4NSOB

Crystal structure of the effector-immunity protein complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
TSGVHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNSLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Protein binding
molecule keywords Effector protein
total genus 35
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2013-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1160 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nsoB00
4NSOB 4NSRA 4NOOB
chains in the Genus database with same CATH superfamily
3EIHA 2YFQA 2CHGA 2KW0A 2L09A 2L2DA 2UUCM 3M6AA 4FVMA 2LVQD 4LJ5A 4NOOB 3NBXX 4DV3M 2ZAMA 1N33M 3GPPA 3LVWA 2CP8A 3TL4X 2CV0A 2QP9X 2XF3A 2JXNA 4F1IA 4BB9A 4LFCM 3NBIA 4JXJA 3CGWA 4Q7JA 4QNRA 5KPTA 1Y8GA 1ZMWA 2V1UA 5DYIA 4MGHA 3B9PA 3TWKA 1HR0M 1XB2B 3LCVB 5EP3A 1W5SA 5KQ8A 1HQCA 3FTDA 3GLIE 2OPFA 3U6SA 5ITXE 3A46A 1HNXM 1JR3D 3GO8A 1N75A 1ZMVA 3PFIA 3KOWE 1OAIA 2JY8A 3HKPA 4GMQA 4M9SA 1HNZM 2CWBA 3SMSA 4MM3B 1DO0A 3GLIB 2O01F 4R3DA 4PT5A 4REZA 4CGYB 5BR8M 2APLA 1LTMA 5IREB 1D0LA 1L2CA 2X49A 4QOSA 1SXJA 2DAEA 4JI8M 3GRRA 2A5YB 4GEWA 5IT9S 2K47A 4NSRA 2UUAM 4JI6M 3U5ZB 2UXCM 1G41A 1Z6TA 4PDGA 1J7KA 2O25A 1SXJD 5JI2E 3B7QA 2Z3XA 4JI2M 2KDLA 1IXZA 3IECA 4PDIA 3SATA 1YSYA 1GKIA 3E46A 3GLHB 3MHVC 4GH9A 1S3SA 2RGOA 2CEAA 2BJVA 4LJ6A 4LJ7A 3AOGA 7CATA 2DWLA 4F2LA 1R7RA 4FCWA 4EIWA 2VF8A 1E9RA 3GPXA 2JNHA 1K3XA 1IBKM 4MH0E 4Z6YA 4IBKA 1EE8A 2C96A 3TE6A 4LF4M 4LY6A 1TDHA 5E26A 5EQTA 2KXEA 2X4AA 4G4OA 2LNHC 3F92A 4P16A 1J09A 1MN3A 4ZPXA 2UXDM 5EXXA 4LJ4A 1HNWM 1JQJC 2UUBM 1QZMA 4DR4M 4AG5A 2Y0TA 3FUTA 4LGYA 2H5XA 4LF5M 4W5WA 2VQEM 1RU3A 2N35A 1PRBA 3RGPA 3U60A 1DGHB 1V34A 5ITTA 1XXHE 4X65M 1Q02A 4LGMA 4GKJM 1OKSA 1T6OA 2EKFA 4FWDA 3KSJA 4B3MM 3J80S 3T15A 3HJSA 2C9CA 4IBCA 1PJJA 2R65A 2ZTCA 3A45A 3KS4A 1NNUC 3FUVA 2KRKA 3ZH9B 1Z5AA 2DHYA 3GLFB 2I7NA 3B7NA 3THGA 4LRSA 1ZAEA 2DAIA 2G8LA 3KOYE 1QZEA 3RGSA 1QYRA 3D8BA 2DWNA 1R6BX 2DAKA 3IG5A 1R2ZA 1DGBA 2UU9M 3KS8A 2R4JA 1DV0A 2ERCA 2M60A 1J5EM 4DV1M 2J5YA 3B74A 4NSOB 3GLGE 3U6QA 1IBMM 3PNYA 2DHRA 3I4YA 3R8FA 1VDDA 4FCTA 3L27A 2V1CA 4YY3M 1EIJA 1NHGC 3FRIA 1NVMA 1OTRA 4CHTB 2KZSA 3M0EA 3QAUA 1LV7A 2YR0A 4PD2A 1HQYE 2F5PA 1QDRA 3H4JA 4FW9A 5C1BA 4JI4M 2FH0A 4Z8XA 4B3SM 2XSZD 1G8PA 2L7HA 4G3OA 3FYCA 3T38A 3T1YM 3TQSA 4L8RC 3VFDA 4DUZM 2LVNC 4RNAA 5EXPA 3AV0A 2K6BA 1WHCA 3M7GA 1WXQA 3FYDA 4MB7A 4G4NA 3W67A 2JY7A 2DVWB 2C99A 3L29A 5FTJA 4MGYE 4KODA 4RF1A 2DENA 2QNJA 3RE8A 4GHAA 4LFAM 3E4RA 1KSFX 4AZFA 4AKGA 2R0IA 5KO3A 3L25A 4LJ8A 1IFYA 3VLFB 1IXRC 2R62A 4MGKE 3K2LA 3PVSA 4M9ZA 4X66M 4LF6M 4BBAA 2KZUA 4I5SA 4D82A 4LRTA 2JUJA 2MR9A 2ZTDA 3W68A 1GABA 1IXSA 1D0MA 2JY5A 4XGIA 2CHQA 3QYBA 3K9OA 1G71A 1Q39A 3HHXA 3B89A 3BXWA 3OTOM 2DI0A 2J7OA 3A42A 5LMNM 4GKKM 4TUWA 1D0KA 4HEOA 5KPRA 2P5TA 2F5NA 4DR7M 3KP1E 4NC6A 2CUZA 1QUTA 4WW0A 2WZJA 4YHHM 1YE9A 3SAWA 3J7BA 2OOAA 3CTWB 4M9XA 4R7GA 3NWLA 1AUAA 8CATA 4L4UA 1PJQA 1SXJE 2M5ZA 3HWSA 5FTLA 1N32M 4AKHA 2DWZB 3HX3A 2VIIA 4I4LA 3C58A 5F3WA 1L8QA 2CRUA 1QUSA 3K92A 3SAUA 1VG5A 4HLQA 4IBGA 1QAMA 3HHWA 4NRWA 1XXHA 4NXNM 1IY1A 1E32A 3I4VA 2WSCF 4IBEA 3HZJA 2BJWA 2DAGA 3IHPA 4QHSA 2GQFA 1NJGA 2DZNB 4L16A 2OOBA 2BWBA 4CIZA 1FJGM 1OFHA 2Q2EB 1R4GA 2HAKA 4X64M 4AQYM 3GQ5A 2EJSA 1JR3A 2Z4SA 1DO2A 3JAMS 2F4VM 2XGNA 2R46A 1OAOC 1IXSB 1G4AE 2YNMD 2DXIA 2XFTA 2YQZA 1SXJC 4QNMA 3I01M 3TPZA 3ZCBB 3U60B 1YUBA 4DV6M 4B08A 3GLIA 2K9DA 1TH2A 2FE8A 4B3RM 2H1RA 3I51A 4FWHA 4IJEA 3JR4A 2QQ8A 2EO2A 3FE3A 1TDZA 1OFIA 2OO9A 3FTFA 1ZV1A 1TH4A 2QPAA 3C3EA 2KNVA 4JI5M 4LF8M 3KFUG 4GRIA 1PJIA 2QHOB 3GLHA 1KYIA 4DR1M 3VDUA 2QBYB 2L7IA 4G4QA 1NNJA 4LJAA 3SC3A 2CV2A 1MX0A 2MJ5B 1WJ7A 3SYKA 3Q8XA 4B7FA 3WHLA 4KO8A 2Y21A 3UGJA 1SXJB 4X62M 1H6UA 2JZ0A 5IWAM 3U6PA 2B3TA 2G5GX 2RRUA 3HU3A 3J27B 3KDSE 5FTMA 3FTEA 3AFHA 1T43A 2KHHA 3K9PA 1UFZA 3L2AA 4CJ6A 5ITQA 5LMUM 3U6MA 3SBJA 4JI3M 2F5QA 2LHCA 3U5ZA 2FFJA 1QDTA 1TGUA 1N78A 5DFLA 3Q8GA 3CF0A 4M0DA 3GQ4A 2E5LM 4KHPM 2Z4RA 4LZZA 1HJPA 4DR3M 4QOZC 2W82A 1NV8A 2VDBB 5IZ7D 2EUCA 2C5RA 1IN7A 3RFWA 1QAQA 3VKHA 3U61A 1DGHA 4LG2A 2MROB 4HL4A 1PJTA 4IBFA 4OW0A 4QHTA 2L4EA 2K0BX 3KOXE 3SYLA 4DR5M 3GLFA 1L2DA 1E94E 2CHVA 1IY0A 2GNOA 3DA1A 4CISA 3SAVA 5KQDA 1V92A 3J2PB 4OVZA 5GKNA 3FUUA 3E9SA 1G3IA 1PGYA 4B3TM 2QCUA 4IJFA 2KEBA 4NRVA 4DUYM 1IM2A 4B7GA 4B7HA 1ZQ9A 3LW5F 1WGLA 2UXBM 1IY2A 4BLCA 3U6DA 3AL0C 1EFUB 4DR6M 1Q3CA 4S12A 2X8AA 2DKLA 2XLJA 2F5SA 2BNKA 1OIZA 4ITQA 1BVSA 1VEJA 3SASA 2LHGA 1AIPC 4UN2B 1NJFA 2Z8YM 1GL7A 1OJLA 2LXEA 3SMPA 1MJGM 2KNAA 4XBOA 5FLXS 3GLGA 2RGHA 2DZOB 3FRHA 3W0FA 4KT0F 1OQYA 2HCBA 4IBBA 4JN6A 4L78A 3UMMA 2WSFF 4DV7M 2D7GA 2WSEF 2CV1A 4LF9M 3R9XB 4DV2M 3JR5A 3CF6E 1GLNA 4PCZA 5FTKA 4L6V6 4Y28F 1TR8A 3EIEA 1OIPA 1VEKA 2QSFX 3LVVA 3DFZA 3GLGB 1NV9A 4P17A 2ZANA 3C3DA 3WHKA 4DV0M 3HJ8A 1Z59A 1ZMUA 4G6ZA 1QANA 3GQ3A 2HHHM 1FNNA 3T6PA 1GJSA 2LTUA 3I04M 2FS1A 1VEGA 1W5TA 3MK6A 4IBDA 5L8RF 2RKOA 3ILKA 3IG8A 4DV5M 1R2YA 5ITUA 2JY6B 3VKGA 1JB0F 3CF2A 1XC8A 3GPYA 5FTNA 2LVPC 1N77A 2C98A 2LH0A 1KFVA 1QAOA 3DOAA 3HHYA 1L1ZA 5H37D 1IN5A 3VK8A 2F5OA 2HWJA 2XH9A 2OQ4A 3SARA 4GHLA 2EA0A 5KPZA 5BPVA 1JR3E 1TH3A 2XSZA 1PM5A 3J81S 2ZM6M 3KSXA 2C9OA 2J7NA 1ORYB 5FSWA 3LQQA 3TWMA 2FOIC 2AHMA 3LCUA 5JI3E 3FUWA 3BBZA 5EJCA 2L4FA 1XWIA 1PJSA 2DAMA 4I8OA 4WURA 4LFBM 5EXTA 2D7EA 3AOEC 4GITA 3KP0E 3HGIA 4I81A 3U6CA 3KXEC 2Z7JA 1XMOM 3GPUA 1N34M 2Y0QA 5DYGA 1XMQM 5EP2A 1CUKA 3GRVA 4KLNA 1XNQM 3KW6A 1VQ1A 1HT2E 1Q3BA 4K0KM 1L1TA 3BOSA 2Y20A 3KVWA 4D80A 2I7PA 1IN4A 4DR2M 1F4IA 3GP1A 1D2NA 2XEPA 3FD9A 4FD2A 2VF7A 1QVRA 2MGWA 4MGZE 1IBLM 2KNZA 3U6OA 2LWXA 3HY5A 3MMPA 2CE7A 1IN8A 4LJ9A 3DZDA 2D7HA 3J7AS 1HT1E 3HU2A 1N36M 4GIPA 1WGNA 2O5RA 4OVZB 1TF0B 1NY6A 3GLFE 3B7ZA 1SG9A 2QZ4A 3UZUA 2L6OA 5A2QS 2QENA 1K3WA 2FNAA 4AW4A 1I4WA 2LVOC 3U6LA 4MGIE 3K1JA 2R18A 1TTEA 1WR1B 4A3VB 3LMMA 2R6FA 2XZFA 3U61B 3PXGA 3VDPA 4ANRA 1XXHB 5EXSA 4OU7A 4NL4H 1I94M 3MJ5A 2DZLA 3W0LB 1YLAA 1DGGA 5ITYA 2KA6B 5EP1A 2G3QA 1NHWC 3AOEA 4G4RA 1A5TA 1IN6A 2HKJA 4JI1M 5EP4A 3QYEA 2R4EA 1NSFA 2LBCA 1K82A 3L28A 3V76A 4AKIA 4JYAM 1GJTA 2DNAA 4DBGB 3HHZA 3SFZA 4LZJA 4WP2A 2HL7A 2JWSA 1G59A 3L26A 3GRUA 4GC9A 4NXMM 1QQWA 1GO5A 4GC5A 2KRUA 5C18A 1XNRM 2CFOA 2NQ8C 3AJIB 3FUXA 4M0WA 1UM8A 3C9PA 1NY5A 1MU5A 2ZBKB 4IBIA 4R71A 3QWLA 1GL6A 3GLHE 2JA2A 2R45A 3A98B 4II7A 3U6EA 4AG6A 2QBYA 5DNYA 4OX9M 5ITXA 1VDLA 4XK8F 4JI7M 4DV4M 1L2BA 3E21A 4IBJA 1WIVA 1Z5BA 1T3TA 3FTCA 4D81A 2XFSA 3ZQJA 3VK7A 4JV5M 2DWMA 4IIWA 2R44A 3FKEA 3SHFA 3H4MA 1GVNA 4RKUF 1E9SA 5ITRA 2XZUA 2JZ1A 3T1HM 1V33A 4LF7M 1DGFA 1XHBA 4JI0M 4RF0A 1C1KA 3HU1A 5E6JA 3UJNA 3PNVA 4FCVA 4LCBA 3LQRA 3HJQA 1IQPA 1Z5CA 2VQFM 3TWLA 4L15A 2JP7A 3K8ZA 1C7YA 4AI6A 2V6ZM 3UK6A 4FWGA 2EKKA 2MH8A 2BWEA 2ZAOA 1P3QQ 3ZC7B 3KOZE 1R5LA 3SHGB 3AKZA 1X37A 2LVAA 3GRYA 3D8LA 1NO1A
chains in the Genus database with same CATH topology
3EIHA 2YFQA 2CHGA 2KW0A 2L09A 2UUCM 3M6AA 4FVMA 4LJ5A 4NOOB 4DV3M 2ZAMA 1N33M 3GPPA 3LVWA 3TL4X 2CV0A 2QP9X 2XF3A 4BB9A 4LFCM 3NBIA 4JXJA 4QNRA 5KPTA 2V1UA 5DYIA 4MGHA 3B9PA 3TWKA 1HR0M 5KQ8A 5EP3A 1W5SA 1HQCA 3FTDA 2OPFA 3U6SA 5ITXE 3A46A 1HNXM 1JR3D 3GO8A 1N75A 3PFIA 3KOWE 3HKPA 4GMQA 4M9SA 1HNZM 3SMSA 4MM3B 1DO0A 3GLIB 4R3DA 4PT5A 4REZA 4CGYB 5BR8M 5IREB 1L2CA 2X49A 4QOSA 1SXJA 4JI8M 3GRRA 2A5YB 5IT9S 2K47A 4NSRA 2UUAM 3U5ZB 2UXCM 1G41A 1Z6TA 4PDGA 1J7KA 1SXJD 5JI2E 2Z3XA 4JI2M 1IXZA 3SATA 4PDIA 1YSYA 1GKIA 3GLHB 3MHVC 4GH9A 1S3SA 2RGOA 2CEAA 2BJVA 4LJ6A 4LJ7A 3AOGA 7CATA 2DWLA 1R7RA 4FCWA 4EIWA 1E9RA 3GPXA 1K3XA 1IBKM 4MH0E 4Z6YA 4IBKA 1EE8A 2C96A 3TE6A 4LF4M 4LY6A 1TDHA 5E26A 5EQTA 2KXEA 2X4AA 4G4OA 2LNHC 4P16A 1J09A 4ZPXA 2UXDM 5EXXA 4LJ4A 1HNWM 1JQJC 2UUBM 1QZMA 4DR4M 4AG5A 2Y0TA 3FUTA 4LGYA 4LF5M 4W5WA 2VQEM 3RGPA 3U60A 1DGHB 5ITTA 4X65M 4LGMA 4GKJM 4FWDA 3KSJA 4B3MM 3J80S 3T15A 3HJSA 2C9CA 4IBCA 1PJJA 2R65A 3KS4A 3A45A 1NNUC 3FUVA 2KRKA 3ZH9B 1Z5AA 3GLFB 2I7NA 3THGA 4LRSA 1ZAEA 2G8LA 3KOYE 3RGSA 1QYRA 3D8BA 2DWNA 1R6BX 3IG5A 1R2ZA 2UU9M 1DGBA 3KS8A 2R4JA 2ERCA 2M60A 1J5EM 4DV1M 1IBMM 4NSOB 3U6QA 3PNYA 2DHRA 3I4YA 3R8FA 1VDDA 4FCTA 3L27A 2V1CA 4YY3M 1NHGC 1NVMA 4CHTB 2KZSA 3M0EA 3QAUA 1LV7A 2YR0A 4PD2A 1HQYE 2F5PA 4FW9A 5C1BA 4JI4M 4Z8XA 4B3SM 2XSZD 1G8PA 2L7HA 3FYCA 3T38A 3T1YM 3TQSA 4L8RC 3VFDA 4DUZM 4RNAA 5EXPA 3AV0A 3M7GA 1WXQA 3FYDA 4MB7A 4G4NA 2DVWB 2C99A 3L29A 5FTJA 4MGYE 4KODA 4RF1A 3RE8A 4GHAA 4LFAM 3E4RA 1KSFX 4AZFA 4AKGA 5KO3A 3L25A 4LJ8A 3VLFB 1IXRC 2R62A 4MGKE 3K2LA 3PVSA 4M9ZA 4X66M 4LF6M 4BBAA 2KZUA 4I5SA 4D82A 4LRTA 4XGIA 2CHQA 1Q39A 3HHXA 5LMNM 3OTOM 4TUWA 2J7OA 3A42A 4GKKM 2F5NA 5KPRA 2P5TA 4DR7M 3KP1E 2CUZA 4WW0A 4YHHM 1YE9A 3SAWA 3J7BA 3CTWB 4M9XA 4R7GA 3NWLA 8CATA 4L4UA 1SXJE 2M5ZA 5FTLA 3HWSA 1N32M 4AKHA 2DWZB 3C58A 2VIIA 4I4LA 5F3WA 1L8QA 3K92A 3SAUA 4HLQA 4IBGA 1QAMA 3HHWA 4NRWA 1XXHA 4NXNM 1IY1A 1E32A 3I4VA 4IBEA 2BJWA 4QHSA 1NJGA 2DZNB 4L16A 1FJGM 1OFHA 2Q2EB 4X64M 4AQYM 3GQ5A 1JR3A 2Z4SA 1DO2A 3JAMS 2F4VM 2XGNA 2R46A 2DXIA 1IXSB 1G4AE 2YNMD 2XFTA 2YQZA 1SXJC 4QNMA 3TPZA 3ZCBB 3U60B 1YUBA 4DV6M 4B08A 3GLIA 1TH2A 2FE8A 4B3RM 2H1RA 3I51A 4FWHA 4IJEA 3JR4A 1TDZA 2EO2A 1OFIA 3FTFA 1TH4A 2QPAA 4JI5M 4LF8M 3KFUG 4GRIA 1PJIA 3GLHA 4DR1M 1KYIA 2QBYB 3VDUA 2L7IA 4G4QA 1NNJA 4LJAA 3SC3A 2CV2A 1MX0A 3SYKA 3Q8XA 4B7FA 3WHLA 4KO8A 2Y21A 3UGJA 1SXJB 4X62M 1H6UA 5IWAM 3U6PA 2G5GX 3HU3A 3FTEA 3J27B 3KDSE 5FTMA 3AFHA 3L2AA 5ITQA 5LMUM 3U6MA 3SBJA 4JI3M 2F5QA 3U5ZA 2FFJA 1TGUA 1N78A 3GQ4A 3CF0A 4M0DA 2E5LM 4KHPM 2Z4RA 4LZZA 4DR3M 4QOZC 2W82A 5IZ7D 2EUCA 2C5RA 1IN7A 3RFWA 1QAQA 3VKHA 3U61A 1DGHA 4LG2A 4HL4A 4IBFA 4OW0A 4QHTA 3SYLA 4DR5M 3KOXE 1L2DA 4JI6M 3GLFA 1E94E 2CHVA 1IY0A 4CISA 3DA1A 3SAVA 5KQDA 3J2PB 4OVZA 5GKNA 3FUUA 3E9SA 1G3IA 4B3TM 2QCUA 4IJFA 2KEBA 4NRVA 4DUYM 1IM2A 4B7GA 4B7HA 1ZQ9A 2UXBM 1IY2A 4BLCA 3U6DA 3AL0C 4DR6M 1Q3CA 4S12A 2X8AA 2XLJA 2F5SA 2BNKA 4ITQA 3SASA 1NJFA 1GL7A 1OJLA 2LXEA 3SMPA 4XBOA 5FLXS 3GLGA 2RGHA 2DZOB 3W0FA 2HCBA 4JN6A 4IBBA 4L78A 4DV7M 3UMMA 2CV1A 2D7GA 4LF9M 3R9XB 4DV2M 3JR5A 3CF6E 1GLNA 4PCZA 5FTKA 3EIEA 3LVVA 3DFZA 3GLGB 2ZANA 3WHKA 4DV0M 3HJ8A 1Z59A 4G6ZA 1QANA 3GQ3A 2HHHM 1FNNA 1W5TA 3MK6A 4IBDA 2RKOA 3ILKA 3IG8A 4DV5M 1R2YA 5ITUA 3VKGA 3CF2A 1XC8A 1N77A 3GPYA 5FTNA 2C98A 2LH0A 1KFVA 1QAOA 3DOAA 3HHYA 1L1ZA 5H37D 1IN5A 3VK8A 2F5OA 2XH9A 2OQ4A 3SARA 4GHLA 2EA0A 5KPZA 5BPVA 1TH3A 2XSZA 1PM5A 3J81S 2ZM6M 3KSXA 2C9OA 2J7NA 1ORYB 5FSWA 3LQQA 3TWMA 2FOIC 2AHMA 5JI3E 3FUWA 5EJCA 1XWIA 4I8OA 4WURA 4LFBM 5EXTA 2D7EA 3AOEC 4GITA 3KP0E 3HGIA 4I81A 3U6CA 3KXEC 2Z7JA 1XMOM 3GPUA 1N34M 2Y0QA 5DYGA 1XMQM 5EP2A 3GRVA 4KLNA 1XNQM 3KW6A 1HT2E 1Q3BA 4K0KM 1L1TA 3BOSA 2Y20A 3KVWA 4D80A 2I7PA 1IN4A 4DR2M 3GP1A 1D2NA 2XEPA 3FD9A 4FD2A 1IBLM 1QVRA 4MGZE 3U6OA 2LWXA 2CE7A 1IN8A 4LJ9A 3DZDA 2D7HA 3J7AS 1HT1E 3HU2A 1N36M 4GIPA 2O5RA 4OVZB 1NY6A 2QZ4A 3UZUA 2L6OA 5A2QS 2QENA 1K3WA 2FNAA 4AW4A 1I4WA 3U6LA 4MGIE 3K1JA 2R18A 4A3VB 3LMMA 2XZFA 3U61B 3PXGA 3VDPA 1XXHB 5EXSA 4OU7A 4NL4H 1I94M 3MJ5A 3W0LB 1DGGA 5ITYA 2KA6B 5EP1A 1NHWC 3AOEA 4G4RA 2HKJA 1IN6A 4JI1M 5EP4A 2R4EA 1NSFA 1K82A 3L28A 4AKIA 4JYAM 3HHZA 3SFZA 4LZJA 2HL7A 1G59A 3L26A 3GRUA 4GC9A 4NXMM 1QQWA 4GC5A 2KRUA 5C18A 1XNRM 2CFOA 2NQ8C 3AJIB 3FUXA 4M0WA 1UM8A 1NY5A 1MU5A 2ZBKB 4IBIA 3QWLA 1GL6A 2JA2A 2R45A 3A98B 4II7A 3U6EA 4AG6A 2QBYA 5DNYA 4OX9M 5ITXA 4JI7M 4DV4M 1L2BA 4IBJA 1Z5BA 3FTCA 1T3TA 4D81A 3VK7A 2XFSA 4JV5M 2DWMA 4IIWA 3FKEA 3SHFA 3H4MA 1GVNA 1E9SA 5ITRA 2XZUA 3T1HM 4LF7M 1DGFA 1XHBA 4JI0M 4RF0A 1C1KA 3HU1A 5E6JA 3UJNA 3PNVA 4FCVA 4LCBA 3LQRA 3HJQA 1IQPA 1Z5CA 2VQFM 3TWLA 4L15A 3K8ZA 4AI6A 2V6ZM 3UK6A 4FWGA 2ZAOA 3ZC7B 3KOZE 3SHGB 3AKZA 1X37A 3GRYA 3D8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NSO B;  4NSR A;  4NOO B; 
#chains in the Genus database with same CATH topology
 3EIH A;  2YFQ A;  2CHG A;  2KW0 A;  2L09 A;  2L2D A;  2UUC M;  3M6A A;  4FVM A;  2LVQ D;  4LJ5 A;  4NOO B;  3NBX X;  4DV3 M;  2ZAM A;  1N33 M;  3GPP A;  3LVW A;  2CP8 A;  3TL4 X;  2CV0 A;  2QP9 X;  2XF3 A;  2JXN A;  4F1I A;  4BB9 A;  4LFC M;  3NBI A;  4JXJ A;  3CGW A;  4Q7J A;  4QNR A;  5KPT A;  1Y8G A;  1ZMW A;  2V1U A;  5DYI A;  4MGH A;  3B9P A;  3TWK A;  1HR0 M;  1XB2 B;  3LCV B;  5EP3 A;  1W5S A;  5KQ8 A;  1HQC A;  3FTD A;  3GLI E;  2OPF A;  3U6S A;  5ITX E;  3A46 A;  1HNX M;  1JR3 D;  3GO8 A;  1N75 A;  1ZMV A;  3PFI A;  3KOW E;  1OAI A;  2JY8 A;  3HKP A;  4GMQ A;  4M9S A;  1HNZ M;  2CWB A;  3SMS A;  4MM3 B;  1DO0 A;  3GLI B;  2O01 F;  4R3D A;  4PT5 A;  4REZ A;  4CGY B;  5BR8 M;  2APL A;  1LTM A;  5IRE B;  1D0L A;  1L2C A;  2X49 A;  4QOS A;  1SXJ A;  2DAE A;  4JI8 M;  3GRR A;  2A5Y B;  4GEW A;  5IT9 S;  2K47 A;  4NSR A;  2UUA M;  4JI6 M;  3U5Z B;  2UXC M;  1G41 A;  1Z6T A;  4PDG A;  1J7K A;  2O25 A;  1SXJ D;  5JI2 E;  3B7Q A;  2Z3X A;  4JI2 M;  2KDL A;  1IXZ A;  3IEC A;  4PDI A;  3SAT A;  1YSY A;  1GKI A;  3E46 A;  3GLH B;  3MHV C;  4GH9 A;  1S3S A;  2RGO A;  2CEA A;  2BJV A;  4LJ6 A;  4LJ7 A;  3AOG A;  7CAT A;  2DWL A;  4F2L A;  1R7R A;  4FCW A;  4EIW A;  2VF8 A;  1E9R A;  3GPX A;  2JNH A;  1K3X A;  1IBK M;  4MH0 E;  4Z6Y A;  4IBK A;  1EE8 A;  2C96 A;  3TE6 A;  4LF4 M;  4LY6 A;  1TDH A;  5E26 A;  5EQT A;  2KXE A;  2X4A A;  4G4O A;  2LNH C;  3F92 A;  4P16 A;  1J09 A;  1MN3 A;  4ZPX A;  2UXD M;  5EXX A;  4LJ4 A;  1HNW M;  1JQJ C;  2UUB M;  1QZM A;  4DR4 M;  4AG5 A;  2Y0T A;  3FUT A;  4LGY A;  2H5X A;  4LF5 M;  4W5W A;  2VQE M;  1RU3 A;  2N35 A;  1PRB A;  3RGP A;  3U60 A;  1DGH B;  1V34 A;  5ITT A;  1XXH E;  4X65 M;  1Q02 A;  4LGM A;  4GKJ M;  1OKS A;  1T6O A;  2EKF A;  4FWD A;  3KSJ A;  4B3M M;  3J80 S;  3T15 A;  3HJS A;  2C9C A;  4IBC A;  1PJJ A;  2R65 A;  2ZTC A;  3A45 A;  3KS4 A;  1NNU C;  3FUV A;  2KRK A;  3ZH9 B;  1Z5A A;  2DHY A;  3GLF B;  2I7N A;  3B7N A;  3THG A;  4LRS A;  1ZAE A;  2DAI A;  2G8L A;  3KOY E;  1QZE A;  3RGS A;  1QYR A;  3D8B A;  2DWN A;  1R6B X;  2DAK A;  3IG5 A;  1R2Z A;  1DGB A;  2UU9 M;  3KS8 A;  2R4J A;  1DV0 A;  2ERC A;  2M60 A;  1J5E M;  4DV1 M;  2J5Y A;  3B74 A;  4NSO B;  3GLG E;  3U6Q A;  1IBM M;  3PNY A;  2DHR A;  3I4Y A;  3R8F A;  1VDD A;  4FCT A;  3L27 A;  2V1C A;  4YY3 M;  1EIJ A;  1NHG C;  3FRI A;  1NVM A;  1OTR A;  4CHT B;  2KZS A;  3M0E A;  3QAU A;  1LV7 A;  2YR0 A;  4PD2 A;  1HQY E;  2F5P A;  1QDR A;  3H4J A;  4FW9 A;  5C1B A;  4JI4 M;  2FH0 A;  4Z8X A;  4B3S M;  2XSZ D;  1G8P A;  2L7H A;  4G3O A;  3FYC A;  3T38 A;  3T1Y M;  3TQS A;  4L8R C;  3VFD A;  4DUZ M;  2LVN C;  4RNA A;  5EXP A;  3AV0 A;  2K6B A;  1WHC A;  3M7G A;  1WXQ A;  3FYD A;  4MB7 A;  4G4N A;  3W67 A;  2JY7 A;  2DVW B;  2C99 A;  3L29 A;  5FTJ A;  4MGY E;  4KOD A;  4RF1 A;  2DEN A;  2QNJ A;  3RE8 A;  4GHA A;  4LFA M;  3E4R A;  1KSF X;  4AZF A;  4AKG A;  2R0I A;  5KO3 A;  3L25 A;  4LJ8 A;  1IFY A;  3VLF B;  1IXR C;  2R62 A;  4MGK E;  3K2L A;  3PVS A;  4M9Z A;  4X66 M;  4LF6 M;  4BBA A;  2KZU A;  4I5S A;  4D82 A;  4LRT A;  2JUJ A;  2MR9 A;  2ZTD A;  3W68 A;  1GAB A;  1IXS A;  1D0M A;  2JY5 A;  4XGI A;  2CHQ A;  3QYB A;  3K9O A;  1G71 A;  1Q39 A;  3HHX A;  3B89 A;  3BXW A;  3OTO M;  2DI0 A;  2J7O A;  3A42 A;  5LMN M;  4GKK M;  4TUW A;  1D0K A;  4HEO A;  5KPR A;  2P5T A;  2F5N A;  4DR7 M;  3KP1 E;  4NC6 A;  2CUZ A;  1QUT A;  4WW0 A;  2WZJ A;  4YHH M;  1YE9 A;  3SAW A;  3J7B A;  2OOA A;  3CTW B;  4M9X A;  4R7G A;  3NWL A;  1AUA A;  8CAT A;  4L4U A;  1PJQ A;  1SXJ E;  2M5Z A;  3HWS A;  5FTL A;  1N32 M;  4AKH A;  2DWZ B;  3HX3 A;  2VII A;  4I4L A;  3C58 A;  5F3W A;  1L8Q A;  2CRU A;  1QUS A;  3K92 A;  3SAU A;  1VG5 A;  4HLQ A;  4IBG A;  1QAM A;  3HHW A;  4NRW A;  1XXH A;  4NXN M;  1IY1 A;  1E32 A;  3I4V A;  2WSC F;  4IBE A;  3HZJ A;  2BJW A;  2DAG A;  3IHP A;  4QHS A;  2GQF A;  1NJG A;  2DZN B;  4L16 A;  2OOB A;  2BWB A;  4CIZ A;  1FJG M;  1OFH A;  2Q2E B;  1R4G A;  2HAK A;  4X64 M;  4AQY M;  3GQ5 A;  2EJS A;  1JR3 A;  2Z4S A;  1DO2 A;  3JAM S;  2F4V M;  2XGN A;  2R46 A;  1OAO C;  1IXS B;  1G4A E;  2YNM D;  2DXI A;  2XFT A;  2YQZ A;  1SXJ C;  4QNM A;  3I01 M;  3TPZ A;  3ZCB B;  3U60 B;  1YUB A;  4DV6 M;  4B08 A;  3GLI A;  2K9D A;  1TH2 A;  2FE8 A;  4B3R M;  2H1R A;  3I51 A;  4FWH A;  4IJE A;  3JR4 A;  2QQ8 A;  2EO2 A;  3FE3 A;  1TDZ A;  1OFI A;  2OO9 A;  3FTF A;  1ZV1 A;  1TH4 A;  2QPA A;  3C3E A;  2KNV A;  4JI5 M;  4LF8 M;  3KFU G;  4GRI A;  1PJI A;  2QHO B;  3GLH A;  1KYI A;  4DR1 M;  3VDU A;  2QBY B;  2L7I A;  4G4Q A;  1NNJ A;  4LJA A;  3SC3 A;  2CV2 A;  1MX0 A;  2MJ5 B;  1WJ7 A;  3SYK A;  3Q8X A;  4B7F A;  3WHL A;  4KO8 A;  2Y21 A;  3UGJ A;  1SXJ B;  4X62 M;  1H6U A;  2JZ0 A;  5IWA M;  3U6P A;  2B3T A;  2G5G X;  2RRU A;  3HU3 A;  3J27 B;  3KDS E;  5FTM A;  3FTE A;  3AFH A;  1T43 A;  2KHH A;  3K9P A;  1UFZ A;  3L2A A;  4CJ6 A;  5ITQ A;  5LMU M;  3U6M A;  3SBJ A;  4JI3 M;  2F5Q A;  2LHC A;  3U5Z A;  2FFJ A;  1QDT A;  1TGU A;  1N78 A;  5DFL A;  3Q8G A;  3CF0 A;  4M0D A;  3GQ4 A;  2E5L M;  4KHP M;  2Z4R A;  4LZZ A;  1HJP A;  4DR3 M;  4QOZ C;  2W82 A;  1NV8 A;  2VDB B;  5IZ7 D;  2EUC A;  2C5R A;  1IN7 A;  3RFW A;  1QAQ A;  3VKH A;  3U61 A;  1DGH A;  4LG2 A;  2MRO B;  4HL4 A;  1PJT A;  4IBF A;  4OW0 A;  4QHT A;  2L4E A;  2K0B X;  3KOX E;  3SYL A;  4DR5 M;  3GLF A;  1L2D A;  1E94 E;  2CHV A;  1IY0 A;  2GNO A;  3DA1 A;  4CIS A;  3SAV A;  5KQD A;  1V92 A;  3J2P B;  4OVZ A;  5GKN A;  3FUU A;  3E9S A;  1G3I A;  1PGY A;  4B3T M;  2QCU A;  4IJF A;  2KEB A;  4NRV A;  4DUY M;  1IM2 A;  4B7G A;  4B7H A;  1ZQ9 A;  3LW5 F;  1WGL A;  2UXB M;  1IY2 A;  4BLC A;  3U6D A;  3AL0 C;  1EFU B;  4DR6 M;  1Q3C A;  4S12 A;  2X8A A;  2DKL A;  2XLJ A;  2F5S A;  2BNK A;  1OIZ A;  4ITQ A;  1BVS A;  1VEJ A;  3SAS A;  2LHG A;  1AIP C;  4UN2 B;  1NJF A;  2Z8Y M;  1GL7 A;  1OJL A;  2LXE A;  3SMP A;  1MJG M;  2KNA A;  4XBO A;  5FLX S;  3GLG A;  2RGH A;  2DZO B;  3FRH A;  3W0F A;  4KT0 F;  1OQY A;  2HCB A;  4IBB A;  4JN6 A;  4L78 A;  3UMM A;  2WSF F;  4DV7 M;  2D7G A;  2WSE F;  2CV1 A;  4LF9 M;  3R9X B;  4DV2 M;  3JR5 A;  3CF6 E;  1GLN A;  4PCZ A;  5FTK A;  4L6V 6;  4Y28 F;  1TR8 A;  3EIE A;  1OIP A;  1VEK A;  2QSF X;  3LVV A;  3DFZ A;  3GLG B;  1NV9 A;  4P17 A;  2ZAN A;  3C3D A;  3WHK A;  4DV0 M;  3HJ8 A;  1Z59 A;  1ZMU A;  4G6Z A;  1QAN A;  3GQ3 A;  2HHH M;  1FNN A;  3T6P A;  1GJS A;  2LTU A;  3I04 M;  2FS1 A;  1VEG A;  1W5T A;  3MK6 A;  4IBD A;  5L8R F;  2RKO A;  3ILK A;  3IG8 A;  4DV5 M;  1R2Y A;  5ITU A;  2JY6 B;  3VKG A;  1JB0 F;  3CF2 A;  1XC8 A;  3GPY A;  5FTN A;  2LVP C;  1N77 A;  2C98 A;  2LH0 A;  1KFV A;  1QAO A;  3DOA A;  3HHY A;  1L1Z A;  5H37 D;  1IN5 A;  3VK8 A;  2F5O A;  2HWJ A;  2XH9 A;  2OQ4 A;  3SAR A;  4GHL A;  2EA0 A;  5KPZ A;  5BPV A;  1JR3 E;  1TH3 A;  2XSZ A;  1PM5 A;  3J81 S;  2ZM6 M;  3KSX A;  2C9O A;  2J7N A;  1ORY B;  5FSW A;  3LQQ A;  3TWM A;  2FOI C;  2AHM A;  3LCU A;  5JI3 E;  3FUW A;  3BBZ A;  5EJC A;  2L4F A;  1XWI A;  1PJS A;  2DAM A;  4I8O A;  4WUR A;  4LFB M;  5EXT A;  2D7E A;  3AOE C;  4GIT A;  3KP0 E;  3HGI A;  4I81 A;  3U6C A;  3KXE C;  2Z7J A;  1XMO M;  3GPU A;  1N34 M;  2Y0Q A;  5DYG A;  1XMQ M;  5EP2 A;  1CUK A;  3GRV A;  4KLN A;  1XNQ M;  3KW6 A;  1VQ1 A;  1HT2 E;  1Q3B A;  4K0K M;  1L1T A;  3BOS A;  2Y20 A;  3KVW A;  4D80 A;  2I7P A;  1IN4 A;  4DR2 M;  1F4I A;  3GP1 A;  1D2N A;  2XEP A;  3FD9 A;  4FD2 A;  2VF7 A;  1QVR A;  2MGW A;  4MGZ E;  1IBL M;  2KNZ A;  3U6O A;  2LWX A;  3HY5 A;  3MMP A;  2CE7 A;  1IN8 A;  4LJ9 A;  3DZD A;  2D7H A;  3J7A S;  1HT1 E;  3HU2 A;  1N36 M;  4GIP A;  1WGN A;  2O5R A;  4OVZ B;  1TF0 B;  1NY6 A;  3GLF E;  3B7Z A;  1SG9 A;  2QZ4 A;  3UZU A;  2L6O A;  5A2Q S;  2QEN A;  1K3W A;  2FNA A;  4AW4 A;  1I4W A;  2LVO C;  3U6L A;  4MGI E;  3K1J A;  2R18 A;  1TTE A;  1WR1 B;  4A3V B;  3LMM A;  2R6F A;  2XZF A;  3U61 B;  3PXG A;  3VDP A;  4ANR A;  1XXH B;  5EXS A;  4OU7 A;  4NL4 H;  1I94 M;  3MJ5 A;  2DZL A;  3W0L B;  1YLA A;  1DGG A;  5ITY A;  2KA6 B;  5EP1 A;  2G3Q A;  1NHW C;  3AOE A;  4G4R A;  1A5T A;  1IN6 A;  2HKJ A;  4JI1 M;  5EP4 A;  3QYE A;  2R4E A;  1NSF A;  2LBC A;  1K82 A;  3L28 A;  3V76 A;  4AKI A;  4JYA M;  1GJT A;  2DNA A;  4DBG B;  3HHZ A;  3SFZ A;  4LZJ A;  4WP2 A;  2HL7 A;  2JWS A;  1G59 A;  3L26 A;  3GRU A;  4GC9 A;  4NXM M;  1QQW A;  1GO5 A;  4GC5 A;  2KRU A;  5C18 A;  1XNR M;  2CFO A;  2NQ8 C;  3AJI B;  3FUX A;  4M0W A;  1UM8 A;  3C9P A;  1NY5 A;  1MU5 A;  2ZBK B;  4IBI A;  4R71 A;  3QWL A;  1GL6 A;  3GLH E;  2JA2 A;  2R45 A;  3A98 B;  4II7 A;  3U6E A;  4AG6 A;  2QBY A;  5DNY A;  4OX9 M;  5ITX A;  1VDL A;  4XK8 F;  4JI7 M;  4DV4 M;  1L2B A;  3E21 A;  4IBJ A;  1WIV A;  1Z5B A;  1T3T A;  3FTC A;  4D81 A;  2XFS A;  3ZQJ A;  3VK7 A;  4JV5 M;  2DWM A;  4IIW A;  2R44 A;  3FKE A;  3SHF A;  3H4M A;  1GVN A;  4RKU F;  1E9S A;  5ITR A;  2XZU A;  2JZ1 A;  3T1H M;  1V33 A;  4LF7 M;  1DGF A;  1XHB A;  4JI0 M;  4RF0 A;  1C1K A;  3HU1 A;  5E6J A;  3UJN A;  3PNV A;  4FCV A;  4LCB A;  3LQR A;  3HJQ A;  1IQP A;  1Z5C A;  2VQF M;  3TWL A;  4L15 A;  2JP7 A;  3K8Z A;  1C7Y A;  4AI6 A;  2V6Z M;  3UK6 A;  4FWG A;  2EKK A;  2MH8 A;  2BWE A;  2ZAO A;  1P3Q Q;  3ZC7 B;  3KOZ E;  1R5L A;  3SHG B;  3AKZ A;  1X37 A;  2LVA A;  3GRY A;  3D8L A;  1NO1 A; 
#chains in the Genus database with same CATH homology
 3EIH A;  2YFQ A;  2CHG A;  2KW0 A;  2L09 A;  2UUC M;  3M6A A;  4FVM A;  4LJ5 A;  4NOO B;  4DV3 M;  2ZAM A;  1N33 M;  3GPP A;  3LVW A;  3TL4 X;  2CV0 A;  2QP9 X;  2XF3 A;  4BB9 A;  4LFC M;  3NBI A;  4JXJ A;  4QNR A;  5KPT A;  2V1U A;  5DYI A;  4MGH A;  3B9P A;  3TWK A;  1HR0 M;  5KQ8 A;  5EP3 A;  1W5S A;  1HQC A;  3FTD A;  2OPF A;  3U6S A;  5ITX E;  3A46 A;  1HNX M;  1JR3 D;  3GO8 A;  1N75 A;  3PFI A;  3KOW E;  3HKP A;  4GMQ A;  4M9S A;  1HNZ M;  3SMS A;  4MM3 B;  1DO0 A;  3GLI B;  4R3D A;  4PT5 A;  4REZ A;  4CGY B;  5BR8 M;  5IRE B;  1L2C A;  2X49 A;  4QOS A;  1SXJ A;  4JI8 M;  3GRR A;  2A5Y B;  5IT9 S;  2K47 A;  4NSR A;  2UUA M;  3U5Z B;  2UXC M;  1G41 A;  1Z6T A;  4PDG A;  1J7K A;  1SXJ D;  5JI2 E;  2Z3X A;  4JI2 M;  1IXZ A;  3SAT A;  4PDI A;  1YSY A;  1GKI A;  3GLH B;  3MHV C;  4GH9 A;  1S3S A;  2RGO A;  2CEA A;  2BJV A;  4LJ6 A;  4LJ7 A;  3AOG A;  7CAT A;  2DWL A;  1R7R A;  4FCW A;  4EIW A;  1E9R A;  3GPX A;  1K3X A;  1IBK M;  4MH0 E;  4Z6Y A;  4IBK A;  1EE8 A;  2C96 A;  3TE6 A;  4LF4 M;  4LY6 A;  1TDH A;  5E26 A;  5EQT A;  2KXE A;  2X4A A;  4G4O A;  2LNH C;  4P16 A;  1J09 A;  4ZPX A;  2UXD M;  5EXX A;  4LJ4 A;  1HNW M;  1JQJ C;  2UUB M;  1QZM A;  4DR4 M;  4AG5 A;  2Y0T A;  3FUT A;  4LGY A;  4LF5 M;  4W5W A;  2VQE M;  3RGP A;  3U60 A;  1DGH B;  5ITT A;  4X65 M;  4LGM A;  4GKJ M;  4FWD A;  3KSJ A;  4B3M M;  3J80 S;  3T15 A;  3HJS A;  2C9C A;  4IBC A;  1PJJ A;  2R65 A;  3KS4 A;  3A45 A;  1NNU C;  3FUV A;  2KRK A;  3ZH9 B;  1Z5A A;  3GLF B;  2I7N A;  3THG A;  4LRS A;  1ZAE A;  2G8L A;  3KOY E;  3RGS A;  1QYR A;  3D8B A;  2DWN A;  1R6B X;  3IG5 A;  1R2Z A;  2UU9 M;  1DGB A;  3KS8 A;  2R4J A;  2ERC A;  2M60 A;  1J5E M;  4DV1 M;  1IBM M;  4NSO B;  3U6Q A;  3PNY A;  2DHR A;  3I4Y A;  3R8F A;  1VDD A;  4FCT A;  3L27 A;  2V1C A;  4YY3 M;  1NHG C;  1NVM A;  4CHT B;  2KZS A;  3M0E A;  3QAU A;  1LV7 A;  2YR0 A;  4PD2 A;  1HQY E;  2F5P A;  4FW9 A;  5C1B A;  4JI4 M;  4Z8X A;  4B3S M;  2XSZ D;  1G8P A;  2L7H A;  3FYC A;  3T38 A;  3T1Y M;  3TQS A;  4L8R C;  3VFD A;  4DUZ M;  4RNA A;  5EXP A;  3AV0 A;  3M7G A;  1WXQ A;  3FYD A;  4MB7 A;  4G4N A;  2DVW B;  2C99 A;  3L29 A;  5FTJ A;  4MGY E;  4KOD A;  4RF1 A;  3RE8 A;  4GHA A;  4LFA M;  3E4R A;  1KSF X;  4AZF A;  4AKG A;  5KO3 A;  3L25 A;  4LJ8 A;  3VLF B;  1IXR C;  2R62 A;  4MGK E;  3K2L A;  3PVS A;  4M9Z A;  4X66 M;  4LF6 M;  4BBA A;  2KZU A;  4I5S A;  4D82 A;  4LRT A;  4XGI A;  2CHQ A;  1Q39 A;  3HHX A;  5LMN M;  3OTO M;  4TUW A;  2J7O A;  3A42 A;  4GKK M;  2F5N A;  5KPR A;  2P5T A;  4DR7 M;  3KP1 E;  2CUZ A;  4WW0 A;  4YHH M;  1YE9 A;  3SAW A;  3J7B A;  3CTW B;  4M9X A;  4R7G A;  3NWL A;  8CAT A;  4L4U A;  1SXJ E;  2M5Z A;  5FTL A;  3HWS A;  1N32 M;  4AKH A;  2DWZ B;  3C58 A;  2VII A;  4I4L A;  5F3W A;  1L8Q A;  3K92 A;  3SAU A;  4HLQ A;  4IBG A;  1QAM A;  3HHW A;  4NRW A;  1XXH A;  4NXN M;  1IY1 A;  1E32 A;  3I4V A;  4IBE A;  2BJW A;  4QHS A;  1NJG A;  2DZN B;  4L16 A;  1FJG M;  1OFH A;  2Q2E B;  4X64 M;  4AQY M;  3GQ5 A;  1JR3 A;  2Z4S A;  1DO2 A;  3JAM S;  2F4V M;  2XGN A;  2R46 A;  2DXI A;  1IXS B;  1G4A E;  2YNM D;  2XFT A;  2YQZ A;  1SXJ C;  4QNM A;  3TPZ A;  3ZCB B;  3U60 B;  1YUB A;  4DV6 M;  4B08 A;  3GLI A;  1TH2 A;  2FE8 A;  4B3R M;  2H1R A;  3I51 A;  4FWH A;  4IJE A;  3JR4 A;  1TDZ A;  2EO2 A;  1OFI A;  3FTF A;  1TH4 A;  2QPA A;  4JI5 M;  4LF8 M;  3KFU G;  4GRI A;  1PJI A;  3GLH A;  4DR1 M;  1KYI A;  2QBY B;  3VDU A;  2L7I A;  4G4Q A;  1NNJ A;  4LJA A;  3SC3 A;  2CV2 A;  1MX0 A;  3SYK A;  3Q8X A;  4B7F A;  3WHL A;  4KO8 A;  2Y21 A;  3UGJ A;  1SXJ B;  4X62 M;  1H6U A;  5IWA M;  3U6P A;  2G5G X;  3HU3 A;  3FTE A;  3J27 B;  3KDS E;  5FTM A;  3AFH A;  3L2A A;  5ITQ A;  5LMU M;  3U6M A;  3SBJ A;  4JI3 M;  2F5Q A;  3U5Z A;  2FFJ A;  1TGU A;  1N78 A;  3GQ4 A;  3CF0 A;  4M0D A;  2E5L M;  4KHP M;  2Z4R A;  4LZZ A;  4DR3 M;  4QOZ C;  2W82 A;  5IZ7 D;  2EUC A;  2C5R A;  1IN7 A;  3RFW A;  1QAQ A;  3VKH A;  3U61 A;  1DGH A;  4LG2 A;  4HL4 A;  4IBF A;  4OW0 A;  4QHT A;  3SYL A;  4DR5 M;  3KOX E;  1L2D A;  4JI6 M;  3GLF A;  1E94 E;  2CHV A;  1IY0 A;  4CIS A;  3DA1 A;  3SAV A;  5KQD A;  3J2P B;  4OVZ A;  5GKN A;  3FUU A;  3E9S A;  1G3I A;  4B3T M;  2QCU A;  4IJF A;  2KEB A;  4NRV A;  4DUY M;  1IM2 A;  4B7G A;  4B7H A;  1ZQ9 A;  2UXB M;  1IY2 A;  4BLC A;  3U6D A;  3AL0 C;  4DR6 M;  1Q3C A;  4S12 A;  2X8A A;  2XLJ A;  2F5S A;  2BNK A;  4ITQ A;  3SAS A;  1NJF A;  1GL7 A;  1OJL A;  2LXE A;  3SMP A;  4XBO A;  5FLX S;  3GLG A;  2RGH A;  2DZO B;  3W0F A;  2HCB A;  4JN6 A;  4IBB A;  4L78 A;  4DV7 M;  3UMM A;  2CV1 A;  2D7G A;  4LF9 M;  3R9X B;  4DV2 M;  3JR5 A;  3CF6 E;  1GLN A;  4PCZ A;  5FTK A;  3EIE A;  3LVV A;  3DFZ A;  3GLG B;  2ZAN A;  3WHK A;  4DV0 M;  3HJ8 A;  1Z59 A;  4G6Z A;  1QAN A;  3GQ3 A;  2HHH M;  1FNN A;  1W5T A;  3MK6 A;  4IBD A;  2RKO A;  3ILK A;  3IG8 A;  4DV5 M;  1R2Y A;  5ITU A;  3VKG A;  3CF2 A;  1XC8 A;  1N77 A;  3GPY A;  5FTN A;  2C98 A;  2LH0 A;  1KFV A;  1QAO A;  3DOA A;  3HHY A;  1L1Z A;  5H37 D;  1IN5 A;  3VK8 A;  2F5O A;  2XH9 A;  2OQ4 A;  3SAR A;  4GHL A;  2EA0 A;  5KPZ A;  5BPV A;  1TH3 A;  2XSZ A;  1PM5 A;  3J81 S;  2ZM6 M;  3KSX A;  2C9O A;  2J7N A;  1ORY B;  5FSW A;  3LQQ A;  3TWM A;  2FOI C;  2AHM A;  5JI3 E;  3FUW A;  5EJC A;  1XWI A;  4I8O A;  4WUR A;  4LFB M;  5EXT A;  2D7E A;  3AOE C;  4GIT A;  3KP0 E;  3HGI A;  4I81 A;  3U6C A;  3KXE C;  2Z7J A;  1XMO M;  3GPU A;  1N34 M;  2Y0Q A;  5DYG A;  1XMQ M;  5EP2 A;  3GRV A;  4KLN A;  1XNQ M;  3KW6 A;  1HT2 E;  1Q3B A;  4K0K M;  1L1T A;  3BOS A;  2Y20 A;  3KVW A;  4D80 A;  2I7P A;  1IN4 A;  4DR2 M;  3GP1 A;  1D2N A;  2XEP A;  3FD9 A;  4FD2 A;  1IBL M;  1QVR A;  4MGZ E;  3U6O A;  2LWX A;  2CE7 A;  1IN8 A;  4LJ9 A;  3DZD A;  2D7H A;  3J7A S;  1HT1 E;  3HU2 A;  1N36 M;  4GIP A;  2O5R A;  4OVZ B;  1NY6 A;  2QZ4 A;  3UZU A;  2L6O A;  5A2Q S;  2QEN A;  1K3W A;  2FNA A;  4AW4 A;  1I4W A;  3U6L A;  4MGI E;  3K1J A;  2R18 A;  4A3V B;  3LMM A;  2XZF A;  3U61 B;  3PXG A;  3VDP A;  1XXH B;  5EXS A;  4OU7 A;  4NL4 H;  1I94 M;  3MJ5 A;  3W0L B;  1DGG A;  5ITY A;  2KA6 B;  5EP1 A;  1NHW C;  3AOE A;  4G4R A;  2HKJ A;  1IN6 A;  4JI1 M;  5EP4 A;  2R4E A;  1NSF A;  1K82 A;  3L28 A;  4AKI A;  4JYA M;  3HHZ A;  3SFZ A;  4LZJ A;  2HL7 A;  1G59 A;  3L26 A;  3GRU A;  4GC9 A;  4NXM M;  1QQW A;  4GC5 A;  2KRU A;  5C18 A;  1XNR M;  2CFO A;  2NQ8 C;  3AJI B;  3FUX A;  4M0W A;  1UM8 A;  1NY5 A;  1MU5 A;  2ZBK B;  4IBI A;  3QWL A;  1GL6 A;  2JA2 A;  2R45 A;  3A98 B;  4II7 A;  3U6E A;  4AG6 A;  2QBY A;  5DNY A;  4OX9 M;  5ITX A;  4JI7 M;  4DV4 M;  1L2B A;  4IBJ A;  1Z5B A;  3FTC A;  1T3T A;  4D81 A;  3VK7 A;  2XFS A;  4JV5 M;  2DWM A;  4IIW A;  3FKE A;  3SHF A;  3H4M A;  1GVN A;  1E9S A;  5ITR A;  2XZU A;  3T1H M;  4LF7 M;  1DGF A;  1XHB A;  4JI0 M;  4RF0 A;  1C1K A;  3HU1 A;  5E6J A;  3UJN A;  3PNV A;  4FCV A;  4LCB A;  3LQR A;  3HJQ A;  1IQP A;  1Z5C A;  2VQF M;  3TWL A;  4L15 A;  3K8Z A;  4AI6 A;  2V6Z M;  3UK6 A;  4FWG A;  2ZAO A;  3ZC7 B;  3KOZ E;  3SHG B;  3AKZ A;  1X37 A;  3GRY A;  3D8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...