4NRWA

Mvnei1-g86d
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
285
structure length
285
Chain Sequence
PEGPEVALTADILEKYFKGKTLEYIDFISGRYSKSEPEGYDDFIANLPLKVSNVDTKGKFLWFELFDPNDKSNKWYIWNTFGLTDMWSLFEAKYTRAVLSFDNELMAYFSDMRNFGTFKFSNSEKELKRKLNELGPDFLKNDDIDISKIKKYKQPIVALLMDQKKIGSGLGNYLVAEILYRAKIDPHKLGSNLTDQEIENLWYWIKYETKLAYDSNHIGYMVNLENESSKIGRKNYHPNIHPTEKEFDFLVYRKKKDPNGNKVIADKIIGSGKNKRTTYWAPAIQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Genome and cancer single nucleotide polymorphisms of the human NEIL1 DNA glycosylase: Activity, structure, and the effect of editing.
pubmed doi rcsb
source organism Acanthamoeba polyphaga mimivirus
molecule tags Hydrolase, lyase/dna
molecule keywords formamidopyrimidine-DNA glycosylase
total genus 68
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 3.2.2.23: DNA-formamidopyrimidine glycosylase.
pdb deposition date 2013-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06831 H2TH Formamidopyrimidine-DNA glycosylase H2TH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nrwA02
3.20.190.10 Alpha Beta Alpha-Beta Barrel N-terminal domain of MutM-like DNA repair proteins MutM-like, N-terminal 4nrwA01
1L1ZA 4DR2M 3TWLA 1Q3CA 2Q2EB 4X64M 4JI4M 4B3TM 1N33M 1J5EM 1PM5A 4DR3M 4LFCM 3GP1A 1EE8A 3GQ3A 2VQFM 4B3MM 3U6CA 4DV7M 2UUCM 3JR5A 3SAWA 4YY3M 3DOAA 1L2BA 1XNQM 4AQYM 5IWAM 4LF4M 3TWMA 1HNWM 4PDGA 4LF9M 4G4OA 3GPPA 5A2QS 3U6LA 3U6MA 1N36M 1PJJA 3SATA 2ZM6M 2UUBM 3SARA 3U6SA 3GPXA 4JI2M 4OX9M 1XNRM 4DR6M 4DR1M 1R2YA 3GQ5A 1Z5CA 1NNJA 4K0KM 1K3XA 4DV0M 3SAUA 4DV3M 1MU5A 1N34M 1IBLM 1XMOM 1KFVA 3VK8A 2F5QA 4LF7M 3U6OA 4JI5M 4LFAM 4GKJM 3T1HM 3J7AS 3C58A 5ITYA 4G4RA 2F4VM 4DUZM 2XZUA 4JI3M 4JI8M 1XC8A 3GO8A 2F5PA 5FLXS 4KHPM 3JR4A 4YHHM 1HNXM 3SASA 4ITQA 2HHHM 3GPUA 4GKKM 4MB7A 3A46A 2UUAM 3JAMS 2VQEM 3TWKA 2F5OA 4DV1M 3A42A 4LF5M 1Z5AA 3OTOM 3VK7A 4NXMM 5ITUA 4JI1M 4NXNM 1PJIA 4NRWA 5BR8M 5LMUM 4DR5M 5IT9S 4X66M 2UXDM 2HKJA 1MX0A 4JI6M 2UU9M 4DV2M 2XZFA 5ITRA 4JI0M 2UXBM 5LMNM 4LF8M 1FJGM 4LFBM 4G4NA 2E5LM 3GPYA 5ITQA 4DR4M 4B3RM 4DV5M 4CISA 4DUYM 3W0FA 5ITXE 4DR7M 2ZBKB 4PCZA 2OPFA 3SAVA 3U6QA 4B3SM 1L2DA 2F5NA 3SBJA 3J81S 1K3WA 2F5SA 4JYAM 5ITXA 4DV4M 4DV6M 2OQ4A 1I94M 4LF6M 4X65M 5ITTA 1IBMM 1HNZM 1L1TA 3U6PA 3GQ4A 3A45A 4PDIA 4X62M 3U6EA 4JI7M 4JV5M 1Q39A 1TDHA 1Q3BA 1L2CA 4PD2A 1TDZA 3U6DA 2UXCM 4G4QA 3J80S 1XMQM 1R2ZA 1K82A 3T1YM 2EA0A 1N32M 1Z59A 4NRVA 1Z5BA 1HR0M 1IBKM
chains in the Genus database with same CATH superfamily
1L1ZA 3TWLA 2Q2EB 4FW9A 1P3QQ 4B3TM 3VKGA 1J5EM 2LWXA 2QZ4A 3KP1E 2KRUA 5IREB 1R6BX 2DWNA 3GLGE 4B08A 1QQWA 2QNJA 1G3IA 3GP1A 3MHVC 4B3MM 4OVZB 4PT5A 3B74A 4UN2B 2DVWB 4MGZE 1T6OA 1IQPA 2LBCA 4LCBA 4NL4H 5JI2E 2QHOB 2XLJA 1IXZA 1R5LA 3J27B 3FUVA 1ZV1A 4S12A 4W5WA 3CGWA 2DXIA 1NV9A 3RFWA 3U60B 1TF0B 4IBIA 5E6JA 2QP9X 3TWMA 2VIIA 2WSCF 4G4OA 3U6LA 1QAMA 1OIZA 2RGOA 5L8RF 1VDLA 1IM2A 1XNRM 4DR1M 4Z6YA 2QCUA 2JUJA 2EUCA 3HHWA 3GLFA 2J7NA 3HJ8A 1GABA 3KVWA 5FTJA 3QYEA 5DNYA 2LHGA 2J7OA 1IN8A 2R0IA 3VK8A 3E21A 2F5QA 4Y28F 2G8LA 4MM3B 3L25A 4GKJM 3RGPA 2L2DA 4AKIA 4KO8A 4GC9A 5BPVA 2I7NA 1DO0A 1OFHA 1GKIA 3KW6A 2XZUA 1NY5A 1GJSA 1VEGA 1WR1B 2DAGA 1JB0F 4NC6A 5FLXS 2JZ1A 4F1IA 3JR4A 3RGSA 3U5ZA 3U60A 5KQ8A 2FH0A 2OOAA 3VLFB 4LJAA 2Z4SA 4MGKE 1HNXM 3SASA 1XHBA 3L27A 4FCTA 1QYRA 2JY5A 3I01M 2VQEM 3GLFB 4DV1M 1SG9A 2DAMA 2LNHC 2C9OA 1AUAA 1KSFX 2K0BX 2LVOC 2YFQA 4FCVA 4LF5M 1DGGA 1R7RA 3HU2A 4FVMA 1I4WA 3GLGA 1E9SA 2B3TA 3SMSA 4DR5M 2LTUA 3FKEA 4X66M 5IT9S 3SHFA 3FRIA 1NHGC 3PFIA 3U61B 2O01F 2UU9M 4DV2M 5JI3E 2QBYB 1ZMVA 2R4EA 1LTMA 3C3DA 1FNNA 3LVVA 3KOXE 4IBEA 3ZC7B 5C1BA 2I7PA 5EXXA 3HWSA 3AOEA 4M9XA 1OFIA 4B7GA 4DR4M 3AV0A 2KNZA 4ANRA 3W0FA 3HU3A 4REZA 3W0LB 5ITXE 2KNVA 2ZBKB 3MK6A 5DFLA 3SAVA 3HX3A 1E32A 4GHAA 2F5NA 3UJNA 2GQFA 3B9PA 4GITA 2CV1A 3LQRA 5ITXA 4DV4M 2M60A 1NVMA 1HT1E 2DZNB 2WZJA 4LF6M 3HHXA 4L8RC 3NWLA 2FS1A 2FOIC 3CF6E 1TH4A 3M0EA 4JV5M 5IZ7D 2Z8YM 1Q3BA 2KA6B 2L4FA 2R6FA 2CHVA 1L2CA 4PD2A 2UXCM 2L7IA 2HL7A 4G4QA 3KOZE 3GLIA 3CF2A 5FSWA 1K82A 1SXJD 2X8AA 4JXJA 1GVNA 1CUKA 1VEJA 1MN3A 4AI6A 5EXSA 4NRVA 1SXJE 5FTMA 1H6UA 2L09A 2DKLA 2WSFF 2A5YB 2C99A 4AZFA 4IIWA 1IN4A 1GLNA 5EP1A 4JI4M 4BB9A 1N33M 1PM5A 4DR3M 3KSXA 1JR3D 1QAOA 2K6BA 3HY5A 1HT2E 1EE8A 5FTLA 2QENA 3ILKA 4AW4A 1TGUA 3SYLA 3RE8A 3GRYA 4FWGA 2R65A 1DO2A 3JR5A 3GRRA 1EIJA 3SAWA 3KXEC 4YY3M 3LCVB 2MJ5B 3L26A 3GLIB 3PVSA 5IWAM 1QUTA 3AFHA 3UZUA 4LF9M 4NSRA 1S3SA 5A2QS 4I4LA 4JI2M 2CUZA 2DAEA 3B89A 3IHPA 3E46A 1K3XA 1XXHB 1MU5A 2O25A 1IBLM 1YE9A 4QNRA 1ZQ9A 3CF0A 4QOSA 2CRUA 3TL4X 3U6OA 1D2NA 3CTWB 3AL0C 2Y21A 4GH9A 2BJVA 3MMPA 3PNYA 4DUZM 2CFOA 3M7GA 2F4VM 4JI3M 1ZMUA 1VDDA 2JP7A 3FD9A 3GO8A 2DZOB 2Z4RA 2GNOA 3SFZA 1D0MA 1QZMA 2X49A 5EP4A 4B7HA 2KXEA 5EXTA 2YNMD 4LRSA 3MJ5A 4IJEA 2DWMA 2XF3A 3FRHA 3GRUA 4CGYB 3K9OA 5EP2A 2KNAA 3I51A 3T6PA 5EXPA 3TWKA 5F3WA 2F5OA 2ZAOA 3SMPA 1G41A 3B7QA 1DV0A 1ZMWA 1KYIA 7CATA 1NV8A 3VK7A 1N75A 2R46A 2RKOA 2BJWA 1PJIA 4NRWA 4LGYA 3LW5F 1AIPC 2Y0TA 1OTRA 4ZPXA 4LGMA 2MROB 4XGIA 2XZFA 2UXBM 3J2PB 3I4YA 4L78A 4LFBM 4G4NA 4KT0F 2FE8A 2H1RA 4IJFA 2WSEF 2X4AA 2K9DA 3NBXX 3T38A 4LZJA 3FTEA 2ZTCA 4B3RM 1SXJC 1PJTA 2JA2A 2OOBA 2JXNA 1GL6A 1MJGM 1HJPA 4JYAM 1K3WA 3IG5A 1OJLA 3FTCA 4FWDA 1V33A 3WHLA 5EQTA 4X65M 4L4UA 3GLHE 4AG5A 4LRTA 1HNZM 4II7A 3GQ4A 3A45A 4QHSA 3U6EA 4M0WA 3H4MA 3D8LA 4RF0A 2XFSA 4LJ5A 5H37D 3HU1A 4LJ6A 5DYGA 4BBAA 1D0KA 1JR3E 1UFZA 1R2ZA 4GHLA 3HGIA 2QSFX 4OW0A 3ZQJA 4EIWA 2C5RA 3KS4A 4Z8XA 4LG2A 2YR0A 3Q8XA 3T1YM 4LJ7A 2NQ8C 1T3TA 3AOGA 5KPTA 3FYDA 2CHQA 3BOSA 4DR2M 1N77A 1Q3CA 4X64M 1BVSA 1VQ1A 2W82A 1IY0A 1PJSA 2HWJA 2KDLA 2KW0A 4M9SA 3UGJA 4LFCM 3GQ3A 2HAKA 3SHGB 5KPZA 2MGWA 1IN6A 1IN5A 2KZUA 2JY6B 4G6ZA 3LMMA 1ZAEA 2OO9A 2UUCM 4FCWA 3E4RA 2KHHA 3DOAA 1L2BA 4D80A 2Z7JA 2XSZD 1XNQM 4R3DA 5GKNA 4LF4M 1HNWM 4CIZA 4Q7JA 1NJGA 1Z6TA 3FTDA 4PDGA 2Z3XA 3GPPA 3SARA 3U6MA 2JNHA 1PJJA 1N36M 3SATA 4HL4A 3U6SA 3GPXA 4DR6M 2D7EA 4WURA 1VEKA 1R2YA 1Z5CA 2APLA 1IY2A 4L15A 1TTEA 3AKZA 3GRVA 4DV0M 2VF8A 3HJSA 3DA1A 4XBOA 4LJ4A 1N34M 1GO5A 1XMOM 3IG8A 1KFVA 2KEBA 4OVZA 4JI5M 4LFAM 1N78A 3GLGB 4GEWA 3C58A 4G4RA 2G3QA 2CP8A 1XC8A 2F5PA 2ERCA 2O5RA 4AKGA 2QBYA 2Y20A 3KS8A 1IXSA 2HCBA 4YHHM 1J09A 4ITQA 4M0DA 1RU3A 2L6OA 3GPUA 4F2LA 1GL7A 3THGA 4MGYE 2QQ8A 2G5GX 2R62A 3HKPA 1NNUC 4MB7A 3A46A 3UMMA 2L4EA 3KP0E 3PXGA 1G59A 1QANA 3FUWA 1R4GA 2CV0A 3K2LA 3A42A 3SC3A 4R71A 1Z5AA 3B7ZA 1YSYA 4IBKA 4R7GA 2EKFA 4OU7A 1TH3A 3KOWE 2LVNC 3OTOM 4NXMM 5ITUA 1E94E 2N35A 2KZSA 4GRIA 5BR8M 3PNVA 3DZDA 2JZ0A 2RRUA 2HKJA 3K9PA 4IBGA 4GMQA 3HHZA 3U5ZB 3R8FA 4MH0E 4FD2A 1FJGM 3J7BA 3FUUA 2J5YA 1IXSB 2MH8A 3M6AA 2JWSA 2BWBA 1F4IA 3GPYA 1E9RA 4RF1A 1L8QA 4MGIE 3TPZA 3VDPA 4AG6A 3BXWA 5ITQA 3QYBA 4DV5M 4XK8F 1DGHA 3AOEC 3ZCBB 4DR7M 4PCZA 3EIEA 3LVWA 4I81A 4IBDA 2DENA 3SBJA 1L2DA 2LVPC 5EP3A 2C96A 2F5SA 2P5TA 4JN6A 4L16A 1VG5A 1WHCA 2OQ4A 3H4JA 1I94M 1PGYA 1Q02A 5ITTA 1IBMM 2LVAA 3GLFE 1IXRC 1L1TA 3U6PA 5C18A 4X62M 2CV2A 1WGNA 2LXEA 4JI7M 3VKHA 2ZANA 4GC5A 1LV7A 4A3VB 3U6DA 3U61A 3ZH9B 1TDZA 4TUWA 4AKHA 3KDSE 1WGLA 3J80S 1XMQM 1G71A 2M5ZA 3V76A 1HQCA 2XEPA 2EO2A 3L2AA 3HZJA 1TH2A 2EA0A 3KFUG 3FE3A 3LCUA 3HJQA 1IY1A 1OAOC 2CEAA 3NBIA 1DGHB 1HR0M 2YQZA 3IECA 1ORYB 8CATA 1SXJA 1UM8A 3FUXA 5FTKA 1OAIA 2QPAA 3HHYA 3QAUA 3UK6A 4DBGB 3C3EA 1PRBA 1NHWC 1IN7A 4G3OA 2VQFM 4WP2A 3L28A 1QVRA 4KODA 1X37A 4D82A 3U6CA 4DV7M 4NSOB 3I04M 5E26A 3SYKA 1W5SA 3FUTA 4IBFA 1DGBA 1WXQA 1OKSA 3LQQA 4AQYM 4BLCA 1TR8A 2C9CA 2CHGA 3K92A 3KSJA 2ZM6M 2UUBM 4RKUF 1QUSA 4OX9M 4D81A 2R45A 1NNJA 3GQ5A 1D0LA 2XGNA 4IBBA 3TQSA 5KPRA 4K0KM 1SXJB 1NO1A 2CWBA 4LY6A 3SAUA 4DV3M 2DAIA 2LH0A 1OQYA 3GLHB 4QNMA 2R44A 4LF7M 4M9ZA 3A98B 1HQYE 2V1UA 3K8ZA 2BWEA 3T1HM 2CE7A 3J7AS 2DAKA 3DFZA 5ITYA 2D7HA 3L29A 2DHYA 3T15A 4JI8M 4I5SA 1GJTA 3FTFA 2C98A 2DHRA 1WIVA 4KHPM 5EJCA 1V92A 2JY7A 4NOOB 2AHMA 1C7YA 3C9PA 1T43A 2RGHA 1W5TA 4B7FA 2HHHM 2K47A 3Q8GA 2VDBB 2Y0QA 3F92A 2D7GA 3B7NA 4GKKM 1YLAA 1QDTA 2JY8A 2UUAM 3JAMS 1J7KA 4L6V6 1XXHA 4CHTB 1OIPA 2DWZB 1XWIA 5FTNA 4LZZA 3GLHA 4P16A 4MGHA 4KLNA 4JI1M 2DNAA 4I8OA 1XXHE 4NXNM 3TE6A 5KO3A 5LMUM 3VDUA 2EKKA 2DI0A 1XB2B 4CJ6A 2R18A 2XH9A 2UXDM 4FWHA 1MX0A 2R4JA 1JR3A 4JI6M 1NJFA 5ITRA 4JI0M 4LJ9A 5DYIA 5LMNM 4LF8M 4QHTA 4IBCA 1JQJC 1EFUB 2V1CA 3E9SA 1QZEA 2E5LM 3R9XB 3QWLA 2VF7A 1G4AE 1Y8GA 4CISA 1YUBA 3KOYE 3W67A 4DUYM 3W68A 1DGFA 2OPFA 4B3SM 1NSFA 3U6QA 3WHKA 3J81S 2FNAA 3EIHA 4DV6M 2DWLA 1C1KA 2H5XA 2V6ZM 1A5TA 1G8PA 4HLQA 2LVQD 2ZAMA 1V34A 2ZTDA 4RNAA 3GLIE 4PDIA 4LJ8A 1WJ7A 1Q39A 1TDHA 2FFJA 4GIPA 1IFYA 3AJIB 2KRKA 3D8BA 4IBJA 2BNKA 4WW0A 2DZLA 2L7HA 2LHCA 3BBZA 3K1JA 4QOZC 1QDRA 1NY6A 3VFDA 1PJQA 2EJSA 2XFTA 1N32M 3FYCA 1Z59A 5KQDA 3I4VA 1QAQA 2XSZA 1Z5BA 4P17A 2MR9A 4HEOA 1IBKM
chains in the Genus database with same CATH topology
1L1ZA 3TWLA 2Q2EB 4FW9A 4B3TM 3VKGA 1J5EM 2LWXA 2QZ4A 3KP1E 2KRUA 5IREB 1R6BX 2DWNA 4B08A 1QQWA 1G3IA 3GP1A 3MHVC 4B3MM 4OVZB 4PT5A 2DVWB 4MGZE 4LCBA 1IQPA 4NL4H 5JI2E 2XLJA 1IXZA 3J27B 3FUVA 4S12A 4W5WA 2DXIA 3RFWA 3U60B 4IBIA 5E6JA 2QP9X 3TWMA 2VIIA 4G4OA 3U6LA 1QAMA 2RGOA 1IM2A 1XNRM 4DR1M 4Z6YA 2QCUA 3HHWA 2EUCA 3GLFA 2J7NA 3HJ8A 3KVWA 5FTJA 5DNYA 2J7OA 1IN8A 3L25A 3VK8A 2F5QA 2G8LA 4MM3B 4GKJM 3RGPA 4KO8A 4GC9A 5BPVA 2I7NA 1DO0A 1OFHA 1GKIA 3KW6A 2XZUA 1NY5A 5FLXS 3JR4A 3RGSA 3U5ZA 3U60A 5KQ8A 3VLFB 4LJAA 2Z4SA 4MGKE 1HNXM 3SASA 1XHBA 3L27A 4FCTA 1QYRA 2VQEM 3GLFB 4DV1M 2LNHC 2C9OA 4LF5M 1KSFX 4FCVA 2YFQA 1DGGA 1R7RA 3HU2A 4FVMA 1I4WA 3GLGA 1E9SA 3SMSA 4DR5M 5IT9S 3FKEA 4X66M 3SHFA 1NHGC 3PFIA 3U61B 2UU9M 4DV2M 5JI3E 2QBYB 3ZC7B 2R4EA 3LVVA 5KPZA 1FNNA 5C1BA 3KOXE 4IBEA 2I7PA 5EXXA 3HWSA 3AOEA 4M9XA 1OFIA 4B7GA 4DR4M 3AV0A 3W0FA 3HU3A 4REZA 3W0LB 5ITXE 2ZBKB 3SAVA 3MK6A 4GHAA 1E32A 2F5NA 3UJNA 3B9PA 4GITA 2CV1A 3LQRA 5ITXA 4DV4M 1NVMA 1HT1E 2DZNB 2M60A 4LF6M 3HHXA 4L8RC 3NWLA 2FOIC 3CF6E 1TH4A 3M0EA 4JV5M 5IZ7D 1Q3BA 2KA6B 2CHVA 1L2CA 4PD2A 2UXCM 2L7IA 2HL7A 4G4QA 3KOZE 3GLIA 3CF2A 5FSWA 1K82A 1SXJD 2X8AA 4JXJA 1GVNA 4AI6A 5EXSA 4NRVA 1SXJE 5FTMA 1H6UA 2L09A 2A5YB 2C99A 4AZFA 4IIWA 1IN4A 1GLNA 5EP1A 4JI4M 4BB9A 1N33M 1PM5A 4DR3M 3KSXA 1JR3D 1QAOA 1HT2E 1EE8A 5FTLA 2QENA 3ILKA 4AW4A 1TGUA 3SYLA 3RE8A 3GRYA 4FWGA 2R65A 1DO2A 3JR5A 3GRRA 3SAWA 3KXEC 4YY3M 3L26A 3GLIB 3PVSA 5IWAM 3UZUA 3AFHA 4LF9M 4NSRA 1S3SA 5A2QS 4I4LA 4JI2M 2CUZA 1K3XA 1XXHB 1MU5A 1IBLM 1YE9A 4QNRA 1ZQ9A 3CF0A 4QOSA 3TL4X 3U6OA 1D2NA 3CTWB 3AL0C 2Y21A 4GH9A 2BJVA 3PNYA 2F4VM 4DUZM 2CFOA 3M7GA 3KS8A 4JI3M 1VDDA 3FD9A 3GO8A 2DZOB 2Z4RA 3SFZA 1QZMA 2X49A 5EP4A 4B7HA 2KXEA 5EXTA 2YNMD 4LRSA 3MJ5A 4IJEA 2DWMA 2XF3A 3GRUA 4CGYB 5EP2A 3I51A 3TWKA 5F3WA 5EXPA 2F5OA 2ZAOA 3SMPA 1G41A 1KYIA 7CATA 3VK7A 1N75A 2R46A 2RKOA 2BJWA 1PJIA 4NRWA 4LGYA 2Y0TA 4ZPXA 4LGMA 2XZFA 4XGIA 2UXBM 3J2PB 3I4YA 4L78A 4LFBM 4G4NA 2FE8A 2H1RA 4IJFA 2X4AA 3T38A 4LZJA 3FTEA 4B3RM 1SXJC 2JA2A 1GL6A 4JYAM 1K3WA 3IG5A 1OJLA 3FTCA 4FWDA 3WHLA 5EQTA 4X65M 4L4UA 4AG5A 4LRTA 1HNZM 4II7A 3GQ4A 3A45A 4QHSA 3U6EA 4M0WA 3H4MA 3D8LA 4RF0A 2XFSA 4LJ5A 5H37D 3HU1A 4LJ6A 5DYGA 4BBAA 1R2ZA 4GHLA 3HGIA 4OW0A 4LG2A 2C5RA 4EIWA 3KS4A 4Z8XA 2YR0A 3Q8XA 3T1YM 4LJ7A 2NQ8C 1T3TA 3AOGA 5KPTA 3FYDA 2CHQA 3BOSA 4DR2M 1N77A 1Q3CA 4X64M 2W82A 1IY0A 2KW0A 3UGJA 4M9SA 4LFCM 3GQ3A 3SHGB 1IN6A 1IN5A 2KZUA 4G6ZA 3LMMA 1ZAEA 2UUCM 4FCWA 3E4RA 3DOAA 1L2BA 4D80A 2Z7JA 2XSZD 1XNQM 4R3DA 5GKNA 4LF4M 1HNWM 4PDGA 1NJGA 1Z6TA 3FTDA 2Z3XA 3GPPA 3SARA 3U6MA 1N36M 1PJJA 3SATA 4HL4A 3U6SA 3GPXA 4DR6M 2D7EA 4WURA 1R2YA 1Z5CA 1IY2A 4L15A 3AKZA 3GRVA 4DV0M 3HJSA 3DA1A 4XBOA 4LJ4A 1N34M 1XMOM 3IG8A 1KFVA 2KEBA 4OVZA 4JI5M 4LFAM 1N78A 3GLGB 3C58A 4G4RA 1XC8A 2F5PA 2ERCA 2O5RA 4AKGA 2QBYA 2Y20A 2HCBA 4YHHM 1J09A 4ITQA 4M0DA 2L6OA 3GPUA 1GL7A 3THGA 4MGYE 3HKPA 2G5GX 2R62A 4MB7A 1NNUC 3A46A 3UMMA 1G59A 3KP0E 3PXGA 1QANA 3FUWA 2CV0A 3K2LA 3A42A 3SC3A 4AKIA 1Z5AA 4IBKA 1YSYA 4R7GA 4OU7A 1TH3A 3KOWE 3OTOM 4NXMM 5ITUA 1E94E 2KZSA 4GRIA 5BR8M 3PNVA 3DZDA 2HKJA 4IBGA 4GMQA 3HHZA 3U5ZB 3R8FA 4MH0E 4FD2A 1FJGM 3J7BA 3FUUA 3M6AA 1IXSB 3GPYA 1E9RA 4RF1A 1L8QA 4MGIE 3TPZA 3VDPA 4AG6A 5ITQA 4DV5M 1DGHA 3AOEC 3ZCBB 4DR7M 4PCZA 3EIEA 3LVWA 4I81A 4IBDA 1L2DA 3SBJA 5EP3A 2C96A 2F5SA 2P5TA 4JN6A 4L16A 2OQ4A 1I94M 5ITTA 1IBMM 1IXRC 1L1TA 3U6PA 5C18A 4X62M 2CV2A 4JI7M 2LXEA 3VKHA 2ZANA 4GC5A 1LV7A 4A3VB 3U6DA 3U61A 3ZH9B 1TDZA 4TUWA 4AKHA 3KDSE 3J80S 1XMQM 2M5ZA 1HQCA 2XEPA 2EO2A 3L2AA 1TH2A 2EA0A 3KFUG 3HJQA 1IY1A 2CEAA 3NBIA 1DGHB 1HR0M 2YQZA 1ORYB 8CATA 1SXJA 1UM8A 3FUXA 5FTKA 2QPAA 3HHYA 3QAUA 3UK6A 1NHWC 1IN7A 2VQFM 3L28A 1QVRA 4KODA 1X37A 4D82A 3U6CA 4DV7M 4NSOB 5E26A 3SYKA 1W5SA 3FUTA 4IBFA 1DGBA 1WXQA 3LQQA 4AQYM 4BLCA 2CHGA 2C9CA 3K92A 3KSJA 2ZM6M 2UUBM 4OX9M 4D81A 2R45A 1NNJA 3GQ5A 2XGNA 5KPRA 4IBBA 3TQSA 4K0KM 1SXJB 4LY6A 3SAUA 4DV3M 2LH0A 4QNMA 3GLHB 4LF7M 4M9ZA 3A98B 1HQYE 2V1UA 3K8ZA 3T1HM 2CE7A 3J7AS 3DFZA 5ITYA 2D7HA 3L29A 3T15A 4JI8M 4I5SA 3FTFA 2C98A 2DHRA 4KHPM 5EJCA 4NOOB 2AHMA 2RGHA 1W5TA 4B7FA 2HHHM 2K47A 2Y0QA 2D7GA 4GKKM 2UUAM 3JAMS 1J7KA 1XXHA 4CHTB 2DWZB 1XWIA 5FTNA 4LZZA 3GLHA 4P16A 4MGHA 4KLNA 4JI1M 4I8OA 4NXNM 3TE6A 5KO3A 5LMUM 3VDUA 2UXDM 2R18A 2XH9A 4FWHA 1MX0A 2R4JA 1JR3A 4JI6M 1NJFA 5ITRA 4JI0M 4LJ9A 5DYIA 5LMNM 4LF8M 4QHTA 4IBCA 1JQJC 3R9XB 2V1CA 3E9SA 2E5LM 3QWLA 1G4AE 4CISA 1YUBA 3KOYE 4DUYM 1DGFA 2OPFA 4B3SM 1NSFA 3U6QA 3WHKA 3J81S 2FNAA 3EIHA 4DV6M 2DWLA 1C1KA 2V6ZM 1G8PA 4HLQA 2ZAMA 4RNAA 4PDIA 4LJ8A 1Q39A 1TDHA 2FFJA 4GIPA 3AJIB 2KRKA 3D8BA 4IBJA 2BNKA 4WW0A 3K1JA 2L7HA 4QOZC 1NY6A 3VFDA 2XFTA 1N32M 3FYCA 1Z59A 5KQDA 3I4VA 1QAQA 2XSZA 1Z5BA 1IBKM
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1Z A;  4DR2 M;  3TWL A;  1Q3C A;  2Q2E B;  4X64 M;  4JI4 M;  4B3T M;  1N33 M;  1J5E M;  1PM5 A;  4DR3 M;  4LFC M;  3GP1 A;  1EE8 A;  3GQ3 A;  2VQF M;  4B3M M;  3U6C A;  4DV7 M;  2UUC M;  3JR5 A;  3SAW A;  4YY3 M;  3DOA A;  1L2B A;  1XNQ M;  4AQY M;  5IWA M;  4LF4 M;  3TWM A;  1HNW M;  4PDG A;  4LF9 M;  4G4O A;  3GPP A;  5A2Q S;  3U6L A;  3U6M A;  1N36 M;  1PJJ A;  3SAT A;  2ZM6 M;  2UUB M;  3SAR A;  3U6S A;  3GPX A;  4JI2 M;  4OX9 M;  1XNR M;  4DR6 M;  4DR1 M;  1R2Y A;  3GQ5 A;  1Z5C A;  1NNJ A;  4K0K M;  1K3X A;  4DV0 M;  3SAU A;  4DV3 M;  1MU5 A;  1N34 M;  1IBL M;  1XMO M;  1KFV A;  3VK8 A;  2F5Q A;  4LF7 M;  3U6O A;  4JI5 M;  4LFA M;  4GKJ M;  3T1H M;  3J7A S;  3C58 A;  5ITY A;  4G4R A;  2F4V M;  4DUZ M;  2XZU A;  4JI3 M;  4JI8 M;  1XC8 A;  3GO8 A;  2F5P A;  5FLX S;  4KHP M;  3JR4 A;  4YHH M;  1HNX M;  3SAS A;  4ITQ A;  2HHH M;  3GPU A;  4GKK M;  4MB7 A;  3A46 A;  2UUA M;  3JAM S;  2VQE M;  3TWK A;  2F5O A;  4DV1 M;  3A42 A;  4LF5 M;  1Z5A A;  3OTO M;  3VK7 A;  4NXM M;  5ITU A;  4JI1 M;  4NXN M;  1PJI A;  4NRW A;  5BR8 M;  5LMU M;  4DR5 M;  5IT9 S;  4X66 M;  2UXD M;  2HKJ A;  1MX0 A;  4JI6 M;  2UU9 M;  4DV2 M;  2XZF A;  5ITR A;  4JI0 M;  2UXB M;  5LMN M;  4LF8 M;  1FJG M;  4LFB M;  4G4N A;  2E5L M;  3GPY A;  5ITQ A;  4DR4 M;  4B3R M;  4DV5 M;  4CIS A;  4DUY M;  3W0F A;  5ITX E;  4DR7 M;  2ZBK B;  4PCZ A;  2OPF A;  3SAV A;  3U6Q A;  4B3S M;  1L2D A;  2F5N A;  3SBJ A;  3J81 S;  1K3W A;  2F5S A;  4JYA M;  5ITX A;  4DV4 M;  4DV6 M;  2OQ4 A;  1I94 M;  4LF6 M;  4X65 M;  5ITT A;  1IBM M;  1HNZ M;  1L1T A;  3U6P A;  3GQ4 A;  3A45 A;  4PDI A;  4X62 M;  3U6E A;  4JI7 M;  4JV5 M;  1Q39 A;  1TDH A;  1Q3B A;  1L2C A;  4PD2 A;  1TDZ A;  3U6D A;  2UXC M;  4G4Q A;  3J80 S;  1XMQ M;  1R2Z A;  1K82 A;  3T1Y M;  2EA0 A;  1N32 M;  1Z59 A;  4NRV A;  1Z5B A;  1HR0 M;  1IBK M; 
#chains in the Genus database with same CATH topology
 1L1Z A;  3TWL A;  2Q2E B;  4FW9 A;  1P3Q Q;  4B3T M;  3VKG A;  1J5E M;  2LWX A;  2QZ4 A;  3KP1 E;  2KRU A;  5IRE B;  1R6B X;  2DWN A;  3GLG E;  4B08 A;  1QQW A;  2QNJ A;  1G3I A;  3GP1 A;  3MHV C;  4B3M M;  4OVZ B;  4PT5 A;  3B74 A;  4UN2 B;  2DVW B;  4MGZ E;  1T6O A;  1IQP A;  2LBC A;  4LCB A;  4NL4 H;  5JI2 E;  2QHO B;  2XLJ A;  1IXZ A;  1R5L A;  3J27 B;  3FUV A;  1ZV1 A;  4S12 A;  4W5W A;  3CGW A;  2DXI A;  1NV9 A;  3RFW A;  3U60 B;  1TF0 B;  4IBI A;  5E6J A;  2QP9 X;  3TWM A;  2VII A;  2WSC F;  4G4O A;  3U6L A;  1QAM A;  1OIZ A;  2RGO A;  5L8R F;  1VDL A;  1IM2 A;  1XNR M;  4DR1 M;  4Z6Y A;  2QCU A;  2JUJ A;  2EUC A;  3HHW A;  3GLF A;  2J7N A;  3HJ8 A;  1GAB A;  3KVW A;  5FTJ A;  3QYE A;  5DNY A;  2LHG A;  2J7O A;  1IN8 A;  2R0I A;  3VK8 A;  3E21 A;  2F5Q A;  4Y28 F;  2G8L A;  4MM3 B;  3L25 A;  4GKJ M;  3RGP A;  2L2D A;  4AKI A;  4KO8 A;  4GC9 A;  5BPV A;  2I7N A;  1DO0 A;  1OFH A;  1GKI A;  3KW6 A;  2XZU A;  1NY5 A;  1GJS A;  1VEG A;  1WR1 B;  2DAG A;  1JB0 F;  4NC6 A;  5FLX S;  2JZ1 A;  4F1I A;  3JR4 A;  3RGS A;  3U5Z A;  3U60 A;  5KQ8 A;  2FH0 A;  2OOA A;  3VLF B;  4LJA A;  2Z4S A;  4MGK E;  1HNX M;  3SAS A;  1XHB A;  3L27 A;  4FCT A;  1QYR A;  2JY5 A;  3I01 M;  2VQE M;  3GLF B;  4DV1 M;  1SG9 A;  2DAM A;  2LNH C;  2C9O A;  1AUA A;  1KSF X;  2K0B X;  2LVO C;  2YFQ A;  4FCV A;  4LF5 M;  1DGG A;  1R7R A;  3HU2 A;  4FVM A;  1I4W A;  3GLG A;  1E9S A;  2B3T A;  3SMS A;  4DR5 M;  2LTU A;  3FKE A;  4X66 M;  5IT9 S;  3SHF A;  3FRI A;  1NHG C;  3PFI A;  3U61 B;  2O01 F;  2UU9 M;  4DV2 M;  5JI3 E;  2QBY B;  1ZMV A;  2R4E A;  1LTM A;  3C3D A;  1FNN A;  3LVV A;  3KOX E;  4IBE A;  3ZC7 B;  5C1B A;  2I7P A;  5EXX A;  3HWS A;  3AOE A;  4M9X A;  1OFI A;  4B7G A;  4DR4 M;  3AV0 A;  2KNZ A;  4ANR A;  3W0F A;  3HU3 A;  4REZ A;  3W0L B;  5ITX E;  2KNV A;  2ZBK B;  3MK6 A;  5DFL A;  3SAV A;  3HX3 A;  1E32 A;  4GHA A;  2F5N A;  3UJN A;  2GQF A;  3B9P A;  4GIT A;  2CV1 A;  3LQR A;  5ITX A;  4DV4 M;  2M60 A;  1NVM A;  1HT1 E;  2DZN B;  2WZJ A;  4LF6 M;  3HHX A;  4L8R C;  3NWL A;  2FS1 A;  2FOI C;  3CF6 E;  1TH4 A;  3M0E A;  4JV5 M;  5IZ7 D;  2Z8Y M;  1Q3B A;  2KA6 B;  2L4F A;  2R6F A;  2CHV A;  1L2C A;  4PD2 A;  2UXC M;  2L7I A;  2HL7 A;  4G4Q A;  3KOZ E;  3GLI A;  3CF2 A;  5FSW A;  1K82 A;  1SXJ D;  2X8A A;  4JXJ A;  1GVN A;  1CUK A;  1VEJ A;  1MN3 A;  4AI6 A;  5EXS A;  4NRV A;  1SXJ E;  5FTM A;  1H6U A;  2L09 A;  2DKL A;  2WSF F;  2A5Y B;  2C99 A;  4AZF A;  4IIW A;  1IN4 A;  1GLN A;  5EP1 A;  4JI4 M;  4BB9 A;  1N33 M;  1PM5 A;  4DR3 M;  3KSX A;  1JR3 D;  1QAO A;  2K6B A;  3HY5 A;  1HT2 E;  1EE8 A;  5FTL A;  2QEN A;  3ILK A;  4AW4 A;  1TGU A;  3SYL A;  3RE8 A;  3GRY A;  4FWG A;  2R65 A;  1DO2 A;  3JR5 A;  3GRR A;  1EIJ A;  3SAW A;  3KXE C;  4YY3 M;  3LCV B;  2MJ5 B;  3L26 A;  3GLI B;  3PVS A;  5IWA M;  1QUT A;  3AFH A;  3UZU A;  4LF9 M;  4NSR A;  1S3S A;  5A2Q S;  4I4L A;  4JI2 M;  2CUZ A;  2DAE A;  3B89 A;  3IHP A;  3E46 A;  1K3X A;  1XXH B;  1MU5 A;  2O25 A;  1IBL M;  1YE9 A;  4QNR A;  1ZQ9 A;  3CF0 A;  4QOS A;  2CRU A;  3TL4 X;  3U6O A;  1D2N A;  3CTW B;  3AL0 C;  2Y21 A;  4GH9 A;  2BJV A;  3MMP A;  3PNY A;  4DUZ M;  2CFO A;  3M7G A;  2F4V M;  4JI3 M;  1ZMU A;  1VDD A;  2JP7 A;  3FD9 A;  3GO8 A;  2DZO B;  2Z4R A;  2GNO A;  3SFZ A;  1D0M A;  1QZM A;  2X49 A;  5EP4 A;  4B7H A;  2KXE A;  5EXT A;  2YNM D;  4LRS A;  3MJ5 A;  4IJE A;  2DWM A;  2XF3 A;  3FRH A;  3GRU A;  4CGY B;  3K9O A;  5EP2 A;  2KNA A;  3I51 A;  3T6P A;  5EXP A;  3TWK A;  5F3W A;  2F5O A;  2ZAO A;  3SMP A;  1G41 A;  3B7Q A;  1DV0 A;  1ZMW A;  1KYI A;  7CAT A;  1NV8 A;  3VK7 A;  1N75 A;  2R46 A;  2RKO A;  2BJW A;  1PJI A;  4NRW A;  4LGY A;  3LW5 F;  1AIP C;  2Y0T A;  1OTR A;  4ZPX A;  4LGM A;  2MRO B;  4XGI A;  2XZF A;  2UXB M;  3J2P B;  3I4Y A;  4L78 A;  4LFB M;  4G4N A;  4KT0 F;  2FE8 A;  2H1R A;  4IJF A;  2WSE F;  2X4A A;  2K9D A;  3NBX X;  3T38 A;  4LZJ A;  3FTE A;  2ZTC A;  4B3R M;  1SXJ C;  1PJT A;  2JA2 A;  2OOB A;  2JXN A;  1GL6 A;  1MJG M;  1HJP A;  4JYA M;  1K3W A;  3IG5 A;  1OJL A;  3FTC A;  4FWD A;  1V33 A;  3WHL A;  5EQT A;  4X65 M;  4L4U A;  3GLH E;  4AG5 A;  4LRT A;  1HNZ M;  4II7 A;  3GQ4 A;  3A45 A;  4QHS A;  3U6E A;  4M0W A;  3H4M A;  3D8L A;  4RF0 A;  2XFS A;  4LJ5 A;  5H37 D;  3HU1 A;  4LJ6 A;  5DYG A;  4BBA A;  1D0K A;  1JR3 E;  1UFZ A;  1R2Z A;  4GHL A;  3HGI A;  2QSF X;  4OW0 A;  3ZQJ A;  4EIW A;  2C5R A;  3KS4 A;  4Z8X A;  4LG2 A;  2YR0 A;  3Q8X A;  3T1Y M;  4LJ7 A;  2NQ8 C;  1T3T A;  3AOG A;  5KPT A;  3FYD A;  2CHQ A;  3BOS A;  4DR2 M;  1N77 A;  1Q3C A;  4X64 M;  1BVS A;  1VQ1 A;  2W82 A;  1IY0 A;  1PJS A;  2HWJ A;  2KDL A;  2KW0 A;  4M9S A;  3UGJ A;  4LFC M;  3GQ3 A;  2HAK A;  3SHG B;  5KPZ A;  2MGW A;  1IN6 A;  1IN5 A;  2KZU A;  2JY6 B;  4G6Z A;  3LMM A;  1ZAE A;  2OO9 A;  2UUC M;  4FCW A;  3E4R A;  2KHH A;  3DOA A;  1L2B A;  4D80 A;  2Z7J A;  2XSZ D;  1XNQ M;  4R3D A;  5GKN A;  4LF4 M;  1HNW M;  4CIZ A;  4Q7J A;  1NJG A;  1Z6T A;  3FTD A;  4PDG A;  2Z3X A;  3GPP A;  3SAR A;  3U6M A;  2JNH A;  1PJJ A;  1N36 M;  3SAT A;  4HL4 A;  3U6S A;  3GPX A;  4DR6 M;  2D7E A;  4WUR A;  1VEK A;  1R2Y A;  1Z5C A;  2APL A;  1IY2 A;  4L15 A;  1TTE A;  3AKZ A;  3GRV A;  4DV0 M;  2VF8 A;  3HJS A;  3DA1 A;  4XBO A;  4LJ4 A;  1N34 M;  1GO5 A;  1XMO M;  3IG8 A;  1KFV A;  2KEB A;  4OVZ A;  4JI5 M;  4LFA M;  1N78 A;  3GLG B;  4GEW A;  3C58 A;  4G4R A;  2G3Q A;  2CP8 A;  1XC8 A;  2F5P A;  2ERC A;  2O5R A;  4AKG A;  2QBY A;  2Y20 A;  3KS8 A;  1IXS A;  2HCB A;  4YHH M;  1J09 A;  4ITQ A;  4M0D A;  1RU3 A;  2L6O A;  3GPU A;  4F2L A;  1GL7 A;  3THG A;  4MGY E;  2QQ8 A;  2G5G X;  2R62 A;  3HKP A;  1NNU C;  4MB7 A;  3A46 A;  3UMM A;  2L4E A;  3KP0 E;  3PXG A;  1G59 A;  1QAN A;  3FUW A;  1R4G A;  2CV0 A;  3K2L A;  3A42 A;  3SC3 A;  4R71 A;  1Z5A A;  3B7Z A;  1YSY A;  4IBK A;  4R7G A;  2EKF A;  4OU7 A;  1TH3 A;  3KOW E;  2LVN C;  3OTO M;  4NXM M;  5ITU A;  1E94 E;  2N35 A;  2KZS A;  4GRI A;  5BR8 M;  3PNV A;  3DZD A;  2JZ0 A;  2RRU A;  2HKJ A;  3K9P A;  4IBG A;  4GMQ A;  3HHZ A;  3U5Z B;  3R8F A;  4MH0 E;  4FD2 A;  1FJG M;  3J7B A;  3FUU A;  2J5Y A;  1IXS B;  2MH8 A;  3M6A A;  2JWS A;  2BWB A;  1F4I A;  3GPY A;  1E9R A;  4RF1 A;  1L8Q A;  4MGI E;  3TPZ A;  3VDP A;  4AG6 A;  3BXW A;  5ITQ A;  3QYB A;  4DV5 M;  4XK8 F;  1DGH A;  3AOE C;  3ZCB B;  4DR7 M;  4PCZ A;  3EIE A;  3LVW A;  4I81 A;  4IBD A;  2DEN A;  3SBJ A;  1L2D A;  2LVP C;  5EP3 A;  2C96 A;  2F5S A;  2P5T A;  4JN6 A;  4L16 A;  1VG5 A;  1WHC A;  2OQ4 A;  3H4J A;  1I94 M;  1PGY A;  1Q02 A;  5ITT A;  1IBM M;  2LVA A;  3GLF E;  1IXR C;  1L1T A;  3U6P A;  5C18 A;  4X62 M;  2CV2 A;  1WGN A;  2LXE A;  4JI7 M;  3VKH A;  2ZAN A;  4GC5 A;  1LV7 A;  4A3V B;  3U6D A;  3U61 A;  3ZH9 B;  1TDZ A;  4TUW A;  4AKH A;  3KDS E;  1WGL A;  3J80 S;  1XMQ M;  1G71 A;  2M5Z A;  3V76 A;  1HQC A;  2XEP A;  2EO2 A;  3L2A A;  3HZJ A;  1TH2 A;  2EA0 A;  3KFU G;  3FE3 A;  3LCU A;  3HJQ A;  1IY1 A;  1OAO C;  2CEA A;  3NBI A;  1DGH B;  1HR0 M;  2YQZ A;  3IEC A;  1ORY B;  8CAT A;  1SXJ A;  1UM8 A;  3FUX A;  5FTK A;  1OAI A;  2QPA A;  3HHY A;  3QAU A;  3UK6 A;  4DBG B;  3C3E A;  1PRB A;  1NHW C;  1IN7 A;  4G3O A;  2VQF M;  4WP2 A;  3L28 A;  1QVR A;  4KOD A;  1X37 A;  4D82 A;  3U6C A;  4DV7 M;  4NSO B;  3I04 M;  5E26 A;  3SYK A;  1W5S A;  3FUT A;  4IBF A;  1DGB A;  1WXQ A;  1OKS A;  3LQQ A;  4AQY M;  4BLC A;  1TR8 A;  2C9C A;  2CHG A;  3K92 A;  3KSJ A;  2ZM6 M;  2UUB M;  4RKU F;  1QUS A;  4OX9 M;  4D81 A;  2R45 A;  1NNJ A;  3GQ5 A;  1D0L A;  2XGN A;  4IBB A;  3TQS A;  5KPR A;  4K0K M;  1SXJ B;  1NO1 A;  2CWB A;  4LY6 A;  3SAU A;  4DV3 M;  2DAI A;  2LH0 A;  1OQY A;  3GLH B;  4QNM A;  2R44 A;  4LF7 M;  4M9Z A;  3A98 B;  1HQY E;  2V1U A;  3K8Z A;  2BWE A;  3T1H M;  2CE7 A;  3J7A S;  2DAK A;  3DFZ A;  5ITY A;  2D7H A;  3L29 A;  2DHY A;  3T15 A;  4JI8 M;  4I5S A;  1GJT A;  3FTF A;  2C98 A;  2DHR A;  1WIV A;  4KHP M;  5EJC A;  1V92 A;  2JY7 A;  4NOO B;  2AHM A;  1C7Y A;  3C9P A;  1T43 A;  2RGH A;  1W5T A;  4B7F A;  2HHH M;  2K47 A;  3Q8G A;  2VDB B;  2Y0Q A;  3F92 A;  2D7G A;  3B7N A;  4GKK M;  1YLA A;  1QDT A;  2JY8 A;  2UUA M;  3JAM S;  1J7K A;  4L6V 6;  1XXH A;  4CHT B;  1OIP A;  2DWZ B;  1XWI A;  5FTN A;  4LZZ A;  3GLH A;  4P16 A;  4MGH A;  4KLN A;  4JI1 M;  2DNA A;  4I8O A;  1XXH E;  4NXN M;  3TE6 A;  5KO3 A;  5LMU M;  3VDU A;  2EKK A;  2DI0 A;  1XB2 B;  4CJ6 A;  2R18 A;  2XH9 A;  2UXD M;  4FWH A;  1MX0 A;  2R4J A;  1JR3 A;  4JI6 M;  1NJF A;  5ITR A;  4JI0 M;  4LJ9 A;  5DYI A;  5LMN M;  4LF8 M;  4QHT A;  4IBC A;  1JQJ C;  1EFU B;  2V1C A;  3E9S A;  1QZE A;  2E5L M;  3R9X B;  3QWL A;  2VF7 A;  1G4A E;  1Y8G A;  4CIS A;  1YUB A;  3KOY E;  3W67 A;  4DUY M;  3W68 A;  1DGF A;  2OPF A;  4B3S M;  1NSF A;  3U6Q A;  3WHK A;  3J81 S;  2FNA A;  3EIH A;  4DV6 M;  2DWL A;  1C1K A;  2H5X A;  2V6Z M;  1A5T A;  1G8P A;  4HLQ A;  2LVQ D;  2ZAM A;  1V34 A;  2ZTD A;  4RNA A;  3GLI E;  4PDI A;  4LJ8 A;  1WJ7 A;  1Q39 A;  1TDH A;  2FFJ A;  4GIP A;  1IFY A;  3AJI B;  2KRK A;  3D8B A;  4IBJ A;  2BNK A;  4WW0 A;  2DZL A;  2L7H A;  2LHC A;  3BBZ A;  3K1J A;  4QOZ C;  1QDR A;  1NY6 A;  3VFD A;  1PJQ A;  2EJS A;  2XFT A;  1N32 M;  3FYC A;  1Z59 A;  5KQD A;  3I4V A;  1QAQ A;  2XSZ A;  1Z5B A;  4P17 A;  2MR9 A;  4HEO A;  1IBK M; 
#chains in the Genus database with same CATH homology
 1L1Z A;  3TWL A;  2Q2E B;  4FW9 A;  4B3T M;  3VKG A;  1J5E M;  2LWX A;  2QZ4 A;  3KP1 E;  2KRU A;  5IRE B;  1R6B X;  2DWN A;  4B08 A;  1QQW A;  1G3I A;  3GP1 A;  3MHV C;  4B3M M;  4OVZ B;  4PT5 A;  2DVW B;  4MGZ E;  4LCB A;  1IQP A;  4NL4 H;  5JI2 E;  2XLJ A;  1IXZ A;  3J27 B;  3FUV A;  4S12 A;  4W5W A;  2DXI A;  3RFW A;  3U60 B;  4IBI A;  5E6J A;  2QP9 X;  3TWM A;  2VII A;  4G4O A;  3U6L A;  1QAM A;  2RGO A;  1IM2 A;  1XNR M;  4DR1 M;  4Z6Y A;  2QCU A;  3HHW A;  2EUC A;  3GLF A;  2J7N A;  3HJ8 A;  3KVW A;  5FTJ A;  5DNY A;  2J7O A;  1IN8 A;  3L25 A;  3VK8 A;  2F5Q A;  2G8L A;  4MM3 B;  4GKJ M;  3RGP A;  4KO8 A;  4GC9 A;  5BPV A;  2I7N A;  1DO0 A;  1OFH A;  1GKI A;  3KW6 A;  2XZU A;  1NY5 A;  5FLX S;  3JR4 A;  3RGS A;  3U5Z A;  3U60 A;  5KQ8 A;  3VLF B;  4LJA A;  2Z4S A;  4MGK E;  1HNX M;  3SAS A;  1XHB A;  3L27 A;  4FCT A;  1QYR A;  2VQE M;  3GLF B;  4DV1 M;  2LNH C;  2C9O A;  4LF5 M;  1KSF X;  4FCV A;  2YFQ A;  1DGG A;  1R7R A;  3HU2 A;  4FVM A;  1I4W A;  3GLG A;  1E9S A;  3SMS A;  4DR5 M;  5IT9 S;  3FKE A;  4X66 M;  3SHF A;  1NHG C;  3PFI A;  3U61 B;  2UU9 M;  4DV2 M;  5JI3 E;  2QBY B;  3ZC7 B;  2R4E A;  3LVV A;  5KPZ A;  1FNN A;  5C1B A;  3KOX E;  4IBE A;  2I7P A;  5EXX A;  3HWS A;  3AOE A;  4M9X A;  1OFI A;  4B7G A;  4DR4 M;  3AV0 A;  3W0F A;  3HU3 A;  4REZ A;  3W0L B;  5ITX E;  2ZBK B;  3SAV A;  3MK6 A;  4GHA A;  1E32 A;  2F5N A;  3UJN A;  3B9P A;  4GIT A;  2CV1 A;  3LQR A;  5ITX A;  4DV4 M;  1NVM A;  1HT1 E;  2DZN B;  2M60 A;  4LF6 M;  3HHX A;  4L8R C;  3NWL A;  2FOI C;  3CF6 E;  1TH4 A;  3M0E A;  4JV5 M;  5IZ7 D;  1Q3B A;  2KA6 B;  2CHV A;  1L2C A;  4PD2 A;  2UXC M;  2L7I A;  2HL7 A;  4G4Q A;  3KOZ E;  3GLI A;  3CF2 A;  5FSW A;  1K82 A;  1SXJ D;  2X8A A;  4JXJ A;  1GVN A;  4AI6 A;  5EXS A;  4NRV A;  1SXJ E;  5FTM A;  1H6U A;  2L09 A;  2A5Y B;  2C99 A;  4AZF A;  4IIW A;  1IN4 A;  1GLN A;  5EP1 A;  4JI4 M;  4BB9 A;  1N33 M;  1PM5 A;  4DR3 M;  3KSX A;  1JR3 D;  1QAO A;  1HT2 E;  1EE8 A;  5FTL A;  2QEN A;  3ILK A;  4AW4 A;  1TGU A;  3SYL A;  3RE8 A;  3GRY A;  4FWG A;  2R65 A;  1DO2 A;  3JR5 A;  3GRR A;  3SAW A;  3KXE C;  4YY3 M;  3L26 A;  3GLI B;  3PVS A;  5IWA M;  3UZU A;  3AFH A;  4LF9 M;  4NSR A;  1S3S A;  5A2Q S;  4I4L A;  4JI2 M;  2CUZ A;  1K3X A;  1XXH B;  1MU5 A;  1IBL M;  1YE9 A;  4QNR A;  1ZQ9 A;  3CF0 A;  4QOS A;  3TL4 X;  3U6O A;  1D2N A;  3CTW B;  3AL0 C;  2Y21 A;  4GH9 A;  2BJV A;  3PNY A;  2F4V M;  4DUZ M;  2CFO A;  3M7G A;  3KS8 A;  4JI3 M;  1VDD A;  3FD9 A;  3GO8 A;  2DZO B;  2Z4R A;  3SFZ A;  1QZM A;  2X49 A;  5EP4 A;  4B7H A;  2KXE A;  5EXT A;  2YNM D;  4LRS A;  3MJ5 A;  4IJE A;  2DWM A;  2XF3 A;  3GRU A;  4CGY B;  5EP2 A;  3I51 A;  3TWK A;  5F3W A;  5EXP A;  2F5O A;  2ZAO A;  3SMP A;  1G41 A;  1KYI A;  7CAT A;  3VK7 A;  1N75 A;  2R46 A;  2RKO A;  2BJW A;  1PJI A;  4NRW A;  4LGY A;  2Y0T A;  4ZPX A;  4LGM A;  2XZF A;  4XGI A;  2UXB M;  3J2P B;  3I4Y A;  4L78 A;  4LFB M;  4G4N A;  2FE8 A;  2H1R A;  4IJF A;  2X4A A;  3T38 A;  4LZJ A;  3FTE A;  4B3R M;  1SXJ C;  2JA2 A;  1GL6 A;  4JYA M;  1K3W A;  3IG5 A;  1OJL A;  3FTC A;  4FWD A;  3WHL A;  5EQT A;  4X65 M;  4L4U A;  4AG5 A;  4LRT A;  1HNZ M;  4II7 A;  3GQ4 A;  3A45 A;  4QHS A;  3U6E A;  4M0W A;  3H4M A;  3D8L A;  4RF0 A;  2XFS A;  4LJ5 A;  5H37 D;  3HU1 A;  4LJ6 A;  5DYG A;  4BBA A;  1R2Z A;  4GHL A;  3HGI A;  4OW0 A;  4LG2 A;  2C5R A;  4EIW A;  3KS4 A;  4Z8X A;  2YR0 A;  3Q8X A;  3T1Y M;  4LJ7 A;  2NQ8 C;  1T3T A;  3AOG A;  5KPT A;  3FYD A;  2CHQ A;  3BOS A;  4DR2 M;  1N77 A;  1Q3C A;  4X64 M;  2W82 A;  1IY0 A;  2KW0 A;  3UGJ A;  4M9S A;  4LFC M;  3GQ3 A;  3SHG B;  1IN6 A;  1IN5 A;  2KZU A;  4G6Z A;  3LMM A;  1ZAE A;  2UUC M;  4FCW A;  3E4R A;  3DOA A;  1L2B A;  4D80 A;  2Z7J A;  2XSZ D;  1XNQ M;  4R3D A;  5GKN A;  4LF4 M;  1HNW M;  4PDG A;  1NJG A;  1Z6T A;  3FTD A;  2Z3X A;  3GPP A;  3SAR A;  3U6M A;  1N36 M;  1PJJ A;  3SAT A;  4HL4 A;  3U6S A;  3GPX A;  4DR6 M;  2D7E A;  4WUR A;  1R2Y A;  1Z5C A;  1IY2 A;  4L15 A;  3AKZ A;  3GRV A;  4DV0 M;  3HJS A;  3DA1 A;  4XBO A;  4LJ4 A;  1N34 M;  1XMO M;  3IG8 A;  1KFV A;  2KEB A;  4OVZ A;  4JI5 M;  4LFA M;  1N78 A;  3GLG B;  3C58 A;  4G4R A;  1XC8 A;  2F5P A;  2ERC A;  2O5R A;  4AKG A;  2QBY A;  2Y20 A;  2HCB A;  4YHH M;  1J09 A;  4ITQ A;  4M0D A;  2L6O A;  3GPU A;  1GL7 A;  3THG A;  4MGY E;  3HKP A;  2G5G X;  2R62 A;  4MB7 A;  1NNU C;  3A46 A;  3UMM A;  1G59 A;  3KP0 E;  3PXG A;  1QAN A;  3FUW A;  2CV0 A;  3K2L A;  3A42 A;  3SC3 A;  4AKI A;  1Z5A A;  4IBK A;  1YSY A;  4R7G A;  4OU7 A;  1TH3 A;  3KOW E;  3OTO M;  4NXM M;  5ITU A;  1E94 E;  2KZS A;  4GRI A;  5BR8 M;  3PNV A;  3DZD A;  2HKJ A;  4IBG A;  4GMQ A;  3HHZ A;  3U5Z B;  3R8F A;  4MH0 E;  4FD2 A;  1FJG M;  3J7B A;  3FUU A;  3M6A A;  1IXS B;  3GPY A;  1E9R A;  4RF1 A;  1L8Q A;  4MGI E;  3TPZ A;  3VDP A;  4AG6 A;  5ITQ A;  4DV5 M;  1DGH A;  3AOE C;  3ZCB B;  4DR7 M;  4PCZ A;  3EIE A;  3LVW A;  4I81 A;  4IBD A;  1L2D A;  3SBJ A;  5EP3 A;  2C96 A;  2F5S A;  2P5T A;  4JN6 A;  4L16 A;  2OQ4 A;  1I94 M;  5ITT A;  1IBM M;  1IXR C;  1L1T A;  3U6P A;  5C18 A;  4X62 M;  2CV2 A;  4JI7 M;  2LXE A;  3VKH A;  2ZAN A;  4GC5 A;  1LV7 A;  4A3V B;  3U6D A;  3U61 A;  3ZH9 B;  1TDZ A;  4TUW A;  4AKH A;  3KDS E;  3J80 S;  1XMQ M;  2M5Z A;  1HQC A;  2XEP A;  2EO2 A;  3L2A A;  1TH2 A;  2EA0 A;  3KFU G;  3HJQ A;  1IY1 A;  2CEA A;  3NBI A;  1DGH B;  1HR0 M;  2YQZ A;  1ORY B;  8CAT A;  1SXJ A;  1UM8 A;  3FUX A;  5FTK A;  2QPA A;  3HHY A;  3QAU A;  3UK6 A;  1NHW C;  1IN7 A;  2VQF M;  3L28 A;  1QVR A;  4KOD A;  1X37 A;  4D82 A;  3U6C A;  4DV7 M;  4NSO B;  5E26 A;  3SYK A;  1W5S A;  3FUT A;  4IBF A;  1DGB A;  1WXQ A;  3LQQ A;  4AQY M;  4BLC A;  2CHG A;  2C9C A;  3K92 A;  3KSJ A;  2ZM6 M;  2UUB M;  4OX9 M;  4D81 A;  2R45 A;  1NNJ A;  3GQ5 A;  2XGN A;  5KPR A;  4IBB A;  3TQS A;  4K0K M;  1SXJ B;  4LY6 A;  3SAU A;  4DV3 M;  2LH0 A;  4QNM A;  3GLH B;  4LF7 M;  4M9Z A;  3A98 B;  1HQY E;  2V1U A;  3K8Z A;  3T1H M;  2CE7 A;  3J7A S;  3DFZ A;  5ITY A;  2D7H A;  3L29 A;  3T15 A;  4JI8 M;  4I5S A;  3FTF A;  2C98 A;  2DHR A;  4KHP M;  5EJC A;  4NOO B;  2AHM A;  2RGH A;  1W5T A;  4B7F A;  2HHH M;  2K47 A;  2Y0Q A;  2D7G A;  4GKK M;  2UUA M;  3JAM S;  1J7K A;  1XXH A;  4CHT B;  2DWZ B;  1XWI A;  5FTN A;  4LZZ A;  3GLH A;  4P16 A;  4MGH A;  4KLN A;  4JI1 M;  4I8O A;  4NXN M;  3TE6 A;  5KO3 A;  5LMU M;  3VDU A;  2UXD M;  2R18 A;  2XH9 A;  4FWH A;  1MX0 A;  2R4J A;  1JR3 A;  4JI6 M;  1NJF A;  5ITR A;  4JI0 M;  4LJ9 A;  5DYI A;  5LMN M;  4LF8 M;  4QHT A;  4IBC A;  1JQJ C;  3R9X B;  2V1C A;  3E9S A;  2E5L M;  3QWL A;  1G4A E;  4CIS A;  1YUB A;  3KOY E;  4DUY M;  1DGF A;  2OPF A;  4B3S M;  1NSF A;  3U6Q A;  3WHK A;  3J81 S;  2FNA A;  3EIH A;  4DV6 M;  2DWL A;  1C1K A;  2V6Z M;  1G8P A;  4HLQ A;  2ZAM A;  4RNA A;  4PDI A;  4LJ8 A;  1Q39 A;  1TDH A;  2FFJ A;  4GIP A;  3AJI B;  2KRK A;  3D8B A;  4IBJ A;  2BNK A;  4WW0 A;  3K1J A;  2L7H A;  4QOZ C;  1NY6 A;  3VFD A;  2XFT A;  1N32 M;  3FYC A;  1Z59 A;  5KQD A;  3I4V A;  1QAQ A;  2XSZ A;  1Z5B A;  1IBK M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...