VQ1A 3BBZA 3HJSA 4DV2M 1K3WA 1IM2A 2DWNA 4OW0A 1QANA 2LBCA 3FYDA 2DWLA 1HT2E 4MGKE 3A45A 2BWBA 4BLCA 4FCWA 3VDPA 4LF5M 2MROB 2Y21A 3DA1A 3HY5A 5ITRA 4B3TM 1JQJC 1XNRM 3V76A 5A2QS 1SXJA 3E4RA 2YQZA 3I04M 3LMMA 3UZUA 4DR1M 2F4VM 3GQ5A 3GLGA 4LF4M 1V34A 3CF0A 1YE9A 3GQ4A 2Y0TA 2R45A 2W82A 3MHVC 4NSOB 2G8LA 4L6V6 2XH9A 2DXIA 3Q8XA 1TF0B 2LXEA 3A42A 5EJCA 2F5PA 3U5ZB 1KFVA 1VDDA 3PFIA 1D0MA 1S3SA 2R0IA 3CTWB 2D7GA 2JY8A 2JY7A 4JI6M 1QDRA 3FTDA 5ITYA 4FCVA 1DO2A 2ZAOA 4FWHA 3C3EA 4LFAM 4CGYB 3LQRA 4LFBM 4LCBA 2K6BA 2LWXA 1JR3D 2CHVA 1VDLA 1J09A 1GABA 5LMUM 3MMPA 4LGMA 1IY0A 4Y28F 4R3DA 3HHZA 4JI0M 4OX9M 1EFUB 5KO3A 4G6ZA 3U61B 2D7EA 1LV7A 3M7GA 3U5ZA 2KDLA 2UXDM 2EKKA 2JY6B 3UMMA 3FUUA 4G4NA 1IFYA 1R4GA 4LFCM 2Y0QA 1DGFA 1XC8A 4DR6M 2JZ1A 4GEWA 2RKOA 3K8ZA 4MH0E 4DV3M 3FUVA 3ZQJA 3U6LA 3L25A 1QUSA 2VF7A 4L4UA 5IWAM 1SXJB 1PJTA 3U6QA 5FTKA 2CV2A 2ZANA 4IBKA 2ZTCA 3ZCBB 1TH3A 3KP0E 3QYBA 1I4WA 4GIPA 2JA2A 2DZNB 4CJ6A 3FTCA 3NBIA 2BNKA 2LVNC 2Z3XA 3NBXX 2DAKA 1ZAEA 1XMQM 3GRVA 3U6DA 4JYAM 1IN5A 1IBKM 4W5WA 4DV1M 1OAOC 1N36M 2UXBM 3LVVA 2KXEA 3L29A 1G71A 3VKHA 1NV8A 2EO2A 3GLGB 3HWSA 1OTRA 2I7NA 4I4LA 1R7RA 2FOIC 2QSFX 4NRWA 1SXJD 2ZAMA 2L6OA 1D2NA 2FS1A 3B9PA 4XBOA 5EP3A 3U6OA 1Q02A 2O25A 1K82A 4GITA 4JI2M 2KEBA 2DKLA 2R62A 1OFHA 1HT1E 1IXZA 2C96A 1IY2A 1GVNA 1RU3A 3F92A 1YLAA 3HGIA 3TWKA 1SXJC 1W5TA 2HCBA 3HHXA 4F2LA 3U6MA 5L8RF 5BPVA 3LCUA 1E32A 3WHLA 2GQFA 4XGIA 3IG5A 1NNUC 4ANRA 1C7YA 1XB2B 4NXNM 4AG5A 3FTFA 1CUKA 3AL0C 2JZ0A 2WSFF 3RE8A 4LF7M 3SFZA 4M9XA 2V1UA 3HU3A 2QZ4A 1IQPA 5KQDA 4B7FA 3GPYA 3DFZA 2XF3A 1NY5A 3J81S 1E94E 1GL7A 2ZTDA 3MJ5A 2CUZA 1IXSA 2C9CA 1XHBA 1E9SA 1Z5BA 4AKIA 5FTJA 3SHGB 3K9PA 1PJJA 4DUYM 3SYKA 2VQEM 4QHTA 2CV0A 4I81A 3RGPA 1HQYE 3KFUG 1JR3E 3M0EA 1IXRC 4FWGA 2DZLA 2CHQA 2H5XA 3AOEA 2P5TA 2R65A 4GC9A 4HEOA 1IBMM 1YUBA 1N34M 3SYLA 3KDSE 3OTOM 2H1RA 4DR5M 1DGHB 5ITUA 1G3IA 5GKNA 4R71A 1MU5A 2EKFA 1FNNA 5FSWA 3GLHA 1J5EM 1GLNA 5DFLA 4CISA 3MK6A 2K9DA 3QAUA 2L2DA 1FJGM 2KA6B 3GPPA 3HZJA 4QNMA 1DGBA 4IJEA 2KW0A 4ZPXA 2RGHA 3A98B 1R6BX 2HL7A 4NOOB 4BB9A 3KOZE 5FTNA 5BR8M 4S12A 2LVPC 4NXMM 4LG2A 4JI5M 1ZQ9A 3GLFE 4K0KM 3R9XB 1W5SA 1NV9A 1JB0F 4AI6A 3FE3A 5IREB 2KZSA 3IECA 3KS4A 1NSFA 2G3QA 3SBJA 1GJSA 2CP8A 3L28A 2R4EA 3GRUA 4IBJA 1I94M 2UUCM 1OJLA 2L4EA 1G4AE 4DV7M 4X66M 4X65M 3KSJA 2DNAA 1E9RA 1N75A 4HL4A 5EXSA 5C1BA 3U6SA 1R2YA 1L2DA 2OOBA 5DYIA 4KLNA 1IN7A 3T15A 4IJFA 4G3OA 4NSRA 2EUCA 2QNJA 2R46A 2MJ5B 2BWEA 3HU1A 5EP1A 1OIZA 1KSFX 4D82A 3GLFA 2KHHA 2DI0A 2R4JA 4JV5M 2WSEF 4M0WA 1NJGA 4KT0F 3TPZA 2JNHA 2XZUA 2C99A 2DHRA 4IBBA 3U60B 3D8LA 1TTEA 3FD9A 3GPUA 4JI4M 3KS8A 3CGWA 2L7IA 3FKEA 3HKPA 3AJIB 3KXEC 4AZFA 3GLIA 4FD2A 2CEAA 3HJQA 3J7BA 1Q3CA 3K1JA 5EP2A 4RNAA 1R5LA 2L4FA 2LH0A 3W0LB 3TQSA 1N32M 4B7HA 4MGYE 3ZC7B 2I7PA 1L1TA 3BOSA 4NL4H 1AUAA 4B3RM 2D7HA 1V92A 3EIHA 4LZJA 1VEJA 5KPZA 1A5TA 2WZJA 4REZA 1IBLM 4IBDA 2FE8A 3GQ3A 1T6OA 2Q2EB 5FTMA 2JUJA 4R7GA 2CFOA 3H4JA 3AOEC 4LJ6A 1IN4A 4DV4M 3GLIE 3CF6E 2WSCF 3KW6A 4PCZA 4IBCA 5ITXE 2KZUA 1ZMVA 2OOAA 4L15A 1L2CA 1HNXM 1KYIA 2J7NA 3SC3A
chains in the Genus database with same CATH topology
3HJ8A 3VK8A 1G8PA 5EQTA 2A5YB 3M6AA 3AFHA 2UXCM 4LJ4A 3SAUA 5E6JA 1G59A 3FYCA 4GH9A 1NNJA 3PNYA 3J27B 4I8OA 3FUXA 1Q39A 5ITXA 3CF2A 2R18A 2G5GX 2FFJA 4A3VB 3SAVA 2M5ZA 3AOGA 4QOSA 3GRRA 1XXHA 3PXGA 2DVWB 4HLQA 2CHGA 3FUWA 2X8AA 3L26A 4KODA 2Y20A 1NVMA 4ITQA 4WURA 5ITQA 3VDUA 1QVRA 3UJNA 4AKHA 4OVZA 3KSXA 1HNZM 1EE8A 2XSZD 2HKJA 3HHWA 3R8FA 4Z6YA 3HU2A 4IBEA 5EXTA 3SMPA 3U61A 4QNRA 4LY6A 3LQQA 3C58A 4WW0A 1TDZA 3PVSA 1TDHA 4JXJA 4MGIE 1ORYB 1XWIA 2X4AA 3W0FA 4LJ7A 4L78A 4IBIA 1WXQA 4OU7A 3JR5A 2CE7A 4M9ZA 3EIEA 3SHFA 4LJ8A 3AKZA 4FVMA 2XFTA 5KQ8A 2QBYA 3U6EA 1T3TA 4LJ9A 4PDGA 5DYGA 3L2AA 7CATA 3U6CA 4I5SA 2K47A 4II7A 1R2ZA 1L8QA 4OVZB 1HR0M 4D81A 4AG6A 3LVWA 3JR4A 4LF9M 1OFIA 1HQCA 3SAWA 5JI3E 4QOZC 4FWDA 4FW9A 5H37D 5F3WA 1H6UA 3SMSA 3RGSA 1QAMA 2C9OA 2L7HA 3QWLA 4JN6A 4PD2A 5KPRA 4NRVA 1J7KA 3IG8A 2F5NA 3FUTA 3SATA 1N78A 1QAQA 1K3XA 2QENA 4LF6M 1PM5A 2CV1A 4DR4M 3A46A 3GLFB 4B7GA 2Z7JA 4AW4A 3RFWA 4LRTA 1TGUA 2QCUA 4JI7M 3E9SA 1HNWM 4D80A 5C18A 1NY6A 2YR0A 3AV0A 4RF0A 3GP1A 1G41A 5EP4A 5EXXA 3TWMA 3NWLA 4AQYM 4LZZA 3T38A 3TL4X 2V6ZM 2VIIA 3TE6A 4GHLA 4GRIA 1Q3BA 4YHHM 1L1ZA 4LF8M 4G4RA 3ZH9B 2BJWA 5IZ7D 2FNAA 2OQ4A 3UGJA 2DZOB 4B08A 4L16A 3GLHB 2VQFM 2XSZA 3KOXE 4P16A 4DV6M 4RF1A 2ZM6M 4IBFA 2XLJA 4TUWA 4LGYA 1PJIA 1UM8A 3K92A 1NJFA 3KOWE 4MB7A 3J80S 2OPFA 1C1KA 3L27A 2UU9M 4JI8M 3I4YA 3SARA 1GKIA 5DNYA 1L2BA 4B3SM 2XEPA 1NHGC 1QYRA 1IN6A 2QP9X 3TWLA 2E5LM 4MM3B 3HHYA 3UK6A 4G4QA 3DOAA 2M60A 3ILKA 3T1HM 3U6PA 4GHAA 1TH4A 4M9SA 3GLIB 3K2LA 4MGZE 4M0DA 2C98A 4CHTB 3PNVA 1Z59A 2NQ8C 2DWMA 1XMOM 2ZBKB 4DV0M 4G4OA 3DZDA 2DWZB 5KPTA 2LNHC 4YY3M 1Z6TA 1QAOA 1DGHA 2AHMA 1GL6A 3VFDA 2HHHM 2YFQA 4MGHA 2BJVA 2KRUA 3THGA 1QQWA 2KRKA 2XGNA 3GO8A 1Z5CA 4B3MM 4PT5A 1XNQM 2UUBM 3D8BA 4JI3M 2F5OA 4Z8XA 4PDIA 2XZFA 4JI1M 3GPXA 2F5SA 3WHKA 3FTEA 8CATA 5FLXS 4DV5M 1N77A 3JAMS 2YNMD 3J2PB 4KHPM 3VKGA 1MX0A 2UUAM 1TH2A 3KP1E 4AKGA 4DUZM 4LJ5A 3SASA 4GKJM 5IT9S 1IN8A 5E26A 1DO0A 4GC5A 4GMQA 4GKKM 2J7OA 3T1YM 2Z4SA 1NHWC 2L09A 4BBAA 2EA0A 2O5RA 4FCTA 5FTLA 1DGGA 4IIWA 1JR3A 5EXPA 4X62M 1X37A 2ERCA 1YSYA 5LMNM 4LRSA 4EIWA 2C5RA 3J7AS 4L8RC 4DR2M 1IXSB 4DR3M 3VLFB 3KVWA 4KO8A 1QZMA 3H4MA 3GRYA 2XFSA 4QHSA 3I51A 4LJAA 1SXJE 2QPAA 4IBGA 5ITTA 1N33M 5JI2E 1Z5AA 4X64M 2QBYB 2Z4RA 2F5QA 3KOYE 4DR7M 1XXHB 2RGOA 3I4VA 3VK7A 1IY1A 2V1CA 2X49A 1K3WA 2DWNA 3HJSA 4DV2M 1IM2A 4OW0A 1QANA 3FYDA 2DWLA 1HT2E 4MGKE 3A45A 4BLCA 4FCWA 3VDPA 4LF5M 2Y21A 3DA1A 4B3TM 5ITRA 1JQJC 1XNRM 5A2QS 1SXJA 3E4RA 2YQZA 3LMMA 3UZUA 4DR1M 2F4VM 3GQ5A 3GLGA 4LF4M 3CF0A 3GQ4A 1YE9A 2Y0TA 2R45A 2W82A 3MHVC 4NSOB 2G8LA 2XH9A 2DXIA 3Q8XA 3A42A 2LXEA 5EJCA 2F5PA 3U5ZB 1KFVA 1VDDA 3PFIA 1S3SA 3CTWB 2D7GA 4JI6M 3FTDA 5ITYA 4FCVA 1DO2A 2ZAOA 4FWHA 4LFAM 4CGYB 3LQRA 4LFBM 4LCBA 2LWXA 1JR3D 2CHVA 1J09A 5LMUM 4LGMA 1IY0A 4R3DA 3HHZA 4JI0M 4OX9M 5KO3A 4G6ZA 3U61B 2D7EA 1LV7A 3M7GA 3U5ZA 2UXDM 3UMMA 4G4NA 3FUUA 4LFCM 2Y0QA 1DGFA 1XC8A 4DR6M 2RKOA 3K8ZA 4MH0E 4DV3M 3FUVA 3U6LA 3L25A 5IWAM 4L4UA 1SXJB 3U6QA 5FTKA 2CV2A 2ZANA 4IBKA 3ZCBB 1TH3A 3KP0E 1I4WA 4GIPA 2JA2A 2DZNB 3FTCA 3NBIA 2BNKA 2Z3XA 1XMQM 1ZAEA 3GRVA 3U6DA 4JYAM 1IN5A 1IBKM 4W5WA 4DV1M 1N36M 2UXBM 3LVVA 2KXEA 3L29A 3VKHA 2EO2A 3GLGB 3HWSA 2I7NA 4I4LA 1R7RA 2FOIC 4NRWA 1SXJD 2ZAMA 2L6OA 1D2NA 3B9PA 4XBOA 5EP3A 3U6OA 1K82A 4GITA 4JI2M 2KEBA 1OFHA 2R62A 1HT1E 1IXZA 2C96A 1IY2A 1GVNA 3HGIA 3TWKA 3U60A 1SXJC 1W5TA 2HCBA 3HHXA 3U6MA 5BPVA 1E32A 3WHLA 4XGIA 3IG5A 1NNUC 4NXNM 4AG5A 3FTFA 3AL0C 3RE8A 4LF7M 3SFZA 4M9XA 2V1UA 3HU3A 2QZ4A 1IQPA 5KQDA 4B7FA 3GPYA 3DFZA 2XF3A 1NY5A 3J81S 1E94E 1GL7A 3MJ5A 2CUZA 2C9CA 1XHBA 1E9SA 1Z5BA 4AKIA 5FTJA 3SHGB 1PJJA 4DUYM 3SYKA 2VQEM 4QHTA 2CV0A 4I81A 3RGPA 1HQYE 3KFUG 3M0EA 1IXRC 4FWGA 2CHQA 3AOEA 2P5TA 2R65A 4GC9A 1IBMM 1YUBA 1N34M 3SYLA 3KDSE 3OTOM 2H1RA 4DR5M 1DGHB 5ITUA 1G3IA 5GKNA 1MU5A 1FNNA 5FSWA 3GLHA 1J5EM 1GLNA 4CISA 1FJGM 3MK6A 3QAUA 2KA6B 3GPPA 4QNMA 1DGBA 4IJEA 2KW0A 4ZPXA 2RGHA 3A98B 1R6BX 2HL7A 4NOOB 4BB9A 3KOZE 5FTNA 5BR8M 4S12A 4NXMM 4LG2A 4JI5M 1ZQ9A 4K0KM 3R9XB 1W5SA 4AI6A 5IREB 2KZSA 3KS4A 1NSFA 3SBJA 3L28A 2R4EA 3GRUA 4IBJA 1I94M 2UUCM 1OJLA 1G4AE 4DV7M 4X66M 4X65M 3KSJA 4HL4A 1E9RA 1N75A 5EXSA 5C1BA 3U6SA 1R2YA 1L2DA 5DYIA 4KLNA 1IN7A 3T15A 4IJFA 4NSRA 2EUCA 2R46A 3HU1A 5EP1A 4D82A 1KSFX 3GLFA 2R4JA 4JV5M 4M0WA 1NJGA 3TPZA 2XZUA 2C99A 2DHRA 4IBBA 3U60B 3D8LA 3GPUA 3FD9A 4JI4M 3KS8A 2L7IA 3FKEA 3HKPA 3AJIB 3KXEC 4AZFA 3GLIA 4FD2A 2CEAA 3HJQA 3J7BA 1Q3CA 3K1JA 5EP2A 4RNAA 2LH0A 3W0LB 3TQSA 1N32M 4B7HA 4MGYE 3ZC7B 2I7PA 1L1TA 3BOSA 4NL4H 4B3RM 2D7HA 3EIHA 4LZJA 5KPZA 4REZA 1IBLM 4IBDA 2FE8A 3GQ3A 2Q2EB 5FTMA 4R7GA 2CFOA 3AOEC 4LJ6A 1IN4A 4DV4M 3CF6E 4PCZA 3KW6A 4IBCA 5ITXE 2KZUA 4L15A 1L2CA 1HNXM 1KYIA 2J7NA 3SC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 M;  3VK8 A;  3VK7 A;  3GPY A;  2OQ4 A;  1K3W A;  2VQF M;  4DV2 M;  3J81 S;  2UXC M;  3SAU A;  3A45 A;  1Z5B A;  4DV6 M;  1PJJ A;  4LF5 M;  2ZM6 M;  4DUY M;  1NNJ A;  5ITR A;  4B3T M;  2VQE M;  1PJI A;  4MB7 A;  1Q39 A;  3J80 S;  1XNR M;  5A2Q S;  5ITX A;  3SAV A;  2OPF A;  4DR1 M;  2F4V M;  2UU9 M;  3GQ5 A;  4JI8 M;  3SAR A;  4LF4 M;  3GQ4 A;  1IBM M;  1L2B A;  4B3S M;  1N34 M;  3TWL A;  2E5L M;  4G4Q A;  3A42 A;  3DOA A;  3OTO M;  4DR5 M;  2F5P A;  1KFV A;  5ITU A;  3T1H M;  3U6P A;  4ITQ A;  1MU5 A;  1J5E M;  4CIS A;  4JI6 M;  5ITQ A;  5ITY A;  1FJG M;  3GPP A;  1Z59 A;  1HNZ M;  1EE8 A;  4LFA M;  2HKJ A;  1XMO M;  2ZBK B;  4DV0 M;  4LFB M;  4G4O A;  5BR8 M;  4NXM M;  4JI5 M;  3C58 A;  5LMU M;  1TDZ A;  4K0K M;  1TDH A;  3W0F A;  4YY3 M;  4JI0 M;  4OX9 M;  3SBJ A;  2UXD M;  3JR5 A;  4G4N A;  2HHH M;  1I94 M;  4LFC M;  1XC8 A;  2UUC M;  4DR6 M;  4DV7 M;  4X66 M;  3GO8 A;  4X65 M;  1Z5C A;  1R2Y A;  4DV3 M;  1L2D A;  3U6L A;  3U6S A;  5IWA M;  3U6E A;  4B3M M;  4PDG A;  1XNQ M;  2UUB M;  3U6Q A;  4JI3 M;  2F5O A;  4PDI A;  3U6C A;  2XZF A;  1R2Z A;  3GPX A;  4JI1 M;  1HR0 M;  2F5S A;  5FLX S;  3JR4 A;  4DV5 M;  4LF9 M;  3JAM S;  4JV5 M;  3SAW A;  4KHP M;  1MX0 A;  2XZU A;  2UUA M;  1XMQ M;  3GPU A;  4DUZ M;  3U6D A;  4JYA M;  4PD2 A;  1IBK M;  3SAS A;  4JI4 M;  4GKJ M;  5IT9 S;  4DV1 M;  1N36 M;  4NRV A;  4GKK M;  2UXB M;  2F5N A;  3T1Y M;  3SAT A;  1Q3C A;  1K3X A;  4LF6 M;  2EA0 A;  1PM5 A;  4DR4 M;  1N32 M;  3A46 A;  4NRW A;  1L1T A;  4X62 M;  4B3R M;  3U6O A;  1K82 A;  4JI2 M;  1IBL M;  4JI7 M;  5LMN M;  3TWK A;  3GQ3 A;  1HNW M;  3J7A S;  4DR2 M;  2Q2E B;  3U6M A;  4DR3 M;  3GP1 A;  4DV4 M;  3TWM A;  4AQY M;  4PCZ A;  5ITX E;  1N33 M;  5ITT A;  4NXN M;  1Z5A A;  1L2C A;  1HNX M;  1Q3B A;  4X64 M;  4YHH M;  1L1Z A;  4LF8 M;  4G4R A;  2F5Q A;  4LF7 M; 
#chains in the Genus database with same CATH topology
 3HJ8 A;  3VK8 A;  1G8P A;  5EQT A;  2A5Y B;  3M6A A;  1OQY A;  1D0K A;  3AFH A;  2UXC M;  4LJ4 A;  3SAU A;  2LVA A;  5E6J A;  1G59 A;  3LCV B;  3FYC A;  3W68 A;  2CRU A;  4GH9 A;  1NNJ A;  3PNY A;  2QHO B;  3J27 B;  4I8O A;  2GNO A;  2O01 F;  1Q39 A;  3FUX A;  5ITX A;  3CF2 A;  2R18 A;  2G5G X;  2FFJ A;  4A3V B;  2J5Y A;  3SAV A;  2M5Z A;  3AOG A;  1QDT A;  4QOS A;  3GRR A;  1XXH A;  2KNA A;  3PXG A;  2DVW B;  3T6P A;  4HLQ A;  2MGW A;  2CHG A;  3FUW A;  2X8A A;  3L26 A;  1ZMW A;  3LW5 F;  2DEN A;  4KOD A;  2Y20 A;  1NVM A;  4AQY M;  4ITQ A;  4WUR A;  1OAI A;  5ITQ A;  3VDU A;  1QVR A;  3UJN A;  4XK8 F;  4AKH A;  4OVZ A;  3KSX A;  1HNZ M;  1EE8 A;  2R44 A;  2XSZ D;  1UFZ A;  2HKJ A;  3HHW A;  3R8F A;  4Z6Y A;  3HU2 A;  4IBE A;  5EXT A;  2N35 A;  3SMP A;  3U61 A;  4QNR A;  2Z8Y M;  4LY6 A;  3LQQ A;  3C58 A;  4WW0 A;  3GLH E;  1TDZ A;  3PVS A;  1TDH A;  4JXJ A;  4MGI E;  1ORY B;  1XWI A;  2X4A A;  3W0F A;  4LJ7 A;  2VDB B;  4L78 A;  4IBI A;  1WXQ A;  2LHC A;  4OU7 A;  2CE7 A;  3JR5 A;  3FRI A;  4M9Z A;  3EIE A;  3SHF A;  4LJ8 A;  2HWJ A;  3HX3 A;  4RKU F;  3AKZ A;  4FVM A;  2XFT A;  5KQ8 A;  2QBY A;  3U6E A;  1T3T A;  1P3Q Q;  4LJ9 A;  2HAK A;  5DYG A;  4PDG A;  3L2A A;  7CAT A;  1QZE A;  4I5S A;  3U6C A;  2K47 A;  1NO1 A;  2OO9 A;  4II7 A;  1R2Z A;  1L8Q A;  4OVZ B;  1HR0 M;  4D81 A;  4AG6 A;  3LVW A;  3JR4 A;  1XXH E;  2KNZ A;  4LF9 M;  1OFI A;  1HQC A;  3SAW A;  5JI3 E;  1PRB A;  2JWS A;  4QOZ C;  4FWD A;  4FW9 A;  5H37 D;  5F3W A;  1H6U A;  1VG5 A;  3SMS A;  3RGS A;  1QAM A;  2C9O A;  2L7H A;  3QWL A;  4JN6 A;  4PD2 A;  5KPR A;  1VEK A;  3B7Q A;  4NRV A;  1J7K A;  3IG8 A;  3QYE A;  2F5N A;  1WGL A;  3FUT A;  3SAT A;  1OKS A;  3BXW A;  1QAQ A;  1N78 A;  1K3X A;  2DAE A;  2QEN A;  1QUT A;  1PM5 A;  2CV1 A;  4LF6 M;  4DR4 M;  3A46 A;  3GLF B;  4B7G A;  2QQ8 A;  2Z7J A;  1VEG A;  4AW4 A;  3C9P A;  2MR9 A;  3RFW A;  4LRT A;  1TGU A;  2QCU A;  1WHC A;  4JI7 M;  3E9S A;  1HNW M;  4D80 A;  5C18 A;  1NY6 A;  1PJS A;  2YR0 A;  3AV0 A;  4RF0 A;  3GP1 A;  1G41 A;  1T43 A;  5EP4 A;  5EXX A;  3NWL A;  4P17 A;  3TWM A;  4LZZ A;  3T38 A;  2K0B X;  2KNV A;  4Q7J A;  2V6Z M;  3TL4 X;  1PGY A;  2VII A;  1V33 A;  3TE6 A;  4GHL A;  4GRI A;  1Q3B A;  2DAI A;  4YHH M;  1L1Z A;  4LF8 M;  1SG9 A;  1DV0 A;  4G4R A;  3ZH9 B;  2BJW A;  5IZ7 D;  2FNA A;  2OQ4 A;  3UGJ A;  2DZO B;  4B08 A;  1D0L A;  3GLH B;  4L16 A;  2VQF M;  2MH8 A;  1BVS A;  1MJG M;  2XSZ A;  3KOX E;  2R6F A;  4P16 A;  4DBG B;  4DV6 M;  4RF1 A;  2ZM6 M;  4IBF A;  2XLJ A;  4TUW A;  1WIV A;  4LGY A;  1PJI A;  1UM8 A;  3K92 A;  1NJF A;  3KOW E;  4MB7 A;  3J80 S;  2OPF A;  1C1K A;  3L27 A;  3B7Z A;  2UU9 M;  4JI8 M;  3I4Y A;  3SAR A;  1GKI A;  5DNY A;  1L2B A;  4B3S M;  2XEP A;  1NHG C;  1QYR A;  1IN6 A;  2QP9 X;  3TWL A;  2E5L M;  2LVO C;  4MM3 B;  3HHY A;  3UK6 A;  4G4Q A;  3DOA A;  2M60 A;  1GO5 A;  3ILK A;  3T1H M;  3U6P A;  4GHA A;  1TH4 A;  3B7N A;  4M9S A;  4WP2 A;  1F4I A;  2B3T A;  1LTM A;  2JP7 A;  3GLI B;  2FH0 A;  3K2L A;  3U60 A;  4MGZ E;  4M0D A;  2C98 A;  4CHT B;  3PNV A;  1MN3 A;  1Z59 A;  1OIP A;  2NQ8 C;  2DWM A;  1XMO M;  2ZBK B;  4DV0 M;  1HJP A;  4G4O A;  1Y8G A;  3DZD A;  2DWZ B;  5KPT A;  3GLG E;  2LNH C;  4YY3 M;  1Z6T A;  1QAO A;  1DGH A;  2AHM A;  1GL6 A;  3VFD A;  1ZV1 A;  1ZMU A;  2HHH M;  2YFQ A;  4MGH A;  2BJV A;  2KRU A;  3THG A;  1QQW A;  1TR8 A;  2KRK A;  2XGN A;  4CIZ A;  3E46 A;  3GO8 A;  1Z5C A;  2EJS A;  2LTU A;  4PT5 A;  4B3M M;  1GJT A;  1XNQ M;  2UUB M;  3D8B A;  3B74 A;  4JI3 M;  4F1I A;  4Z8X A;  4PDI A;  2RRU A;  2F5O A;  2XZF A;  4JI1 M;  3GPX A;  2JXN A;  3E21 A;  2APL A;  3WHK A;  2F5S A;  3FTE A;  8CAT A;  5FLX S;  4DV5 M;  1AIP C;  3JAM S;  1N77 A;  2YNM D;  3J2P B;  3FRH A;  4KHP M;  3VKG A;  1MX0 A;  4UN2 B;  2UUA M;  1TH2 A;  3KP1 E;  4AKG A;  4DUZ M;  4NC6 A;  2LVQ D;  4LJ5 A;  3SAS A;  4GKJ M;  5IT9 S;  1IN8 A;  5E26 A;  1DO0 A;  4GC5 A;  4GMQ A;  4GKK M;  2J7O A;  3T1Y M;  2Z4S A;  1NHW C;  1PJQ A;  2L09 A;  4BBA A;  2EA0 A;  2CWB A;  2O5R A;  4FCT A;  5FTL A;  3I01 M;  1DGG A;  4IIW A;  1JR3 A;  5EXP A;  3B89 A;  1X37 A;  4X62 M;  2VF8 A;  2ERC A;  1WR1 B;  1YSY A;  5LMN M;  4LRS A;  4EIW A;  2C5R A;  3J7A S;  4L8R C;  3Q8G A;  4DR2 M;  2DAG A;  1IXS B;  4DR3 M;  3VLF B;  3W67 A;  3KVW A;  4KO8 A;  1QZM A;  3H4M A;  3GRY A;  2XFS A;  4QHS A;  3I51 A;  3IHP A;  2QPA A;  1SXJ E;  2JY5 A;  4IBG A;  4LJA A;  5JI2 E;  5ITT A;  1Z5A A;  2LHG A;  1N33 M;  4X64 M;  2QBY B;  2DAM A;  2Z4R A;  1EIJ A;  2DHY A;  2F5Q A;  3KOY E;  1WJ7 A;  3K9O A;  4DR7 M;  1XXH B;  2RGO A;  3C3D A;  3I4V A;  3VK7 A;  1IY1 A;  1WGN A;  2V1C A;  2X49 A;  1VQ1 A;  3BBZ A;  3HJS A;  4DV2 M;  1K3W A;  1IM2 A;  2DWN A;  4OW0 A;  1QAN A;  2LBC A;  3FYD A;  2DWL A;  1HT2 E;  4MGK E;  3A45 A;  2BWB A;  4BLC A;  4FCW A;  3VDP A;  4LF5 M;  2MRO B;  2Y21 A;  3DA1 A;  3HY5 A;  5ITR A;  4B3T M;  1JQJ C;  1XNR M;  3V76 A;  5A2Q S;  1SXJ A;  3E4R A;  2YQZ A;  3I04 M;  3LMM A;  3UZU A;  4DR1 M;  2F4V M;  3GQ5 A;  3GLG A;  4LF4 M;  1V34 A;  3CF0 A;  1YE9 A;  3GQ4 A;  2Y0T A;  2R45 A;  2W82 A;  3MHV C;  4NSO B;  2G8L A;  4L6V 6;  2XH9 A;  2DXI A;  3Q8X A;  1TF0 B;  2LXE A;  3A42 A;  5EJC A;  2F5P A;  3U5Z B;  1KFV A;  1VDD A;  3PFI A;  1D0M A;  1S3S A;  2R0I A;  3CTW B;  2D7G A;  2JY8 A;  2JY7 A;  4JI6 M;  1QDR A;  3FTD A;  5ITY A;  4FCV A;  1DO2 A;  2ZAO A;  4FWH A;  3C3E A;  4LFA M;  4CGY B;  3LQR A;  4LFB M;  4LCB A;  2K6B A;  2LWX A;  1JR3 D;  2CHV A;  1VDL A;  1J09 A;  1GAB A;  5LMU M;  3MMP A;  4LGM A;  1IY0 A;  4Y28 F;  4R3D A;  3HHZ A;  4JI0 M;  4OX9 M;  1EFU B;  5KO3 A;  4G6Z A;  3U61 B;  2D7E A;  1LV7 A;  3M7G A;  3U5Z A;  2KDL A;  2UXD M;  2EKK A;  2JY6 B;  3UMM A;  3FUU A;  4G4N A;  1IFY A;  1R4G A;  4LFC M;  2Y0Q A;  1DGF A;  1XC8 A;  4DR6 M;  2JZ1 A;  4GEW A;  2RKO A;  3K8Z A;  4MH0 E;  4DV3 M;  3FUV A;  3ZQJ A;  3U6L A;  3L25 A;  1QUS A;  2VF7 A;  4L4U A;  5IWA M;  1SXJ B;  1PJT A;  3U6Q A;  5FTK A;  2CV2 A;  2ZAN A;  4IBK A;  2ZTC A;  3ZCB B;  1TH3 A;  3KP0 E;  3QYB A;  1I4W A;  4GIP A;  2JA2 A;  2DZN B;  4CJ6 A;  3FTC A;  3NBI A;  2BNK A;  2LVN C;  2Z3X A;  3NBX X;  2DAK A;  1ZAE A;  1XMQ M;  3GRV A;  3U6D A;  4JYA M;  1IN5 A;  1IBK M;  4W5W A;  4DV1 M;  1OAO C;  1N36 M;  2UXB M;  3LVV A;  2KXE A;  3L29 A;  1G71 A;  3VKH A;  1NV8 A;  2EO2 A;  3GLG B;  3HWS A;  1OTR A;  2I7N A;  4I4L A;  1R7R A;  2FOI C;  2QSF X;  4NRW A;  1SXJ D;  2ZAM A;  2L6O A;  1D2N A;  2FS1 A;  3B9P A;  4XBO A;  5EP3 A;  3U6O A;  1Q02 A;  2O25 A;  1K82 A;  4GIT A;  4JI2 M;  2KEB A;  2DKL A;  2R62 A;  1OFH A;  1HT1 E;  1IXZ A;  2C96 A;  1IY2 A;  1GVN A;  1RU3 A;  3F92 A;  1YLA A;  3HGI A;  3TWK A;  1SXJ C;  1W5T A;  2HCB A;  3HHX A;  4F2L A;  3U6M A;  5L8R F;  5BPV A;  3LCU A;  1E32 A;  3WHL A;  2GQF A;  4XGI A;  3IG5 A;  1NNU C;  4ANR A;  1C7Y A;  1XB2 B;  4NXN M;  4AG5 A;  3FTF A;  1CUK A;  3AL0 C;  2JZ0 A;  2WSF F;  3RE8 A;  4LF7 M;  3SFZ A;  4M9X A;  2V1U A;  3HU3 A;  2QZ4 A;  1IQP A;  5KQD A;  4B7F A;  3GPY A;  3DFZ A;  2XF3 A;  1NY5 A;  3J81 S;  1E94 E;  1GL7 A;  2ZTD A;  3MJ5 A;  2CUZ A;  1IXS A;  2C9C A;  1XHB A;  1E9S A;  1Z5B A;  4AKI A;  5FTJ A;  3SHG B;  3K9P A;  1PJJ A;  4DUY M;  3SYK A;  2VQE M;  4QHT A;  2CV0 A;  4I81 A;  3RGP A;  1HQY E;  3KFU G;  1JR3 E;  3M0E A;  1IXR C;  4FWG A;  2DZL A;  2CHQ A;  2H5X A;  3AOE A;  2P5T A;  2R65 A;  4GC9 A;  4HEO A;  1IBM M;  1YUB A;  1N34 M;  3SYL A;  3KDS E;  3OTO M;  2H1R A;  4DR5 M;  1DGH B;  5ITU A;  1G3I A;  5GKN A;  4R71 A;  1MU5 A;  2EKF A;  1FNN A;  5FSW A;  3GLH A;  1J5E M;  1GLN A;  5DFL A;  4CIS A;  3MK6 A;  2K9D A;  3QAU A;  2L2D A;  1FJG M;  2KA6 B;  3GPP A;  3HZJ A;  4QNM A;  1DGB A;  4IJE A;  2KW0 A;  4ZPX A;  2RGH A;  3A98 B;  1R6B X;  2HL7 A;  4NOO B;  4BB9 A;  3KOZ E;  5FTN A;  5BR8 M;  4S12 A;  2LVP C;  4NXM M;  4LG2 A;  4JI5 M;  1ZQ9 A;  3GLF E;  4K0K M;  3R9X B;  1W5S A;  1NV9 A;  1JB0 F;  4AI6 A;  3FE3 A;  5IRE B;  2KZS A;  3IEC A;  3KS4 A;  1NSF A;  2G3Q A;  3SBJ A;  1GJS A;  2CP8 A;  3L28 A;  2R4E A;  3GRU A;  4IBJ A;  1I94 M;  2UUC M;  1OJL A;  2L4E A;  1G4A E;  4DV7 M;  4X66 M;  4X65 M;  3KSJ A;  2DNA A;  1E9R A;  1N75 A;  4HL4 A;  5EXS A;  5C1B A;  3U6S A;  1R2Y A;  1L2D A;  2OOB A;  5DYI A;  4KLN A;  1IN7 A;  3T15 A;  4IJF A;  4G3O A;  4NSR A;  2EUC A;  2QNJ A;  2R46 A;  2MJ5 B;  2BWE A;  3HU1 A;  5EP1 A;  1OIZ A;  1KSF X;  4D82 A;  3GLF A;  2KHH A;  2DI0 A;  2R4J A;  4JV5 M;  2WSE F;  4M0W A;  1NJG A;  4KT0 F;  3TPZ A;  2JNH A;  2XZU A;  2C99 A;  2DHR A;  4IBB A;  3U60 B;  3D8L A;  1TTE A;  3FD9 A;  3GPU A;  4JI4 M;  3KS8 A;  3CGW A;  2L7I A;  3FKE A;  3HKP A;  3AJI B;  3KXE C;  4AZF A;  3GLI A;  4FD2 A;  2CEA A;  3HJQ A;  3J7B A;  1Q3C A;  3K1J A;  5EP2 A;  4RNA A;  1R5L A;  2L4F A;  2LH0 A;  3W0L B;  3TQS A;  1N32 M;  4B7H A;  4MGY E;  3ZC7 B;  2I7P A;  1L1T A;  3BOS A;  4NL4 H;  1AUA A;  4B3R M;  2D7H A;  1V92 A;  3EIH A;  4LZJ A;  1VEJ A;  5KPZ A;  1A5T A;  2WZJ A;  4REZ A;  1IBL M;  4IBD A;  2FE8 A;  3GQ3 A;  1T6O A;  2Q2E B;  5FTM A;  2JUJ A;  4R7G A;  2CFO A;  3H4J A;  3AOE C;  4LJ6 A;  1IN4 A;  4DV4 M;  3GLI E;  3CF6 E;  2WSC F;  3KW6 A;  4PCZ A;  4IBC A;  5ITX E;  2KZU A;  1ZMV A;  2OOA A;  4L15 A;  1L2C A;  1HNX M;  1KYI A;  2J7N A;  3SC3 A; 
#chains in the Genus database with same CATH homology
 3HJ8 A;  3VK8 A;  1G8P A;  5EQT A;  2A5Y B;  3M6A A;  3AFH A;  2UXC M;  4LJ4 A;  3SAU A;  5E6J A;  1G59 A;  3FYC A;  4GH9 A;  1NNJ A;  3PNY A;  3J27 B;  4I8O A;  3FUX A;  1Q39 A;  5ITX A;  3CF2 A;  2R18 A;  2G5G X;  2FFJ A;  4A3V B;  3SAV A;  2M5Z A;  3AOG A;  4QOS A;  3GRR A;  1XXH A;  3PXG A;  2DVW B;  4HLQ A;  2CHG A;  3FUW A;  2X8A A;  3L26 A;  4KOD A;  2Y20 A;  1NVM A;  4ITQ A;  4WUR A;  5ITQ A;  3VDU A;  1QVR A;  3UJN A;  4AKH A;  4OVZ A;  3KSX A;  1HNZ M;  1EE8 A;  2XSZ D;  2HKJ A;  3HHW A;  3R8F A;  4Z6Y A;  3HU2 A;  4IBE A;  5EXT A;  3SMP A;  3U61 A;  4QNR A;  4LY6 A;  3LQQ A;  3C58 A;  4WW0 A;  1TDZ A;  3PVS A;  1TDH A;  4JXJ A;  4MGI E;  1ORY B;  1XWI A;  2X4A A;  3W0F A;  4LJ7 A;  4L78 A;  4IBI A;  1WXQ A;  4OU7 A;  3JR5 A;  2CE7 A;  4M9Z A;  3EIE A;  3SHF A;  4LJ8 A;  3AKZ A;  4FVM A;  2XFT A;  5KQ8 A;  2QBY A;  3U6E A;  1T3T A;  4LJ9 A;  4PDG A;  5DYG A;  3L2A A;  7CAT A;  3U6C A;  4I5S A;  2K47 A;  4II7 A;  1R2Z A;  1L8Q A;  4OVZ B;  1HR0 M;  4D81 A;  4AG6 A;  3LVW A;  3JR4 A;  4LF9 M;  1OFI A;  1HQC A;  3SAW A;  5JI3 E;  4QOZ C;  4FWD A;  4FW9 A;  5H37 D;  5F3W A;  1H6U A;  3SMS A;  3RGS A;  1QAM A;  2C9O A;  2L7H A;  3QWL A;  4JN6 A;  4PD2 A;  5KPR A;  4NRV A;  1J7K A;  3IG8 A;  2F5N A;  3FUT A;  3SAT A;  1N78 A;  1QAQ A;  1K3X A;  2QEN A;  4LF6 M;  1PM5 A;  2CV1 A;  4DR4 M;  3A46 A;  3GLF B;  4B7G A;  2Z7J A;  4AW4 A;  3RFW A;  4LRT A;  1TGU A;  2QCU A;  4JI7 M;  3E9S A;  1HNW M;  4D80 A;  5C18 A;  1NY6 A;  2YR0 A;  3AV0 A;  4RF0 A;  3GP1 A;  1G41 A;  5EP4 A;  5EXX A;  3TWM A;  3NWL A;  4AQY M;  4LZZ A;  3T38 A;  3TL4 X;  2V6Z M;  2VII A;  3TE6 A;  4GHL A;  4GRI A;  1Q3B A;  4YHH M;  1L1Z A;  4LF8 M;  4G4R A;  3ZH9 B;  2BJW A;  5IZ7 D;  2FNA A;  2OQ4 A;  3UGJ A;  2DZO B;  4B08 A;  4L16 A;  3GLH B;  2VQF M;  2XSZ A;  3KOX E;  4P16 A;  4DV6 M;  4RF1 A;  2ZM6 M;  4IBF A;  2XLJ A;  4TUW A;  4LGY A;  1PJI A;  1UM8 A;  3K92 A;  1NJF A;  3KOW E;  4MB7 A;  3J80 S;  2OPF A;  1C1K A;  3L27 A;  2UU9 M;  4JI8 M;  3I4Y A;  3SAR A;  1GKI A;  5DNY A;  1L2B A;  4B3S M;  2XEP A;  1NHG C;  1QYR A;  1IN6 A;  2QP9 X;  3TWL A;  2E5L M;  4MM3 B;  3HHY A;  3UK6 A;  4G4Q A;  3DOA A;  2M60 A;  3ILK A;  3T1H M;  3U6P A;  4GHA A;  1TH4 A;  4M9S A;  3GLI B;  3K2L A;  4MGZ E;  4M0D A;  2C98 A;  4CHT B;  3PNV A;  1Z59 A;  2NQ8 C;  2DWM A;  1XMO M;  2ZBK B;  4DV0 M;  4G4O A;  3DZD A;  2DWZ B;  5KPT A;  2LNH C;  4YY3 M;  1Z6T A;  1QAO A;  1DGH A;  2AHM A;  1GL6 A;  3VFD A;  2HHH M;  2YFQ A;  4MGH A;  2BJV A;  2KRU A;  3THG A;  1QQW A;  2KRK A;  2XGN A;  3GO8 A;  1Z5C A;  4B3M M;  4PT5 A;  1XNQ M;  2UUB M;  3D8B A;  4JI3 M;  2F5O A;  4Z8X A;  4PDI A;  2XZF A;  4JI1 M;  3GPX A;  2F5S A;  3WHK A;  3FTE A;  8CAT A;  5FLX S;  4DV5 M;  1N77 A;  3JAM S;  2YNM D;  3J2P B;  4KHP M;  3VKG A;  1MX0 A;  2UUA M;  1TH2 A;  3KP1 E;  4AKG A;  4DUZ M;  4LJ5 A;  3SAS A;  4GKJ M;  5IT9 S;  1IN8 A;  5E26 A;  1DO0 A;  4GC5 A;  4GMQ A;  4GKK M;  2J7O A;  3T1Y M;  2Z4S A;  1NHW C;  2L09 A;  4BBA A;  2EA0 A;  2O5R A;  4FCT A;  5FTL A;  1DGG A;  4IIW A;  1JR3 A;  5EXP A;  4X62 M;  1X37 A;  2ERC A;  1YSY A;  5LMN M;  4LRS A;  4EIW A;  2C5R A;  3J7A S;  4L8R C;  4DR2 M;  1IXS B;  4DR3 M;  3VLF B;  3KVW A;  4KO8 A;  1QZM A;  3H4M A;  3GRY A;  2XFS A;  4QHS A;  3I51 A;  4LJA A;  1SXJ E;  2QPA A;  4IBG A;  5ITT A;  1N33 M;  5JI2 E;  1Z5A A;  4X64 M;  2QBY B;  2Z4R A;  2F5Q A;  3KOY E;  4DR7 M;  1XXH B;  2RGO A;  3I4V A;  3VK7 A;  1IY1 A;  2V1C A;  2X49 A;  1K3W A;  2DWN A;  3HJS A;  4DV2 M;  1IM2 A;  4OW0 A;  1QAN A;  3FYD A;  2DWL A;  1HT2 E;  4MGK E;  3A45 A;  4BLC A;  4FCW A;  3VDP A;  4LF5 M;  2Y21 A;  3DA1 A;  4B3T M;  5ITR A;  1JQJ C;  1XNR M;  5A2Q S;  1SXJ A;  3E4R A;  2YQZ A;  3LMM A;  3UZU A;  4DR1 M;  2F4V M;  3GQ5 A;  3GLG A;  4LF4 M;  3CF0 A;  3GQ4 A;  1YE9 A;  2Y0T A;  2R45 A;  2W82 A;  3MHV C;  4NSO B;  2G8L A;  2XH9 A;  2DXI A;  3Q8X A;  3A42 A;  2LXE A;  5EJC A;  2F5P A;  3U5Z B;  1KFV A;  1VDD A;  3PFI A;  1S3S A;  3CTW B;  2D7G A;  4JI6 M;  3FTD A;  5ITY A;  4FCV A;  1DO2 A;  2ZAO A;  4FWH A;  4LFA M;  4CGY B;  3LQR A;  4LFB M;  4LCB A;  2LWX A;  1JR3 D;  2CHV A;  1J09 A;  5LMU M;  4LGM A;  1IY0 A;  4R3D A;  3HHZ A;  4JI0 M;  4OX9 M;  5KO3 A;  4G6Z A;  3U61 B;  2D7E A;  1LV7 A;  3M7G A;  3U5Z A;  2UXD M;  3UMM A;  4G4N A;  3FUU A;  4LFC M;  2Y0Q A;  1DGF A;  1XC8 A;  4DR6 M;  2RKO A;  3K8Z A;  4MH0 E;  4DV3 M;  3FUV A;  3U6L A;  3L25 A;  5IWA M;  4L4U A;  1SXJ B;  3U6Q A;  5FTK A;  2CV2 A;  2ZAN A;  4IBK A;  3ZCB B;  1TH3 A;  3KP0 E;  1I4W A;  4GIP A;  2JA2 A;  2DZN B;  3FTC A;  3NBI A;  2BNK A;  2Z3X A;  1XMQ M;  1ZAE A;  3GRV A;  3U6D A;  4JYA M;  1IN5 A;  1IBK M;  4W5W A;  4DV1 M;  1N36 M;  2UXB M;  3LVV A;  2KXE A;  3L29 A;  3VKH A;  2EO2 A;  3GLG B;  3HWS A;  2I7N A;  4I4L A;  1R7R A;  2FOI C;  4NRW A;  1SXJ D;  2ZAM A;  2L6O A;  1D2N A;  3B9P A;  4XBO A;  5EP3 A;  3U6O A;  1K82 A;  4GIT A;  4JI2 M;  2KEB A;  1OFH A;  2R62 A;  1HT1 E;  1IXZ A;  2C96 A;  1IY2 A;  1GVN A;  3HGI A;  3TWK A;  3U60 A;  1SXJ C;  1W5T A;  2HCB A;  3HHX A;  3U6M A;  5BPV A;  1E32 A;  3WHL A;  4XGI A;  3IG5 A;  1NNU C;  4NXN M;  4AG5 A;  3FTF A;  3AL0 C;  3RE8 A;  4LF7 M;  3SFZ A;  4M9X A;  2V1U A;  3HU3 A;  2QZ4 A;  1IQP A;  5KQD A;  4B7F A;  3GPY A;  3DFZ A;  2XF3 A;  1NY5 A;  3J81 S;  1E94 E;  1GL7 A;  3MJ5 A;  2CUZ A;  2C9C A;  1XHB A;  1E9S A;  1Z5B A;  4AKI A;  5FTJ A;  3SHG B;  1PJJ A;  4DUY M;  3SYK A;  2VQE M;  4QHT A;  2CV0 A;  4I81 A;  3RGP A;  1HQY E;  3KFU G;  3M0E A;  1IXR C;  4FWG A;  2CHQ A;  3AOE A;  2P5T A;  2R65 A;  4GC9 A;  1IBM M;  1YUB A;  1N34 M;  3SYL A;  3KDS E;  3OTO M;  2H1R A;  4DR5 M;  1DGH B;  5ITU A;  1G3I A;  5GKN A;  1MU5 A;  1FNN A;  5FSW A;  3GLH A;  1J5E M;  1GLN A;  4CIS A;  1FJG M;  3MK6 A;  3QAU A;  2KA6 B;  3GPP A;  4QNM A;  1DGB A;  4IJE A;  2KW0 A;  4ZPX A;  2RGH A;  3A98 B;  1R6B X;  2HL7 A;  4NOO B;  4BB9 A;  3KOZ E;  5FTN A;  5BR8 M;  4S12 A;  4NXM M;  4LG2 A;  4JI5 M;  1ZQ9 A;  4K0K M;  3R9X B;  1W5S A;  4AI6 A;  5IRE B;  2KZS A;  3KS4 A;  1NSF A;  3SBJ A;  3L28 A;  2R4E A;  3GRU A;  4IBJ A;  1I94 M;  2UUC M;  1OJL A;  1G4A E;  4DV7 M;  4X66 M;  4X65 M;  3KSJ A;  4HL4 A;  1E9R A;  1N75 A;  5EXS A;  5C1B A;  3U6S A;  1R2Y A;  1L2D A;  5DYI A;  4KLN A;  1IN7 A;  3T15 A;  4IJF A;  4NSR A;  2EUC A;  2R46 A;  3HU1 A;  5EP1 A;  4D82 A;  1KSF X;  3GLF A;  2R4J A;  4JV5 M;  4M0W A;  1NJG A;  3TPZ A;  2XZU A;  2C99 A;  2DHR A;  4IBB A;  3U60 B;  3D8L A;  3GPU A;  3FD9 A;  4JI4 M;  3KS8 A;  2L7I A;  3FKE A;  3HKP A;  3AJI B;  3KXE C;  4AZF A;  3GLI A;  4FD2 A;  2CEA A;  3HJQ A;  3J7B A;  1Q3C A;  3K1J A;  5EP2 A;  4RNA A;  2LH0 A;  3W0L B;  3TQS A;  1N32 M;  4B7H A;  4MGY E;  3ZC7 B;  2I7P A;  1L1T A;  3BOS A;  4NL4 H;  4B3R M;  2D7H A;  3EIH A;  4LZJ A;  5KPZ A;  4REZ A;  1IBL M;  4IBD A;  2FE8 A;  3GQ3 A;  2Q2E B;  5FTM A;  4R7G A;  2CFO A;  3AOE C;  4LJ6 A;  1IN4 A;  4DV4 M;  3CF6 E;  4PCZ A;  3KW6 A;  4IBC A;  5ITX E;  2KZU A;  4L15 A;  1L2C A;  1HNX M;  1KYI A;  2J7N A;  3SC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...