4NSLA

X-ray crystal structure of adenylosuccinate lyase from salmonella typhimurium
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
456
structure length
446
Chain Sequence
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADANGYLDTLVANFNEEDAARIKTIERTTNHDVKAVEYFLKEKVAAIPALHDVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQVINAVKDLATQYRDIPLLSRTHGQPATPSTLGKEMANVAYRMERQFRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCIARFNTILIDFDRDVWGYIALNHFKQKTMPHKVNPIDFENSEGNLGLSNAVLHHLANKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRKRVDAEGMKQFIDSLALPEAEKTRLKAMTPANYIGRAVTLVDELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and kinetic studies on Adenylosuccinate Lyase from Salmonella typhimurium
rcsb
molecule keywords Adenylosuccinate lyase
molecule tags Lyase
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 155
structure length 446
sequence length 456
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 4nslA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 4nslA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 4nslA02
4BAAA 3RRPA 1W27A 2RJSA 2PFMA 1TJ7A 3OCEA 4HGVA 1J3UA 2O6YA 4C6GA 4V2RA 1C3CA 1U16A 2J91A 1JSWA 3E04A 1GKMA 1K62A 2FUSA 1T6PA 1XWOA 5HW2A 4APAA 5F91A 1VDKA 2QVEA 2X75A 1EB4A 2YIIA 1C3UA 3TV2A 2O7DA 1B8FA 2VD6A 3NO9A 1HY0A 3C8TA 1T6JA 2O7BA 1TJUA 1DCNA 3R6QA 1TJVA 1KQ7A 1YFEA 3R6VA 5EYVA 4V2QA 4FLCA 3UNVA 1FUQA 2O78A 2O7FA 4C5SA 3KDYA 4ADLA 1FUOA 1GKJA 5D6BA 2QGAB 3QBPA 2OHYA 4MX2A 1GK2A 2NYFA 2RJRA 3KDZA 4EEIA 1DOFA 3R6YA 1FURA 2PTSA 1RE5A 4NSLA 1Q5NA 1HY1A 4FFXA 5EYTA 1I0AA 1TJWA 3BHGA 1U15A 4C5UA 4NLEA 4EFCA 5F92A 4ADMA 1YFMA 3OCFA 1YISA 3CZOA 1AUWA 3GTDA 1FUPA 1GK3A 2E9FA 1Y2MA 4C5RA 2PTQA 1K7WA 3GZHA 3RD8A 4CQ5A 2PTRA 3NZ4A 4APBA 2HVGA 4BABA 2NYNA 2O7EA
chains in the Genus database with same CATH superfamily
4BAAA 3RRPA 1W27A 2RJSA 2PFMA 1XLYA 1TJ7A 3OCEA 1Z4JA 2VSFA 1Z4LA 4HGVA 4L6CA 1J3UA 2O6YA 4C6GA 4V2RA 1C3CA 1U16A 2J91A 1JSWA 3E04A 1GKMA 1K62A 2FUSA 1T6PA 1Z4QA 1XWOA 1Z4IA 5HW2A 4MUMA 4APAA 5F91A 3F4TA 1VDKA 2QVEA 2X75A 1EB4A 2YV5A 1Z4MA 2YIIA 1C3UA 3TV2A 4A15A 2RCNA 3F4SA 1T9HA 2D28C 4IQJM 2O7DA 1B8FA 1XMDA 2VD6A 2JAUA 1Z4PX 2D27A 3NO9A 1HY0A 3C8TA 1T6JA 4YIHA 2O7BA 1Q91A 1TJUA 1DCNA 3R6QA 3U13A 1TJVA 1KQ7A 5M0JA 1YFEA 3R6VA 4MWOA 4L57A 5EYVA 1U0LA 4V2QA 4FLCA 3UNVA 1FUQA 2O78A 2O7FA 4C5SA 3KDYA 4ADLA 1FUOA 1GKJA 2JAOA 5D6BA 2QGAB 3QBPA 2OHYA 2I7DA 4MX2A 4E88A 3F4RA 1GK2A 2NYFA 2RJRA 3KDZA 5M0IA 1MH9A 4YIKA 3CRVA 4EEIA 1DOFA 1XL7A 4NFLA 3R6YA 1FURA 2JARA 1Q92A 2JAWA 2PTSA 1RE5A 4NSLA 1Q5NA 1HY1A 4FFXA 5EYTA 2FELA 1I0AA 3CRW1 1TJWA 3BHGA 3U19A 2FENA 1U15A 4C5UA 3BWVA 4NLEA 4EFCA 5F92A 4ADMA 1YFMA 1Z4KA 3OCFA 1YISA 1XL8A 3CZOA 4L6AA 3CI0K 1AUWA 3GTDA 1FUPA 1GK3A 2E9FA 1XMCA 1Y2MA 4C5RA 4WNLA 2PTQA 1K7WA 2VL7A 5H8WA 3GZHA 3RD8A 4CQ5A 1IW7D 2PTRA 3NZ4A 4APBA 2HVGA 4BABA 2NYNA 2O7EA
chains in the Genus database with same CATH topology
4BAAA 3RRPA 1W27A 2RJSA 2PFMA 1TJ7A 3OCEA 4HGVA 1J3UA 2O6YA 4C6GA 4V2RA 1C3CA 1U16A 2J91A 1JSWA 3E04A 1GKMA 1K62A 2FUSA 1T6PA 1XWOA 5HW2A 4APAA 5F91A 1VDKA 2QVEA 2X75A 1EB4A 2YIIA 1C3UA 3TV2A 2O7DA 1B8FA 2VD6A 3NO9A 1HY0A 3C8TA 1T6JA 2O7BA 1TJUA 1DCNA 3R6QA 1TJVA 1KQ7A 1YFEA 3R6VA 5EYVA 4V2QA 4FLCA 3UNVA 1FUQA 2O78A 2O7FA 4C5SA 3KDYA 4ADLA 1FUOA 1GKJA 5D6BA 2QGAB 3QBPA 2OHYA 4MX2A 1GK2A 2NYFA 2RJRA 3KDZA 4EEIA 1DOFA 3R6YA 1FURA 2PTSA 1RE5A 4NSLA 1Q5NA 1HY1A 4FFXA 5EYTA 1I0AA 1TJWA 3BHGA 1U15A 4C5UA 4NLEA 4EFCA 5F92A 4ADMA 1YFMA 3OCFA 1YISA 3CZOA 1AUWA 3GTDA 1FUPA 1GK3A 2E9FA 1Y2MA 4C5RA 2PTQA 1K7WA 3GZHA 3RD8A 4CQ5A 2PTRA 3NZ4A 4APBA 2HVGA 4BABA 2NYNA 2O7EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BAA A;  3RRP A;  1W27 A;  2RJS A;  2PFM A;  1TJ7 A;  3OCE A;  4HGV A;  1J3U A;  2O6Y A;  4C6G A;  4V2R A;  1C3C A;  1U16 A;  2J91 A;  1JSW A;  3E04 A;  1GKM A;  1K62 A;  2FUS A;  1T6P A;  1XWO A;  5HW2 A;  4APA A;  5F91 A;  1VDK A;  2QVE A;  2X75 A;  1EB4 A;  2YII A;  1C3U A;  3TV2 A;  2O7D A;  1B8F A;  2VD6 A;  3NO9 A;  1HY0 A;  3C8T A;  1T6J A;  2O7B A;  1TJU A;  1DCN A;  3R6Q A;  1TJV A;  1KQ7 A;  1YFE A;  3R6V A;  5EYV A;  4V2Q A;  4FLC A;  3UNV A;  1FUQ A;  2O78 A;  2O7F A;  4C5S A;  3KDY A;  4ADL A;  1FUO A;  1GKJ A;  5D6B A;  2QGA B;  3QBP A;  2OHY A;  4MX2 A;  1GK2 A;  2NYF A;  2RJR A;  3KDZ A;  4EEI A;  1DOF A;  3R6Y A;  1FUR A;  2PTS A;  1RE5 A;  4NSL A;  1Q5N A;  1HY1 A;  4FFX A;  5EYT A;  1I0A A;  1TJW A;  3BHG A;  1U15 A;  4C5U A;  4NLE A;  4EFC A;  5F92 A;  4ADM A;  1YFM A;  3OCF A;  1YIS A;  3CZO A;  1AUW A;  3GTD A;  1FUP A;  1GK3 A;  2E9F A;  1Y2M A;  4C5R A;  2PTQ A;  1K7W A;  3GZH A;  3RD8 A;  4CQ5 A;  2PTR A;  3NZ4 A;  4APB A;  2HVG A;  4BAB A;  2NYN A;  2O7E A; 
#chains in the Genus database with same CATH topology
 4BAA A;  3RRP A;  1W27 A;  2RJS A;  2PFM A;  1XLY A;  1TJ7 A;  3OCE A;  1Z4J A;  2VSF A;  1Z4L A;  4HGV A;  4L6C A;  1J3U A;  2O6Y A;  4C6G A;  4V2R A;  1C3C A;  1U16 A;  2J91 A;  1JSW A;  3E04 A;  1GKM A;  1K62 A;  2FUS A;  1T6P A;  1Z4Q A;  1XWO A;  1Z4I A;  5HW2 A;  4MUM A;  4APA A;  5F91 A;  3F4T A;  1VDK A;  2QVE A;  2X75 A;  1EB4 A;  2YV5 A;  1Z4M A;  2YII A;  1C3U A;  3TV2 A;  4A15 A;  2RCN A;  3F4S A;  1T9H A;  2D28 C;  4IQJ M;  2O7D A;  1B8F A;  1XMD A;  2VD6 A;  2JAU A;  1Z4P X;  2D27 A;  3NO9 A;  1HY0 A;  3C8T A;  1T6J A;  4YIH A;  2O7B A;  1Q91 A;  1TJU A;  1DCN A;  3R6Q A;  3U13 A;  1TJV A;  1KQ7 A;  5M0J A;  1YFE A;  3R6V A;  4MWO A;  4L57 A;  5EYV A;  1U0L A;  4V2Q A;  4FLC A;  3UNV A;  1FUQ A;  2O78 A;  2O7F A;  4C5S A;  3KDY A;  4ADL A;  1FUO A;  1GKJ A;  2JAO A;  5D6B A;  2QGA B;  3QBP A;  2OHY A;  2I7D A;  4MX2 A;  4E88 A;  3F4R A;  1GK2 A;  2NYF A;  2RJR A;  3KDZ A;  5M0I A;  1MH9 A;  4YIK A;  3CRV A;  4EEI A;  1DOF A;  1XL7 A;  4NFL A;  3R6Y A;  1FUR A;  2JAR A;  1Q92 A;  2JAW A;  2PTS A;  1RE5 A;  4NSL A;  1Q5N A;  1HY1 A;  4FFX A;  5EYT A;  2FEL A;  1I0A A;  3CRW 1;  1TJW A;  3BHG A;  3U19 A;  2FEN A;  1U15 A;  4C5U A;  3BWV A;  4NLE A;  4EFC A;  5F92 A;  4ADM A;  1YFM A;  1Z4K A;  3OCF A;  1YIS A;  1XL8 A;  3CZO A;  4L6A A;  3CI0 K;  1AUW A;  3GTD A;  1FUP A;  1GK3 A;  2E9F A;  1XMC A;  1Y2M A;  4C5R A;  4WNL A;  2PTQ A;  1K7W A;  2VL7 A;  5H8W A;  3GZH A;  3RD8 A;  4CQ5 A;  1IW7 D;  2PTR A;  3NZ4 A;  4APB A;  2HVG A;  4BAB A;  2NYN A;  2O7E A; 
#chains in the Genus database with same CATH homology
 4BAA A;  3RRP A;  1W27 A;  2RJS A;  2PFM A;  1TJ7 A;  3OCE A;  4HGV A;  1J3U A;  2O6Y A;  4C6G A;  4V2R A;  1C3C A;  1U16 A;  2J91 A;  1JSW A;  3E04 A;  1GKM A;  1K62 A;  2FUS A;  1T6P A;  1XWO A;  5HW2 A;  4APA A;  5F91 A;  1VDK A;  2QVE A;  2X75 A;  1EB4 A;  2YII A;  1C3U A;  3TV2 A;  2O7D A;  1B8F A;  2VD6 A;  3NO9 A;  1HY0 A;  3C8T A;  1T6J A;  2O7B A;  1TJU A;  1DCN A;  3R6Q A;  1TJV A;  1KQ7 A;  1YFE A;  3R6V A;  5EYV A;  4V2Q A;  4FLC A;  3UNV A;  1FUQ A;  2O78 A;  2O7F A;  4C5S A;  3KDY A;  4ADL A;  1FUO A;  1GKJ A;  5D6B A;  2QGA B;  3QBP A;  2OHY A;  4MX2 A;  1GK2 A;  2NYF A;  2RJR A;  3KDZ A;  4EEI A;  1DOF A;  3R6Y A;  1FUR A;  2PTS A;  1RE5 A;  4NSL A;  1Q5N A;  1HY1 A;  4FFX A;  5EYT A;  1I0A A;  1TJW A;  3BHG A;  1U15 A;  4C5U A;  4NLE A;  4EFC A;  5F92 A;  4ADM A;  1YFM A;  3OCF A;  1YIS A;  3CZO A;  1AUW A;  3GTD A;  1FUP A;  1GK3 A;  2E9F A;  1Y2M A;  4C5R A;  2PTQ A;  1K7W A;  3GZH A;  3RD8 A;  4CQ5 A;  2PTR A;  3NZ4 A;  4APB A;  2HVG A;  4BAB A;  2NYN A;  2O7E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...