4NSLA

X-ray crystal structure of adenylosuccinate lyase from salmonella typhimurium
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
456
structure length
446
Chain Sequence
MELSSLTAVSPVDGRYGDKVSALRGIFSEYGLLKFRVQVEVRWLQKLAAHAAIKEVPAFAADANGYLDTLVANFNEEDAARIKTIERTTNHDVKAVEYFLKEKVAAIPALHDVSEFIHFACTSEDINNLSHALMLKTARDEVILPYWRQVINAVKDLATQYRDIPLLSRTHGQPATPSTLGKEMANVAYRMERQFRQLNQVEILGKINGAVGNYNAHIAAYPEVDWHQFSEEFVTSLGIQWNPYTTQIEPHDYIAELFDCIARFNTILIDFDRDVWGYIALNHFKQKTMPHKVNPIDFENSEGNLGLSNAVLHHLANKLPVSRWQRDLTDSTVLRNLGVGIGYALIAYQSTLKGVSKLEVNRDHLLDELDHNWEVLAEPIQTVMRRYGIEKPYEKLKELTRKRVDAEGMKQFIDSLALPEAEKTRLKAMTPANYIGRAVTLVDELK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic and kinetic studies on Adenylosuccinate Lyase from Salmonella typhimurium
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Lyase
molecule keywords Adenylosuccinate lyase
total genus 155
structure length 446
sequence length 456
chains with identical sequence B, C, D
ec nomenclature ec 4.3.2.2: Adenylosuccinate lyase.
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00206 Lyase_1 Lyase
A PF08328 ASL_C Adenylosuccinate lyase C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.40.30 Mainly Alpha Orthogonal Bundle Ribonucleotide Reductase Protein R1; domain 1 Fumarase/aspartase (C-terminal domain) 4nslA03
1.10.275.10 Mainly Alpha Orthogonal Bundle Fumarase C; Chain B, domain 1 Fumarase/aspartase (N-terminal domain) 4nslA01
1.20.200.10 Mainly Alpha Up-down Bundle Fumarase C; Chain A, domain 2 Fumarase/aspartase (Central domain) 4nslA02
4C6GA 3OCEA 2O6YA 1T6PA 1DCNA 2O7EA 4MX2A 1RE5A 1YFEA 1YFMA 2X75A 1GKJA 1Q5NA 5HW2A 4FFXA 4C5SA 5D6BA 2O7DA 1B8FA 3GZHA 1FUPA 1KQ7A 3R6QA 2PTRA 1U16A 1W27A 3R6VA 1C3CA 1TJVA 1VDKA 1K62A 1K7WA 5EYTA 3CZOA 2NYNA 1HY0A 3GTDA 3E04A 2VD6A 1GKMA 1TJWA 4BAAA 2PFMA 1GK3A 3NZ4A 2YIIA 4EEIA 2QGAB 1FUOA 2QVEA 2RJSA 4C5RA 1TJ7A 2O7BA 2NYFA 3C8TA 1U15A 2PTSA 2E9FA 4NLEA 1FURA 4EFCA 5F92A 1DOFA 1T6JA 4V2RA 1YISA 4V2QA 2RJRA 3KDYA 4CQ5A 1TJUA 2OHYA 4NSLA 3RD8A 3NO9A 2HVGA 1I0AA 4ADMA 4ADLA 2J91A 4C5UA 3UNVA 4HGVA 4FLCA 2FUSA 1AUWA 1C3UA 1J3UA 3KDZA 3R6YA 5EYVA 3RRPA 2O7FA 5F91A 1Y2MA 4APBA 1GK2A 4APAA 3QBPA 2O78A 1HY1A 2PTQA 1JSWA 1EB4A 1XWOA 4BABA 1FUQA 3BHGA 3TV2A 3OCFA
chains in the Genus database with same CATH superfamily
4C6GA 3OCEA 2O6YA 1T6PA 1DCNA 2O7EA 4MX2A 2YV5A 1RE5A 1YFEA 1YFMA 2X75A 1Z4JA 1GKJA 3F4SA 1Q5NA 5HW2A 4FFXA 4C5SA 5D6BA 4MUMA 1XMDA 2O7DA 4MWOA 1T9HA 1B8FA 2JAOA 1Z4IA 3GZHA 1FUPA 1KQ7A 3R6QA 2PTRA 1U16A 1W27A 3R6VA 2D28C 4YIHA 1C3CA 1TJVA 1VDKA 1K62A 4YIKA 2FELA 1K7WA 2VL7A 5EYTA 3CZOA 2NYNA 1HY0A 3GTDA 3E04A 3CRVA 2VSFA 2VD6A 3U13A 1GKMA 1TJWA 4WNLA 4BAAA 3F4RA 2PFMA 1GK3A 3NZ4A 1Z4KA 2YIIA 4EEIA 2QGAB 1FUOA 2QVEA 2RJSA 4C5RA 1TJ7A 2JAWA 2FENA 1Z4LA 2O7BA 2NYFA 3C8TA 1U15A 2PTSA 1IW7D 2E9FA 4NLEA 1FURA 4EFCA 2D27A 5F92A 1DOFA 2JAUA 5H8WA 1T6JA 4V2RA 1Q91A 1YISA 4A15A 1XMCA 4V2QA 2RJRA 3KDYA 2JARA 3F4TA 1Z4MA 4CQ5A 4NFLA 4L6CA 1TJUA 2OHYA 1XL8A 3CI0K 4NSLA 4L57A 3NO9A 3RD8A 2HVGA 1MH9A 1I0AA 4L6AA 4ADMA 4E88A 4ADLA 2J91A 4C5UA 3UNVA 1XLYA 4HGVA 3U19A 4FLCA 1Z4QA 2FUSA 1AUWA 1C3UA 1J3UA 3KDZA 3R6YA 5EYVA 3RRPA 2O7FA 5F91A 3BWVA 1Y2MA 5M0JA 4APBA 1GK2A 4APAA 3QBPA 2O78A 1HY1A 1Q92A 2PTQA 4IQJM 1JSWA 1Z4PX 2I7DA 1EB4A 1XWOA 5M0IA 4BABA 1XL7A 1FUQA 3BHGA 3TV2A 3CRW1 3OCFA 1U0LA 2RCNA
chains in the Genus database with same CATH topology
4C6GA 3OCEA 2O6YA 1T6PA 1DCNA 2O7EA 4MX2A 1RE5A 1YFEA 1YFMA 2X75A 1GKJA 1Q5NA 5HW2A 4FFXA 4C5SA 5D6BA 2O7DA 1B8FA 3GZHA 1FUPA 1KQ7A 3R6QA 2PTRA 1U16A 1W27A 3R6VA 1C3CA 1TJVA 1VDKA 1K62A 1K7WA 5EYTA 3CZOA 2NYNA 1HY0A 3GTDA 3E04A 2VD6A 1GKMA 1TJWA 4BAAA 2PFMA 1GK3A 3NZ4A 2YIIA 4EEIA 2QGAB 1FUOA 2QVEA 2RJSA 4C5RA 1TJ7A 2O7BA 2NYFA 3C8TA 1U15A 2PTSA 2E9FA 4NLEA 1FURA 4EFCA 5F92A 1DOFA 1T6JA 4V2RA 1YISA 4V2QA 2RJRA 3KDYA 4CQ5A 1TJUA 2OHYA 4NSLA 3RD8A 3NO9A 2HVGA 1I0AA 4ADMA 4ADLA 2J91A 4C5UA 3UNVA 4HGVA 4FLCA 2FUSA 1AUWA 1C3UA 1J3UA 3KDZA 3R6YA 5EYVA 3RRPA 2O7FA 5F91A 1Y2MA 4APBA 1GK2A 4APAA 3QBPA 2O78A 1HY1A 2PTQA 1JSWA 1EB4A 1XWOA 4BABA 1FUQA 3BHGA 3TV2A 3OCFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C6G A;  3OCE A;  2O6Y A;  1T6P A;  1DCN A;  2O7E A;  4MX2 A;  1RE5 A;  1YFE A;  1YFM A;  2X75 A;  1GKJ A;  1Q5N A;  5HW2 A;  4FFX A;  4C5S A;  5D6B A;  2O7D A;  1B8F A;  3GZH A;  1FUP A;  1KQ7 A;  3R6Q A;  2PTR A;  1U16 A;  1W27 A;  3R6V A;  1C3C A;  1TJV A;  1VDK A;  1K62 A;  1K7W A;  5EYT A;  3CZO A;  2NYN A;  1HY0 A;  3GTD A;  3E04 A;  2VD6 A;  1GKM A;  1TJW A;  4BAA A;  2PFM A;  1GK3 A;  3NZ4 A;  2YII A;  4EEI A;  2QGA B;  1FUO A;  2QVE A;  2RJS A;  4C5R A;  1TJ7 A;  2O7B A;  2NYF A;  3C8T A;  1U15 A;  2PTS A;  2E9F A;  4NLE A;  1FUR A;  4EFC A;  5F92 A;  1DOF A;  1T6J A;  4V2R A;  1YIS A;  4V2Q A;  2RJR A;  3KDY A;  4CQ5 A;  1TJU A;  2OHY A;  4NSL A;  3RD8 A;  3NO9 A;  2HVG A;  1I0A A;  4ADM A;  4ADL A;  2J91 A;  4C5U A;  3UNV A;  4HGV A;  4FLC A;  2FUS A;  1AUW A;  1C3U A;  1J3U A;  3KDZ A;  3R6Y A;  5EYV A;  3RRP A;  2O7F A;  5F91 A;  1Y2M A;  4APB A;  1GK2 A;  4APA A;  3QBP A;  2O78 A;  1HY1 A;  2PTQ A;  1JSW A;  1EB4 A;  1XWO A;  4BAB A;  1FUQ A;  3BHG A;  3TV2 A;  3OCF A; 
#chains in the Genus database with same CATH topology
 4C6G A;  3OCE A;  2O6Y A;  1T6P A;  1DCN A;  2O7E A;  4MX2 A;  2YV5 A;  1RE5 A;  1YFE A;  1YFM A;  2X75 A;  1Z4J A;  1GKJ A;  3F4S A;  1Q5N A;  5HW2 A;  4FFX A;  4C5S A;  5D6B A;  4MUM A;  1XMD A;  2O7D A;  4MWO A;  1T9H A;  1B8F A;  2JAO A;  1Z4I A;  3GZH A;  1FUP A;  1KQ7 A;  3R6Q A;  2PTR A;  1U16 A;  1W27 A;  3R6V A;  2D28 C;  4YIH A;  1C3C A;  1TJV A;  1VDK A;  1K62 A;  4YIK A;  2FEL A;  1K7W A;  2VL7 A;  5EYT A;  3CZO A;  2NYN A;  1HY0 A;  3GTD A;  3E04 A;  3CRV A;  2VSF A;  2VD6 A;  3U13 A;  1GKM A;  1TJW A;  4WNL A;  4BAA A;  3F4R A;  2PFM A;  1GK3 A;  3NZ4 A;  1Z4K A;  2YII A;  4EEI A;  2QGA B;  1FUO A;  2QVE A;  2RJS A;  4C5R A;  1TJ7 A;  2JAW A;  2FEN A;  1Z4L A;  2O7B A;  2NYF A;  3C8T A;  1U15 A;  2PTS A;  1IW7 D;  2E9F A;  4NLE A;  1FUR A;  4EFC A;  2D27 A;  5F92 A;  1DOF A;  2JAU A;  5H8W A;  1T6J A;  4V2R A;  1Q91 A;  1YIS A;  4A15 A;  1XMC A;  4V2Q A;  2RJR A;  3KDY A;  2JAR A;  3F4T A;  1Z4M A;  4CQ5 A;  4NFL A;  4L6C A;  1TJU A;  2OHY A;  1XL8 A;  3CI0 K;  4NSL A;  4L57 A;  3NO9 A;  3RD8 A;  2HVG A;  1MH9 A;  1I0A A;  4L6A A;  4ADM A;  4E88 A;  4ADL A;  2J91 A;  4C5U A;  3UNV A;  1XLY A;  4HGV A;  3U19 A;  4FLC A;  1Z4Q A;  2FUS A;  1AUW A;  1C3U A;  1J3U A;  3KDZ A;  3R6Y A;  5EYV A;  3RRP A;  2O7F A;  5F91 A;  3BWV A;  1Y2M A;  5M0J A;  4APB A;  1GK2 A;  4APA A;  3QBP A;  2O78 A;  1HY1 A;  1Q92 A;  2PTQ A;  4IQJ M;  1JSW A;  1Z4P X;  2I7D A;  1EB4 A;  1XWO A;  5M0I A;  4BAB A;  1XL7 A;  1FUQ A;  3BHG A;  3TV2 A;  3CRW 1;  3OCF A;  1U0L A;  2RCN A; 
#chains in the Genus database with same CATH homology
 4C6G A;  3OCE A;  2O6Y A;  1T6P A;  1DCN A;  2O7E A;  4MX2 A;  1RE5 A;  1YFE A;  1YFM A;  2X75 A;  1GKJ A;  1Q5N A;  5HW2 A;  4FFX A;  4C5S A;  5D6B A;  2O7D A;  1B8F A;  3GZH A;  1FUP A;  1KQ7 A;  3R6Q A;  2PTR A;  1U16 A;  1W27 A;  3R6V A;  1C3C A;  1TJV A;  1VDK A;  1K62 A;  1K7W A;  5EYT A;  3CZO A;  2NYN A;  1HY0 A;  3GTD A;  3E04 A;  2VD6 A;  1GKM A;  1TJW A;  4BAA A;  2PFM A;  1GK3 A;  3NZ4 A;  2YII A;  4EEI A;  2QGA B;  1FUO A;  2QVE A;  2RJS A;  4C5R A;  1TJ7 A;  2O7B A;  2NYF A;  3C8T A;  1U15 A;  2PTS A;  2E9F A;  4NLE A;  1FUR A;  4EFC A;  5F92 A;  1DOF A;  1T6J A;  4V2R A;  1YIS A;  4V2Q A;  2RJR A;  3KDY A;  4CQ5 A;  1TJU A;  2OHY A;  4NSL A;  3RD8 A;  3NO9 A;  2HVG A;  1I0A A;  4ADM A;  4ADL A;  2J91 A;  4C5U A;  3UNV A;  4HGV A;  4FLC A;  2FUS A;  1AUW A;  1C3U A;  1J3U A;  3KDZ A;  3R6Y A;  5EYV A;  3RRP A;  2O7F A;  5F91 A;  1Y2M A;  4APB A;  1GK2 A;  4APA A;  3QBP A;  2O78 A;  1HY1 A;  2PTQ A;  1JSW A;  1EB4 A;  1XWO A;  4BAB A;  1FUQ A;  3BHG A;  3TV2 A;  3OCF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...