4NSOB

Crystal structure of the effector-immunity protein complex
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
94
structure length
94
Chain Sequence
b'TSGVHQKILVCIQNEIAKSETQIRNNISSKSIDYGFPDDFYSKQRLAIHEKCMLYINVGGQRGELLMNQCELSMLQGLDIYIQQYIEDVDNSLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Effector protein
publication title Structural basis for recognition of the type VI spike protein VgrG3 by a cognate immunity protein.
pubmed doi rcsb
source organism Vibrio cholerae o1 biovar el tor
molecule tags Protein binding
total genus 35
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2013-11-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.1160 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 4nsoB00
4NSRA 4NSOB 4NOOB
chains in the Genus database with same CATH superfamily
3GLHE 4OVZA 3HY5A 5EP4A 1WGLA 4F2LA 4JI8M 1HR0M 4LGYA 3LVWA 2K9DA 3F92A 2DAIA 3KS4A 1QZEA 2VQEM 3T6PA 4LJ5A 5ITQA 2V1CA 4DBGB 4R3DA 2CV1A 2OOBA 4ZPXA 3SATA 2XZUA 4IBGA 2C96A 4AG6A 4X66M 4Y28F 3TWKA 1ORYB 4GEWA 2ERCA 2MH8A 3Q8GA 2YQZA 1PJJA 4IBDA 5FTKA 3TPZA 2CEAA 3FTFA 1GJSA 3RGSA 1EIJA 2E5LM 2LVNC 1Z6TA 3GLGA 3M6AA 1XNQM 4QOSA 5GKNA 5LMUM 4NC6A 1VEGA 2LH0A 1QQWA 1QYRA 2JUJA 2YFQA 3KFUG 3RFWA 4DR2M 4FWGA 5EXTA 3JR4A 2C98A 2BWBA 4DV4M 2VF7A 1JB0F 3B7ZA 2QQ8A 3SHFA 2ZTDA 4PCZA 3K8ZA 5EXXA 5IREB 3QWLA 3SMPA 2QBYB 2DAGA 2LVOC 3B89A 4NXNM 4F1IA 3PVSA 2UXDM 2Z8YM 1OKSA 1Q3BA 1DO2A 2DNAA 4LJ8A 2QENA 4NSRA 4QNMA 2Y21A 4XBOA 4G4QA 3GQ4A 3TWLA 5JI3E 2Z3XA 2YR0A 3AL0C 2A5YB 3LMMA 3U60A 1ZMVA 1NHGC 4CJ6A 1VDLA 5JI2E 3KOWE 5E26A 1PM5A 1E94E 1NY5A 5C1BA 4DV2M 2MR9A 2F5OA 3SYLA 3ZCBB 2MGWA 1SXJC 2DZOB 3IG5A 4GRIA 4IBFA 2JP7A 2W82A 4PDIA 3FRHA 4IBEA 1L2DA 3PFIA 2QSFX 4QHTA 4QHSA 2UUBM 3A98B 4AKHA 3GLIE 2R18A 1QVRA 3SBJA 3FKEA 1P3QQ 3A42A 1F4IA 1N34M 1TH2A 3KP0E 1N77A 1ZV1A 4B3TM 2XSZD 3FUUA 3HHWA 4AI6A 1XHBA 1IN6A 1KSFX 1LV7A 3AV0A 4IBKA 2UU9M 3B7QA 2EO2A 2OO9A 4YHHM 2HCBA 2XFSA 2R4EA 3VLFB 4FD2A 4AW4A 4K0KM 2D7HA 4JN6A 4M9XA 3UMMA 4QNRA 3JR5A 3T15A 3KOZE 3SAUA 3AOEC 1NHWC 2KRKA 3KVWA 4OVZB 3SC3A 1KFVA 3MHVC 1EE8A 2N35A 3AOEA 4AZFA 2RRUA 5ITXE 4I5SA 2EUCA 1HNWM 3D8LA 2L09A 2LHGA 4I81A 1VQ1A 3SMSA 4MGZE 4X64M 4L15A 2OPFA 4NXMM 2XGNA 1HQCA 2QZ4A 2MROB 4II7A 2CV2A 1GJTA 3JAMS 3HJQA 3HU1A 5ITTA 1V33A 4LF5M 1LTMA 3I04M 4HLQA 1IY1A 3ZH9B 3SASA 2LWXA 1XC8A 1NNUC 3LCVB 3QAUA 2DHRA 2FNAA 3VKHA 1CUKA 1PJSA 2X49A 4WURA 4P17A 4AQYM 4NSOB 3B7NA 3CF6E 4LRSA 3ZC7B 2B3TA 1XWIA 5LMNM 3K9PA 4DV7M 1WR1B 2BWEA 5EXSA 2L7HA 3FUVA 3MJ5A 3T1HM 2JY8A 3C58A 3EIHA 2Q2EB 4LCBA 2X8AA 3D8BA 1XXHB 2APLA 2JY6B 2KNAA 1TDHA 2LVQD 2XEPA 4JXJA 3RGPA 4B7FA 2XF3A 4LZZA 3I01M 1R4GA 3K9OA 1KYIA 4Q7JA 2ZANA 3FUTA 3U60B 1NY6A 3WHKA 1WIVA 2UUCM 1IN5A 1PJQA 4AG5A 2DKLA 4G3OA 1JQJC 3SARA 5C18A 1SXJB 3PNYA 3IHPA 4RF1A 3SAWA 3KXEC 1UFZA 1I94M 4LF8M 3LVVA 2CUZA 1V92A 3T1YM 1IBMM 1NJGA 2XFTA 1H6UA 1X37A 4B3MM 3TE6A 1TF0B 3GLHA 3E21A 4PT5A 2ZAMA 1YSYA 1IXZA 1I4WA 3E4RA 2KEBA 4L16A 4LJ9A 4DV6M 2F5NA 3C3EA 1GL7A 3I4VA 2WSCF 2KDLA 3GLFE 1D0KA 2VF8A 3AFHA 1TGUA 3DZDA 3C9PA 1OAOC 2G5GX 2C5RA 2WZJA 5ITUA 3IG8A 2Z4RA 3PNVA 2V6ZM 3DFZA 5H37D 2ZAOA 4D82A 4OU7A 3LW5F 3LQRA 3CTWB 4GH9A 4JI7M 1BVSA 2CHQA 2WSEF 3QYBA 3KS8A 1EFUB 2RKOA 1IFYA 2ZBKB 2L7IA 4IJEA 2V1UA 3FYDA 4DR3M 1MU5A 2ZM6M 4NRWA 2LVAA 2Z4SA 1HT1E 2C9CA 2Y0QA 3HZJA 2DZNB 5BR8M 1XMOM 1W5SA 5DNYA 1QUTA 2DAKA 4IBCA 2OOAA 2L4EA 1DGGA 4M0WA 2DENA 1GL6A 1Q39A 3W67A 1JR3A 1XXHA 1DV0A 2G3QA 3M7GA 4JI3M 3E46A 2JY5A 2KZUA 2Y0TA 4FWHA 2EJSA 1DO0A 3I51A 2R62A 1QAQA 2DWNA 4LFCM 3U6SA 2KA6B 4FCTA 4M0DA 4LF4M 2L4FA 2CRUA 3HGIA 2R46A 3B74A 3GLGE 3ILKA 1OFIA 4KT0F 4BLCA 3U6PA 4DV0M 2RGOA 3KSXA 5EP2A 2GNOA 4GMQA 4B7GA 1D0LA 2R45A 1SXJA 1GKIA 1AIPC 5EQTA 4YY3M 1R2YA 4B3RM 3NBXX 3TWMA 1PRBA 2L6OA 3HWSA 1OJLA 1VEKA 4DR1M 2O01F 4LG2A 3VFDA 5L8RF 4JI0M 3U6CA 2CV0A 2C9OA 2HL7A 3HJ8A 1R6BX 2BNKA 4FVMA 3NBIA 1AUAA 1GVNA 5DYGA 2DWLA 3K1JA 3VKGA 2O25A 3GLHB 3FYCA 4LJ7A 1ZMWA 4MGKE 5ITXA 4IBBA 4M9SA 3GRUA 3HKPA 1ZQ9A 4CHTB 3TQSA 3J7BA 1NSFA 3VDUA 3GPUA 1WHCA 2R6FA 2F4VM 1HJPA 4MH0E 1QDRA 3THGA 3GP1A 4GIPA 2QPAA 2Y20A 2XZFA 1OFHA 2K6BA 2ZTCA 2XLJA 4L4UA 3KOXE 4Z8XA 5EXPA 2UUAM 4LF6M 5DYIA 1QANA 2LHCA 2QCUA 3L28A 3GRRA 4FCVA 2J7NA 4FWDA 4MGIE 3BBZA 2P5TA 4OX9M 1DGHB 1E32A 1T6OA 1VG5A 4JI4M 3SHGB 4ITQA 2HKJA 2VQFM 4JI5M 1FJGM 2KNZA 3FTCA 2DHYA 3FRIA 1R7RA 2QP9X 2KRUA 3LQQA 2JZ0A 4S12A 8CATA 2X4AA 5KO3A 1IBKM 1HNZM 1XMQM 3GPXA 1T3TA 5ITRA 1QDTA 4L8RC 4LGMA 2DZLA 3M0EA 1G3IA 2LBCA 1Z59A 2EKFA 5BPVA 2FH0A 3SFZA 1N36M 3TL4X 3FTEA 3LCUA 2CE7A 4M9ZA 2M5ZA 1S3SA 3A46A 4IJFA 2MJ5B 5KPRA 1HNXM 4UN2B 1E9SA 1ZAEA 3MK6A 1MN3A 5FTMA 3J2PB 5A2QS 2UXCM 4P16A 3ZQJA 3GLIB 5EJCA 4JI2M 3U61B 1OIZA 4DV1M 3FUXA 4B08A 3QYEA 2DWMA 1Q02A 4OW0A 5F3WA 5DFLA 1R2ZA 3DA1A 2FE8A 3BXWA 2RGHA 3A45A 4I4LA 2XH9A 2LVPC 4KLNA 4AKIA 4I8OA 1E9RA 1IBLM 3HHXA 4IBJA 3HJSA 1NVMA 3EIEA 1MJGM 4HL4A 1N33M 1IQPA 1Y8GA 2CHGA 2C99A 4PD2A 4FW9A 3UZUA 2HWJA 3H4MA 1WGNA 4DR7M 2UXBM 2AHMA 4IBIA 4GITA 3VK7A 4GC5A 1RU3A 2BJVA 3J80S 2LXEA 1IN4A 3W0LB 4XGIA 1TDZA 3V76A 1DGHA 1SG9A 2NQ8C 3SAVA 1G8PA 3I4YA 4LZJA 4LFAM 4LF9M 4HEOA 1C7YA 2F5QA 2DI0A 5FSWA 2VDBB 3UGJA 2FFJA 3R8FA 3U6MA 3B9PA 5FLXS 1IXSB 1FNNA 3AJIB 3L26A 1J7KA 2K47A 4JV5M 1G59A 4GHAA 4IIWA 1PJTA 2CFOA 3OTOM 3U5ZA 1UM8A 4KHPM 2J7OA 4A3VB 1NV9A 3HX3A 3Q8XA 4B7HA 1GLNA 4L78A 2BJWA 3CF0A 3L29A 1YLAA 3KOYE 2CHVA 2FOIC 2I7NA 3U6DA 1OAIA 1G4AE 3L27A 3SYKA 4DUZM 4LJ4A 3E9SA 3R9XB 3GQ5A 2XSZA 2YNMD 1GABA 3W68A 1NNJA 1K3WA 3GQ3A 4LRTA 5IT9S 1GO5A 5IZ7D 3GLIA 2LTUA 4KODA 4G4RA 1L1TA 3U61A 3H4JA 1IN7A 3CF2A 2L2DA 3K2LA 1WJ7A 4DR6M 3C3DA 1JR3E 3K92A 2QNJA 1XXHE 1XNRM 1OQYA 2M60A 4CGYB 1W5TA 2R65A 3KSJA 3FTDA 2FS1A 4MGYE 2JWSA 1IM2A 2R0IA 2G8LA 1Z5AA 5FTJA 4WP2A 3WHLA 4FCWA 3BOSA 4X65M 1VEJA 1JR3D 3GLFB 2F5SA 4LJ6A 1TTEA 4D80A 1NJFA 4DR5M 4MM3B 4GC9A 1PGYA 4DV3M 1G71A 1QZMA 1G41A 4GHLA 2R44A 1NV8A 1SXJE 3KDSE 4DUYM 1DGBA 1Z5CA 2EA0A 1NO1A 1D2NA 1Z5BA 1D0MA 1R5LA 4XK8F 3U6QA 3GO8A 4LF7M 3PXGA 3FD9A 1HQYE 3UK6A 2JA2A 1ZMUA 2CWBA 2I7PA 4NRVA 2GQFA 5IWAM 1J5EM 1IXSA 2OQ4A 1SXJD 1QAOA 1TH3A 4L6V6 1L2BA 4CIZA 3VK8A 3NWLA 4REZA 3L2AA 1DGFA 1TH4A 2JY7A 4JYAM 3IECA 1OTRA 5FTLA 3U6EA 1YUBA 1L1ZA 4JI1M 1WXQA 1C1KA 2JNHA 2KNVA 3RE8A 3U5ZB 2QHOB 1N32M 5ITYA 1A5TA 1Q3CA 4MGHA 4RNAA 3U6OA 3HHZA 1K3XA 1XB2B 1K82A 2O5RA 4X62M 4DR4M 3HU2A 3J27B 3GLGB 2EKKA 4BB9A 3AKZA 4R7GA 2H1RA 2LNHC 4ANRA 4LFBM 2DAEA 2DXIA 4KO8A 2JXNA 2F5PA 3DOAA 5EP1A 5EP3A 7CATA 1L2CA 3VDPA 1YE9A 3MMPA 4EIWA 2QBYA 1V34A 2D7EA 5KQDA 3FE3A 4NOOB 1HT2E 4WW0A 4G4NA 1N75A 4BBAA 5KPTA 5E6JA 2KXEA 2KW0A 4G6ZA 4AKGA 1QUSA 1L8QA 1PJIA 1TR8A 4B3SM 4MB7A 2DVWB 4RKUF 2H5XA 3GRVA 3W0FA 2DWZB 3GRYA 2J5YA 2Z7JA 1J09A 4PDGA 2R4JA 4R71A 3HHYA 2JZ1A 4NL4H 3HU3A 3GLFA 2CP8A 4RF0A 3UJNA 2VIIA 4QOZC 3U6LA 2DAMA 2WSFF 2KHHA 1IN8A 4D81A 4W5WA 3GPPA 3J81S 1OIPA 1N78A 3T38A 3J7AS 5KPZA 1QAMA 1VDDA 4TUWA 2D7GA 4DV5M 2HHHM 3FUWA 1MX0A 4GKKM 1IY0A 3GPYA 1IY2A 4LJAA 3CGWA 3KW6A 5FTNA 5KQ8A 4G4OA 4GKJM 2K0BX 3AOGA 1IXRC 4LY6A 4Z6YA 4JI6M 3KP1E 1T43A 3L25A 4CISA 2HAKA 2KZSA
chains in the Genus database with same CATH topology
4OVZA 5EP4A 4JI8M 1HR0M 4LGYA 3LVWA 3KS4A 2VQEM 5ITQA 4LJ5A 2CV1A 2V1CA 4R3DA 4ZPXA 3SATA 2XZUA 4IBGA 2C96A 4AG6A 4X66M 3TWKA 1ORYB 2ERCA 2YQZA 1PJJA 4IBDA 5FTKA 3TPZA 2CEAA 3FTFA 3RGSA 2E5LM 1Z6TA 3GLGA 3M6AA 1XNQM 4QOSA 5GKNA 5LMUM 2LH0A 1QQWA 1QYRA 2YFQA 3KFUG 3RFWA 4DR2M 4FWGA 5EXTA 3JR4A 2C98A 4DV4M 3SHFA 4PCZA 3K8ZA 5EXXA 5IREB 3QWLA 3SMPA 2QBYB 4NXNM 2UXDM 3PVSA 1Q3BA 4NSRA 1DO2A 4LJ8A 2QENA 4QNMA 2Y21A 4XBOA 4G4QA 3GQ4A 3TWLA 5JI3E 2Z3XA 2YR0A 3AL0C 2A5YB 3LMMA 3U60A 1NHGC 5JI2E 3KOWE 5E26A 1PM5A 1E94E 1NY5A 5C1BA 4DV2M 2F5OA 3SYLA 3ZCBB 4PDIA 1SXJC 2DZOB 3IG5A 4GRIA 4IBFA 2W82A 4IBEA 1L2DA 3PFIA 4QHTA 2UUBM 4QHSA 3A98B 4AKHA 2R18A 1QVRA 3SBJA 3FKEA 3A42A 1N34M 1TH2A 3KP0E 1N77A 4B3TM 2XSZD 3FUUA 3HHWA 4AI6A 1XHBA 1IN6A 1KSFX 1LV7A 3AV0A 4IBKA 2UU9M 2EO2A 4YHHM 2HCBA 2XFSA 2R4EA 3VLFB 4FD2A 4AW4A 4K0KM 2D7HA 4JN6A 4M9XA 3UMMA 4QNRA 3JR5A 3T15A 3KOZE 3SAUA 3AOEC 1NHWC 2KRKA 3KVWA 4OVZB 3SC3A 1KFVA 3MHVC 1EE8A 3AOEA 4AZFA 5ITXE 4I5SA 2EUCA 1HNWM 3D8LA 2L09A 4I81A 3SMSA 4MGZE 4X64M 4L15A 2OPFA 4NXMM 2XGNA 1HQCA 2QZ4A 4II7A 2CV2A 3JAMS 3HJQA 3HU1A 5ITTA 4LF5M 4HLQA 1IY1A 3ZH9B 3SASA 2LWXA 1XC8A 1NNUC 3QAUA 2DHRA 2FNAA 3VKHA 2X49A 4WURA 4AQYM 4NSOB 3CF6E 4LRSA 3ZC7B 1XWIA 5LMNM 4DV7M 5EXSA 2L7HA 3FUVA 3MJ5A 3T1HM 3C58A 3EIHA 2Q2EB 4LCBA 2X8AA 3D8BA 1XXHB 4JXJA 1TDHA 2XEPA 3RGPA 4B7FA 2XF3A 4LZZA 1KYIA 2ZANA 3FUTA 3U60B 1NY6A 3WHKA 2UUCM 1IN5A 4AG5A 1JQJC 3SARA 5C18A 1SXJB 3PNYA 4RF1A 3SAWA 3KXEC 1I94M 4LF8M 3LVVA 2CUZA 3T1YM 1IBMM 1NJGA 2XFTA 1H6UA 1X37A 4B3MM 3TE6A 3GLHA 4PT5A 2ZAMA 1YSYA 1IXZA 1I4WA 3E4RA 2KEBA 4L16A 4LJ9A 4DV6M 2F5NA 1GL7A 3I4VA 3AFHA 1TGUA 3DZDA 2G5GX 2C5RA 5ITUA 3IG8A 2Z4RA 3PNVA 2V6ZM 3DFZA 5H37D 2ZAOA 4D82A 4OU7A 3LQRA 3CTWB 4GH9A 4JI7M 2CHQA 3KS8A 2RKOA 2ZBKB 2L7IA 4IJEA 2V1UA 3FYDA 4DR3M 1MU5A 2ZM6M 4NRWA 2Z4SA 1HT1E 2C9CA 2Y0QA 2DZNB 5BR8M 1XMOM 1W5SA 5DNYA 4IBCA 1DGGA 4M0WA 1GL6A 1Q39A 1JR3A 1XXHA 3M7GA 4JI3M 2KZUA 2Y0TA 4FWHA 1DO0A 3I51A 2R62A 1QAQA 2DWNA 4LFCM 3U6SA 2KA6B 4FCTA 4M0DA 4LF4M 3HGIA 2R46A 3ILKA 1OFIA 4BLCA 3U6PA 4DV0M 2RGOA 3KSXA 5EP2A 4GMQA 4B7GA 2R45A 1SXJA 1GKIA 5EQTA 4YY3M 1R2YA 4B3RM 3TWMA 2L6OA 3HWSA 1OJLA 4DR1M 4LG2A 3VFDA 4JI0M 3U6CA 2CV0A 2C9OA 2HL7A 3HJ8A 1R6BX 2BNKA 4FVMA 3NBIA 1GVNA 5DYGA 2DWLA 3K1JA 3VKGA 3GLHB 3FYCA 4LJ7A 4MGKE 5ITXA 4IBBA 4M9SA 3GRUA 3HKPA 1ZQ9A 4CHTB 3TQSA 3J7BA 1NSFA 3VDUA 3GPUA 2F4VM 4MH0E 3THGA 3GP1A 4GIPA 2QPAA 2Y20A 2XZFA 1OFHA 2XLJA 4L4UA 3KOXE 4Z8XA 5EXPA 2UUAM 4LF6M 5DYIA 1QANA 2QCUA 3L28A 4FCVA 3GRRA 4MGIE 2J7NA 4FWDA 4OX9M 2P5TA 1DGHB 1E32A 4JI4M 3SHGB 4ITQA 2HKJA 2VQFM 4JI5M 1FJGM 3FTCA 1R7RA 2QP9X 2KRUA 3LQQA 4S12A 5KO3A 8CATA 2X4AA 1IBKM 1HNZM 1XMQM 3GPXA 1T3TA 5ITRA 4L8RC 4LGMA 3M0EA 1G3IA 1Z59A 5BPVA 3SFZA 1N36M 3TL4X 3FTEA 2CE7A 4M9ZA 2M5ZA 1S3SA 3A46A 4IJFA 5KPRA 1HNXM 1E9SA 1ZAEA 3MK6A 5FTMA 2UXCM 3J2PB 5A2QS 4P16A 3GLIB 5EJCA 4JI2M 3U61B 4DV1M 3FUXA 4B08A 2DWMA 4OW0A 5F3WA 1R2ZA 3DA1A 2FE8A 2RGHA 3A45A 4I4LA 2XH9A 4KLNA 4AKIA 4I8OA 1E9RA 1IBLM 3HHXA 4IBJA 3HJSA 1NVMA 3EIEA 4HL4A 1N33M 1IQPA 2CHGA 2C99A 4PD2A 4FW9A 3UZUA 3H4MA 2UXBM 4DR7M 2AHMA 4IBIA 4GITA 3VK7A 4GC5A 3J80S 2BJVA 2LXEA 1IN4A 3W0LB 4XGIA 1TDZA 1DGHA 2NQ8C 3SAVA 1G8PA 3I4YA 4LZJA 4LFAM 4LF9M 2F5QA 3UGJA 5FSWA 3R8FA 2FFJA 3U6MA 3B9PA 5FLXS 1IXSB 1FNNA 3AJIB 3L26A 1J7KA 2K47A 4JV5M 1G59A 4GHAA 4IIWA 2CFOA 3OTOM 3U5ZA 1UM8A 4KHPM 2J7OA 4A3VB 3Q8XA 4B7HA 1GLNA 4L78A 2BJWA 3CF0A 3L29A 3KOYE 2CHVA 2FOIC 2I7NA 3U6DA 1G4AE 3L27A 3SYKA 4DUZM 4LJ4A 3E9SA 3R9XB 3GQ5A 2XSZA 2YNMD 1NNJA 1K3WA 3GQ3A 4LRTA 5IT9S 5IZ7D 3GLIA 4KODA 4G4RA 1L1TA 3U61A 1IN7A 3CF2A 3K2LA 4DR6M 3K92A 1XNRM 4CGYB 2M60A 1W5TA 2R65A 3KSJA 3FTDA 4MGYE 1IM2A 2G8LA 1Z5AA 5FTJA 3WHLA 4FCWA 3BOSA 4X65M 1JR3D 3GLFB 2F5SA 4LJ6A 4D80A 1NJFA 4DR5M 4MM3B 4GC9A 4DV3M 1QZMA 4GHLA 1G41A 1SXJE 3KDSE 4DUYM 1DGBA 1Z5CA 2EA0A 1D2NA 1Z5BA 3U6QA 4LF7M 3GO8A 3PXGA 3FD9A 1HQYE 3UK6A 2JA2A 2I7PA 4NRVA 5IWAM 1J5EM 2OQ4A 1SXJD 1QAOA 1TH3A 1L2BA 3VK8A 3NWLA 4REZA 3L2AA 1DGFA 1TH4A 4JYAM 5FTLA 3U6EA 1YUBA 1L1ZA 4JI1M 1WXQA 1C1KA 3RE8A 3U5ZB 1N32M 5ITYA 1Q3CA 4MGHA 4RNAA 3U6OA 3HHZA 1K3XA 1K82A 2O5RA 4X62M 4DR4M 3HU2A 3J27B 3GLGB 4BB9A 3AKZA 4R7GA 2H1RA 2LNHC 4LFBM 2DXIA 4KO8A 2F5PA 3DOAA 5EP1A 5EP3A 7CATA 1L2CA 3VDPA 1YE9A 4EIWA 2QBYA 2D7EA 5KQDA 4NOOB 1HT2E 4WW0A 4G4NA 1N75A 4BBAA 5KPTA 5E6JA 2KXEA 2KW0A 4G6ZA 4AKGA 1L8QA 1PJIA 4B3SM 4MB7A 2DVWB 3GRVA 3W0FA 2DWZB 3GRYA 2Z7JA 1J09A 4PDGA 2R4JA 3HHYA 4NL4H 3HU3A 3GLFA 4RF0A 3UJNA 2VIIA 4QOZC 3U6LA 4D81A 1IN8A 4W5WA 3GPPA 3J81S 1N78A 3T38A 3J7AS 5KPZA 1QAMA 1VDDA 4TUWA 2D7GA 4DV5M 2HHHM 3FUWA 1MX0A 4GKKM 1IY0A 3GPYA 1IY2A 4LJAA 3KW6A 5FTNA 5KQ8A 4G4OA 4GKJM 3AOGA 4LY6A 1IXRC 4Z6YA 4JI6M 3KP1E 3L25A 4CISA 2KZSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NSR A;  4NSO B;  4NOO B; 
#chains in the Genus database with same CATH topology
 3GLH E;  4OVZ A;  3HY5 A;  5EP4 A;  1WGL A;  4F2L A;  4JI8 M;  1HR0 M;  4LGY A;  3LVW A;  2K9D A;  3F92 A;  2DAI A;  3KS4 A;  1QZE A;  2VQE M;  3T6P A;  4LJ5 A;  5ITQ A;  2V1C A;  4DBG B;  4R3D A;  2CV1 A;  2OOB A;  4ZPX A;  3SAT A;  2XZU A;  4IBG A;  2C96 A;  4AG6 A;  4X66 M;  4Y28 F;  3TWK A;  1ORY B;  4GEW A;  2ERC A;  2MH8 A;  3Q8G A;  2YQZ A;  1PJJ A;  4IBD A;  5FTK A;  3TPZ A;  2CEA A;  3FTF A;  1GJS A;  3RGS A;  1EIJ A;  2E5L M;  2LVN C;  1Z6T A;  3GLG A;  3M6A A;  1XNQ M;  4QOS A;  5GKN A;  5LMU M;  4NC6 A;  1VEG A;  2LH0 A;  1QQW A;  1QYR A;  2JUJ A;  2YFQ A;  3KFU G;  3RFW A;  4DR2 M;  4FWG A;  5EXT A;  3JR4 A;  2C98 A;  2BWB A;  4DV4 M;  2VF7 A;  1JB0 F;  3B7Z A;  2QQ8 A;  3SHF A;  2ZTD A;  4PCZ A;  3K8Z A;  5EXX A;  5IRE B;  3QWL A;  3SMP A;  2QBY B;  2DAG A;  2LVO C;  3B89 A;  4NXN M;  4F1I A;  3PVS A;  2UXD M;  2Z8Y M;  1OKS A;  1Q3B A;  1DO2 A;  2DNA A;  4LJ8 A;  2QEN A;  4NSR A;  4QNM A;  2Y21 A;  4XBO A;  4G4Q A;  3GQ4 A;  3TWL A;  5JI3 E;  2Z3X A;  2YR0 A;  3AL0 C;  2A5Y B;  3LMM A;  3U60 A;  1ZMV A;  1NHG C;  4CJ6 A;  1VDL A;  5JI2 E;  3KOW E;  5E26 A;  1PM5 A;  1E94 E;  1NY5 A;  5C1B A;  4DV2 M;  2MR9 A;  2F5O A;  3SYL A;  3ZCB B;  2MGW A;  1SXJ C;  2DZO B;  3IG5 A;  4GRI A;  4IBF A;  2JP7 A;  2W82 A;  4PDI A;  3FRH A;  4IBE A;  1L2D A;  3PFI A;  2QSF X;  4QHT A;  4QHS A;  2UUB M;  3A98 B;  4AKH A;  3GLI E;  2R18 A;  1QVR A;  3SBJ A;  3FKE A;  1P3Q Q;  3A42 A;  1F4I A;  1N34 M;  1TH2 A;  3KP0 E;  1N77 A;  1ZV1 A;  4B3T M;  2XSZ D;  3FUU A;  3HHW A;  4AI6 A;  1XHB A;  1IN6 A;  1KSF X;  1LV7 A;  3AV0 A;  4IBK A;  2UU9 M;  3B7Q A;  2EO2 A;  2OO9 A;  4YHH M;  2HCB A;  2XFS A;  2R4E A;  3VLF B;  4FD2 A;  4AW4 A;  4K0K M;  2D7H A;  4JN6 A;  4M9X A;  3UMM A;  4QNR A;  3JR5 A;  3T15 A;  3KOZ E;  3SAU A;  3AOE C;  1NHW C;  2KRK A;  3KVW A;  4OVZ B;  3SC3 A;  1KFV A;  3MHV C;  1EE8 A;  2N35 A;  3AOE A;  4AZF A;  2RRU A;  5ITX E;  4I5S A;  2EUC A;  1HNW M;  3D8L A;  2L09 A;  2LHG A;  4I81 A;  1VQ1 A;  3SMS A;  4MGZ E;  4X64 M;  4L15 A;  2OPF A;  4NXM M;  2XGN A;  1HQC A;  2QZ4 A;  2MRO B;  4II7 A;  2CV2 A;  1GJT A;  3JAM S;  3HJQ A;  3HU1 A;  5ITT A;  1V33 A;  4LF5 M;  1LTM A;  3I04 M;  4HLQ A;  1IY1 A;  3ZH9 B;  3SAS A;  2LWX A;  1XC8 A;  1NNU C;  3LCV B;  3QAU A;  2DHR A;  2FNA A;  3VKH A;  1CUK A;  1PJS A;  2X49 A;  4WUR A;  4P17 A;  4AQY M;  4NSO B;  3B7N A;  3CF6 E;  4LRS A;  3ZC7 B;  2B3T A;  1XWI A;  5LMN M;  3K9P A;  4DV7 M;  1WR1 B;  2BWE A;  5EXS A;  2L7H A;  3FUV A;  3MJ5 A;  3T1H M;  2JY8 A;  3C58 A;  3EIH A;  2Q2E B;  4LCB A;  2X8A A;  3D8B A;  1XXH B;  2APL A;  2JY6 B;  2KNA A;  1TDH A;  2LVQ D;  2XEP A;  4JXJ A;  3RGP A;  4B7F A;  2XF3 A;  4LZZ A;  3I01 M;  1R4G A;  3K9O A;  1KYI A;  4Q7J A;  2ZAN A;  3FUT A;  3U60 B;  1NY6 A;  3WHK A;  1WIV A;  2UUC M;  1IN5 A;  1PJQ A;  4AG5 A;  2DKL A;  4G3O A;  1JQJ C;  3SAR A;  5C18 A;  1SXJ B;  3PNY A;  3IHP A;  4RF1 A;  3SAW A;  3KXE C;  1UFZ A;  1I94 M;  4LF8 M;  3LVV A;  2CUZ A;  1V92 A;  3T1Y M;  1IBM M;  1NJG A;  2XFT A;  1H6U A;  1X37 A;  4B3M M;  3TE6 A;  1TF0 B;  3GLH A;  3E21 A;  4PT5 A;  2ZAM A;  1YSY A;  1IXZ A;  1I4W A;  3E4R A;  2KEB A;  4L16 A;  4LJ9 A;  4DV6 M;  2F5N A;  3C3E A;  1GL7 A;  3I4V A;  2WSC F;  2KDL A;  3GLF E;  1D0K A;  2VF8 A;  3AFH A;  1TGU A;  3DZD A;  3C9P A;  1OAO C;  2G5G X;  2C5R A;  2WZJ A;  5ITU A;  3IG8 A;  2Z4R A;  3PNV A;  2V6Z M;  3DFZ A;  5H37 D;  2ZAO A;  4D82 A;  4OU7 A;  3LW5 F;  3LQR A;  3CTW B;  4GH9 A;  4JI7 M;  1BVS A;  2CHQ A;  2WSE F;  3QYB A;  3KS8 A;  1EFU B;  2RKO A;  1IFY A;  2ZBK B;  2L7I A;  4IJE A;  2V1U A;  3FYD A;  4DR3 M;  1MU5 A;  2ZM6 M;  4NRW A;  2LVA A;  2Z4S A;  1HT1 E;  2C9C A;  2Y0Q A;  3HZJ A;  2DZN B;  5BR8 M;  1XMO M;  1W5S A;  5DNY A;  1QUT A;  2DAK A;  4IBC A;  2OOA A;  2L4E A;  1DGG A;  4M0W A;  2DEN A;  1GL6 A;  1Q39 A;  3W67 A;  1JR3 A;  1XXH A;  1DV0 A;  2G3Q A;  3M7G A;  4JI3 M;  3E46 A;  2JY5 A;  2KZU A;  2Y0T A;  4FWH A;  2EJS A;  1DO0 A;  3I51 A;  2R62 A;  1QAQ A;  2DWN A;  4LFC M;  3U6S A;  2KA6 B;  4FCT A;  4M0D A;  4LF4 M;  2L4F A;  2CRU A;  3HGI A;  2R46 A;  3B74 A;  3GLG E;  3ILK A;  1OFI A;  4KT0 F;  4BLC A;  3U6P A;  4DV0 M;  2RGO A;  3KSX A;  5EP2 A;  2GNO A;  4GMQ A;  4B7G A;  1D0L A;  2R45 A;  1SXJ A;  1GKI A;  1AIP C;  5EQT A;  4YY3 M;  1R2Y A;  4B3R M;  3NBX X;  3TWM A;  1PRB A;  2L6O A;  3HWS A;  1OJL A;  1VEK A;  4DR1 M;  2O01 F;  4LG2 A;  3VFD A;  5L8R F;  4JI0 M;  3U6C A;  2CV0 A;  2C9O A;  2HL7 A;  3HJ8 A;  1R6B X;  2BNK A;  4FVM A;  3NBI A;  1AUA A;  1GVN A;  5DYG A;  2DWL A;  3K1J A;  3VKG A;  2O25 A;  3GLH B;  3FYC A;  4LJ7 A;  1ZMW A;  4MGK E;  5ITX A;  4IBB A;  4M9S A;  3GRU A;  3HKP A;  1ZQ9 A;  4CHT B;  3TQS A;  3J7B A;  1NSF A;  3VDU A;  3GPU A;  1WHC A;  2R6F A;  2F4V M;  1HJP A;  4MH0 E;  1QDR A;  3THG A;  3GP1 A;  4GIP A;  2QPA A;  2Y20 A;  2XZF A;  1OFH A;  2K6B A;  2ZTC A;  2XLJ A;  4L4U A;  3KOX E;  4Z8X A;  5EXP A;  2UUA M;  4LF6 M;  5DYI A;  1QAN A;  2LHC A;  2QCU A;  3L28 A;  3GRR A;  4FCV A;  2J7N A;  4FWD A;  4MGI E;  3BBZ A;  2P5T A;  4OX9 M;  1DGH B;  1E32 A;  1T6O A;  1VG5 A;  4JI4 M;  3SHG B;  4ITQ A;  2HKJ A;  2VQF M;  4JI5 M;  1FJG M;  2KNZ A;  3FTC A;  2DHY A;  3FRI A;  1R7R A;  2QP9 X;  2KRU A;  3LQQ A;  2JZ0 A;  4S12 A;  8CAT A;  2X4A A;  5KO3 A;  1IBK M;  1HNZ M;  1XMQ M;  3GPX A;  1T3T A;  5ITR A;  1QDT A;  4L8R C;  4LGM A;  2DZL A;  3M0E A;  1G3I A;  2LBC A;  1Z59 A;  2EKF A;  5BPV A;  2FH0 A;  3SFZ A;  1N36 M;  3TL4 X;  3FTE A;  3LCU A;  2CE7 A;  4M9Z A;  2M5Z A;  1S3S A;  3A46 A;  4IJF A;  2MJ5 B;  5KPR A;  1HNX M;  4UN2 B;  1E9S A;  1ZAE A;  3MK6 A;  1MN3 A;  5FTM A;  3J2P B;  5A2Q S;  2UXC M;  4P16 A;  3ZQJ A;  3GLI B;  5EJC A;  4JI2 M;  3U61 B;  1OIZ A;  4DV1 M;  3FUX A;  4B08 A;  3QYE A;  2DWM A;  1Q02 A;  4OW0 A;  5F3W A;  5DFL A;  1R2Z A;  3DA1 A;  2FE8 A;  3BXW A;  2RGH A;  3A45 A;  4I4L A;  2XH9 A;  2LVP C;  4KLN A;  4AKI A;  4I8O A;  1E9R A;  1IBL M;  3HHX A;  4IBJ A;  3HJS A;  1NVM A;  3EIE A;  1MJG M;  4HL4 A;  1N33 M;  1IQP A;  1Y8G A;  2CHG A;  2C99 A;  4PD2 A;  4FW9 A;  3UZU A;  2HWJ A;  3H4M A;  1WGN A;  4DR7 M;  2UXB M;  2AHM A;  4IBI A;  4GIT A;  3VK7 A;  4GC5 A;  1RU3 A;  2BJV A;  3J80 S;  2LXE A;  1IN4 A;  3W0L B;  4XGI A;  1TDZ A;  3V76 A;  1DGH A;  1SG9 A;  2NQ8 C;  3SAV A;  1G8P A;  3I4Y A;  4LZJ A;  4LFA M;  4LF9 M;  4HEO A;  1C7Y A;  2F5Q A;  2DI0 A;  5FSW A;  2VDB B;  3UGJ A;  2FFJ A;  3R8F A;  3U6M A;  3B9P A;  5FLX S;  1IXS B;  1FNN A;  3AJI B;  3L26 A;  1J7K A;  2K47 A;  4JV5 M;  1G59 A;  4GHA A;  4IIW A;  1PJT A;  2CFO A;  3OTO M;  3U5Z A;  1UM8 A;  4KHP M;  2J7O A;  4A3V B;  1NV9 A;  3HX3 A;  3Q8X A;  4B7H A;  1GLN A;  4L78 A;  2BJW A;  3CF0 A;  3L29 A;  1YLA A;  3KOY E;  2CHV A;  2FOI C;  2I7N A;  3U6D A;  1OAI A;  1G4A E;  3L27 A;  3SYK A;  4DUZ M;  4LJ4 A;  3E9S A;  3R9X B;  3GQ5 A;  2XSZ A;  2YNM D;  1GAB A;  3W68 A;  1NNJ A;  1K3W A;  3GQ3 A;  4LRT A;  5IT9 S;  1GO5 A;  5IZ7 D;  3GLI A;  2LTU A;  4KOD A;  4G4R A;  1L1T A;  3U61 A;  3H4J A;  1IN7 A;  3CF2 A;  2L2D A;  3K2L A;  1WJ7 A;  4DR6 M;  3C3D A;  1JR3 E;  3K92 A;  2QNJ A;  1XXH E;  1XNR M;  1OQY A;  2M60 A;  4CGY B;  1W5T A;  2R65 A;  3KSJ A;  3FTD A;  2FS1 A;  4MGY E;  2JWS A;  1IM2 A;  2R0I A;  2G8L A;  1Z5A A;  5FTJ A;  4WP2 A;  3WHL A;  4FCW A;  3BOS A;  4X65 M;  1VEJ A;  1JR3 D;  3GLF B;  2F5S A;  4LJ6 A;  1TTE A;  4D80 A;  1NJF A;  4DR5 M;  4MM3 B;  4GC9 A;  1PGY A;  4DV3 M;  1G71 A;  1QZM A;  1G41 A;  4GHL A;  2R44 A;  1NV8 A;  1SXJ E;  3KDS E;  4DUY M;  1DGB A;  1Z5C A;  2EA0 A;  1NO1 A;  1D2N A;  1Z5B A;  1D0M A;  1R5L A;  4XK8 F;  3U6Q A;  3GO8 A;  4LF7 M;  3PXG A;  3FD9 A;  1HQY E;  3UK6 A;  2JA2 A;  1ZMU A;  2CWB A;  2I7P A;  4NRV A;  2GQF A;  5IWA M;  1J5E M;  1IXS A;  2OQ4 A;  1SXJ D;  1QAO A;  1TH3 A;  4L6V 6;  1L2B A;  4CIZ A;  3VK8 A;  3NWL A;  4REZ A;  3L2A A;  1DGF A;  1TH4 A;  2JY7 A;  4JYA M;  3IEC A;  1OTR A;  5FTL A;  3U6E A;  1YUB A;  1L1Z A;  4JI1 M;  1WXQ A;  1C1K A;  2JNH A;  2KNV A;  3RE8 A;  3U5Z B;  2QHO B;  1N32 M;  5ITY A;  1A5T A;  1Q3C A;  4MGH A;  4RNA A;  3U6O A;  3HHZ A;  1K3X A;  1XB2 B;  1K82 A;  2O5R A;  4X62 M;  4DR4 M;  3HU2 A;  3J27 B;  3GLG B;  2EKK A;  4BB9 A;  3AKZ A;  4R7G A;  2H1R A;  2LNH C;  4ANR A;  4LFB M;  2DAE A;  2DXI A;  4KO8 A;  2JXN A;  2F5P A;  3DOA A;  5EP1 A;  5EP3 A;  7CAT A;  1L2C A;  3VDP A;  1YE9 A;  3MMP A;  4EIW A;  2QBY A;  1V34 A;  2D7E A;  5KQD A;  3FE3 A;  4NOO B;  1HT2 E;  4WW0 A;  4G4N A;  1N75 A;  4BBA A;  5KPT A;  5E6J A;  2KXE A;  2KW0 A;  4G6Z A;  4AKG A;  1QUS A;  1L8Q A;  1PJI A;  1TR8 A;  4B3S M;  4MB7 A;  2DVW B;  4RKU F;  2H5X A;  3GRV A;  3W0F A;  2DWZ B;  3GRY A;  2J5Y A;  2Z7J A;  1J09 A;  4PDG A;  2R4J A;  4R71 A;  3HHY A;  2JZ1 A;  4NL4 H;  3HU3 A;  3GLF A;  2CP8 A;  4RF0 A;  3UJN A;  2VII A;  4QOZ C;  3U6L A;  2DAM A;  2WSF F;  2KHH A;  1IN8 A;  4D81 A;  4W5W A;  3GPP A;  3J81 S;  1OIP A;  1N78 A;  3T38 A;  3J7A S;  5KPZ A;  1QAM A;  1VDD A;  4TUW A;  2D7G A;  4DV5 M;  2HHH M;  3FUW A;  1MX0 A;  4GKK M;  1IY0 A;  3GPY A;  1IY2 A;  4LJA A;  3CGW A;  3KW6 A;  5FTN A;  5KQ8 A;  4G4O A;  4GKJ M;  2K0B X;  3AOG A;  1IXR C;  4LY6 A;  4Z6Y A;  4JI6 M;  3KP1 E;  1T43 A;  3L25 A;  4CIS A;  2HAK A;  2KZS A; 
#chains in the Genus database with same CATH homology
 4OVZ A;  5EP4 A;  4JI8 M;  1HR0 M;  4LGY A;  3LVW A;  3KS4 A;  2VQE M;  5ITQ A;  4LJ5 A;  2CV1 A;  2V1C A;  4R3D A;  4ZPX A;  3SAT A;  2XZU A;  4IBG A;  2C96 A;  4AG6 A;  4X66 M;  3TWK A;  1ORY B;  2ERC A;  2YQZ A;  1PJJ A;  4IBD A;  5FTK A;  3TPZ A;  2CEA A;  3FTF A;  3RGS A;  2E5L M;  1Z6T A;  3GLG A;  3M6A A;  1XNQ M;  4QOS A;  5GKN A;  5LMU M;  2LH0 A;  1QQW A;  1QYR A;  2YFQ A;  3KFU G;  3RFW A;  4DR2 M;  4FWG A;  5EXT A;  3JR4 A;  2C98 A;  4DV4 M;  3SHF A;  4PCZ A;  3K8Z A;  5EXX A;  5IRE B;  3QWL A;  3SMP A;  2QBY B;  4NXN M;  2UXD M;  3PVS A;  1Q3B A;  4NSR A;  1DO2 A;  4LJ8 A;  2QEN A;  4QNM A;  2Y21 A;  4XBO A;  4G4Q A;  3GQ4 A;  3TWL A;  5JI3 E;  2Z3X A;  2YR0 A;  3AL0 C;  2A5Y B;  3LMM A;  3U60 A;  1NHG C;  5JI2 E;  3KOW E;  5E26 A;  1PM5 A;  1E94 E;  1NY5 A;  5C1B A;  4DV2 M;  2F5O A;  3SYL A;  3ZCB B;  4PDI A;  1SXJ C;  2DZO B;  3IG5 A;  4GRI A;  4IBF A;  2W82 A;  4IBE A;  1L2D A;  3PFI A;  4QHT A;  2UUB M;  4QHS A;  3A98 B;  4AKH A;  2R18 A;  1QVR A;  3SBJ A;  3FKE A;  3A42 A;  1N34 M;  1TH2 A;  3KP0 E;  1N77 A;  4B3T M;  2XSZ D;  3FUU A;  3HHW A;  4AI6 A;  1XHB A;  1IN6 A;  1KSF X;  1LV7 A;  3AV0 A;  4IBK A;  2UU9 M;  2EO2 A;  4YHH M;  2HCB A;  2XFS A;  2R4E A;  3VLF B;  4FD2 A;  4AW4 A;  4K0K M;  2D7H A;  4JN6 A;  4M9X A;  3UMM A;  4QNR A;  3JR5 A;  3T15 A;  3KOZ E;  3SAU A;  3AOE C;  1NHW C;  2KRK A;  3KVW A;  4OVZ B;  3SC3 A;  1KFV A;  3MHV C;  1EE8 A;  3AOE A;  4AZF A;  5ITX E;  4I5S A;  2EUC A;  1HNW M;  3D8L A;  2L09 A;  4I81 A;  3SMS A;  4MGZ E;  4X64 M;  4L15 A;  2OPF A;  4NXM M;  2XGN A;  1HQC A;  2QZ4 A;  4II7 A;  2CV2 A;  3JAM S;  3HJQ A;  3HU1 A;  5ITT A;  4LF5 M;  4HLQ A;  1IY1 A;  3ZH9 B;  3SAS A;  2LWX A;  1XC8 A;  1NNU C;  3QAU A;  2DHR A;  2FNA A;  3VKH A;  2X49 A;  4WUR A;  4AQY M;  4NSO B;  3CF6 E;  4LRS A;  3ZC7 B;  1XWI A;  5LMN M;  4DV7 M;  5EXS A;  2L7H A;  3FUV A;  3MJ5 A;  3T1H M;  3C58 A;  3EIH A;  2Q2E B;  4LCB A;  2X8A A;  3D8B A;  1XXH B;  4JXJ A;  1TDH A;  2XEP A;  3RGP A;  4B7F A;  2XF3 A;  4LZZ A;  1KYI A;  2ZAN A;  3FUT A;  3U60 B;  1NY6 A;  3WHK A;  2UUC M;  1IN5 A;  4AG5 A;  1JQJ C;  3SAR A;  5C18 A;  1SXJ B;  3PNY A;  4RF1 A;  3SAW A;  3KXE C;  1I94 M;  4LF8 M;  3LVV A;  2CUZ A;  3T1Y M;  1IBM M;  1NJG A;  2XFT A;  1H6U A;  1X37 A;  4B3M M;  3TE6 A;  3GLH A;  4PT5 A;  2ZAM A;  1YSY A;  1IXZ A;  1I4W A;  3E4R A;  2KEB A;  4L16 A;  4LJ9 A;  4DV6 M;  2F5N A;  1GL7 A;  3I4V A;  3AFH A;  1TGU A;  3DZD A;  2G5G X;  2C5R A;  5ITU A;  3IG8 A;  2Z4R A;  3PNV A;  2V6Z M;  3DFZ A;  5H37 D;  2ZAO A;  4D82 A;  4OU7 A;  3LQR A;  3CTW B;  4GH9 A;  4JI7 M;  2CHQ A;  3KS8 A;  2RKO A;  2ZBK B;  2L7I A;  4IJE A;  2V1U A;  3FYD A;  4DR3 M;  1MU5 A;  2ZM6 M;  4NRW A;  2Z4S A;  1HT1 E;  2C9C A;  2Y0Q A;  2DZN B;  5BR8 M;  1XMO M;  1W5S A;  5DNY A;  4IBC A;  1DGG A;  4M0W A;  1GL6 A;  1Q39 A;  1JR3 A;  1XXH A;  3M7G A;  4JI3 M;  2KZU A;  2Y0T A;  4FWH A;  1DO0 A;  3I51 A;  2R62 A;  1QAQ A;  2DWN A;  4LFC M;  3U6S A;  2KA6 B;  4FCT A;  4M0D A;  4LF4 M;  3HGI A;  2R46 A;  3ILK A;  1OFI A;  4BLC A;  3U6P A;  4DV0 M;  2RGO A;  3KSX A;  5EP2 A;  4GMQ A;  4B7G A;  2R45 A;  1SXJ A;  1GKI A;  5EQT A;  4YY3 M;  1R2Y A;  4B3R M;  3TWM A;  2L6O A;  3HWS A;  1OJL A;  4DR1 M;  4LG2 A;  3VFD A;  4JI0 M;  3U6C A;  2CV0 A;  2C9O A;  2HL7 A;  3HJ8 A;  1R6B X;  2BNK A;  4FVM A;  3NBI A;  1GVN A;  5DYG A;  2DWL A;  3K1J A;  3VKG A;  3GLH B;  3FYC A;  4LJ7 A;  4MGK E;  5ITX A;  4IBB A;  4M9S A;  3GRU A;  3HKP A;  1ZQ9 A;  4CHT B;  3TQS A;  3J7B A;  1NSF A;  3VDU A;  3GPU A;  2F4V M;  4MH0 E;  3THG A;  3GP1 A;  4GIP A;  2QPA A;  2Y20 A;  2XZF A;  1OFH A;  2XLJ A;  4L4U A;  3KOX E;  4Z8X A;  5EXP A;  2UUA M;  4LF6 M;  5DYI A;  1QAN A;  2QCU A;  3L28 A;  4FCV A;  3GRR A;  4MGI E;  2J7N A;  4FWD A;  4OX9 M;  2P5T A;  1DGH B;  1E32 A;  4JI4 M;  3SHG B;  4ITQ A;  2HKJ A;  2VQF M;  4JI5 M;  1FJG M;  3FTC A;  1R7R A;  2QP9 X;  2KRU A;  3LQQ A;  4S12 A;  5KO3 A;  8CAT A;  2X4A A;  1IBK M;  1HNZ M;  1XMQ M;  3GPX A;  1T3T A;  5ITR A;  4L8R C;  4LGM A;  3M0E A;  1G3I A;  1Z59 A;  5BPV A;  3SFZ A;  1N36 M;  3TL4 X;  3FTE A;  2CE7 A;  4M9Z A;  2M5Z A;  1S3S A;  3A46 A;  4IJF A;  5KPR A;  1HNX M;  1E9S A;  1ZAE A;  3MK6 A;  5FTM A;  2UXC M;  3J2P B;  5A2Q S;  4P16 A;  3GLI B;  5EJC A;  4JI2 M;  3U61 B;  4DV1 M;  3FUX A;  4B08 A;  2DWM A;  4OW0 A;  5F3W A;  1R2Z A;  3DA1 A;  2FE8 A;  2RGH A;  3A45 A;  4I4L A;  2XH9 A;  4KLN A;  4AKI A;  4I8O A;  1E9R A;  1IBL M;  3HHX A;  4IBJ A;  3HJS A;  1NVM A;  3EIE A;  4HL4 A;  1N33 M;  1IQP A;  2CHG A;  2C99 A;  4PD2 A;  4FW9 A;  3UZU A;  3H4M A;  2UXB M;  4DR7 M;  2AHM A;  4IBI A;  4GIT A;  3VK7 A;  4GC5 A;  3J80 S;  2BJV A;  2LXE A;  1IN4 A;  3W0L B;  4XGI A;  1TDZ A;  1DGH A;  2NQ8 C;  3SAV A;  1G8P A;  3I4Y A;  4LZJ A;  4LFA M;  4LF9 M;  2F5Q A;  3UGJ A;  5FSW A;  3R8F A;  2FFJ A;  3U6M A;  3B9P A;  5FLX S;  1IXS B;  1FNN A;  3AJI B;  3L26 A;  1J7K A;  2K47 A;  4JV5 M;  1G59 A;  4GHA A;  4IIW A;  2CFO A;  3OTO M;  3U5Z A;  1UM8 A;  4KHP M;  2J7O A;  4A3V B;  3Q8X A;  4B7H A;  1GLN A;  4L78 A;  2BJW A;  3CF0 A;  3L29 A;  3KOY E;  2CHV A;  2FOI C;  2I7N A;  3U6D A;  1G4A E;  3L27 A;  3SYK A;  4DUZ M;  4LJ4 A;  3E9S A;  3R9X B;  3GQ5 A;  2XSZ A;  2YNM D;  1NNJ A;  1K3W A;  3GQ3 A;  4LRT A;  5IT9 S;  5IZ7 D;  3GLI A;  4KOD A;  4G4R A;  1L1T A;  3U61 A;  1IN7 A;  3CF2 A;  3K2L A;  4DR6 M;  3K92 A;  1XNR M;  4CGY B;  2M60 A;  1W5T A;  2R65 A;  3KSJ A;  3FTD A;  4MGY E;  1IM2 A;  2G8L A;  1Z5A A;  5FTJ A;  3WHL A;  4FCW A;  3BOS A;  4X65 M;  1JR3 D;  3GLF B;  2F5S A;  4LJ6 A;  4D80 A;  1NJF A;  4DR5 M;  4MM3 B;  4GC9 A;  4DV3 M;  1QZM A;  4GHL A;  1G41 A;  1SXJ E;  3KDS E;  4DUY M;  1DGB A;  1Z5C A;  2EA0 A;  1D2N A;  1Z5B A;  3U6Q A;  4LF7 M;  3GO8 A;  3PXG A;  3FD9 A;  1HQY E;  3UK6 A;  2JA2 A;  2I7P A;  4NRV A;  5IWA M;  1J5E M;  2OQ4 A;  1SXJ D;  1QAO A;  1TH3 A;  1L2B A;  3VK8 A;  3NWL A;  4REZ A;  3L2A A;  1DGF A;  1TH4 A;  4JYA M;  5FTL A;  3U6E A;  1YUB A;  1L1Z A;  4JI1 M;  1WXQ A;  1C1K A;  3RE8 A;  3U5Z B;  1N32 M;  5ITY A;  1Q3C A;  4MGH A;  4RNA A;  3U6O A;  3HHZ A;  1K3X A;  1K82 A;  2O5R A;  4X62 M;  4DR4 M;  3HU2 A;  3J27 B;  3GLG B;  4BB9 A;  3AKZ A;  4R7G A;  2H1R A;  2LNH C;  4LFB M;  2DXI A;  4KO8 A;  2F5P A;  3DOA A;  5EP1 A;  5EP3 A;  7CAT A;  1L2C A;  3VDP A;  1YE9 A;  4EIW A;  2QBY A;  2D7E A;  5KQD A;  4NOO B;  1HT2 E;  4WW0 A;  4G4N A;  1N75 A;  4BBA A;  5KPT A;  5E6J A;  2KXE A;  2KW0 A;  4G6Z A;  4AKG A;  1L8Q A;  1PJI A;  4B3S M;  4MB7 A;  2DVW B;  3GRV A;  3W0F A;  2DWZ B;  3GRY A;  2Z7J A;  1J09 A;  4PDG A;  2R4J A;  3HHY A;  4NL4 H;  3HU3 A;  3GLF A;  4RF0 A;  3UJN A;  2VII A;  4QOZ C;  3U6L A;  4D81 A;  1IN8 A;  4W5W A;  3GPP A;  3J81 S;  1N78 A;  3T38 A;  3J7A S;  5KPZ A;  1QAM A;  1VDD A;  4TUW A;  2D7G A;  4DV5 M;  2HHH M;  3FUW A;  1MX0 A;  4GKK M;  1IY0 A;  3GPY A;  1IY2 A;  4LJA A;  3KW6 A;  5FTN A;  5KQ8 A;  4G4O A;  4GKJ M;  3AOG A;  4LY6 A;  1IXR C;  4Z6Y A;  4JI6 M;  3KP1 E;  3L25 A;  4CIS A;  2KZS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...