4NSLA

X-ray crystal structure of adenylosuccinate lyase from salmonella typhimurium
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
456
structure length
446
Chain Sequence
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADANGYLDTLVANFNEEDAARIKTIERTTNHDVKAVEYFLKEKVAAIPALHDVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQVINAVKDLATQYRDIPLLSRTHGQPATPSTLGKEMANVAYRMERQFRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCIARFNTILIDFDRDVWGYIALNHFKQKTMPHKVNPIDFENSEGNLGLSNAVLHHLANKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRKRVDAEGMKQFIDSLALPEAEKTRLKAMTPANYIGRAVTLVDELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenylosuccinate lyase
publication title Crystallographic and kinetic studies on Adenylosuccinate Lyase from Salmonella typhimurium
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
total genus 155
structure length 446
sequence length 456
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 4nslA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 4nslA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 4nslA02
1YFEA 2QGAB 3R6YA 3R6QA 1Y2MA 2RJSA 1FUOA 4BABA 4CQ5A 3OCEA 4NSLA 1U15A 3RRPA 4ADMA 2HVGA 2NYFA 2FUSA 3C8TA 1DCNA 3KDYA 4HGVA 1AUWA 1JSWA 1TJWA 5F92A 4ADLA 3R6VA 2O7BA 1T6PA 4FFXA 3QBPA 1J3UA 3OCFA 1GKJA 2PTRA 1DOFA 2PFMA 2PTSA 2O7DA 1TJUA 3NO9A 4FLCA 4C6GA 1FUPA 3GTDA 4C5RA 2E9FA 4V2QA 1FUQA 4EFCA 1B8FA 1C3UA 3TV2A 1TJVA 1T6JA 2OHYA 1GK2A 3E04A 1TJ7A 2QVEA 1EB4A 1XWOA 4NLEA 1VDKA 2O7FA 4MX2A 2O78A 1U16A 1KQ7A 4APBA 2PTQA 4BAAA 3RD8A 1W27A 1HY0A 2YIIA 5D6BA 2O6YA 1YISA 3CZOA 3UNVA 5F91A 4C5SA 4C5UA 3BHGA 1GK3A 4APAA 1K7WA 2O7EA 3NZ4A 4V2RA 1K62A 2RJRA 2J91A 3GZHA 1Q5NA 2VD6A 2X75A 5EYVA 1C3CA 4EEIA 5HW2A 2NYNA 1GKMA 1HY1A 1RE5A 3KDZA 1FURA 1I0AA 1YFMA 5EYTA
chains in the Genus database with same CATH superfamily
1YFEA 2JAUA 4NFLA 2QGAB 3R6YA 4MUMA 3R6QA 1Z4PX 1Y2MA 2JAWA 3F4SA 2RJSA 1Z4MA 1MH9A 1FUOA 4BABA 4CQ5A 3OCEA 4NSLA 4L57A 1U15A 3RRPA 4ADMA 2HVGA 4YIKA 2NYFA 2FUSA 3C8TA 2FELA 1DCNA 3KDYA 1XL7A 4HGVA 1AUWA 1JSWA 1TJWA 5F92A 2JARA 4ADLA 3R6VA 2O7BA 1T6PA 1XMCA 4FFXA 3QBPA 1J3UA 3OCFA 1GKJA 2PTRA 1DOFA 1XMDA 1T9HA 3CRW1 2PFMA 2PTSA 1U0LA 2O7DA 1TJUA 3CRVA 1XLYA 3NO9A 4FLCA 4C6GA 1FUPA 2VL7A 1Z4JA 3U13A 3GTDA 4C5RA 2E9FA 4V2QA 1FUQA 2VSFA 4EFCA 1Z4QA 1B8FA 1C3UA 1Z4KA 5M0IA 3TV2A 1TJVA 3F4TA 1T6JA 2OHYA 1GK2A 3E04A 1TJ7A 2QVEA 1Z4LA 4MWOA 4A15A 1EB4A 1Q91A 4IQJM 1XWOA 4NLEA 1VDKA 2O7FA 4MX2A 2O78A 1U16A 1KQ7A 4APBA 2PTQA 4BAAA 1Q92A 3RD8A 1Z4IA 1W27A 3F4RA 4YIHA 1HY0A 2RCNA 2YV5A 1XL8A 2YIIA 1IW7D 5D6BA 2O6YA 4L6AA 1YISA 3CZOA 3UNVA 5F91A 4C5SA 5M0JA 4C5UA 3BHGA 1GK3A 4E88A 4APAA 1K7WA 2O7EA 3NZ4A 4V2RA 1K62A 2RJRA 2J91A 2FENA 4WNLA 2D27A 3GZHA 1Q5NA 2VD6A 2D28C 2X75A 3BWVA 5EYVA 1C3CA 3CI0K 3U19A 4L6CA 4EEIA 5HW2A 2JAOA 2NYNA 1GKMA 1HY1A 1RE5A 5H8WA 3KDZA 1FURA 2I7DA 1I0AA 1YFMA 5EYTA
chains in the Genus database with same CATH topology
1YFEA 2QGAB 3R6YA 3R6QA 1Y2MA 2RJSA 1FUOA 4BABA 4CQ5A 3OCEA 4NSLA 1U15A 3RRPA 4ADMA 2HVGA 2NYFA 2FUSA 3C8TA 1DCNA 3KDYA 4HGVA 1AUWA 1JSWA 1TJWA 5F92A 4ADLA 3R6VA 2O7BA 1T6PA 4FFXA 3QBPA 1J3UA 3OCFA 1GKJA 2PTRA 1DOFA 2PFMA 2PTSA 2O7DA 1TJUA 3NO9A 4FLCA 4C6GA 1FUPA 3GTDA 4C5RA 2E9FA 4V2QA 1FUQA 4EFCA 1B8FA 1C3UA 3TV2A 1TJVA 1T6JA 2OHYA 1GK2A 3E04A 1TJ7A 2QVEA 1EB4A 1XWOA 4NLEA 1VDKA 2O7FA 4MX2A 2O78A 1U16A 1KQ7A 4APBA 2PTQA 4BAAA 3RD8A 1W27A 1HY0A 2YIIA 5D6BA 2O6YA 1YISA 3CZOA 3UNVA 5F91A 4C5SA 4C5UA 3BHGA 1GK3A 4APAA 1K7WA 2O7EA 3NZ4A 4V2RA 1K62A 2RJRA 2J91A 3GZHA 1Q5NA 2VD6A 2X75A 5EYVA 1C3CA 4EEIA 5HW2A 2NYNA 1GKMA 1HY1A 1RE5A 3KDZA 1FURA 1I0AA 1YFMA 5EYTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YFE A;  2QGA B;  3R6Y A;  3R6Q A;  1Y2M A;  2RJS A;  1FUO A;  4BAB A;  4CQ5 A;  3OCE A;  4NSL A;  1U15 A;  3RRP A;  4ADM A;  2HVG A;  2NYF A;  2FUS A;  3C8T A;  1DCN A;  3KDY A;  4HGV A;  1AUW A;  1JSW A;  1TJW A;  5F92 A;  4ADL A;  3R6V A;  2O7B A;  1T6P A;  4FFX A;  3QBP A;  1J3U A;  3OCF A;  1GKJ A;  2PTR A;  1DOF A;  2PFM A;  2PTS A;  2O7D A;  1TJU A;  3NO9 A;  4FLC A;  4C6G A;  1FUP A;  3GTD A;  4C5R A;  2E9F A;  4V2Q A;  1FUQ A;  4EFC A;  1B8F A;  1C3U A;  3TV2 A;  1TJV A;  1T6J A;  2OHY A;  1GK2 A;  3E04 A;  1TJ7 A;  2QVE A;  1EB4 A;  1XWO A;  4NLE A;  1VDK A;  2O7F A;  4MX2 A;  2O78 A;  1U16 A;  1KQ7 A;  4APB A;  2PTQ A;  4BAA A;  3RD8 A;  1W27 A;  1HY0 A;  2YII A;  5D6B A;  2O6Y A;  1YIS A;  3CZO A;  3UNV A;  5F91 A;  4C5S A;  4C5U A;  3BHG A;  1GK3 A;  4APA A;  1K7W A;  2O7E A;  3NZ4 A;  4V2R A;  1K62 A;  2RJR A;  2J91 A;  3GZH A;  1Q5N A;  2VD6 A;  2X75 A;  5EYV A;  1C3C A;  4EEI A;  5HW2 A;  2NYN A;  1GKM A;  1HY1 A;  1RE5 A;  3KDZ A;  1FUR A;  1I0A A;  1YFM A;  5EYT A; 
#chains in the Genus database with same CATH topology
 1YFE A;  2JAU A;  4NFL A;  2QGA B;  3R6Y A;  4MUM A;  3R6Q A;  1Z4P X;  1Y2M A;  2JAW A;  3F4S A;  2RJS A;  1Z4M A;  1MH9 A;  1FUO A;  4BAB A;  4CQ5 A;  3OCE A;  4NSL A;  4L57 A;  1U15 A;  3RRP A;  4ADM A;  2HVG A;  4YIK A;  2NYF A;  2FUS A;  3C8T A;  2FEL A;  1DCN A;  3KDY A;  1XL7 A;  4HGV A;  1AUW A;  1JSW A;  1TJW A;  5F92 A;  2JAR A;  4ADL A;  3R6V A;  2O7B A;  1T6P A;  1XMC A;  4FFX A;  3QBP A;  1J3U A;  3OCF A;  1GKJ A;  2PTR A;  1DOF A;  1XMD A;  1T9H A;  3CRW 1;  2PFM A;  2PTS A;  1U0L A;  2O7D A;  1TJU A;  3CRV A;  1XLY A;  3NO9 A;  4FLC A;  4C6G A;  1FUP A;  2VL7 A;  1Z4J A;  3U13 A;  3GTD A;  4C5R A;  2E9F A;  4V2Q A;  1FUQ A;  2VSF A;  4EFC A;  1Z4Q A;  1B8F A;  1C3U A;  1Z4K A;  5M0I A;  3TV2 A;  1TJV A;  3F4T A;  1T6J A;  2OHY A;  1GK2 A;  3E04 A;  1TJ7 A;  2QVE A;  1Z4L A;  4MWO A;  4A15 A;  1EB4 A;  1Q91 A;  4IQJ M;  1XWO A;  4NLE A;  1VDK A;  2O7F A;  4MX2 A;  2O78 A;  1U16 A;  1KQ7 A;  4APB A;  2PTQ A;  4BAA A;  1Q92 A;  3RD8 A;  1Z4I A;  1W27 A;  3F4R A;  4YIH A;  1HY0 A;  2RCN A;  2YV5 A;  1XL8 A;  2YII A;  1IW7 D;  5D6B A;  2O6Y A;  4L6A A;  1YIS A;  3CZO A;  3UNV A;  5F91 A;  4C5S A;  5M0J A;  4C5U A;  3BHG A;  1GK3 A;  4E88 A;  4APA A;  1K7W A;  2O7E A;  3NZ4 A;  4V2R A;  1K62 A;  2RJR A;  2J91 A;  2FEN A;  4WNL A;  2D27 A;  3GZH A;  1Q5N A;  2VD6 A;  2D28 C;  2X75 A;  3BWV A;  5EYV A;  1C3C A;  3CI0 K;  3U19 A;  4L6C A;  4EEI A;  5HW2 A;  2JAO A;  2NYN A;  1GKM A;  1HY1 A;  1RE5 A;  5H8W A;  3KDZ A;  1FUR A;  2I7D A;  1I0A A;  1YFM A;  5EYT A; 
#chains in the Genus database with same CATH homology
 1YFE A;  2QGA B;  3R6Y A;  3R6Q A;  1Y2M A;  2RJS A;  1FUO A;  4BAB A;  4CQ5 A;  3OCE A;  4NSL A;  1U15 A;  3RRP A;  4ADM A;  2HVG A;  2NYF A;  2FUS A;  3C8T A;  1DCN A;  3KDY A;  4HGV A;  1AUW A;  1JSW A;  1TJW A;  5F92 A;  4ADL A;  3R6V A;  2O7B A;  1T6P A;  4FFX A;  3QBP A;  1J3U A;  3OCF A;  1GKJ A;  2PTR A;  1DOF A;  2PFM A;  2PTS A;  2O7D A;  1TJU A;  3NO9 A;  4FLC A;  4C6G A;  1FUP A;  3GTD A;  4C5R A;  2E9F A;  4V2Q A;  1FUQ A;  4EFC A;  1B8F A;  1C3U A;  3TV2 A;  1TJV A;  1T6J A;  2OHY A;  1GK2 A;  3E04 A;  1TJ7 A;  2QVE A;  1EB4 A;  1XWO A;  4NLE A;  1VDK A;  2O7F A;  4MX2 A;  2O78 A;  1U16 A;  1KQ7 A;  4APB A;  2PTQ A;  4BAA A;  3RD8 A;  1W27 A;  1HY0 A;  2YII A;  5D6B A;  2O6Y A;  1YIS A;  3CZO A;  3UNV A;  5F91 A;  4C5S A;  4C5U A;  3BHG A;  1GK3 A;  4APA A;  1K7W A;  2O7E A;  3NZ4 A;  4V2R A;  1K62 A;  2RJR A;  2J91 A;  3GZH A;  1Q5N A;  2VD6 A;  2X75 A;  5EYV A;  1C3C A;  4EEI A;  5HW2 A;  2NYN A;  1GKM A;  1HY1 A;  1RE5 A;  3KDZ A;  1FUR A;  1I0A A;  1YFM A;  5EYT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...