4NSNA

Crystal structure of purine nucleoside phosphorylase from porphyromonas gingivalis atcc 33277, nysgrc target 030972, orthorhombic symmetry
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
273
structure length
272
Chain Sequence
MKLQEQHYHEAASFLSSRLPGDAKTAIILGSGLGELAEKIENKTVIPYNEIPHFAQATAVGHKGNIIGGILGGTPVVAMQGRFHYYEGYSMDQVTFPIRVMKLLGIENLFVSNAAGGINTSFKVGDLMIIDHINNLPNPLIGPNMDMFGVRFPDMTRAYDREFIAKAKGIAQELNIPVKEGVYVGLTGPSYETPAEYKFWGQVGGDAIGMSTVPEVIVARHTGIRVFGMSVITNEGYHFADDFVNDEQDVIRAANAASEKMGAIFARLIAAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of purine nucleoside phosphorylase from Porphyromonas gingivalis ATCC 33277, NYSGRC Target 030972, orthorhombic symmetry.
rcsb
source organism Porphyromonas gingivalis
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase
total genus 77
structure length 272
sequence length 273
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nsnA00
1QE5A 1Y1RA 4DA0A 4OEHA 3T94A 1Z39A 1RR6A 2OXFA 1RT9A 1RSZA 4GLFA 1Y6QA 2I4TA 3NM6B 5K1ZA 4TTIA 3SCZA 1K27A 1PR4A 3UAYA 1RFGE 1NC1A 1SQ6A 1JDTA 4TXMA 4KN5A 1TGVA 4LZWA 1JDSA 1OVGA 4UC0A 1TD1A 1A9OA 4PNPA 1C3XA 1TGYA 3K8OE 3KUKA 4F2PA 2HWUA 1OU4A 4DARA 1NW4A 1LV8A 3F8WA 1ODIA 3OF3A 1Z35A 5I3CA 3OZCA 3PHBE 1PR6A 1A9SA 1RXCA 4JOSA 3BGSA 4MCIA 3FAZA 4H1TA 4G41A 4D8YA 5CCEA 2QTTA 2IQ5A 1Y1TA 2XRFA 4F1WA 3FNQA 3UAVA 4NSNA 1NC3A 1OV6A 1YR3A 1V48A 3OOHA 1ULBA 4NS1A 3MMSA 1T8RA 5IFKA 4DA8A 1VFNA 4D9HA 5CCDA 3GB9A 1K9SA 1YQQA 1A9QA 1PR2A 4D8XA 3EMVA 1I80A 2QPLA 1OUMA 4GLJA 1Y6RA 4MCHA 5F7OA 5EFOA 3FUCA 3TL6A 1Z38A 3EUFA 5F7ZA 4DANA 5FAKA 2A0WA 1V41E 4OGKA 1Z36A 4LNAA 2H8GA 4YJKA 4MARA 1Z5NA 3MB8A 3ONVA 3K8QA 1PKEA 1V4NA 2Q7OE 1SJ9A 3LGSA 4M7WA 4DA7A 4YO8A 4QATA 1M73E 4DAOA 5JPCA 1U1DA 4QFBA 3FWPA 4D98A 4TXLA 2ON6A 1PR5A 4QARA 4IP0A 3INYA 3UAWA 4JP5A 3EUEA 4L5YA 5CYFA 1JE0A 1K3FA 5CXSA 4WKPA 2A0XA 3D1VA 3BJEA 4TXJA 5F73A 2AC7A 1WTAA 2AI1A 2ISCA 2HSWA 1VHWA 4BMXA 4R31A 4P54A 4R2XA 4TS9A 2QDKA 1XE3A 4OY3A 5B7NA 1LX7A 4EB8A 1V45E 1VMKA 1PWYE 4TS3A 3OZDA 1YQUA 2AI2A 4GKAA 4M1EA 4LKRA 3E0QA 1N3IA 4NY1A 3KU4A 3P0FA 1RCTE 3PHCA 4WKCA 4F2WA 1PK9A 3GGSA 5B7GA 4BN0A 5C80A 1B8OA 3NBQA 1JYSA 3DDOA 4OF4A 1U1EA 5F7JA 1JDZA 1ZL2A 4I2VA 3KVYA 4TTJA 1OTYA 4TYMA 1U1GA 1JDUA 5F78A 4QASA 5CXQA 3IEXA 5CYGA 3KVVA 5KB3A 5F76A 1Z37A 3P0EA 3DP9A 4U2KA 4BMYA 1ODJA 1RXSA 3FOWA 2OECA 4QAQA 3OOEA 2QSUA 3UAXA 5DK6A 3DJFA 4WKOA 1LVUA 4WKNA 3KHSA 3OZBA 1ULAA 4BMZA 3UAZA 3ENZA 4L5CA 4QEZA 1Q1GA 3BL6A 1ECPA 3E9ZA 3PNSA 3LA8A 1VHJA 4YNBA 4G8JA 2OC4A 2B94A 4M3NA 4LNHA 1TCUA 1SD1A 1JP7A 2PGAA 2HN9A 1ODKA 3NM4A 4DAEA 1Y1SA 4TTAA 1PW7A 4OJTA 4K6OA 4G89A 4YMLA 4WKBA 4D8VA 4L0MA 5EUBA 1T8YA 3IOMA 1A9RA 2AI3A 1A69A 1T0UA 1PR1A 3OZEA 5IU6A 5F77A 1YRYE 3EEIA 1JDVA 1SD2A 2A0YA 3C74A 3DF9A 4L5AA 4TXNA 1YBFA 1Z5PA 5EPUA 5ETJA 1U1FA 1V3QE 3UT6A 3KVRA 1TCVA 4F3CA 1PF7E 4GMHA 3E9RA 3QPBA 2RJ3A 3BSFA 2OC9A 1PR0A 3ODGA 4JWTA 3O6VA 1PBNA 4TXHA 2HRDA 4X24A 1T8WA 1CG6A 4LDNA 1JE1A 1Z34A 3O4VA 2QTGA 3FB1A 1ZOSA 1CB0A 1PK7A 1T8SA 1Z5OA 4R2WA 1G2OA 3OPVA 4RJ2A 1U1CA 1RXUA 4DABA 4PR3A 5B7QA 4OGLA 2BSXA 3OCCA 1JPVA 1Z33A 1A9TA 1V2HE 2GUWA 3U40A 1A9PA 2A8YA 1FXUA 1RXYA 4EARA 4DA6A 4F3KA 2P4SA 5B7PA 3PNPA 4ECEA 1OTXA 4FFSA 1ODLA 3NM5A 4L6IA 5F7XA 2I8AA 1B8NA 1RYZA 3LBAA 4E1VA 3DPSA 1Y1QA
chains in the Genus database with same CATH superfamily
1R8XA 4MKGA 4TUYF 1GJRA 3DOOA 4W5NA 1P61B 1PG2A 3A1VA 3EOZA 2VCHA 3KZNA 4X0EA 4YDSA 3OKPA 3PXXA 3T3HA 3TLKA 6AT1A 4Z86A 3DLAA 1ZSVA 1FQWA 1RHMA 4Q15A 3NKVA 4MQEB 1KOGA 4KV9A 2HCBA 2OXFA 2ID7A 3HCEA 1CRLA 3GHHA 3DCIA 1XEXA 1VC2A 2IHTA 2R84A 2VT3A 1AKRA 1CR6A 1RSZA 4RLFA 4V3BA 3K8ZA 4ZPJA 2VRNA 2VWPA 1XUOA 1TA4A 2YWBA 2NU8B 4DWOA 1ORDA 4YI5A 4PC2A 2R6JA 3LHKA 3MAAC 2P2CA 2J7PA 3LY7A 1CJUC 1QH1A 1GXSB 3G9QA 4M9QA 5JDCC 4QUIA 4IHKA 4RIHA 5C7LO 1SUCA 2D2XA 1QUFA 3IUEA 4NC9A 2WKQA 3WC4A 2E5FA 5J23A 1NOJA 3ORFA 2P41A 1FFGA 2WU1A 3CSSA 3H2YA 4PLYA 4EO9A 2G5TA 1R9JA 4JIGA 1NV8A 5T67A 1PWHA 1JRLA 1NC1A 4JBYA 4WOJA 4WA7A 1Z4LA 2X1LA 5HXAA 3BL5A 5BR4A 5IXSA 1HQKA 4IQ8A 2V1XA 1SIWA 4NAVA 4NJOA 5F64A 1VYVA 2W6CX 4H4EA 2UVPA 3KDPA 3WDSA 2VK4A 5CT9A 2ZUFA 1H8HD 1FF9A 1T5IA 2BHTA 2PH5A 5JSHA 1TT5B 3WZ2A 4BPBA 1DKNA 1TJPB 1QGUB 1WZ2A 1YRWA 1U0BB 1Z75A 2C7OA 2EJTA 4OMDA 4BEJA 5B53A 3SJAA 1T5LA 2D0PB 4M54A 2SNIE 4X7MA 3F8WA 1NUUA 2XUAA 4WBNF 3OESA 4G9GA 3W7AA 5LXTB 1ECJA 4LWPA 2W48A 3KJIA 3N2IA 1DTWB 4FBLA 5DKFA 1CUDA 4HPWA 4ISCA 5G41A 1X3SA 1FNNA 4R9SA 4IOJA 2A5DA 3C6KA 1MO5A 1FS4A 4C1BA 1PR6A 3DYBA 3LRPA 2OT3B 2X1MA 3U7IA 1P9OA 1E3IA 3MTAA 4M7RA 1X7XB 1JHZA 1ZGAA 1Q1ZA 3GEGA 1KVQA 4M9CA 3CNOA 4NENB 3WIVA 3BSYA 3L06A 2QX7A 3B89A 3GGJA 3L84A 3F5SA 5LZ5A 2OBLA 4XEUA 5DHQA 3VHLB 5CCEA 5K8VA 4KVFA 5TRTA 3I39X 2N42A 2IY7A 2ZPTX 4YMWA 2OCGA 2J3MA 1HXHA 2UZAA 3JZMA 3NHYA 1A8UA 4EY5A 1BX3A 2C3PA 3EVFA 4ZDKA 5ALOA 3SZOA 4EY6A 5CEEA 2UKDA 2WIFA 1RKBA 3HB4X 3C3JA 2JGRA 1W0JD 4NP6A 2PZGA 4LMAA 1OV6A 4NYMR 5H7XA 3F96A 5KNCD 1VBMA 3HDVA 3RS2A 1M9NA 1TM2A 2LXNA 5FT9A 3IBSA 1LWNA 1PL8A 2NU9B 3U81A 4MGHA 4KNVA 3WICA 2J46A 1XF1A 4BUJA 5HVNA 4TL6A 2CF5A 4TKVB 1PFKA 4L57A 1KRXA 1DAMA 3IAUA 3V48A 3WL7A 1BH2A 2DPYA 2N1BA 1CP2A 1LPMA 2XKBA 3FPKA 4DA8A 3JQ8A 1KI2A 5A5DA 2FRDC 3DEYX 4EY8A 1OYOA 2WA1A 3H3XA 4DCGA 3FMGA 4GI7A 5E9AA 3RWBA 3Q8XB 6YASA 4E5VA 3WA6A 3K5PA 3WLPA 1W30A 3DLPX 1YO6A 1NXVA 2Q7XA 1HTTA 1HNWB 2B36A 3RAPR 3TFOA 5DHPA 2AQ8A 2WWWA 5BRJA 3KSZO 3DP7A 2OCYC 3K72B 1XFDA 3T35A 1XLTC 5AJVB 3L4BA 3WADA 3WFJA 4PEVA 4BNXA 4ZCQA 1UZAA 1E2LA 4TRRA 5B58T 3L5KA 1T3TA 5FAKA 4UHHA 2R8ZA 1DKRA 2WUFA 1INLA 4HDMB 2H48A 1NPTO 4AG6A 9ABPA 3KSUA 3B6MA 5FBQB 3PNBA 1ABEA 1PD1A 1SVNA 3AJ8A 5ER9A 3EZYA 4KO4S 5CDUA 5L4SA 4D56A 5A5VA 3JRXA 1I7SB 5DNEA 3PDJA 3NDIA 4PZZA 4W5OA 4TM7A 3TAHA 3OJWA 3CWZA 3PICA 1DJLA 3UQYS 2D6FA 1DUSA 3DVRX 5JNVA 3UV3A 4GPTA 1HE8B 2A4KA 2HTEA 1IAVA 3R3SA 2SKDA 1RZRD 5IM4F 3RCBA 5CCBA 2AV6A 2J1LA 1FTQA 3LGSA 1MDBA 1K2VN 1SC4A 2HADA 2H1RA 2YWFA 3PI7A 4ZANA 4RLQA 1NF3A 4BQQA 1XHLA 1J8YF 6LDHA 1N0VC 4HLNA 4X63A 2C0QA 2FPLA 1B8PA 4LOKA 4NU8X 3UKJA 1IONA 4G1UC 3H05A 3WGJA 3QWHA 4JI0B 1TZ2A 5TPZD 1PL7A 4ZT3A 4EB0A 1QXSA 1NVGA 1GKLA 5F51A 1TA0A 4X61A 1PR5A 3W6PA 4P5EA 3RSFA 4DRZA 3E5HA 4GE3A 4PNHA 4OHVA 1NMXA 1NYTA 2IE0A 4MI3A 1M34E 3EUEA 4JP5A 4OQPA 3UG7A 4BGDA 1X1BA 4MV8A 1BU5A 4MWEA 1Y6JA 4A8HA 4K87A 1JE0A 1K3FA 1SHKA 4RBNA 1H2XA 2XB6A 5ALKA 5FYQA 1GILA 3R5HA 3PQFA 4LGYA 2QZPA 4DLZA 4PC3A 3AVXA 1E77A 1ZPDA 4JGIA 1N6OA 2QI9C 5KS2A 1GOTA 1TQDA 5ILQA 2Y6UA 2ZIGA 1C3EA 3OY2A 3P9RA 2FWMX 4RY9A 8LDHA 1EK1A 2CD9A 2HK7A 3VR3D 2CYBA 3IQFA 1ECLA 2PR2A 4B3GA 3EVCA 1G42A 1W1UA 2ISQA 1FNBA 1CRZA 3IBFA 1XZAA 4HNQA 4NZOA 4LSMA 4MV5A 3RFTA 4LOIA 3ZU5A 2ACVA 4UHDA 2X5KO 3T52A 5ITZB 1XRMA 3R8XA 2W2QA 5LQCA 2ZYWX 2ZWAA 3B8EA 3PS9A 1GCUA 3UJHA 4YRAA 5M04A 1A5ZA 3N0RA 4NBNA 5TEVA 2XUZA 2Z3WA 4R2XA 5GONA 4NJEA 3W8NA 2VF4X 3ZJ4A 1O5IA 2YS7A 4G0UA 3RREA 1E1QA 1G0NA 1FE8A 1LTKA 1QOZA 1VMKA 2GF0A 1DRJA 1XZLA 1R7RA 1TLFA 2BCJQ 4IGIA 1XN4A 2Y0BA 1YQUA 3VAYA 5HQ3B 1ZMRA 2BYTA 3K9HA 4FNGA 4EUEA 3STYA 1UWKA 1PLJA 3EMBA 1Q6ZA 3FSRA 3UGKA 3A6EA 4P58A 1KVRA 3R44A 5MGNA 4PPNA 1AKQA 3VZSA 1K5GA 1H4VB 3LOPA 2D7JA 2JFXA 2XHEA 4OGGA 2PRZA 1NJ1A 2Q41A 2R8EA 1KHHA 3RBAA 3WMWA 1EJ0A 3VUEA 2YV5A 1C1DB 3MLBA 4KIFA 4TSFA 1PZEA 4NAHA 1XLVA 2HNBA 3D1LA 5H81A 4D4JA 3W05A 4BVAA 2Q49A 4DNOA 2CUKA 3Q7IA 4W1PA 1RFLA 4M1QA 1IH8A 3W77A 3QOWA 4JJKA 4M36A 2HQRA 2QTVB 4YQEA 3H2KA 2VHYA 2KQUA 4IHJF 3WBKA 3WWZA 5LJLA 2PJRA 3DLBA 4IQGA 2W6JA 4KFTA 1EG2A 3C3EA 4FEEA 4CLEA 1IU9A 3PT5A 3CNLA 4B7XA 3VC7A 3K0FB 3O9MA 5F5NA 3WV5A 3BMXA 4TT3D 4JL8A 3NU1A 3BRWD 3NYWA 3PNKA 4YS6A 4YRCA 5DBHX 5FUBA 4BUCA 4DIUA 4HNTA 2JBAA 3IAS6 2GERA 3LK6A 3OLWA 3OTWA 3FMFA 1WMBA 5LL6P 2DYKA 5C7YA 3IVXA 4N76A 1XQ1A 5JJIA 3QU5A 1Z0KA 1TW2A 3FHOA 3Q7EA 1I32A 4MUYA 2ODNA 1NMYA 5IBPA 2LCQA 4BV9A 3L9XA 1KJ9A 4CT4B 4RF3A 4N41A 1JR6A 4X65B 2X40A 1ZO8A 4XVCA 2CWDA 4N9WA 3WWOA 4Q1BA 1NMSA 2XTJA 2MSWA 1UPXA 2EZTA 1ELOA 5HQTA 1JBKA 1I7DA 3RS3A 1R6DA 3HJFA 1VIAA 2AQKA 3ORRA 4M1SA 3RSOA 1CQIA 1ODJA 1YXMA 4G09A 1BXRA 1JDBB 1JLMA 2Q1TA 2ROQA 4BLVA 3K70C 1N77A 2ZSEA 5FBKA 4D74A 1AT1A 2ZSUA 3QLJA 5IUJC 3F5MA 4M9UA 3UAXA 5BW5A 2DKFA 3EDMA 2IBTA 3BULA 1EDDA 4MQLA 3DOEA 1AKTA 1OMOA 3F9CA 4WKOA 1T91A 1IXSB 2DTEA 2WUWE 3E70C 3LT5A 5DX1A 1NIPA 3OZBA 3VVLA 4R1UA 1KJJA 4ROTA 5TQ0A 3FYSA 2YC2C 3VH1A 4CR8A 3W3ZB 2YNMD 4A8PA 4AQ7A 3GJTA 2HSEA 1FDTA 1ZP6A 2X8JB 4L22A 1MNAA 2WPNA 3V8BA 3IOCA 1E59A 2FSFA 4ENSA 4FTWA 1N9KA 4YRRA 5EQTA 4F96A 5J2TF 3WLIA 4K1LA 2RGUA 2J32A 1VB3A 2MTBA 3IT2A 2UVQA 1RKUA 4QKQA 5CEFA 1M1XB 1RWXA 1VBFA 3PGJA 4XD7D 3O8CA 3K6SA 5EYPB 1P2FA 5EMNA 1L7DA 3DDCA 1QC5A 5KAPA 3UN1A 1GNTA 4RVCA 2GCGA 2H9YA 2R25B 3M9LA 1RJ9A 1JEYA 1M1YA 2J9GA 2DFPA 3P27A 3GMTA 2YWJA 3FCYA 3MHPA 2AJCA 2B0JA 4CKZA 4NPCA 3I5UA 3EULA 3AWDA 3LXRA 3ZXXA 4L07A 4LYHA 3ZXIA 5IM4A 4B4UA 1YC2A 3V1LA 5B4TA 1FSFA 2JW5A 1MQAA 1N6NA 2FFJA 5BMVB 1XTRA 1I3MA 1QQTA 3KZCA 2FJUA 3NFYA 2ORYA 1Z0ZA 2ZS9A 1U2GA 1QVWA 3IOMA 1MA0A 4QOEA 4I1SA 3PUZA 4MULA 4E33A 3EVGA 1WV0A 1U7PA 3RK4A 3K0AA 1N34B 4Y0VA 3ZHRA 1YQGA 3ZWKA 1FX1A 3R8FA 1BA3A 1A9YA 1CZKA 1N8SA 1WQ1R 1YOVB 2JK0A 3NP9A 4OUDB 2WMNB 1E0JA 3GGPA 1U9IC 1THZA 2W2LD 3A32A 3QKSB 4Q3LA 4C6TB 5JZVA 3EXHA 4H15A 2GCEA 1JT9A 3JVDA 4NR0A 2JK1A 3WLEA 2B61A 3ZI0A 4E21A 2WF7A 3T1OA 3LP8A 1H94A 1HOTA 2WAXA 3M1AA 3PHGA 3PL5A 4K9PA 2GO1A 2NX2A 3LP6A 5F2EA 2YHIA 5C8XA 1N5RA 4MUXA 4KQKA 1HDGO 3VPDA 3ZWMA 1SD2A 1V8PA 1Y63A 2XYGA 1CE8A 1KI9A 1GGVA 5LU8A 1SHTX 4X1KA 5BURA 3LOUA 3M0EA 2PGIA 4M55A 1A72A 4S1WA 2R6FA 2YZGA 2FPPA 1OZ0A 2O7NA 3SKYA 5C35A 2BN4A 3JYHA 4QOJA 4BTLA 2FWBA 3FHLA 3ESRA 4U4AA 1BJKA 3R0JA 4GZMA 4MR8B 4H31A 3TZHA 1BXKA 5FNZA 4K9DA 3ZZ1A 1ZMOA 4RZSA 5LA6F 3BXHA 3Q2OA 2P0YA 3KKPA 3SF0A 5EJAA 2D2IA 2PMFA 1EFUA 1YHYA 3ETHA 3T41A 4R9VA 3U9SA 3EVDA 1UBCA 3HXTA 4HEA1 1WDLA 1PU2A 3ZR4B 4E13A 3AFNA 1YUNA 2CLCX 2G1KA 4YRIA 5KTRA 3L0PA 1M76A 1Y8QA 3TKLA 5CB4A 1NYQA 2D5CA 1J0DA 2J33A 4B0OA 3FZGA 3RYTC 2UXCB 1SC9A 4YMHA 2JIRA 4WMLA 1XNHA 2WM9B 4BQNA 1FFHA 1MA3A 1SUEA 2FAXA 2XCUA 1L7VC 3IHLA 5DN6D 3ZJ5A 3EVBA 4RIFA 2PTGA 5DX0A 1XRJA 2QW8A 4S0ZA 1G2IA 4CPDA 2JC3A 3G2NA 4C9BA 1MJGM 4F93B 3WV4A 5CHYA 1OWLA 1VG8A 4QJ3A 2PKCA 3UK6A 1YNOA 3I9OA 1KIMA 4LDNA 1IVSA 3BH0A 2Q3BA 1SHJA 1IMJA 2PKXA 4MMYB 5CG2A 1I5OA 4UU8A 3CIFA 4KH1A 1NR1A 1V11B 5LOVF 1XN1A 5JATA 4YYZA 2WD7A 2XW6A 2ECFA 2W71A 4UE6A 4DCTA 2HI0A 4E2YA 3A26A 3UJ3X 3RVQA 1R5OA 1WZCA 3E8SA 3OPYA 1LK7A 3MQ2A 2HU8A 3DL4A 4UM5A 1RLOA 5AICA 4RJ2A 3BXXA 4FQ8A 4ARVA 2AR9A 4BGVA 2GN2A 2JKYA 4MQMA 3GN2A 1D0IA 2BONA 3C6YA 3G2IA 3WJ2A 2W7TA 4AFNA 3RRJA 2PKQP 3O3CA 5DZSA 2YJ4A 5TMEA 1UP4A 4JLKA 4DQUA 1L8LA 3WGTA 3Q12A 3PDHA 3LDHA 1KK2A 2I22A 2E4VA 2IY8A 4QUJA 1IQUA 2I6QA 2OUIA 3VYSB 2IXFA 2V6JA 2AUMA 5AUOB 3U40A 2DMRA 3ORSA 3WLLA 2FE4A 1LBIA 5DXAA 3S55A 4F3KA 3IE1A 5HGJA 2JGIA 2P8SA 2R7NA 4HB0A 4G86A 4KBGA 4OQFA 1V5WA 5B7PA 5BOSB 1Y5MA 3PNPA 5FTJA 1YJ8A 3DL7A 2C8JA 2VK8A 2ODEA 4HQNA 3H1EA 4OM8A 4PRYA 3VMMA 4L6IA 2JANA 4JLNA 1RTKA 1XAJA 2I8AA 1P2GA 5BXYA 1JEEA 3MM4A 4PR0A 1Y80A 4W5HA 1SZCA 4XVHA 1KK3A 1M6YA 5K3AA 1XJQA 4YT4A 1FDWA 1Y1QA 4ESEA 1S9HA 3W5CA 4FYKA 4HLUC 3G8DA 4M88A 4R3NA 4GVPA 1E9RA 4IICA 3K70D 4HOYA 4KDEA 1WSWA 4MUEA 1KJQA 2RKWA 1CY0A 3HEBA 4IIYA 4B3XA 5K45A 5LP6B 4RDIA 4OMCA 2QM7A 2R1ZA 1GPMA 1M2GA 2C2YA 4QBHA 4GLFA 1MVOA 4ND4A 4Q9IA 1T35A 2DP4E 1EP1B 1R0RE 1WP9A 3MCZA 3NM6B 2VTBB 1VI6A 3MWDA 3WRVA 4HP8A 2P9JA 4DXDA 2DRIA 1J2TA 2E9SA 3NUGA 4O25A 2Y92A 4G5YA 4M46A 4DJJA 2EYQA 2FV8A 2PL1A 3SD7A 3WWPA 4BFLA 4V2UA 3IPRA 3GDGA 3FOEC 3PFCA 3TW0A 4KLZA 1S1MA 5DGTA 4KR2A 1QPGA 2NO5A 4V0QA 2IXDA 2PX4A 3P2IA 3NEPX 3OQMA 2AUNA 2CJYA 4W9MC 1EA5A 5I7HA 4DG9A 2R85A 2Z5GA 4TRMA 4YAOA 3OAAA 3PUYA 1HDYA 1FQOA 3KQNA 2KLBA 1JQLB 4HNAA 2QORA 1K1EA 4C4YA 4HL6A 4W99A 1RACA 1VGQA 4IRMA 3OMXA 1XVIA 1E6KA 2OGZA 4IFTA 5EKSA 3OCVA 3IEVA 1C8KA 2JH8A 1OAKA 1NP3A 3NTQA 4HB3A 4HH1A 1NF8A 3SKVA 4HLUA 1Q7RA 3LVRE 4D0NA 4C03A 3COYA 4KFSA 5BSFA 1ONOA 2X2FA 2Y76A 5D84A 4BQSA 2FWIA 2J07A 4DR7B 1OF1A 2PN1A 4K9RA 3AR2A 4QG7A 5IYZB 2B6NA 5I3CA 2HBQA 3TTTA 3JV7A 4FKBA 9GPBA 4YCNA 3SLGA 2WU0A 4JLAA 4KXNA 3ZWNA 4R1TA 4AMUA 1HH4A 1LBHA 3O21A 5E7MA 1FX0B 4XI9A 1ZIYA 3M4XA 1GGJA 4KMOA 5ADUS 1L5YA 2P9CA 3V1UA 3C41J 5AM5A 5EHXA 3T38A 2F59A 1JUDA 3K4PA 4RPGA 3SS9X 3F3SA 3U7QB 2R4TA 3BYZA 2UYHA 2DXIA 3TZCA 4BAUA 4PG8A 4DBLE 1F51E 1VHLA 2JA2A 3KKQA 3ZGYA 1YU9A 3CRQA 3KJZA 3AHGA 4B46A 3F6CA 1ISHA 1QIDA 1WWKA 2QTTA 2CB9A 2PGXA 3DXFA 3FYHA 3ETLA 3QI2A 3EG5A 5ALSA 3RNOA 4QDZA 1H65A 4YAUA 2O7QA 1GNQA 3QFCA 6GPBA 3WGNA 5I4IA 1CQXA 1M72A 1USUA 3QLVA 4RKQA 5JWOA 2EKLA 2C04A 4ZI5A 4LDRA 1GT91 5JMPA 2VBIA 3V8VA 3ZDEA 4F1WA 1JEQA 1XMPA 2L19A 1QJCA 4QOSA 4RK1A 2WMYA 5FO0A 5EJFA 1WO8A 2BI8A 2H54A 2C4MA 3H4MA 4OU5A 1KJYA 4NJMB 3LI2A 1I5RA 2RDMA 2R7AA 4FYHA 3MMNA 5JCJA 2IYVA 5IT4A 4GI2A 1ZGGA 4DB2A 4ZCLA 4CM9A 2PT9A 1GGHA 4C08A 3PA8A 3HTXA 2EHJA 1GPJA 1UODA 2K7ZA 1MJGA 1JEAA 1XRSB 3HUFA 4OQDA 3EIXA 3LTNC 2IXEA 1K86A 1UPUA 3O75A 2EGGA 1ORHA 1V7CA 2V0NA 4XQGA 5EIAA 4RFSB 5L3RA 4CDGA 2PUWA 4F4DA 3A4IA 2PXXA 2IEIA 3ER8A 1RHKA 1IN5A 5DOVA 5FPSA 1G4AE 4REQB 4B3IA 1Q83A 1RYFA 1C41A 1SOWA 4ZYWA 2Z8XA 4EKYA 4QHSA 2BZGA 4DC9A 4W1SA 2JLYA 5I7SA 3B38A 3FPGA 3ISJA 4Z6KA 3FGOA 5LZ7A 5HS6A 3DTVA 4PTYA 3OEHA 2C9MA 2CLEB 3NWJA 4GC9A 4NPAA 4PG7A 2FUG6 3HXQA 4IKEA 2FG7C 5C4IA 5ITWA 1NXWA 3DKIA 3JQBA 1ODTC 3PPXA 2XMQA 4AUNA 1V35A 5L3VA 3KZ1E 6ADHA 1A95A 1NJ8A 2Q45A 1THTA 3N8KA 3PWZA 1L1FA 5BR1A 4NBWA 3RC8A 1DIHA 2FU5C 1K08A 4AQYB 3LYUA 1Z5VA 2QP9X 1ZICA 3Q2KA 3ROXA 4F5ZA 2IYLD 3FCCA 3WJAA 1R3UA 1VPTA 4EO4A 3BWVA 2RGNA 1GKIA 1PKEA 3NGXA 5DBEX 4MYCA 1PLLA 2G0NA 1TYZA 1XRRA 3EZNA 4PLGA 2X0RA 4C89A 3RV3A 1MX9A 2J9FB 2NADA 3R7LA 4YT2A 2R44A 4M7WA 4ZP1A 2L82A 1E98A 1O5TA 2ORWA 4IHJB 1B0ZA 2Q1WA 3V4RA 4R81A 3H6GA 2Q2NA 2HAEA 2F1KA 5TQJA 3RT1A 3GIDA 3I72A 4OU4A 1PW5A 5DSTA 4IJWA 2ZQ5A 1RRPA 4Q9LA 2VDPB 4KRGA 2O5RA 2YXEA 3KBOA 3BPSA 4YRQA 3GGOA 2ZDHA 4C2AA 5KSOA 1H66A 3GT3A 4GXTA 5EOVA 3MT7A 1IHDA 3GJ8A 2AJDA 5BQXA 3RE1A 1FQKA 1ZNQO 2RG1A 1QS0B 2WPDA 4WX2B 4IIBA 1PEAA 3UC9A 3UJCA 2ZATA 3WLNA 3PJGA 1V7ZA 2EX4A 1JFLA 1U2SA 4INOA 2PGOA 1UJ5A 3KQMA 3D31A 3OPXA 4OAOA 4RV9A 4AJ1A 3HFGA 4Y18A 1IPEA 5DNYB 1DI0A 1OWPA 3EFHA 2WICA 3EHEA 3DOFA 4QJ5A 1SU8A 2W6OA 4DR3B 4WEQA 1U7HA 3FMOB 3BSWA 1R0YA 1ZI8A 4XQ9A 3KLNA 4Q1EA 3N59A 3BJMA 3RVDA 5AW0A 1GGEA 1EINA 4O1IA 4JYCA 4EW6A 4YRGA 4NCAA 4J9VA 2YCLA 4MQEA 4DCVA 5KPDA 1T1GA 2QW0X 3W5DA 4FHDA 3OZGA 1II9A 1T9KA 4JNKA 2WV7A 1JSRA 1QCZA 3IBCA 1YL7A 2BV3A 3GVHA 4GW3A 3BBPA 4NCXA 4L02A 4RFSA 1CXZA 4XFKA 2IEYA 2WF9A 3ZNNA 4D81A 3GK3A 4EHAA 3OHPA 3LX6A 4GNKA 4P3PA 1IRXA 1E2GA 1YBHA 5JCJD 2GAOA 4AYTA 3ADDA 2YY6A 3A1TA 2BFEB 4H1HA 1M34B 1DXHA 2PH1A 2QPAA 1X0XA 2ZJ2A 1ST2A 5EIBD 2O0HA 3OEED 4QDTA 3WAKA 1Z4IA 1C0EA 3FUTA 2F00A 3WYGA 4G8DA 3N0WA 3JQRA 1JEQB 2ZIXB 4JA2A 3FI0A 4D4KA 4O4JA 5IAAA 3HVJA 1TRHA 3SYLA 4KVGA 1VQ1A 4Q1VA 1ZJWA 1YZ3A 1IK4A 5AOVA 3I28A 1W5SA 4N0PA 1B6GA 2FSIA 1MKYA 3HV0A 1FFSA 1T8UA 1VGVA 2AL7A 1WUJS 2AN4A 3O82A 3RT7A 1Z4NA 3F1KA 1LDNA 1RBZA 4KX5A 1RWKA 1B8OA 3D8HA 4IHQA 2XRZA 1QVVA 4MP3A 3TLMA 5ALVA 4HGOA 1C1HA 1EUCA 4F6CA 1MIOB 3KKKA 3LYAA 3UMBA 1JYSA 4ECAA 3L6UA 2B8NA 4E15A 1XA4A 1RCFA 1N2XA 3QUCA 1OVMA 2AWNA 3SBXA 4FFLA 4EYEA 5EFZA 5G0SA 2Y1LA 2YJGA 5F7JA 1HL7A 4WADA 2AVNA 2IXAA 4UBJA 3B8HA 4QDXA 3URKA 2XQFA 3VR2A 1QV7A 3QLTA 2V54A 2V6BA 2VZ0A 4O4IA 1VPEA 5FNVB 1QGAA 3AJEA 3IAFA 4URUR 5FP0A 4QLBA 5JY6A 5JXWA 3ZV3A 4NXMB 1VGRA 4FR2A 1IQRA 1EP2B 1WUIS 3R09A 1G20A 2MSEB 1U9YA 4ZQHA 1EGVB 3I1YA 4I19A 4DOMA 5JNSA 5KQPA 1Z37A 4QSMA 2G8LA 4JQZA 1KDOA 3AEQA 3LO5A 3I8OA 4L5IA 2TMDA 1KKUA 3RC1A 1F06A 1G3MA 4I50A 4QJ4A 5SYMA 1C9EA 2QDXA 2DCUA 2QT1A 3REQB 5L3SA 3AI7A 3NBUA 4GQIA 4RA9B 3G5UA 2GGSA 2HSJA 2HD4A 3FZYA 3KOYA 3FFXA 4N3CA 1MC4A 3DMNA 3OJCA 1LZKA 1NULA 1P72A 5EWMB 3PLAE 1GIAA 2R48A 1B6SA 4FM9A 2H1OA 5LBIA 3VHRA 3T3DA 1F2UA 2VRBA 1LWOA 4RO0A 4ZQIA 3T5GA 3FROA 3MELA 4WXYB 3UYLA 1O95C 1C9YA 2JGNA 4Q03A 2PUGA 2QV7A 2ZYRA 1QDEA 3OFSA 2QVCA 1JXMA 4RXTA 1QP7A 2Z83A 2VJLA 3IJ5A 3MW8A 3V1YA 1PQWA 2C2BA 3F73A 4YNBA 5ED4A 3EUWA 1KH1A 1SURA 4G8CA 5SZJA 1NVXQ 1Y0BA 2YRXA 1DBSA 1H0RA 4WNYA 4PZEA 2HQOA 4IEFB 1GZVA 1UAGA 1YS7A 5FJJA 5JMTA 1XVAA 2Z6UA 2C9CA 1DB3A 2D0OB 1ECFA 3R24A 4P08A 4DSUA 2C2ZA 1YZFA 2VP2A 5AD1A 1UBNA 4HDAA 1QIKA 4Z4IA 1ZOIA 5EE0A 1J2YA 1ODKA 2GBLA 5DI9A 4PAOA 3X3HA 1Z4PX 5A5FA 1LRKA 3G5MA 4RNCA 5LPNA 3L4JA 5FBWB 3DS8A 1P5FA 2RAUA 3COPA 1ZMBA 3K1JA 1E1CA 3OCZA 4I81A 2OQVA 5A04A 3MS4A 4JLOA 1NVWQ 2ZSJA 3LNTA 2CHEA 2BE7A 1SH7A 4LZLA 4RUKA 3M3HA 2W6ID 3DE7X 4W63A 4IDPA 3UATA 1LF0A 3ZGVA 3PJFA 2WJZB 4G5OA 1NVTA 3PXGA 2QT9A 2WZQA 1HYHA 1SCUA 4Y2SA 3JQAD 1F7UA 4G0XA 1FLNA 7MHTA 1ZW1A 2I66A 1T2FA 3UHJA 1K7EB 2YQ5A 4IIFA 4MGYR 1LZLA 3IB3A 3TQHA 3I6BA 1D09A 4LXGA 3DONA 2FCAA 3KD2A 3BTUA 1VE6A 1W87A 1YZUA 3W04A 4F6RB 3R3JA 3C8HA 2GXUA 1Q92A 5IF3A 3NP7A 1JPNA 2VPTA 5JCOC 2YXPX 1ZONA 3CKKA 4JJ7A 3OMLA 3BM5A 4R8RA 4KN8A 3L8YA 3ASYA 4XW2A 3JU3A 5CJPA 2C9ZA 5LZ4A 4AZ0B 1ENPA 5JZ9A 1Q0SA 1TYCA 1ORIA 4FE7A 4IL5A 3T9BA 4Q9DA 3HO6A 4XJTA 5CX4A 4BOYA 2CSUA 3Q7PA 3NAQA 5I4KA 1XWWA 1VJRA 1VDZA 3A1FA 5G0VA 4EG3A 4PFQA 2YJ5A 3MINB 4HF7A 4TKUA 4DPLA 1MJHA 2HJVA 3FLEA 1DFGA 3C3XA 2G67A 2Q8QA 1V3QE 1AUQA 4ZCRA 1YQEA 3GQVA 4CTKA 1K75A 3H2ZA 4YRPA 1UMKA 1C4XA 1SXGA 3AB8A 1KR5A 3C6MA 1UKEA 2R7MA 2JAHA 4MEBA 3W6UA 1DKQA 4OFZA 4CIAA 3LF2A 1TVCA 4MVJM 2IBMA 4QRDA 2AEEA 4YJHA 4CLOB 1DDIA 4MTLA 3TOXA 2ZSBA 4RPJA 4YRBA 3PC7A 2WUVA 3LY9A 1T6XA 4QUKA 3GV0A 5T57A 3WE7A 5TVGA 3D4OA 2QM3A 3NYQA 4AUEA 4MUJA 1IEWA 5DWQA 1CK4A 5K3CA 1RP1A 4LGVA 4AJPA 1QFXA 3NVDA 5JANA 1ZDMA 2J08A 3ULKA 1O6ZA 3C3DA 4IS3A 2TECE 4E88A 3UYKA 3NOOA 3RVMA 3Q3IA 1R0CA 2GJ4A 1PV2A 4Z99A 4RKFA 3HKEB 4FFBB 3AERA 1IG3A 2FMUA 4NV0A 3GRRA 4IO0A 1G21E 1Q1BA 3UHOA 1QKKA 4XWAA 2FSHA 2C8KA 1NZFA 2BZ0A 1EE2A 2FPPB 2CUNA 1PUJA 2DKNA 2IZ6A 2REQA 3AK4A 1D1PA 3IFSA 3TD6A 5FNVA 4EX6A 1ZOPA 2PA3A 1ZOSA 4WCFC 4BX0A 3GUCA 3I9FA 2O6LA 3HXLA 1QANA 1SC1A 1SCDA 2VFAA 3DHVA 1E9BA 2GJ9A 2ZBVA 4QD3A 3WLFA 3B2EA 2HMSA 4NBTA 5JNLA 1YFZA 3JQAB 1E3TA 1B23P 4NF2A 1DG1G 1J2EA 4QQKA 1Z5OA 5E6RA 1J0AA 4ZOBA 2POQX 3WRWA 2GAAA 1NUQA 2PMCA 4M8NE 1BIFA 4RTLA 1PJBA 1J8VA 1HT1E 4GZ5A 4QBKA 3LSTA 4ZHQF 1BXRB 4RTKA 2Q07A 4ASUD 1GZSA 5ESXA 2QGZA 2GVDC 3OY7A 5FLEX 3PDIA 3E3OA 3GJ7A 3CNQS 5GZ1A 1BW9A 5K0SA 4Z4QA 4FJ0A 2HYDA 4H27A 3I9V1 5F4ZA 1CUUA 3GFSA 1EFHA 3TIGA 1W2HA 3N8HA 3HI4A 5J5AA 1AO3A 1ILWA 4QGFA 4IXDA 1OBCA 1RXYA 4J0IA 1JHRA 1T1IA 1F12A 1SG0A 2RGAA 1KS2A 1NBME 5IRCD 3LX4A 5CB4F 4ZAYA 3FHCB 2QY9A 1EFPA 1YS6A 3RUFA 4AKIA 3E5NA 4QYXA 1ZC3A 3RC7A 3OIVA 3BIJA 4DLSA 1WXIA 2W42A 4FT4A 4WFKA 3OQVA 1N0IA 2ODBA 5ALTA 4UBIA 3VPAA 2IU6A 1FXWA 3WLAA 4ENWA 3DO8A 3X1DA 4ZYZA 1A7UA 3VO2A 1D3AA 2HLPA 2IYAA 4X44A 2H51A 4ZC1A 1EIZA 3DPSA 3I53A 5CLJA 5K0ZA 3SZMA 4EKDA 3LIIA 2P1RA 4FYMA 3FMPB 1Z6QA 4FBGA 3VV2A 4AC9A 1T4CB 1P81A 2YW2A 3JYLA 4MQ5A 3HDJA 4NCBA 4QYWA 4EPWA 3UV6A 4O2RA 1C3OB 2HBRA 4DA0A 3QTLA 2JLXA 1APBA 2PSSA 2X5JO 2C1EA 3CLKA 3GJXC 1DC4A 3Q7RA 1GGMA 4JYAB 2Z9CA 5DBIA 3OE4A 3EFBA 4CQMA 1LPNA 3N2GA 5ICMA 1ZQ1A 5IBQA 4K6HA 1FSSA 3FTNA 2WYHA 2KMLA 1Y6QA 3NV7A 1OXTA 3CGWA 3K1ZA 2DEUA 2EV9A 2FSVC 5IKEA 2RONA 3RRYA 1G7CA 1AKWA 5CXUA 5DTRA 3UK1A 1AV6A 1UDBA 2PRKA 3CPSA 2P4QA 1Z7GA 2WR8A 1T5BA 3JQDA 3NTXA 4FYWA 4J1QA 1DWQA 2O3SA 1K27A 3TS1A 3FTDA 5DNAA 4DEVA 1JAXA 3JALA 2CWWA 1ZMXA 3PPYA 2H2HA 4UMDA 4F04A 1RFGE 4ATNA 3KQUA 4KB5A 1SQ6A 4MMXB 2HF2A 3JD3A 3VNRA 1A71A 4GP7A 2OO5A 5FA5A 5CA1F 3GFQA 1C2YA 2ZJ6A 5JS6A 3A6HA 1WDKA 2LVBA 1F3LA 3B1VA 3IAHA 5T64A 4AN4A 2HCFA 1SOVA 4DDMA 4W5QA 3F97A 4EJ0A 4NX2A 4JT4A 4RADA 4IEEA 1R74A 2QUIA 3SC2A 2WJPA 3KLMX 3DZFA 3IP3A 4PLVA 4FGKA 4R01A 4CMHA 3WHIA 1W88A 3S27A 1YVUA 5IKMA 1E2BA 1GEGA 4AF8A 1KF0A 3DH0A 5L6LB 5ALXA 1FZTA 3MUFA 1Q7CA 5KDLA 1M83A 3HCNA 3I6IA 3OBBA 4PE5B 3HCRA 4CDNA 1Z0SA 1NPDA 2EFGA 3QX9A 3OJFA 4Z2YA 5KTSA 5GADl 4MINA 1AK9A 3DV0B 4MIOA 4TSRA 1ZLYA 1PN3A 4MUAA 3L8DA 3JAMA 3BKXA 1TJNA 5BOSA 5BV1A 2VP9A 1TK2A 1OT5A 2YN2A 3M34A 3RVOA 4NQRA 3SX2A 2I91A 1YWGO 3BEOA 3VX4A 4KQCA 1LLCA 2C92A 2JD0A 3LHIA 3ZW8A 4EK9A 2BTOA 2H4ZA 5F2OA 2P9ZA 4IIHA 1N6KA 1WB9A 4JC4A 4BCCA 1IBCA 1MLDA 2I2FA 2IQ5A 1RQ7A 2Q8NA 4HDKA 4XZ3A 3I1IA 3PUXA 3BCSA 4OJYA 4HQ0A 1SOMA 2FMHA 2H1HA 2FR8C 4U63A 5TARA 3T7JA 3VXKA 2EKBA 2R6ZA 4KXXA 2Z4RA 1D2GA 1T0IA 1VCHA 3C6XA 4EYQA 1Q84A 4IZ6A 4OIMA 1J7JA 3WG9A 5E6UB 1XU4A 2EIHA 2UZ0A 1CW2B 4MCAA 1OBVA 1XCBA 4MI6A 1PQUA 2GTHA 3K9WA 5KU1A 4J1SA 1YHZA 2JPDA 1GGFA 3NMUF 2QRKA 4NJEB 4GICA 4WTOA 3EPLA 1EFVA 1U2PA 1IJEA 1YJQA 2AOTB 2F1IA 2VRCA 4Z0TA 2CXRA 4HX5A 3FWKA 3JQ7A 2HV8A 4H17A 5AKIA 2O0MA 1T4BA 3TW4A 2IS6A 4BLRA 1TUGA 2CDNA 2V96A 1SKYE 3ST7A 3EARA 3ZK9A 1WW2A 4EJSC 3T3MB 5T8KA 2WTEA 5FHQA 2A6PA 2YIMA 1A9ZA 4JJ6A 4DKJA 3O31A 4CLDA 5ICCA 1ISJA 3MGAA 3A1NA 4OHWA 1XTIA 2Q3HA 2VSOA 3D6AA 4D0GA 1WMDA 4O2AB 2IDZA 3K31A 4Q3BA 4DV4B 5AHXA 3HDGA 3JTMA 1B0UA 2I2WA 1DRWA 1FUKA 3HCBA 3QY9A 4KHPB 3Q41A 3D7MA 1GKUB 2HPZA 1XCMA 1XP5A 1UZNA 4ZALA 3G1UA 5EL0A 1SIOA 2H8GA 4FB4A 5SV2A 1TIPA 4YLGA 1YZYA 1NW9B 4LXQA 1XTTA 4YDQA 3W1VA 1NTRA 2I7XA 3MC1A 3RS5A 3WIDA 4IINA 3QU2A 3U9LA 4R16A 1GU0A 2PANA 2R3SA 3WRYC 1XNQB 3HWWA 1Q44A 1XMJA 5CBPB 1L5FA 4Q4HB 4PICA 5E0OA 1K8XB 2H00A 4H59A 4UM8B 3SVLA 4YO8A 2CMKA 4J03A 5KYGA 4JR1A 4R51A 2C4KA 2O8EB 3I4FA 1J8FA 1GNLA 4TWRA 1H9BA 3MTJA 4KIGA 4PTZA 3H1PA 3LXUX 1GR0A 5HIAA 4OI0A 2IYXA 3IUNA 2CLDX 2GM4A 2ZUWA 5KYNA 5CA0F 1D8AA 1EQAA 1P44A 3GEEA 5CLGA 4XYLA 1A7AA 3TQIA 2G9ZA 1ZQ9A 3JD1A 3LK7A 3AHHA 3CZRA 1KZ9A 3QXSA 4KAFA 3HYRA 4BVGA 3KB8A 2AG6A 2HA0A 4NICA 4CF6A 2AFHA 4DMRA 4F4HA 4FMCB 3KKNA 1HWYA 3GEPA 2VPQA 4ZK6A 1KAQA 3ANXA 3E18A 4IUYA 3E8XA 4ZIRA 3B13B 4DGQA 4TTRA 1YDHA 1KJIA 2H3HA 1BKYA 3R5KA 3JQFC 5AHWA 3V4VB 1F17A 2QA5A 3A1UA 3O5AA 3KQYA 2O8DA 2BGUA 2G9RA 5ADVA 1R5JA 1M2FA 1AXRA 1X6VA 4E5YA 3E5MA 3A05A 4Y3UA 1BC5A 2B1IA 4RLHA 4YXFA 4HGZA 1QRUA 2BHRA 3F6RA 4GZ6A 2JAUA 2QTAA 2ZJYA 1IBRA 4BB6A 3SY8A 3KOWA 3V97A 1YJCA 3IR6A 1QQ5A 1ZINA 2HLHA 2H6EA 3NONA 3NXKA 2NZYA 4KR0A 1AKVA 5DCLA 1RJ9B 4ENTA 4YUZA 4KPFC 2ZVJA 1JEYB 4CMIB 1C7RA 3OIUA 3NIBA 5IT9A 2AC7A 1LC0A 4WZBA 4IIJA 4N9QA 4RU1A 2HSWA 3DFIA 1KP9A 5A6VA 1WQ4A 5DBGA 3FWYA 4B6RA 1M2KA 4K9QA 3TVDA 3T3OA 1QR6A 4QXAA 2C7VA 1M2VB 2APJA 4A6PA 4DLYA 5I9IA 1GPWB 1OGIA 5B7NA 2AXQA 2IPNA 2GNPA 1LX7A 5TMBA 3FTCA 2JLQA 4FVTA 3JQ9A 4RTQA 2NP6A 1HEIA 2IYRA 4B85A 3H5TA 2H4FA 2X3UA 2GNOA 2IS4A 1C0LA 1UZMA 2ZT6A 5E4YA 3VDNB 5KNBD 1XZDA 3AHFA 3B7GA 5C8YB 3MCTA 1QVZA 1R1DA 2XNKA 1OA0A 1Z83A 3EMDA 4OBXA 4MRMA 1NFFA 1BG6A 1I24A 1T1RA 4O2BA 1RRCA 4DE5A 5HZGA 4MEJA 3GLUA 4M9SA 4OI2A 3V34A 4AYXA 1P1IA 1VI5A 5DSXA 2FXIA 2LNDA 4P5DA 5DTMA 1YIDA 3VGPA 2GKOA 2QAGC 1U3VA 3A8TA 3ETNA 3EBPA 4L51A 2Q6IA 3CISA 3AESB 5LWQA 1L5SA 1N2CA 2CHQA 3GMDA 4JC5A 4RYLA 5FTMA 4AY2A 2DBVO 5TQVA 4OF4A 3SK0A 7ABPA 3PEEA 1P62B 2ES4A 4DN6A 4NV1A 3AM5A 3SIXA 4ETMA 4H18A 5HKOA 4Z4EA 1J1UA 1F8GA 4IZHA 1FUIA 3VVCA 1KI6B 1GFWA 2VBFA 1PGJA 1CUEA 1K8QA 1VLMA 2HA4A 5DSZA 4G84A 2IOYA 1NTOA 2M1ZA 3SJZA 1NW7A 4IBOA 4PIPA 1KYXA 4IUDS 3LCUA 4M0DA 5AUNB 1NQUA 2GPNA 4JP2A 1ORVA 1CEYA 3AC0A 2CCKA 1YE8A 2NXNA 1WSAA 4B80A 1AQNA 2GFIA 1K9VF 1J33A 3TXYA 2G3YA 4G4SO 1Z25A 4FUTA 2Q0SA 1H1DA 1NN3A 4Y6OA 3FGZA 3WLOA 4RTNA 3GYBA 1GP2A 2OGWA 1DWOA 4AS3A 4RE6A 2X58A 1MRSA 3U7HB 5LDGA 4PANA 2R47A 4MWSA 3DZKA 3ASUA 3OOEA 3ADKA 3VU9B 2IDMA 3E05A 4I8IA 4CLRA 4V2IA 1YRQA 1FS6A 3VKVA 3KT3A 2VJKA 4ITUA 5U4XA 3DTVB 1UFKA 2OZLB 4Q9KA 1G6OA 1NYRA 2O06A 1LVUA 3QYAA 5DF1A 1X15A 5E1BA 5C7IO 5FQNA 5D5PA 1KZ7B 3OF2A 4JB2A 2PRJA 4E03A 2FPGA 2CVQA 1E2MA 3KB6A 2JGKA 1WXFA 3ENZA 1RKVA 3FBTA 1NI4B 3PIDA 3ZHVA 4MUHA 4XM2A 4DLKA 4EHLA 1V1JA 4CR6A 4DMCA 4CHGA 4Z2AA 2VO1A 1U0TA 3ZBUA 1U7ZA 4FCTA 1TVKA 1E32A 2ZRKA 3LZ6A 3F3KA 1NVVQ 2O8VA 3N58A 1OLUB 4FN5A 4LRXA 2XJ4A 4RSMA 5DYWA 3COZA 2Y27A 1J56A 1Z4QA 3ECSA 3B51X 3LGAA 4WY2A 4PVCA 3V6LA 2HK9A 1AVTA 4DCCA 1R0BA 1KJ8A 1Z2EA 2JKZA 2XMCA 1U0FA 3GCXA 4J1NA 1SD1A 5HF8A 2JI9A 3U48A 3JSAA 3QNWA 5LZ9A 3UCFA 2RGDA 2V3VA 1U6KA 4BNHA 1PZXA 1HFKA 5DM2A 1UBKS 4NKRA 3FPAA 3FFAA 1TK3A 4OXYA 4IDQA 1KTVA 3GQBB 4RZHA 5BVHB 2WJAA 1PNVA 3F8TA 3ZXYA 3NT2A 1NMZA 1WY7A 1CJKC 1PEYA 5ERGB 4GX2A 1BQ4A 5DYGA 1HY3A 3MWFA 2H08A 1LQ2A 1JNXX 2QLTA 1JW9B 2OGUA 5EMLA 2WA2A 4DZTA 3OPMA 3R4VA 1ZD5A 3C1UA 2V65A 3BWDD 5TS3A 3GH1A 4FU0A 2P6UA 3HVUA 4HSEA 1VI2A 1XXHA 2J9RA 3KYCB 3PEUA 5EZYB 4KR7A 2QVBA 3V1NA 1IWOA 1TEHA 2DWCA 2QN6A 2WJGA 3FKJA 4R6WA 2MU1A 3TW8B 2YC4C 3ND6A 3L1HA 2PUTA 4YWJA 1OCEA 4WZAB 3KZKA 1BVHA 1KS9A 4ND8B 1QLJA 3E22B 4YA6A 1NDHA 2YRFA 2YOHA 4AZ3B 4WK0B 2FUCA 3TZBA 2NYAA 4DC0A 3RJ5A 4MHSA 2QG9A 3IHWA 4QBGB 4CDMA 4TZ6A 2CBXA 2FFQA 4DWJA 3T5PA 2ZT7A 2JFNA 2WMOB 1ORTA 1CZOA 4HWSA 4V0KA 4NCHA 1KZ6A 3ISTA 4TMYA 1ZH4A 4ZVSA 1E3QA 4ETNA 4PVDA 4Q48A 3KTOA 3ROPA 1OQAA 2OBMA 1KSGA 1SQ0A 2O2GA 4CE6A 2VWHA 1TUEA 5LDHA 2I71A 2A1UA 4IF4A 4MW2A 2UYQA 4HNAB 4XDGA 3SOZA 5BQ3A 4URXR 4CMJA 2VJAA 2ZIEA 3TKYA 5IAGA 2FH5B 1JB1A 1KNQA 4JJGA 3NHAA 4A23A 2WWRA 3H5NA 2EKQA 2JAQA 3FPBA 1M6EX 4ICIA 2BW0A 3AHEA 3G1WA 4C0AC 3MPOA 1T43A 2A78A 2GXSA 1A5TA 5EJ2A 2R5NA 5JEDA 3OURA 3W79A 1XK6A 3RQIA 4YJFA 3L82B 4I4TF 2B5VA 4JUBA 3EHDA 3ETJA 1C14A 4ZQGA 3I2KA 2XBMA 1M66A 3JZFA 4GF5A 2Q4RA 3EYAA 4OQLA 4RE5A 1U7OA 4B6SA 2NV2B 2AYYA 1N3BA 2TMYA 4Q4JB 1JB9A 1Q6YA 3EPKA 1FJHA 4WK6A 3R7SA 1W88B 3S2FA 1GM5A 1PGQA 2ZYGA 4R0NA 3B3JA 4BMCA 1KQGA 5JNRA 4BQIA 2BOVA 4M0PA 3R0VA 4PX2A 3T4UA 2D5AA 2FSVA 2CXTA 5L3QA 2AJTA 1YBMA 2NQTA 2BM1A 3K1YA 3MD9A 4IMRA 5GGYA 4E2FA 5IF9A 1PJ2A 1TTTA 4TKVA 4YPOA 3CO5A 1E9CA 1MEEA 3EH1A 4YREA 2WABA 2CLLB 2P90A 1E89A 2EL9A 4LOLA 3L1JA 4YCBA 3TJMA 5BMVF 2RGRA 1WF3A 3ESDA 3D4BA 5TGZA 3RRZA 1R8SA 2P11A 4CWAA 5KMGA 1OZFA 1YS1X 2COKA 2QTRA 2PMKA 4LTDA 3CR8A 2OCXA 4WLEA 4BKQA 5I45A 1GPYA 1OFUA 1QG6A 3PIIA 4ENVA 1GSOA 5ALDA 2CFSA 1Y4ZA 2BCGY 2Y77A 3FI9A 3MN1A 5JVDA 2JFZA 1WHSB 1XA0A 4FOLA 1UMBA 4MWZA 5CH5A 2E7ZA 3JXEA 2GA9A 2BFFA 2I55A 2QT0A 4Y2XA 4Q9JA 3Q9UA 2FX2A 1H5NA 1UBRS 2BSXA 2YQZA 3PDCA 1AF7A 4V38A 3TINA 1OB5A 1KY4A 2PWPA 3B85A 2JVJA 3NGLA 2BMVA 1JIKA 4O02B 3ZCPA 1XCGB 4A9AA 1A9PA 1D6SA 2VZ8A 3B1KA 4B81A 4UAUA 2M6RA 2RAPA 3M49A 3OO0A 1L3BA 3T9AA 3QVOA 2GCIA 4QEKA 1M7BA 1SU6A 1TK9A 5KSPA 4AQDA 1GHTA 3E35A 2CXHA 4EG7A 1DO2A 3P7MA 1C3OA 1H85A 1QHNA 3N2ZB 2O1WA 3BE4A 1HEYA 1B8NA 2DECA 1XQ9A 4Y1RA 4H4CA 4YJ3B 2GCOB 3P0RA 3M1IA 3OKCA 2PR7A 2YY5A 2RKBA 2WD7B 4J0EA 1RQGA 1Q95A 5AI6A 4PYOA 3RUAA 2RCYA 3PZBA 4M8LA 3IVGA 5LA6B 4YUXA 1QP0A 4OEHA 4EENA 3H1TA 1VJGA 3RC9A 1Z26A 5HF6A 3P9YA 2FQWA 5A1TA 4OA8A 5FL7D 4A6DA 3PRYA 3TLBA 2YUTA 1EHYA 1PG5A 2ZIVB 4WN9B 3K0SA 2VQEB 1FVOA 3HBLA 5KOHB 2IWRA 3CNEA 1IL0A 2WNIA 1BSVA 1Q22A 1LJUA 3PP8A 2FGKA 4Z3OA 3DE4X 2I2DA 2KI5A 3IDAA 1X86B 1G7SA 1QQ7A 4BL5A 3HN2A 3DHNA 4I9UA 2R8RA 3PDIB 4HYEA 1Y8QB 5KUTA 1A4XA 3D6UA 5FWDA 3EK2A 1KARA 4KTVE 4AKSA 4P0QB 4JVMA 1J8DA 1WOYA 3Q0IA 4B9EA 3HQ4O 4ZOCA 7YASA 3GW8A 3PT9A 4C87A 1SQSA 4QHTA 3LLUA 1YCGA 3FDZB 2ZBRA 3K0EA 3VKFA 5KYVA 5B4UA 2IZ0A 1M0WA 3HFSA 5LOVB 1SVIA 1BDJA 3K6RA 1EH5A 4DXAA 4XYGA 2CFCA 1OT3A 3GUVA 3O90A 4U7TB 3BZWA 5EHZA 1T8PA 2UZ1A 2GESA 3RS4A 3UJ7A 3GNTA 2A1UB 2VAMA 2HRQA 3D4LA 3OOJA 3EW7A 4Y0AA 5JAUA 4X66B 1EQUA 3NPMA 5EG5A 1X2BA 3FYUB 1WXWA 4EKEA 5HS4A 4I5EA 3FVRA 4LYGA 1IM8A 2A67A 3VKUA 1TF7A 3Q1LA 1M2OA 4ZI7B 5CDHA 2RHTA 4QDJA 4F4UA 4KXWA 5T3UA 4DNFA 3IIEA 5JCXA 1Z35A 3UJAA 3RYIA 2P78A 4IV0A 4P35A 1JVNA 4ZOQI 3T7DA 3K9GA 1VYTA 2H63A 1OPRA 2BKAA 4UMFA 3ZOKA 5FUYA 1E0KA 3WB1A 2BEWB 2J5BA 3KFVA 4DIEA 5IABA 1AMNA 2XBUA 3O74A 1M7GA 2X86A 2QVXX 1FDUA 1RXCA 4TMZA 2FZCA 4DT1B 5DNCA 4PY2A 1E1LA 2ORED 4O63O 2V1UA 1NE7A 5EQDA 3VNAA 1AURA 1JA1A 2P2NA 1FXSA 4X45A 1KP2A 1P7WA 4LPKA 2D1RA 3QUAA 4HO1X 4C3ZA 1P74A 2BL4A 4QYTA 3WK7A 1Y9JA 2BR4A 4YR9A 2F64A 3ZIAA 2O5VA 1YQTA 5GPBA 5K8CA 1OLSB 3TGPA 1E69A 1AHNA 3QNMA 4C0QC 3KV3O 1AQIA 2X0IA 3OO1A 5KCZA 2X6RA 2C9BA 4JI1B 2CMDA 4E7OA 1SB9A 4HQKA 3S2UA 4IF6A 4BNYA 2QP3A 4PYRA 2XUHA 2XVMA 4UQOA 3FTEA 1S8AA 3C7DB 1A8PA 4HNVA 5K9ZA 3ZV5A 1XL1A 1YS4A 4BZPA 2NUBA 3BK7A 4IVPA 1O89A 4TKLA 5LP6F 2BGRA 4ESVA 3VOSA 3A6LA 5HM8A 4IJUA 3GCWA 2X7HA 3FWNA 4G5RA 1EWVA 1DCTA 1M2EA 5F3DA 3W5IA 1DEAA 5BWNA 3T7TA 3UXMA 3C1AA 1KGSA 1NOIA 1L5MA 1N2CB 5CCDA 1XP8A 3B6KA 3TQFA 2WYIA 3D0RA 2HREA 1WXDA 2DPXA 2XCOA 2ZUSA 4BFWA 1KO1A 1WDWB 2OAGA 1ISMA 1G3IA 2NYRA 2YJ3A 5TQ0B 1EUZA 3F98A 3WRXC 1NY6A 2ZYVX 2PS1A 3HR8A 3OA0A 4B43A 3LM8A 5M34A 1UC9A 4HDSA 1B43A 3VOAA 4NDNE 2NVOA 3KXIA 4OH7A 4UCFA 1E9AA 3F2VA 4N8DA 4XX1A 5BY2A 4TYYA 3HKEA 4MRMB 5J4YA 3M6AA 1NW5A 3TL6A 1QPZA 4ZEWA 2PLRA 5EHIA 3S1SA 1WABA 2Z2ZA 3ER9A 5AVUA 1EKXA 4ZKEA 2A7QA 4WFIA 4CLOA 1AE1A 3JWEA 3K3PA 1CY4A 4JGGA 5FFNA 1R64A 1PDWA 4F3RA 2IYZA 2J31A 3PRKE 3E3LA 3G85A 4BQRA 1I0ZA 2ODTX 4FHFA 5E1OA 4N0EA 4ZRNA 3VZDA 7REQB 1NSTA 2DZDA 1XRQA 3BXZA 4AS2A 1N3LA 3NNDA 5C34B 4AZSA 1TPZA 1WAMA 4MA5A 4QPCA 3GNLA 3CYFA 4QBIA 3ZWPA 5CAEA 5AVZA 4BFVA 3EVZA 3L0CA 2VVTA 3R5JA 3JAWB 3IL2A 5D2CA 2B1JA 1G8JA 5FTLA 1DAKA 5ESWA 3GLIA 3A04A 3DCJA 2OHGA 4JLUA 4UNNA 4JJ8A 4CM4B 5BQ5A 1OFUX 1HQYE 1QGUA 2H7YA 3DCNA 1SUSA 3TNLA 1QZUA 3U49A 4DREA 3KPVA 3VH4A 3AV3A 1O6BA 1GSHA 1P91A 4OI4A 3MJTA 2F9FA 5IHXA 1F8FA 2I4MA 1BVUA 1JJ7A 2O57A 2WHRA 5L95A 1GFZA 5FOUA 1Z0DA 1Y7PA 4B6PA 3CZ9A 4OLHA 3UH1A 3P2KA 2X15A 1FK8A 2D8AA 3DFZA 4EATA 1W36C 3UCXA 2AN3A 4Z1OA 1ZCZA 4LV5B 3AOEA 1JDBC 1VP9A 2I4RA 3Q10A 4L4RA 1XVLA 2CNWA 3PIRA 4MVJA 1FPQA 4OBEA 5EE3A 1D5WA 1TNDA 1KE1A 1OV4A 4I5IA 2YWHA 4BDTA 2FKNA 4ARCA 1I1NA 3V8EA 2OBFA 2EP5A 2B2NA 2QRGA 3NHJA 3I9KA 2F6RA 1G5HA 1Z3CA 1QF7A 1E96A 2OBXA 2OD9A 2RHDA 2VP4A 2WHPB 3H9UA 2HU7A 4I1RA 5FOQA 2Q1XA 5IVHA 5DNUA 3B52X 1ST3A 4R31A 4E2ZA 4R9RA 5CU7A 4LGMA 1N1GA 1FUEA 1LB1B 1AS3A 1S9DA 2Y1CA 1EDEA 2FK7A 2K5UA 4RCZA 1ZGHA 3PGMA 3I2GA 5CURA 1CRWG 4CM9D 4ENPA 1HT3A 1ZXBA 3EA4A 4UAVA 1GCGA 2QR2A 1II0A 2VQSA 2ZCUA 1Z73A 2R8YA 1YD7A 3QPDA 4XJVA 3VR5H 3HC7A 5EXTA 4F46A 3LBIA 4TV9F 1TVMA 4IIJB 3ZNQA 4KR6A 4XR9A 5JXIA 1Z2CA 1L1RA 3WS7A 4O4LF 1G7RA 1PNTA 5DW0A 5I9TA 4K2AA 4MI1A 3ZQJA 2PBRA 1GPH1 3QE0A 2HXYA 3GLKA 1LC3A 2GAJA 1D7OA 1JG1A 1IUOA 1FFCA 3NTOA 1U0RA 2FPKA 2ZT8A 5ALZA 1GDHA 5AO9A 4D43A 2PBFA 2RJNA 3HVHA 3IQHX 3JSXA 4K9NA 5A3VA 4AD8A 5AESA 2XLCA 1YRBA 1KI1A 1G55A 2AG8A 2I78A 2J9YB 1VHTA 1E20A 1WPQA 1QGOA 4I3HA 3WGZA 2IYSA 2X8AA 3NWEA 4QE3A 1Z22A 3AR5A 5I7UA 4HHEA 2B34A 3DLTA 4OL0A 3ZD9A 2GK4A 2GF9A 1DPFA 4BNUA 3AF0A 4GNRA 1M34A 4IKPA 4PTLA 2B8JA 4UAGA 5EJGA 4PSDA 3OPYI 1FEZA 2PWAA 2XGOA 1FDOA 1U3CA 2A0FA 3G0CA 3N6XA 4LHXA 4RH1A 3G9UA 4S35A 5B57C 2JJMA 4B3FX 5I9NA 1EDBA 1YVPA 4FFVA 3VSDA 1IPHA 3N7UA 2FPSA 1TKRA 1C4OA 1AGNA 1LNZA 4MS1A 5H3LA 3RK0A 3KKLA 3PJEA 4PF1A 2RH9B 5IASA 4TTJA 4WJLA 2GHIA 2C54A 3IOEA 2AN9A 4UNSA 3EZ7A 1Z29A 2LCIA 2WWTA 2P3SA 2PQ0A 2PBLA 3PUWA 4R2MA 2NZUG 4OLBA 1DKLA 4EA8A 4MA0A 3L7JA 2BT4A 3INNA 1VJCA 4YAKA 3OOYA 1HURA 3AU8A 3BXEA 4PBRA 5FEUA 4HZIA 1NVFA 2AHRA 2J0EA 5AXBA 5TQ2A 3AHIA 5CX1A 4NCKA 3TRKA 3VR4D 1JHOA 3H17A 3LECA 2H0RA 2WW8A 2W2NA 5I7EA 3EPJA 2WKPA 4GLOA 3BJZA 1HT2E 2VHZA 4PM4A 4B6QA 2VHXA 3F90A 2NZVG 3W7VA 4D3FA 5I4CA 3MWYW 1E6WA 2PL3A 3K6KA 1E3DA 1U8CB 4LXTA 3IPYA 5LYJA 5DK6A 3MJHA 4KZPA 2LWIA 3OU6A 2ZRDA 3ZKWA 3HB5X 4HMPA 3BF7A 5C46F 1AHPA 2WB2A 2BEUB 3OZRA 3B53X 4O2AA 1CLEA 4W6QA 2VTVA 3CVWA 1Z5GA 2I6TA 3C14C 3UK7A 1YR1A 4JJZA 4B3CA 4UW9A 3RFCA 1R6BX 5DN9A 3V9PA 1KMHA 3HB0A 3K73O 4RVOA 2IDKA 2A9VA 4IJ5A 5C1IA 1Z15A 2V7WA 1MBZA 4S05A 1HR0B 2PWBA 4LCJA 4AJEA 4KKXB 3T5DA 5BORA 3SF8A 2G09A 1R50A 1E64A 1CJCA 4HGQA 4JUAA 1KYIA 1H2ZA 1TZKA 4OHUA 4U9UA 3QU4A 5M5BA 1EVJA 5HW0A 1VRVA 1WVGA 4JS0A 1JIQA 1K5PA 1N0HA 4GXRA 1VMEA 1G4HA 4MR9A 1QHXA 1QE0A 2FZGA 2IYEA 3KVNA 5AM0A 3Q9NA 4LEIA 2B20A 5LUBA 2IY9A 1L5ZA 5H0IA 2VCEA 3AJDA 4BDSA 2RHHA 1Y1SA 4KLAA 2DHRA 1JWAB 5AP9A 3GZNB 3EGWA 1XDZA 5CVCA 5E95A 2XZOA 4X3OA 3WGUA 2BZ1A 3HNPA 5SZKB 2GVNA 4XIJA 4E22A 2QENA 3CA8A 5K09A 3SC3A 3LL7A 4M53A 1D6JA 2ID8A 2WP8J 1NATA 3MTIA 1KYWA 4MWTA 3T0GA 3DEIA 2GARA 4HR7A 1E62A 1CCWA 1T8YA 1UBHS 1L7AA 2J3QA 4M1ZA 2PYDA 3HWX1 3USCS 3F9RA 3U56A 4G0PA 1RTTA 2FR0A 3QYJA 1T0UA 2FRXA 1SN7A 1NR5A 1X7XA 4RPHA 3RRFA 4M0EA 1P6QA 3AL3A 2J30A 1VSTA 5D7BA 1RLIA 1ZSNA 4TKZA 5TPWA 4KDFA 2AH5A 5A5EA 1LNSA 4PGHA 2DJ5A 4TOIA 2QAGB 3LC1O 5JI2E 1TA9A 4LZPA 1FDRA 1T10A 1QGDA 3VO9A 4ZTZB 4GL2A 1WUTA 1NKSA 3K35A 1UXHA 5B55A 1LH0A 3DQPA 4PQYA 4UHKA 3Q9LA 3CN9A 3ONFA 1FP4B 4R6XA 3LKZA 1UQTA 5K3OA 2JVKA 3BXFA 1SUAA 2ECOA 4ETWA 2TMKA 2AG0A 1D5CA 1Y3AA 1X7DA 1TT5A 2C07A 3TCKA 3IERA 3SVTA 3A6JA 2EDCA 3FWHA 1CR4A 4FCCA 1Z6PA 2O14A 4RY2A 3V6MA 4B09A 1RQNA 3MILA 1KQNA 3E61A 1FVHA 1BVYF 5FO1A 3WKEA 3EVAA 1QRAA 1MHTA 1HPLA 1Q11A 2QTMA 4XDYA 5ALUA 5B64A 2B82A 2Q6TA 4Q7KA 3WQBA 4ZGBA 1E99A 2IIBA 1O9HA 3E9RA 4ALLA 3FCEA 3CVUA 1ZLXA 2WF5A 5ALQA 3G79A 1RIFA 4ADSG 2MSCB 3RTGA 3MWGA 3PFBA 2NAPA 3TLEA 3AG6A 4CKEB 1E1QD 2VUHB 1DJNA 5FTNA 1VL5A 1I1OA 1G6Q1 1ISFA 4GRDA 5ABPA 3FOFC 1A7KA 1EEHA 3GLHE 5CGQB 2ONZA 2IXGA 4NMMA 3RUIA 2D1YA 4GG1A 4CL2A 2OV1A 4TLDA 1XVUA 4XRGA 4EUNA 2WF6A 2CW5A 2HHAA 1YZQA 1WF6A 3DW1X 4RXMA 5E2IA 3V4PB 4C5BA 1I33A 3G0DA 1Y7HA 3OWXA 4DY4A 3WNVA 2XOXA 3QPUA 4ZYXA 2JZCA 5LSAA 4IW3B 1JE1A 1Z34A 3O4VA 4MDEA 3L0OA 5CFPA 5EWLA 1CB0A 2HC9A 3GPIA 3RAFC 3PGXA 1B74A 4KMSA 1SBZA 1M1UA 1KMNA 1AZSC 5B6JA 3H1GA 1XJCA 2QTZA 3RVBA 5JDIA 2ODAA 4J0JA 3S29A 3OH8A 4DL9A 4E70A 3WRYA 4BC0A 1G2OA 3O4IA 1U1CA 3X2FA 2OILA 5B37A 2IV2X 4TUYA 3A0UA 2DE0X 2Q5CA 1ISPA 3I9V6 4X90A 4GIBA 3N8NA 3GAMA 4DQXA 5BSKA 3J80A 4CKBA 3I3SR 1YZGA 3MGBA 4ZDJA 5JZMA 2XF2A 4TT8A 2GZHA 2Z8YA 4JT9A 5I48A 3HUDA 5L4LA 5CIWA 3TLJA 3G2HA 2AZMA 1YB5A 4DUGA 4TN1A 2RKOA 4HTFA 4I1VA 3KQWA 3VHXA 3E9QA 1DOAA 3HGQA 5AXCA 1R5BA 3OPNA 3ISVA 4G4SP 4LISA 4X7PA 5C1DA 4COKA 4YDRA 3CG4A 1VJ0A 3CRZA 1DHRA 2A8YA 2PTHA 1U8ZA 2HMWA 2NQ8A 1DV1A 4RKEA 4BKOA 4HS4A 3UG6A 4PQGA 5LYJB 5HNKA 3LE8A 3TCNA 3ZXUB 3V46A 1H5QA 2CVPA 1O03A 2JJ2A 4BVFA 1XPOA 1GLGA 1MU0A 4URZR 1VE1A 1FOEB 1PWXA 4MO9A 3LHFA 5FRDA 2DJIA 3HJUA 4HTAA 2DULA 2G1UA 3B6ZA 3OZWA 4J0HA 4Z9XA 2V7TA 4OFBA 4YXWD 3IPXA 1BTOA 4GMXA 2H9AA 1TEZA 2Y0EA 1SVKA 1PTJC 4I8DA 5JEEA 4UVHA 2WD9A 1BS2A 1ADGA 4I9NA 3HJTA 4PYJA 2Z6QA 3QPVA 1ND6A 4RQAA 3YASA 4A0QA 2ZZNA 4H1VA 1FPMA 2BMEA 1L5NA 3VJLA 3AVPA 3TB6A 4R5HA 4UPDA 5C52B 9ATCA 2C7BA 3CWQA 3IE0A 3UF0A 2AB0A 2NU7B 1I2AA 4KQ2A 4MJLA 1C80A 1EFTA 2ACEA 2IHVA 4H08A 3G0GA 3I01M 4LS3A 1GPLA 3Q72A 1RXIA 4J16A 5DI3B 1KVTA 2PA0A 3ZHYA 4F3TA 3F4LA 5KSZA 3U44B 3KPWA 3A6GA 3TECE 3OX2A 1ZIPA 4BJ6A 1YE3A 1EUDA 2ZJOA 1NY5A 1Y98A 2ATVA 5TF0A 3V5NA 3VDRA 1RYMA 4EPRA 1EVYA 3DVAB 4IH9A 1OY1A 4JT2A 1KBQA 4F2HA 1J0CA 1DINA 5J4KA 2FSUA 3CKLA 4U2GA 2X6QA 1RM0A 3HYNA 5AHOA 5G02A 4IS2A 1BD4A 4KN5A 2F8TA 3GELA 1CUHA 4HQRA 1G0OA 5SZIA 5C1PA 1MN6A 5IAEA 4YMTA 1HOXA 3AIIA 2CEKA 2XCLA 1TD1A 5DHRA 3UW3A 3GLTA 4ILKA 3EE6A 3CXUA 4ZZIA 4F2PA 2PE5A 3G7SA 3NBFA 1WDTA 2NXWA 1QCCA 1XLWA 4E07A 1YGPA 1PTJA 4FFOA 2AEJA 2QRLA 4J3JA 3RFVA 4WCFB 3OE1A 1HKUA 3F7MA 3LC0A 1U63A 1N1MA 2GCNA 4EI9A 3K09A 4ZHQB 4L50A 3KB2A 4A6EA 1QG0A 4IJQA 3AMVA 1O6CA 1E2KA 4I4IA 4C21A 1D8TA 3UXEA 2D2FA 2F3TA 3M3DA 1Q77A 4MUKA 5TMDA 4YMGA 3D5QA 4G1CA 3PQ5A 3ADBA 3IR5A 3DMRA 4J16C 2V55B 3GRPA 1GV0A 1PG0A 5E1DA 3Q5GA 5KC8A 2D2EA 2ZVQX 3KLOA 3M1YA 2MYNA 5CM2Z 2MSDB 3R7BA 2O8BA 1JL3A 1SQ5A 2I1WA 3ASZA 3B9PA 4PHCA 3UH0A 4HFRA 1KMQA 4O4JF 4J3FA 1OBHA 5IDXA 2EWWA 4QOIA 2OESA 2R6CA 3ROMA 4JXXA 1GNSA 2GEJA 5BYKA 3TI9A 1TM3E 3OE7D 5HQJA 4DRYA 1CUXA 1KKMA 3GLRA 4G36A 4U3JB 2YN0A 1FRNA 3QKWA 4IGEA 5HIJA 3BGWA 1XYVA 2XNHA 1QHYA 3AB7A 1GKKA 4MV3A 3T1QA 1OROA 4BASA 2IIQA 1I6LA 2D13A 2W00A 4ZT7A 1QK5A 3L07A 3CXRA 5KYWB 3RAEC 4Z4GA 2CFOA 3ZDBA 1MO6A 1SOUA 4O4HB 4S04A 2HQ1A 4Z0HO 1H93A 3JQQA 1MP0A 1IHYA 3NHUA 3D2BA 4B48A 1JR4A 2PV7A 3OT1A 4GWGA 4H6XA 1L1EA 1RBQA 3CJQA 3PC2A 4B74A 1E3WA 2QRUA 3VR0A 1CVIA 3QVKA 1X38A 4FJ1A 1Q50A 4P5PA 4XJSA 4YRSA 5K01A 3PF8A 2E5WA 4CEJB 2JDIA 2JHPA 4W82A 4LVUA 3IMFA 1YQQA 2J7KA 3DBLB 5A06A 1FQJA 1L5RA 1L5VA 2OMKA 3AOEC 3PQCA 1XTQA 2EJVA 9LDBA 5IBRA 1GTVA 2DLDA 2H2FA 1YZVA 2O9JA 2VYCA 2PZJA 2OD2A 3QF4A 4PFSA 5BQOA 1T6ZA 2Y1DA 3EIUA 5FF9A 2DUWA 3MCUA 1CD5A 4EDHA 4MDFA 1UZLA 4Z4HA 5K7SA 3PCXA 1BCSB 2E4ZA 5M29A 1IRIA 1LCIA 2AGVA 3CF4G 3WQRA 3DMTA 3NTLA 3CUYA 2GFQA 3K5HA 4PPYA 1KEPA 1NNI1 4EB6B 5TXGA 5IJAA 1SCAA 2RHWA 3IKTA 5C4MA 1BHO1 3VR4H 1J0EA 1UBGA 3U4DA 1J06A 5JH7A 3T54A 1U6IA 1KPGA 1N2CE 2GBPA 3A6KA 3PQ4A 2Z6VA 1DOZA 4OG2A 4RS3A 2VZ9A 4TT3A 4MQBA 1Q7TA 2H7XA 4Q4DA 2V03A 4L75A 3CURA 1HG0A 5AJYA 2FN9A 3FNGA 5CM9C 4W5RA 4HEHA 2YZ7A 3BRCA 4HDSB 3GX1A 3CGGA 2P30A 3NBAA 4FDAA 1DVRA 3WB9A 1R8YA 2X14A 1M10A 1D2NA 5JPCA 1YRLA 3WKAA 4LUCA 4A82A 4MOWA 5C53B 5HDQA 2AFRA 3DULA 4EKIA 4YP6A 4E46A 4YIKA 2YVKA 1F6BA 3ORYA 4U6SA 4D02A 1M2JA 2NU6B 1EFLA 3D7NA 3DV2A 5E9JA 3ZE0B 2FZKA 3A9WA 3OLZA 1ZCBA 2AMJA 2ZIFA 3RM3A 3TZKA 2GM5A 5K8JB 1W48A 1QO0D 1T4GA 2BVNA 2XGJA 1Y6GA 5AMXA 1EP9A 4B3TB 2BP7A 5AW5A 1JQEA 1CZUA 4PG5A 1L4UA 1RI2A 2PMBA 3MF4A 3PFKA 3T15A 3C3AA 9LDTA 4JI4B 3PXDA 2C78A 3D7RA 4P4SB 2ODPA 3BRQA 3CLRD 4RY0A 1VYHA 4IDHA 4N5IX 4IUBS 5JS2A 5FV7A 3N39C 4WZBE 4C4ZA 4WINA 3NWBA 2ZS7A 5KKNB 4RF4A 1YQDA 1QBKC 2W2TA 2IUYA 3ZWYA 1AUPA 3KQVA 1A50B 1RI4A 1Y8CA 3ANMA 3K9CA 4RVSA 5AHKA 1B73A 2Q4DA 2PIAA 2VDNB 3CY6A 2HW8A 4IGAA 5E38A 3V1TC 1OLXB 2FG5A 3FPCA 2W37A 4I3FA 5H3CA 3VISA 1M1YB 2JGEA 3MYYA 4PX5A 2QU7A 4AO8A 4C2BA 3KJXA 1DWPA 4R1SA 2PNJA 3TFQA 5KNCA 2P9FA 2Z2KA 3SJ7A 2XXAB 3GLHA 3WX0A 2BFNA 1WXHA 3TTXA 2X4IA 3NXSA 5FPHA 2VDLB 4JJEA 2K2QB 2XLBA 3D8UA 3GVPA 3TO5A 1OBFO 3W1WA 4YCSA 4HAUA 1E6LA 1ZNZA 4FEGA 2SCUA 1MT0A 2A33A 3HZRA 1JBEA 4YUVA 2JIQA 3PKJA 4EJ6A 2F4VB 3VPSA 1SCJA 1WCYA 3JCZA 3PYXA 1VLJA 1Y3DE 3OOWA 4H1UA 3QXXA 4OJMX 4ZCTA 2J6HA 3ADPA 2ZE5A 2PY6A 5TC4A 1VL8A 2ZFUA 2JZOA 4S1NA 4K81B 1TO6A 1Y4SA 3DEAA 3ZWCA 3H3JA 3OIGA 4YT8A 5FFFA 1D2HA 1OHHD 1VLLA 4XSGA 3SQXA 3PCRB 4YRNA 3SAJA 1ZYUA 4L0CA 4LVCA 3QMPA 1G5TA 4F2WA 5JXGA 2OCDA 5K6TA 5BWOA 4R2JA 2GNAA 1WCIA 3ZVRA 3TR0A 3RU9A 1KH3A 4E2XA 4NU5A 1W0CA 1J99A 3DE6X 1EYZA 1QDLB 3UOAB 3AILA 4BNDA 1OWNA 1KEUA 4KEAA 1U1EA 1Q5PA 3L7IA 1G1AA 4W8HA 3WXMA 4OFWA 5EIBC 4BRWA 5CDYA 1DL5A 2HZBA 3WBBA 4DWWA 2OFPA 4GP9A 1NBHA 1XG5A 3ED1A 5HKBA 3AI1A 2HBYA 1KI4A 1LU9A 2EX0A 3L7LA 4RZUA 1MFPA 4B35A 4GM4A 2B1QA 4YALA 5BSUA 5LCXA 4B4OA 1P19A 1JDNA 1ICIA 1IXZA 1BMQA 3GD5A 4L3WA 3R7WB 4N6NA 3RV4A 4EMSA 4FE3A 1CJTC 2L2QA 2MR6A 3DD1A 3M6VA 3NALA 4K88A 2WWYA 5CXQA 1L7NA 2WIDA 1R16A 1Y3IA 4G6ZA 5AWFC 1V4VA 3UWPA 5CYGA 3FOZA 4Y2JA 4EAAA 2ZB8A 4J0KA 2CYAA 1U04A 1DHTA 3ZZNA 4DIMA 3AF4A 3P0EA 3L77A 2A7XA 1YR9A 2XVYA 3LWDA 3UJPA 1QX3A 4YLEA 4P3NA 1KDVA 4ITVA 3R9IA 4YMUA 4I1UA 1C9JA 1GPNA 1ZBQA 1SXIA 4WESB 1TLLA 1K7XB 3HCFA 4HRAA 1NHGA 3KJEA 1NQVA 2WK1A 2DUMA 3E03A 3ZHBA 1BWRA 2WWVD 4ZGGA 1YDMA 4FSDA 2YH2A 2W6QA 3MFQA 4KMMA 1X1SA 4OYRA 2A92A 4FKMA 2X7XA 2WWHA 2CXXA 2IU3A 3V00A 2ID9A 3H19A 4L4YA 1ZGCA 2JCYA 1ULZA 2BEKA 2ZRCA 5KYKA 3UAZA 3DUWA 3OQ1A 1PJ3A 1JLLB 4W4TA 1M6VA 2QMUA 4FOSA 1U1IA 2AZTA 3WGYA 3PNSA 3O95A 5B1IA 5DMHA 3GZNA 5T4EA 4UBNA 3D2LA 3D59A 4R7TA 2PSEA 4BNMA 1UBUS 4F9GA 2VT2A 2GJSA 4U6QA 3AIKA 1PFGA 3GHYA 3HPRA 3IIKA 2ONYA 1CHNA 2XX3A 2OFFA 5HSGA 4MS3B 1BA2A 4FZJA 5LJIA 5HWSA 3TOCA 3PUHA 3BF8A 1G60A 3QVXA 4Q7JB 3SYMA 3AF1A 1VFPA 4AO6A 4FWTA 1KFCB 2CXQA 3BJRA 5F12A 1KYYA 3OJLA 4G4GA 1SVLA 5K5EA 3IS3A 2P3OA 1ATIA 3L1IA 4HDMA 3RANA 3SF8B 4P4NA 4B7AA 2IPLA 3EXFB 1FP1D 3W9SA 5LZ2A 2P6RA 5K6RA 2R1VB 3VZQA 4ONEA 1B26A 3FG9A 4Q3OA 4WKBA 1S8FA 1ONSA 4F8JA 4IV5A 1EJ6A 3KYJB 5DRYA 5GVSA 4B87A 2O2IA 2WJVA 1JHUA 1YR6A 2OV2A 4LZZA 2R6DA 4IOKA 5BSMA 5KCMA 3L4KA 2DVMA 3ZE2B 1EUYA 5JADA 1EB8A 1QQBA 1MMFB 1DLJA 1ZGZA 4P7KA 2A0KA 4HUJA 3E2MA 3L6CA 5EJ9A 1F20A 1BQEA 3FCSB 4TMFA 2X0NA 3BOSA 4RKWA 3ILHA 5DPMA 1SVSA 4INZA 1XZQA 5CG1A 5IU6A 3TZ6A 1IZ8A 1FFXB 3FAKA 4JVSB 1YRYE 3SU8A 1S2OA 3K7EA 3L8HA 3W78A 3ZE1B 1DFIA 5B3KA 5JUWA 1J90A 1DZ3A 1FY2A 1ZRMA 3E4CA 4K1XA 5ALRA 3VH3A 4BFYA 4C2TA 3GUYA 5EPEA 4GX5A 5L7TA 4KXVA 4HG2A 1KVUA 2BHSA 1W8IA 1PJRA 3E84A 4EKGA 4MHTA 4BQOA 1T29A 3Q88A 4UAJA 2PT7A 4OA5A 3GZJA 5J5CA 5EJMA 1W52X 2C2WA 3C87A 5EMJA 3K9FC 2DOKA 1LSSA 1LA2A 2EARA 5AK5A 3WLQA 1CBUA 1O97D 2H2IA 1P0FA 4YJGB 4AXXA 1XEAA 1Y81A 4C6HA 3BMCB 1JNYA 3ZE8A 3E0XA 3R3VA 1AN9A 2QRJA 2J3KA 1O5OA 1LSJA 3WYNA 3DTNA 5HCIA 4C43A 3EZ2A 4EHIA 4CGZA 2ZIWB 2V8BA 4DLXA 1ZAYA 2WTBA 1HDOA 1U81A 2H5IA 3D7LA 3JY6A 2NTEA 3NHLA 3AUXA 3UMSA 2BF7A 2EU8A 4KQIA 1NJ6A 4E1AA 3ANYB 4XUDA 2A14A 1Y3CE 3B78A 1C5KA 1JN0A 1HNNA 2GB4A 4UU1A 4ARZB 2B4QA 3REOA 3BFPA 3T9FA 3UMFA 3OAAD 2X2EA 3PKZA 4S1PA 3BSFA 3QM1A 4FGUA 5AJHA 4BVHA 4DIDA 5LQAA 1HDZA 2HB6A 3DMGA 4JJIA 3BAZA 4YUWA 3VA7A 2XMPA 3MTGA 4QOFA 4F4JA 5JFOA 1S02A 3M6LA 2LRHA 3SXPA 3ZY4A 3PCTA 1KDYA 1PS9A 2JJYA 1Z3IX 3FFWA 4A15A 1VG9B 3CO0S 3RUDA 3WGOA 4XEHA 5IK2D 4I3GA 1UWVA 2NVBA 3LBNA 4DM4A 1W4AA 4JR0A 1E8MA 3W5JA 5JS7A 3ND5A 5K0LA 4TWAA 2R5FA 3PPWA 3QELA 3LW7A 3L7OA 4O1MA 1W8DA 4A03A 4WLNA 3S68A 2PYIA 3FXAA 2QLLA 3UXYA 3THXA 2IHKA 5DYTA 2P4HX 1ZY2A 4IRUB 3EW9A 4FCVA 4ZVPA 4CF4A