4NSQA

Crystal structure of pcaf
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
161
structure length
157
Chain Sequence
KVIEFHVVGNSPNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFLTYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone acetyltransferase KAT2B
publication title Dimeric structure of p300/CBP associated factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 42
structure length 157
sequence length 161
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.48: Histone acetyltransferase.
pdb deposition date 2013-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4nsqA00
5KTDA 3CXSA 2FE7A 3PZJA 1P4NA 1M4IA 1U6MA 2NMTA 2D4PA 4R3LA 1BO4A 3ZZIA 4JJXA 5H84A 2G3AA 1LRZA 1MJ9A 3S6HA 1UFHA 4EVYA 2B4BA 3I9SA 1Z4RA 4XPKA 3B8GA 1S60A 4M85A 1YGHA 3E0KA 4KVOE 2REFA 4XNHC 5I0CA 3GYAA 5C82A 2I79A 1S7KA 4XNHB 2ARHA 5F47A 4KOTA 3FIXA 1BOBA 3TTHA 5DWNA 1IB1E 1B6BA 4NCZA 2B5GB 2EUIA 2Q0YA 4B5OA 1QSRA 4UBRA 2AJ6A 4CRYB 3EXNA 3G3SA 4QUSA 5J8CA 3TO9A 3R95A 3S6GA 3D2MA 3SXNA 1L0CA 4B5PB 1YVOA 2B3UA 2D4OA 4OADA 3C26A 1S7NA 5FVJA 1KUVA 4R9MA 2VEZA 2ZW4A 2OZUA 3OWCA 1YREA 4KUAA 4FD4A 2X7BA 4R87A 2PSWA 3N7ZA 4KUBA 1KZFA 4GS4A 1ON0A 4OAEA 2F5IA 5H86A 3D8PA 3FB3A 1FY7A 3FYNA 2DXQA 4JXRA 2HV2A 1S5KA 3K9UA 1MJAA 1OZPA 4KOSA 2B4DB 1SQHA 2PDOA 2FS5A 3KKWA 2C27A 3FRMA 3TT2A 1YX0A 2FXFA 4ZBGA 1QSTA 2FL4A 3GY9A 2CNMA 3F5BA 2OZHA 1PUAA 4BMHA 1CJWA 2BUEA 4II9A 4UWJA 2HUZA 4NXYA 2JDCA 2PQ8A 4UA3A 4Y49C 4IF5A 2B5GA 3DR8A 4PK3A 3TFYA 4Y49B 4JXQA 1NE9A 2Z10A 4E8OA 3LD2A 1RXTA 2CNSA 1YVKA 1TIQA 4ONUA 1XEBA 1XIXA 3SHPA 4QBJA 4QC6A 1Z9UA 4JLYA 1GHEA 2QMLA 4HNYB 1IIDA 2R98A 3FNCA 2Q4VA 1IYKA 2CY2A 3GKRA 2GE3A 4KOUA 4AVCA 2VZYA 2ZXVA 3CXQA 1I21A 1YLEA 1IYLA 2Q04A 4LUAA 4U9ZA 2R8VA 5DWMA 2KCWA 3IWGA 1Y9KA 3QAHA 2ZW5A 4XPLA 4L89A 4H89A 3MGDA 1PU9A 3S6KA 1XE4A 4F0YA 5J8FA 5JQ4A 3F8KA 4JD6A 5C88A 4AG9A 3F0AA 2OZGA 2Q44A 3R9FA 4XPDC 5EC4A 1M4DA 3FXTA 4XPDB 3R9GA 3DR6A 2A4NA 1K4JA 3BJ7A 2I00A 3TCVA 3EFAA 1I12A 2VZZA 1Y7RA 1KUYA 1KUXA 4L8AA 4KOXA 2P6FA 1S7LA 1XMTA 3WR7A 2REEA 4H6ZA 5EBVA 3R9EA 3G8WA 2GIVA 1CM0A 1XF8A 2WPXA 4NEXA 2BL1A 1VKCA 3LODA 1VHSA 2OB0A 5F48A 2VQYA 3TO6A 2CNTA 2ZPAA 1RO5A 4MY0A 4QVTA 3PP9A 2JDDA 4R57A 3SXOA 1NMTA 4KOYA 4KOVA 1S3ZA 2P0WA 2PRBA 1MK4A 4KVME 2ZW6A 4LX9A 4AVBA 5E96A 3ZJ0A 2JEVA 4DNCA 3P2FA 3JVNA 2J8NA 2AE6A 2GANA 4QB9A 2QIRA 4X5KA 3D3SA 4PV6A 2ZW7A 1Q2YA 5JPHA 4CAWA 5HMNA 4I49A 3D2PA 3VWDA 4RS2A 2WPWA 4PK2A 1WK4A 4CAXA 5KTAA 4J3GA 4UWIA 2BSWA 2PR1A 3VWEA 2IL4A 1J4JA 4R3KA 3W91A 2G0BA 4B5PA 4CS0B 1R57A 4YGOA 2EVNA 1YR0A 5IV0A 1Y9WA 2FT0A 3JUWA 3TOBA 4KLVA 2VI7A 2FIWA 2H5MA 2Z11A 4MI4A 1MJBA 3T9YA 2ATRA 4PSWA 4ORFA 4CAVA 4MY3A 4KOWA 4AG7A 1V0CA 4KVXA 2OU2A 4U9YA 1S7FA 4JWPA 2B3VA 5ISVA 3FBUA 2B4DA 2BEIA 2Q7BA 2O28A 2R7HA 2K5TA 1QSMA 3RYOA 3PGPA 4AB7A 2FIAA 4OLLA 4MJ8A 3S6FA 4YFJA 2PC1A 4IUSA 1Z4EA 1QSOA 4FD6A 2P6EA 3I3GA 4RI1A 5KTCA 2VBQA 4CRZB 1Q2DA 1WWZA 4U5YA 1M44A 4PSXA 4HNXB 4KORA 4FD5A 3BLNA 4YRHA 2Y0MA 3UY5A 5HH1A 2QECA 2VXKA 3DNSA 3TE4A 2RC4A 5GCNA 2Q4YA 3R96A 3IGRA 3W6XA 4AVAA 5IB0A 2G3TA 4E2AA 3DSBA 1IICA 4NSQA 4NF1A 3BJ8A 3EO4A 3EY5A 3CXPA 2P6GA 2JLMA 1Q2CA 1YK3A 5IX3A 4M3SA 5CNPA 2R1IA 1B87A 1P0HA 1QSNA 5F46A 3EC4A 4F6AA 4K30A 3V8IA 2HQYA 1M1DA 4MHDA 2J8RA 3DDDA 4HKFA 4MBUA 4HNWB 2PR8A 4KZTA 2FSRA 3H4QA 3TOAA 3TO7A 2B58A 1I1DA 2J8MA 1M4GA 4FD7A 4H6UA 2OH1A 1NSLA 4KLWA 4E0AA 2FCKA 2Z0ZA 3NE7A 3T90A 3QB8A 1N71A 3W6SA 3R1KA 5F49A 3P2HA
chains in the Genus database with same CATH superfamily
5KTDA 2ZEDA 3CXSA 2FE7A 1Q7LA 4JZ0A 3MRUA 3PZJA 1P4NA 4M6IA 3VARA 3B3TA 3N5FA 4PPZA 1M4IA 2HB6A 1U6MA 2NMTA 4A30A 2D4PA 4BINA 5I4MA 4PXCA 4MHNA 1BO4A 4R3LA 2OOTA 3V38A 3ZZIA 2EWBA 4JJXA 5H84A 2AFZA 4HPSA 2G3AA 1XRYA 4MRIA 5A27A 1XOVA 2GU2A 1LRZA 1MJ9A 4LQ6A 1UFHA 3S6HA 4EVYA 2B4BA 1QQ9A 3I9SA 5K8PA 1Z4RA 1CPSA 1M4LA 2PJ9A 4XPKA 5AG4A 3B8GA 1HDUA 1S60A 4OC0A 2V8HA 3GLJA 4M85A 1YGHA 2PJ1A 3E0KA 2IJZA 4KVOE 4UEZA 2REFA 5AGEA 4XNHC 5I0CA 1IY7A 1F57A 3GYAA 5C82A 2DPTA 2I79A 1S7KA 4XNHB 3B7IA 2ARHA 5F47A 5ELYA 3B3VA 4P45A 4KOTA 5HVGA 3FIXA 3JTKA 3WT4A 1BOBA 3TTHA 4IK2A 5DWNA 1IB1E 1B6BA 4NCZA 2B5GB 2EUIA 2Q0YA 4NFRA 4B13A 4EFDA 3IEHA 1ZG8A 4B5OA 1QSRA 4UBRA 3JRUA 2AJ6A 4ZX9A 3EXNA 4CRYB 3D68A 3G3SA 4F8ZA 4QUSA 5J8CA 1XBUA 3TO9A 3R95A 3RAMA 3S6GA 4MXUA 3D2MA 4A31A 3SXNA 1L0CA 4B5PB 1YVOA 2WYRA 3GIUA 2B3UA 2Z3MA 2D4OA 4IAVA 1JQGA 4OADA 3C26A 1S7NA 5FVJA 3BI1A 1ELLP 1KUVA 4NGNA 1VHOA 2WUUA 4NGSA 4R9MA 1F2OA 2VEZA 4P4FA 2ZW4A 4OC1A 1YSJA 4MFJA 2OZUA 4ZY0A 4NGQA 3OWCA 4ZY2A 1YREA 3NA6A 4KSIA 3V7ZA 4KUAA 4FD4A 3PB4X 2X7BA 4R87A 2OR4A 4ZY1A 4R76A 3DLJA 2PSWA 2BO9A 2CF4A 3N7ZA 4LQGA 4KUBA 1KZFA 3FH4A 3PRTA 4GS4A 1ON0A 4OAEA 3SJXA 2POKA 2EK8A 4C7HA 2F5IA 3A9LA 1ELMP 3D8PA 3FB3A 5G1ZA 5H86A 1FY7A 3FYNA 5IB9A 4MFKA 4P4DA 2DXQA 4JXRA 2HV2A 5BWAB 5G21A 3WABA 2WZNA 1TXRA 4MHPA 2ZOFA 2FVGA 1S5KA 1XJOA 3K9UA 3KQZA 1AYEA 1MJAA 1OZPA 4IHMA 4KOSA 3PBEA 2B4DB 1SQHA 4P4JA 2PDOA 2FS5A 1EE3P 3KKWA 2XEJA 4MFZA 8CPAA 3SI2A 2PJ8A 4EWTA 2C27A 4NGMA 3FRMA 3TT2A 2YNCA 1YX0A 2FXFA 3CT9A 3MN8A 1QSTA 4ZBGA 2FL4A 2Z3KA 4K3NA 3KL9A 3GY9A 2CNMA 3L2NA 3NH4A 3F5BA 2PJBA 3FF3A 4OIWA 1Y7EA 1VIXA 4BBHA 4EMEA 3D7FA 4ONWA 3LMSA 2OZHA 4P6YA 3S9LA 1PUAA 4BMHA 1ZG7A 4OC4A 4CGOA 1CJWA 2BUEA 4H2KA 4CYPA 2YNDA 3SI1A 1AUGA 2NYQA 1X10A 3IWEA 4II9A 4B11A 4G1PA 4FUUA 4UWJA 2HUZA 3GB0A 4NXYA 4MCRA 2JDCA 5HVHA 2EK9A 2PQ8A 4UA3A 4Y49C 5EMIA 4CYQA 5G20A 4IF5A 2WSAA 2B5GA 3DR8A 2PJ5A 4PK3A 3TFYA 2C6PA 4Y49B 1BAVA 4JXQA 1NE9A 2Z10A 4E8OA 3LD2A 1LOKA 1RXTA 2VL1A 1BPNA 2CNSA 5F49A 1YVKA 4C2XA 4CGPA 3CPAA 1TIQA 4ONUA 1XEBA 1XIXA 3SHPA 4DYOA 4QC6A 3IJ3A 3SJGA 4QBJA 2EBJA 1IOFA 1Z9UA 3LWUA 4BD9A 4JLYA 2NSMA 3WC7A 3FEEA 2PJ4A 1GHEA 2QMLA 4M6GA 4HNYB 3CPXA 4PXDA 1IIDA 2R98A 1CP7A 3FNCA 2JBKA 3CZXA 2Q4VA 2YNEA 2IQ6A 1IYKA 2CY2A 3DGVA 1BPMA 2YGWA 2C6GA 3GKRA 3BI0A 3H5ZA 2GE3A 3H8EA 4KOUA 4MFLA 4AVCA 3IIBA 5AG6A 2VZYA 2ZXVA 3CXQA 1I21A 3PB6X 4FWUA 1YLEA 1IYLA 2Q04A 4O23A 3PBBA 2PJAA 4LUAA 4OMEA 4AXVA 4U9ZA 2R8VA 5DWMA 3B3CA 1RTQA 1YLOA 2KCWA 3IWGA 4NGPA 1Y9KA 3T8WA 4A38A 3QAHA 2ZW5A 4M6HA 1ZLHA 4L89A 4XPLA 4C2YA 1R3NA 2XEIA 2ODFA 3MGDA 4H89A 1PU9A 3S6KA 3TC8A 1XE4A 4MCPA 4UEEA 2Z3OA 4F0YA 1LANA 5J8FA 5THWA 5JQ4A 3F8KA 3S9NA 1Z8WA 2PJ2A 4JD6A 5K8NA 5LRGA 5C88A 4AG9A 3F0AA 2OZGA 1HDQA 1Z8XA 2PVWA 2Q44A 1CBXA 1R43A 3R9FA 5LYDA 4F9VA 4XPDC 1HEEA 5EC4A 3KR5A 5D29A 1ZO0A 1M4DA 3FXTA 4XPDB 3R9GA 5K8MA 3DR6A 2A4NA 1K4JA 1Z5RA 3BJ7A 4UCPA 4MHZA 2I00A 4CAEA 1XFOA 5AG5A 4YWYA 3TCVA 1CP6A 3EFAA 1A2ZA 1I12A 2VZZA 3IC1A 2AFXA 1Y7RA 4UIBA 1H8LA 1KUYA 2GLJA 4Q7AA 4UF4A 4R8FA 1KUXA 2DPSA 4KOXA 4L8AA 2AFOA 3PB9X 4MMOA 2P6FA 4PXEA 1S7LA 1Z8LA 2RFHA 5JH9A 1XMTA 4NGTA 2V8DA 3H8GA 3WR7A 5K8OA 2AFSA 4OC5A 3RNZA 2REEA 4H6ZA 4RN7A 4UFVA 4ZYQA 5EBVA 3R9EA 4KSAA 3G8WA 2GIVA 3SI0A 1CM0A 1TF8A 1Z8TA 1XF8A 2WPXA 2ZEFA 2BL1A 3ISZA 4NEXA 4OC2A 2XEGA 1VKCA 3LODA 1VHSA 2OB0A 3PFOA 5F48A 4R6TA 4X3RA 2VQYA 3TX8A 2ZELA 3TO6A 2PIZA 2CNTA 4MCSA 2ZPAA 1RO5A 2PCUA 3KI9A 1CG2A 2I3CA 4MY0A 4QVTA 2HC9A 3IU1A 3PP9A 2JDDA 5LYIA 4R57A 3SXOA 4RUHA 1NMTA 2DF5A 4W9YA 4KOYA 4KOVA 1S3ZA 2P0WA 2PRBA 4P4BA 1MK4A 4KVME 1LFWA 2ZW6A 4LX9A 4A2ZA 2QYVA 3RBUA 1QMUA 3VATA 4NJQA 5A28A 2IMOA 3K2KA 3I1UA 4WWVA 4AVBA 1TKFA 2ZEGA 3NFZA 5E96A 5G22A 3ZJ0A 2V8VA 4R7MA 5HVFA 2CTBA 2CIJA 2JEVA 2BCOA 4UCMA 3P2FA 4DNCA 3JVNA 2J8NA 2AE6A 2GANA 3KQXA 3FEDA 4QB9A 5CPAA 2J9AA 3IFEA 3KASA 2QIRA 1LCPA 4X5KA 3D3SA 4PV6A 2ZW7A 1Q2YA 4NJRA 5JPHA 4YU9A 2JBJA 4CAWA 5HMNA 4I49A 4PQAA 3D2PA 4B12A 2O53A 4X8IA 1JWQA 3K9TA 5LRKA 3VWDA 4RS2A 2WPWA 2XEFA 4PK2A 3BHXA 4A95A 5AG7A 3FECA 4FBEA 1WK4A 1DTDA 3WC6A 3NH8A 4MCQA 4CAXA 2ZEOA 3LACA 2QVPA 5JM6A 3S9MA 5KTAA 2F7VA 4J3GA 2V8GA 3D66A 2RB7A 4UWIA 2AFUA 4P10A 2ZEEA 3D67A 1PCAA 4P4EA 2BSWA 4MFPA 2PR1A 1KWMA 3VWEA 2IL4A 1J4JA 4R3KA 3W91A 1BLLE 2G0BA 4B5PA 4CS0B 3PEIA 1R57A 1YMEA 4KSFA 4YGOA 4CGNA 6CPAA 2ZEPA 3D7DA 2EVNA 1YR0A 5IV0A 1Y9WA 3FX6A 2FT0A 3JUWA 3TOBA 1UWYA 4KLVA 2VI7A 2FIWA 2H5MA 4B6ZA 2Z11A 4MI4A 1MJBA 4TNUA 3T9YA 2ATRA 1CPXA 4PSWA 4ORFA 2GFQA 4CAVA 4MFQA 4GXHA 4MY3A 2YNCC 1X12A 3RO0A 5J1QA 3VH9A 4KOWA 4A33A 3FVLA 2PJ7A 2ZOGA 1AMPA 2PJ6A 2AFWA 3KR4A 4AG7A 1V0CA 1CX8A 1ZLIA 4KVXA 2OU2A 4U9YA 1S7FA 2PRQA 5D8NA 3RZAA 2JEWA 2B3VA 4JWPA 4X2TA 4OKOA 1Y0RA 4B14A 5ISVA 1TKHA 3GUXA 3FBUA 2B4DA 4CYOA 2BEIA 2Q7BA 2O28A 3PFEA 2EO8A 5CBMA 4C2ZA 2R7HA 1TKJA 4UFXA 4UEFA 4OC3A 1LAPA 4ZGYB 2CXAA 1IGBA 1VGYA 1DE4C 2ZEHA 1XMBA 2K5TA 3HLPA 1VHEA 3KZWA 1OBRA 1QSMA 4MHYA 3RYOA 1GYTA 3PGPA 4KS9A 3SJFA 4AB7A 4B10A 3B3SA 2FIAA 4UIAA 4OLLA 4MJ8A 3S6FA 4YFJA 2PC1A 4IUSA 5HXDA 1YW4A 1Z4EA 1TF9A 1QSOA 2PJ0A 4FD6A 2P6EA 3D7HA 3I3GA 3KHZA 2PJ3A 3FMCA 3NE8A 1YQEA 4RI1A 1ZG9A 1FNOA 2VBQA 5KTCA 3WC5A 4CRZB 2DEAA 1Q2DA 1WWZA 1IOIA 3D7GA 1LAMA 4U5YA 2V77A 1M44A 4PSXA 4HNXB 4KORA 5F09A 3PB8X 4FD5A 5JGFA 4GM5A 3BLNA 1PYTB 4YRHA 2Y0MA 7CPAA 3UY5A 5HH1A 2QECA 5LYFA 2VXKA 4DJLA 3DNSA 4CGMA 3TE4A 2ZENA 2RC4A 3QAYA 5GCNA 2Q4YA 3R96A 1Y0YA 3IGRA 3W6XA 4AVAA 3NH5A 4TWEA 5IB0A 3BXMA 1ARLA 2Q4ZA 4A32A 2G3TA 3D4UA 4E2AA 2Z3NA 3DSBA 1IICA 4NSQA 3IU2A 4NF1A 4DUKA 2AFMA 4P4IA 4JYWA 3BJ8A 3EO4A 3HUVA 5LYLA 4PXBA 4Q38A 1NSAA 3EY5A 3CXPA 2P6GA 2JLMA 2GREA 3H8FA 1Q2CA 1YK3A 2F8HA 2CTCA 2ANPA 2PIYA 4Q36A 5IX3A 4M3SA 5CNPA 4Z65A 2QJ8A 1B87A 2R1IA 1P0HA 1QSNA 4CAFA 5F46A 3EC4A 2GLFA 4F6AA 4K30A 4UCNA 3V8IA 2HQYA 1M1DA 4MHDA 2PJCA 3KGQA 2Q51A 2O4HA 3IO1A 2J8RA 2Z3LA 3DDDA 4HKFA 2PVVA 4CPAA 3ISXA 4OIDA 1ARMA 1FT7A 4MBUA 2C6CA 4C68A 4HNWB 1Z2LA 2PR8A 4KZTA 3B35A 4ZX8A 5LRJA 4C7IA 2FSRA 3H4QA 3PB7X 4F9UA 2Z3PA 3TOAA 3B2YA 2B58A 3TO7A 4A39A 4F0XA 3CDXA 1I1DA 2J8MA 1M4GA 4A94A 3IWWA 3SJEA 3QNVA 4FD7A 4H6UA 4WJBA 4FAIA 2OH1A 2ZEMA 1NSLA 4KLWA 2PE3A 4ZI6A 4CGLA 4CYNA 4E0AA 2G9DA 2FCKA 1YW6A 2C1CA 2Z0ZA 3NE7A 3B3WA 3FJUA 2ABZA 2BOAA 3T90A 4A37A 3QB8A 2Q7SA 1N71A 2Q43A 1IU8A 4UFWA 4OP4A 3W6SA 3R1KA 1F2PA 4P44A 4NGRA 5DS0A 3P2HA 3KHXA
chains in the Genus database with same CATH topology
5KTDA 3CXSA 2FE7A 3PZJA 1P4NA 1M4IA 1U6MA 2NMTA 4A30A 2D4PA 4R3LA 1BO4A 3ZZIA 4JJXA 5H84A 2G3AA 5A27A 1LRZA 1MJ9A 3S6HA 1UFHA 4EVYA 2B4BA 3I9SA 1Z4RA 4XPKA 5AG4A 3B8GA 1S60A 4M85A 1YGHA 3E0KA 4KVOE 5AGEA 2REFA 4XNHC 5I0CA 3GYAA 5C82A 2DPTA 2I79A 1S7KA 4XNHB 2ARHA 5F47A 4KOTA 3FIXA 3JTKA 1BOBA 3TTHA 5DWNA 1IB1E 1B6BA 4NCZA 2B5GB 2EUIA 2Q0YA 4B13A 4B5OA 1QSRA 4UBRA 2AJ6A 4CRYB 3EXNA 3G3SA 4QUSA 5J8CA 3TO9A 3R95A 3S6GA 3D2MA 4A31A 3SXNA 1L0CA 4B5PB 1YVOA 2B3UA 2Z3MA 2D4OA 4OADA 3C26A 1S7NA 5FVJA 1KUVA 2WUUA 4R9MA 2VEZA 2ZW4A 4MFJA 2OZUA 3OWCA 1YREA 4KUAA 4FD4A 2X7BA 4R87A 2PSWA 3N7ZA 4KUBA 1KZFA 4GS4A 1ON0A 4OAEA 4C7HA 2F5IA 3A9LA 3D8PA 3FB3A 5H86A 5G1ZA 1FY7A 3FYNA 4MFKA 2DXQA 4JXRA 2HV2A 5BWAB 5G21A 1S5KA 3K9UA 1MJAA 1OZPA 4KOSA 2B4DB 1SQHA 2PDOA 2FS5A 3KKWA 4MFZA 2C27A 3FRMA 3TT2A 2YNCA 1YX0A 2FXFA 4ZBGA 1QSTA 2FL4A 2Z3KA 3GY9A 2CNMA 3F5BA 4BBHA 2OZHA 1PUAA 4BMHA 4CGOA 1CJWA 2BUEA 4CYPA 2YNDA 3IWEA 4II9A 4B11A 4UWJA 2HUZA 4NXYA 2JDCA 2PQ8A 4UA3A 4CYQA 4Y49C 5G20A 4IF5A 2WSAA 2B5GA 3DR8A 4PK3A 3TFYA 4Y49B 4JXQA 1NE9A 2Z10A 4E8OA 3LD2A 1RXTA 2CNSA 1YVKA 4C2XA 1TIQA 4ONUA 1XEBA 1XIXA 3SHPA 4QBJA 4QC6A 1Z9UA 4JLYA 1GHEA 2QMLA 4HNYB 1IIDA 2R98A 3FNCA 2Q4VA 2YNEA 1IYKA 2CY2A 2YGWA 3GKRA 3H5ZA 2GE3A 4KOUA 4MFLA 4AVCA 5AG6A 2VZYA 2ZXVA 3CXQA 1I21A 1YLEA 1IYLA 2Q04A 4LUAA 4U9ZA 2R8VA 5DWMA 2KCWA 3IWGA 1Y9KA 3QAHA 2ZW5A 4XPLA 4L89A 4C2YA 4H89A 3MGDA 1PU9A 3S6KA 1XE4A 2Z3OA 4F0YA 5J8FA 5JQ4A 3F8KA 4JD6A 5C88A 4AG9A 3F0AA 2OZGA 2Q44A 3R9FA 4XPDC 5EC4A 1ZO0A 1M4DA 3FXTA 4XPDB 3R9GA 3DR6A 2A4NA 1K4JA 3BJ7A 4UCPA 2I00A 4CAEA 5AG5A 3TCVA 3EFAA 1I12A 2VZZA 1Y7RA 1KUYA 1KUXA 2DPSA 4KOXA 4L8AA 2P6FA 1S7LA 1XMTA 3WR7A 2REEA 4H6ZA 4UFVA 5EBVA 3R9EA 4KSAA 3G8WA 2GIVA 1CM0A 4CGPA 1XF8A 2WPXA 4NEXA 2BL1A 1VKCA 3LODA 1VHSA 2OB0A 5F48A 2VQYA 3TO6A 2CNTA 2ZPAA 1RO5A 4MY0A 4QVTA 3IU1A 3PP9A 2JDDA 4R57A 3SXOA 1NMTA 4KOYA 4KOVA 1S3ZA 2P0WA 2PRBA 1MK4A 4KVME 2ZW6A 4LX9A 4A2ZA 5A28A 4AVBA 5E96A 5G22A 3ZJ0A 2JEVA 4DNCA 4UCMA 3P2FA 3JVNA 2J8NA 2AE6A 2GANA 4QB9A 2QIRA 4X5KA 3D3SA 4PV6A 2ZW7A 1Q2YA 5JPHA 4CAWA 5HMNA 4I49A 4B12A 3D2PA 3VWDA 4RS2A 2WPWA 4PK2A 4A95A 5AG7A 1WK4A 4CAXA 5KTAA 4J3GA 4UWIA 2BSWA 4MFPA 2PR1A 3VWEA 2IL4A 1J4JA 4R3KA 3W91A 2G0BA 4B5PA 4CS0B 1R57A 4KSFA 4YGOA 4CGNA 2EVNA 1YR0A 5IV0A 1Y9WA 2FT0A 3JUWA 3TOBA 4KLVA 2VI7A 2FIWA 2H5MA 2Z11A 4MI4A 1MJBA 3T9YA 2ATRA 4PSWA 4ORFA 4CAVA 4MFQA 4MY3A 2YNCC 4A33A 4KOWA 4AG7A 1V0CA 4KVXA 2OU2A 4U9YA 1S7FA 4JWPA 2B3VA 4B14A 5ISVA 3FBUA 2B4DA 4CYOA 2BEIA 2Q7BA 2O28A 4C2ZA 2R7HA 4UFXA 4ZGYB 2CXAA 2K5TA 1QSMA 3RYOA 4B10A 4KS9A 3PGPA 4AB7A 2FIAA 4OLLA 4MJ8A 3S6FA 4YFJA 2PC1A 4IUSA 1Z4EA 1QSOA 4FD6A 2P6EA 3I3GA 4RI1A 5KTCA 2VBQA 4CRZB 1Q2DA 1WWZA 4U5YA 1M44A 4PSXA 4HNXB 4KORA 4FD5A 3BLNA 4YRHA 2Y0MA 3UY5A 5HH1A 2QECA 2VXKA 3DNSA 4CGMA 3TE4A 2RC4A 5GCNA 2Q4YA 3R96A 3IGRA 3W6XA 4AVAA 5IB0A 4A32A 2G3TA 4E2AA 2Z3NA 3DSBA 1IICA 4NSQA 3IU2A 4NF1A 3BJ8A 3EO4A 4Q38A 3EY5A 3CXPA 2P6GA 2JLMA 1Q2CA 1YK3A 5IX3A 4Q36A 4M3SA 5CNPA 2R1IA 1B87A 4CAFA 1P0HA 1QSNA 5F46A 3EC4A 4F6AA 4K30A 4UCNA 3V8IA 2HQYA 1M1DA 4MHDA 2J8RA 2Z3LA 3DDDA 4HKFA 4MBUA 4C68A 4HNWB 2PR8A 4KZTA 4C7IA 2FSRA 3H4QA 2Z3PA 3TOAA 3TO7A 2B58A 4F0XA 1I1DA 2J8MA 1M4GA 4FD7A 4H6UA 2OH1A 1NSLA 4KLWA 4CGLA 4CYNA 4E0AA 2FCKA 2Z0ZA 3NE7A 3T90A 3QB8A 1N71A 4UFWA 3W6SA 3R1KA 5F49A 3P2HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KTD A;  3CXS A;  2FE7 A;  3PZJ A;  1P4N A;  1M4I A;  1U6M A;  2NMT A;  2D4P A;  4R3L A;  1BO4 A;  3ZZI A;  4JJX A;  5H84 A;  2G3A A;  1LRZ A;  1MJ9 A;  3S6H A;  1UFH A;  4EVY A;  2B4B A;  3I9S A;  1Z4R A;  4XPK A;  3B8G A;  1S60 A;  4M85 A;  1YGH A;  3E0K A;  4KVO E;  2REF A;  4XNH C;  5I0C A;  3GYA A;  5C82 A;  2I79 A;  1S7K A;  4XNH B;  2ARH A;  5F47 A;  4KOT A;  3FIX A;  1BOB A;  3TTH A;  5DWN A;  1IB1 E;  1B6B A;  4NCZ A;  2B5G B;  2EUI A;  2Q0Y A;  4B5O A;  1QSR A;  4UBR A;  2AJ6 A;  4CRY B;  3EXN A;  3G3S A;  4QUS A;  5J8C A;  3TO9 A;  3R95 A;  3S6G A;  3D2M A;  3SXN A;  1L0C A;  4B5P B;  1YVO A;  2B3U A;  2D4O A;  4OAD A;  3C26 A;  1S7N A;  5FVJ A;  1KUV A;  4R9M A;  2VEZ A;  2ZW4 A;  2OZU A;  3OWC A;  1YRE A;  4KUA A;  4FD4 A;  2X7B A;  4R87 A;  2PSW A;  3N7Z A;  4KUB A;  1KZF A;  4GS4 A;  1ON0 A;  4OAE A;  2F5I A;  5H86 A;  3D8P A;  3FB3 A;  1FY7 A;  3FYN A;  2DXQ A;  4JXR A;  2HV2 A;  1S5K A;  3K9U A;  1MJA A;  1OZP A;  4KOS A;  2B4D B;  1SQH A;  2PDO A;  2FS5 A;  3KKW A;  2C27 A;  3FRM A;  3TT2 A;  1YX0 A;  2FXF A;  4ZBG A;  1QST A;  2FL4 A;  3GY9 A;  2CNM A;  3F5B A;  2OZH A;  1PUA A;  4BMH A;  1CJW A;  2BUE A;  4II9 A;  4UWJ A;  2HUZ A;  4NXY A;  2JDC A;  2PQ8 A;  4UA3 A;  4Y49 C;  4IF5 A;  2B5G A;  3DR8 A;  4PK3 A;  3TFY A;  4Y49 B;  4JXQ A;  1NE9 A;  2Z10 A;  4E8O A;  3LD2 A;  1RXT A;  2CNS A;  1YVK A;  1TIQ A;  4ONU A;  1XEB A;  1XIX A;  3SHP A;  4QBJ A;  4QC6 A;  1Z9U A;  4JLY A;  1GHE A;  2QML A;  4HNY B;  1IID A;  2R98 A;  3FNC A;  2Q4V A;  1IYK A;  2CY2 A;  3GKR A;  2GE3 A;  4KOU A;  4AVC A;  2VZY A;  2ZXV A;  3CXQ A;  1I21 A;  1YLE A;  1IYL A;  2Q04 A;  4LUA A;  4U9Z A;  2R8V A;  5DWM A;  2KCW A;  3IWG A;  1Y9K A;  3QAH A;  2ZW5 A;  4XPL A;  4L89 A;  4H89 A;  3MGD A;  1PU9 A;  3S6K A;  1XE4 A;  4F0Y A;  5J8F A;  5JQ4 A;  3F8K A;  4JD6 A;  5C88 A;  4AG9 A;  3F0A A;  2OZG A;  2Q44 A;  3R9F A;  4XPD C;  5EC4 A;  1M4D A;  3FXT A;  4XPD B;  3R9G A;  3DR6 A;  2A4N A;  1K4J A;  3BJ7 A;  2I00 A;  3TCV A;  3EFA A;  1I12 A;  2VZZ A;  1Y7R A;  1KUY A;  1KUX A;  4L8A A;  4KOX A;  2P6F A;  1S7L A;  1XMT A;  3WR7 A;  2REE A;  4H6Z A;  5EBV A;  3R9E A;  3G8W A;  2GIV A;  1CM0 A;  1XF8 A;  2WPX A;  4NEX A;  2BL1 A;  1VKC A;  3LOD A;  1VHS A;  2OB0 A;  5F48 A;  2VQY A;  3TO6 A;  2CNT A;  2ZPA A;  1RO5 A;  4MY0 A;  4QVT A;  3PP9 A;  2JDD A;  4R57 A;  3SXO A;  1NMT A;  4KOY A;  4KOV A;  1S3Z A;  2P0W A;  2PRB A;  1MK4 A;  4KVM E;  2ZW6 A;  4LX9 A;  4AVB A;  5E96 A;  3ZJ0 A;  2JEV A;  4DNC A;  3P2F A;  3JVN A;  2J8N A;  2AE6 A;  2GAN A;  4QB9 A;  2QIR A;  4X5K A;  3D3S A;  4PV6 A;  2ZW7 A;  1Q2Y A;  5JPH A;  4CAW A;  5HMN A;  4I49 A;  3D2P A;  3VWD A;  4RS2 A;  2WPW A;  4PK2 A;  1WK4 A;  4CAX A;  5KTA A;  4J3G A;  4UWI A;  2BSW A;  2PR1 A;  3VWE A;  2IL4 A;  1J4J A;  4R3K A;  3W91 A;  2G0B A;  4B5P A;  4CS0 B;  1R57 A;  4YGO A;  2EVN A;  1YR0 A;  5IV0 A;  1Y9W A;  2FT0 A;  3JUW A;  3TOB A;  4KLV A;  2VI7 A;  2FIW A;  2H5M A;  2Z11 A;  4MI4 A;  1MJB A;  3T9Y A;  2ATR A;  4PSW A;  4ORF A;  4CAV A;  4MY3 A;  4KOW A;  4AG7 A;  1V0C A;  4KVX A;  2OU2 A;  4U9Y A;  1S7F A;  4JWP A;  2B3V A;  5ISV A;  3FBU A;  2B4D A;  2BEI A;  2Q7B A;  2O28 A;  2R7H A;  2K5T A;  1QSM A;  3RYO A;  3PGP A;  4AB7 A;  2FIA A;  4OLL A;  4MJ8 A;  3S6F A;  4YFJ A;  2PC1 A;  4IUS A;  1Z4E A;  1QSO A;  4FD6 A;  2P6E A;  3I3G A;  4RI1 A;  5KTC A;  2VBQ A;  4CRZ B;  1Q2D A;  1WWZ A;  4U5Y A;  1M44 A;  4PSX A;  4HNX B;  4KOR A;  4FD5 A;  3BLN A;  4YRH A;  2Y0M A;  3UY5 A;  5HH1 A;  2QEC A;  2VXK A;  3DNS A;  3TE4 A;  2RC4 A;  5GCN A;  2Q4Y A;  3R96 A;  3IGR A;  3W6X A;  4AVA A;  5IB0 A;  2G3T A;  4E2A A;  3DSB A;  1IIC A;  4NSQ A;  4NF1 A;  3BJ8 A;  3EO4 A;  3EY5 A;  3CXP A;  2P6G A;  2JLM A;  1Q2C A;  1YK3 A;  5IX3 A;  4M3S A;  5CNP A;  2R1I A;  1B87 A;  1P0H A;  1QSN A;  5F46 A;  3EC4 A;  4F6A A;  4K30 A;  3V8I A;  2HQY A;  1M1D A;  4MHD A;  2J8R A;  3DDD A;  4HKF A;  4MBU A;  4HNW B;  2PR8 A;  4KZT A;  2FSR A;  3H4Q A;  3TOA A;  3TO7 A;  2B58 A;  1I1D A;  2J8M A;  1M4G A;  4FD7 A;  4H6U A;  2OH1 A;  1NSL A;  4KLW A;  4E0A A;  2FCK A;  2Z0Z A;  3NE7 A;  3T90 A;  3QB8 A;  1N71 A;  3W6S A;  3R1K A;  5F49 A;  3P2H A; 
#chains in the Genus database with same CATH topology
 5KTD A;  2ZED A;  3CXS A;  2FE7 A;  1Q7L A;  4JZ0 A;  3MRU A;  3PZJ A;  1P4N A;  4M6I A;  3VAR A;  3B3T A;  3N5F A;  4PPZ A;  1M4I A;  2HB6 A;  1U6M A;  2NMT A;  4A30 A;  2D4P A;  4BIN A;  5I4M A;  4PXC A;  4MHN A;  1BO4 A;  4R3L A;  2OOT A;  3V38 A;  3ZZI A;  2EWB A;  4JJX A;  5H84 A;  2AFZ A;  4HPS A;  2G3A A;  1XRY A;  4MRI A;  5A27 A;  1XOV A;  2GU2 A;  1LRZ A;  1MJ9 A;  4LQ6 A;  1UFH A;  3S6H A;  4EVY A;  2B4B A;  1QQ9 A;  3I9S A;  5K8P A;  1Z4R A;  1CPS A;  1M4L A;  2PJ9 A;  4XPK A;  5AG4 A;  3B8G A;  1HDU A;  1S60 A;  4OC0 A;  2V8H A;  3GLJ A;  4M85 A;  1YGH A;  2PJ1 A;  3E0K A;  2IJZ A;  4KVO E;  4UEZ A;  2REF A;  5AGE A;  4XNH C;  5I0C A;  1IY7 A;  1F57 A;  3GYA A;  5C82 A;  2DPT A;  2I79 A;  1S7K A;  4XNH B;  3B7I A;  2ARH A;  5F47 A;  5ELY A;  3B3V A;  4P45 A;  4KOT A;  5HVG A;  3FIX A;  3JTK A;  3WT4 A;  1BOB A;  3TTH A;  4IK2 A;  5DWN A;  1IB1 E;  1B6B A;  4NCZ A;  2B5G B;  2EUI A;  2Q0Y A;  4NFR A;  4B13 A;  4EFD A;  3IEH A;  1ZG8 A;  4B5O A;  1QSR A;  4UBR A;  3JRU A;  2AJ6 A;  4ZX9 A;  3EXN A;  4CRY B;  3D68 A;  3G3S A;  4F8Z A;  4QUS A;  5J8C A;  1XBU A;  3TO9 A;  3R95 A;  3RAM A;  3S6G A;  4MXU A;  3D2M A;  4A31 A;  3SXN A;  1L0C A;  4B5P B;  1YVO A;  2WYR A;  3GIU A;  2B3U A;  2Z3M A;  2D4O A;  4IAV A;  1JQG A;  4OAD A;  3C26 A;  1S7N A;  5FVJ A;  3BI1 A;  1ELL P;  1KUV A;  4NGN A;  1VHO A;  2WUU A;  4NGS A;  4R9M A;  1F2O A;  2VEZ A;  4P4F A;  2ZW4 A;  4OC1 A;  1YSJ A;  4MFJ A;  2OZU A;  4ZY0 A;  4NGQ A;  3OWC A;  4ZY2 A;  1YRE A;  3NA6 A;  4KSI A;  3V7Z A;  4KUA A;  4FD4 A;  3PB4 X;  2X7B A;  4R87 A;  2OR4 A;  4ZY1 A;  4R76 A;  3DLJ A;  2PSW A;  2BO9 A;  2CF4 A;  3N7Z A;  4LQG A;  4KUB A;  1KZF A;  3FH4 A;  3PRT A;  4GS4 A;  1ON0 A;  4OAE A;  3SJX A;  2POK A;  2EK8 A;  4C7H A;  2F5I A;  3A9L A;  1ELM P;  3D8P A;  3FB3 A;  5G1Z A;  5H86 A;  1FY7 A;  3FYN A;  5IB9 A;  4MFK A;  4P4D A;  2DXQ A;  4JXR A;  2HV2 A;  5BWA B;  5G21 A;  3WAB A;  2WZN A;  1TXR A;  4MHP A;  2ZOF A;  2FVG A;  1S5K A;  1XJO A;  3K9U A;  3KQZ A;  1AYE A;  1MJA A;  1OZP A;  4IHM A;  4KOS A;  3PBE A;  2B4D B;  1SQH A;  4P4J A;  2PDO A;  2FS5 A;  1EE3 P;  3KKW A;  2XEJ A;  4MFZ A;  8CPA A;  3SI2 A;  2PJ8 A;  4EWT A;  2C27 A;  4NGM A;  3FRM A;  3TT2 A;  2YNC A;  1YX0 A;  2FXF A;  3CT9 A;  3MN8 A;  1QST A;  4ZBG A;  2FL4 A;  2Z3K A;  4K3N A;  3KL9 A;  3GY9 A;  2CNM A;  3L2N A;  3NH4 A;  3F5B A;  2PJB A;  3FF3 A;  4OIW A;  1Y7E A;  1VIX A;  4BBH A;  4EME A;  3D7F A;  4ONW A;  3LMS A;  2OZH A;  4P6Y A;  3S9L A;  1PUA A;  4BMH A;  1ZG7 A;  4OC4 A;  4CGO A;  1CJW A;  2BUE A;  4H2K A;  4CYP A;  2YND A;  3SI1 A;  1AUG A;  2NYQ A;  1X10 A;  3IWE A;  4II9 A;  4B11 A;  4G1P A;  4FUU A;  4UWJ A;  2HUZ A;  3GB0 A;  4NXY A;  4MCR A;  2JDC A;  5HVH A;  2EK9 A;  2PQ8 A;  4UA3 A;  4Y49 C;  5EMI A;  4CYQ A;  5G20 A;  4IF5 A;  2WSA A;  2B5G A;  3DR8 A;  2PJ5 A;  4PK3 A;  3TFY A;  2C6P A;  4Y49 B;  1BAV A;  4JXQ A;  1NE9 A;  2Z10 A;  4E8O A;  3LD2 A;  1LOK A;  1RXT A;  2VL1 A;  1BPN A;  2CNS A;  5F49 A;  1YVK A;  4C2X A;  4CGP A;  3CPA A;  1TIQ A;  4ONU A;  1XEB A;  1XIX A;  3SHP A;  4DYO A;  4QC6 A;  3IJ3 A;  3SJG A;  4QBJ A;  2EBJ A;  1IOF A;  1Z9U A;  3LWU A;  4BD9 A;  4JLY A;  2NSM A;  3WC7 A;  3FEE A;  2PJ4 A;  1GHE A;  2QML A;  4M6G A;  4HNY B;  3CPX A;  4PXD A;  1IID A;  2R98 A;  1CP7 A;  3FNC A;  2JBK A;  3CZX A;  2Q4V A;  2YNE A;  2IQ6 A;  1IYK A;  2CY2 A;  3DGV A;  1BPM A;  2YGW A;  2C6G A;  3GKR A;  3BI0 A;  3H5Z A;  2GE3 A;  3H8E A;  4KOU A;  4MFL A;  4AVC A;  3IIB A;  5AG6 A;  2VZY A;  2ZXV A;  3CXQ A;  1I21 A;  3PB6 X;  4FWU A;  1YLE A;  1IYL A;  2Q04 A;  4O23 A;  3PBB A;  2PJA A;  4LUA A;  4OME A;  4AXV A;  4U9Z A;  2R8V A;  5DWM A;  3B3C A;  1RTQ A;  1YLO A;  2KCW A;  3IWG A;  4NGP A;  1Y9K A;  3T8W A;  4A38 A;  3QAH A;  2ZW5 A;  4M6H A;  1ZLH A;  4L89 A;  4XPL A;  4C2Y A;  1R3N A;  2XEI A;  2ODF A;  3MGD A;  4H89 A;  1PU9 A;  3S6K A;  3TC8 A;  1XE4 A;  4MCP A;  4UEE A;  2Z3O A;  4F0Y A;  1LAN A;  5J8F A;  5THW A;  5JQ4 A;  3F8K A;  3S9N A;  1Z8W A;  2PJ2 A;  4JD6 A;  5K8N A;  5LRG A;  5C88 A;  4AG9 A;  3F0A A;  2OZG A;  1HDQ A;  1Z8X A;  2PVW A;  2Q44 A;  1CBX A;  1R43 A;  3R9F A;  5LYD A;  4F9V A;  4XPD C;  1HEE A;  5EC4 A;  3KR5 A;  5D29 A;  1ZO0 A;  1M4D A;  3FXT A;  4XPD B;  3R9G A;  5K8M A;  3DR6 A;  2A4N A;  1K4J A;  1Z5R A;  3BJ7 A;  4UCP A;  4MHZ A;  2I00 A;  4CAE A;  1XFO A;  5AG5 A;  4YWY A;  3TCV A;  1CP6 A;  3EFA A;  1A2Z A;  1I12 A;  2VZZ A;  3IC1 A;  2AFX A;  1Y7R A;  4UIB A;  1H8L A;  1KUY A;  2GLJ A;  4Q7A A;  4UF4 A;  4R8F A;  1KUX A;  2DPS A;  4KOX A;  4L8A A;  2AFO A;  3PB9 X;  4MMO A;  2P6F A;  4PXE A;  1S7L A;  1Z8L A;  2RFH A;  5JH9 A;  1XMT A;  4NGT A;  2V8D A;  3H8G A;  3WR7 A;  5K8O A;  2AFS A;  4OC5 A;  3RNZ A;  2REE A;  4H6Z A;  4RN7 A;  4UFV A;  4ZYQ A;  5EBV A;  3R9E A;  4KSA A;  3G8W A;  2GIV A;  3SI0 A;  1CM0 A;  1TF8 A;  1Z8T A;  1XF8 A;  2WPX A;  2ZEF A;  2BL1 A;  3ISZ A;  4NEX A;  4OC2 A;  2XEG A;  1VKC A;  3LOD A;  1VHS A;  2OB0 A;  3PFO A;  5F48 A;  4R6T A;  4X3R A;  2VQY A;  3TX8 A;  2ZEL A;  3TO6 A;  2PIZ A;  2CNT A;  4MCS A;  2ZPA A;  1RO5 A;  2PCU A;  3KI9 A;  1CG2 A;  2I3C A;  4MY0 A;  4QVT A;  2HC9 A;  3IU1 A;  3PP9 A;  2JDD A;  5LYI A;  4R57 A;  3SXO A;  4RUH A;  1NMT A;  2DF5 A;  4W9Y A;  4KOY A;  4KOV A;  1S3Z A;  2P0W A;  2PRB A;  4P4B A;  1MK4 A;  4KVM E;  1LFW A;  2ZW6 A;  4LX9 A;  4A2Z A;  2QYV A;  3RBU A;  1QMU A;  3VAT A;  4NJQ A;  5A28 A;  2IMO A;  3K2K A;  3I1U A;  4WWV A;  4AVB A;  1TKF A;  2ZEG A;  3NFZ A;  5E96 A;  5G22 A;  3ZJ0 A;  2V8V A;  4R7M A;  5HVF A;  2CTB A;  2CIJ A;  2JEV A;  2BCO A;  4UCM A;  3P2F A;  4DNC A;  3JVN A;  2J8N A;  2AE6 A;  2GAN A;  3KQX A;  3FED A;  4QB9 A;  5CPA A;  2J9A A;  3IFE A;  3KAS A;  2QIR A;  1LCP A;  4X5K A;  3D3S A;  4PV6 A;  2ZW7 A;  1Q2Y A;  4NJR A;  5JPH A;  4YU9 A;  2JBJ A;  4CAW A;  5HMN A;  4I49 A;  4PQA A;  3D2P A;  4B12 A;  2O53 A;  4X8I A;  1JWQ A;  3K9T A;  5LRK A;  3VWD A;  4RS2 A;  2WPW A;  2XEF A;  4PK2 A;  3BHX A;  4A95 A;  5AG7 A;  3FEC A;  4FBE A;  1WK4 A;  1DTD A;  3WC6 A;  3NH8 A;  4MCQ A;  4CAX A;  2ZEO A;  3LAC A;  2QVP A;  5JM6 A;  3S9M A;  5KTA A;  2F7V A;  4J3G A;  2V8G A;  3D66 A;  2RB7 A;  4UWI A;  2AFU A;  4P10 A;  2ZEE A;  3D67 A;  1PCA A;  4P4E A;  2BSW A;  4MFP A;  2PR1 A;  1KWM A;  3VWE A;  2IL4 A;  1J4J A;  4R3K A;  3W91 A;  1BLL E;  2G0B A;  4B5P A;  4CS0 B;  3PEI A;  1R57 A;  1YME A;  4KSF A;  4YGO A;  4CGN A;  6CPA A;  2ZEP A;  3D7D A;  2EVN A;  1YR0 A;  5IV0 A;  1Y9W A;  3FX6 A;  2FT0 A;  3JUW A;  3TOB A;  1UWY A;  4KLV A;  2VI7 A;  2FIW A;  2H5M A;  4B6Z A;  2Z11 A;  4MI4 A;  1MJB A;  4TNU A;  3T9Y A;  2ATR A;  1CPX A;  4PSW A;  4ORF A;  2GFQ A;  4CAV A;  4MFQ A;  4GXH A;  4MY3 A;  2YNC C;  1X12 A;  3RO0 A;  5J1Q A;  3VH9 A;  4KOW A;  4A33 A;  3FVL A;  2PJ7 A;  2ZOG A;  1AMP A;  2PJ6 A;  2AFW A;  3KR4 A;  4AG7 A;  1V0C A;  1CX8 A;  1ZLI A;  4KVX A;  2OU2 A;  4U9Y A;  1S7F A;  2PRQ A;  5D8N A;  3RZA A;  2JEW A;  2B3V A;  4JWP A;  4X2T A;  4OKO A;  1Y0R A;  4B14 A;  5ISV A;  1TKH A;  3GUX A;  3FBU A;  2B4D A;  4CYO A;  2BEI A;  2Q7B A;  2O28 A;  3PFE A;  2EO8 A;  5CBM A;  4C2Z A;  2R7H A;  1TKJ A;  4UFX A;  4UEF A;  4OC3 A;  1LAP A;  4ZGY B;  2CXA A;  1IGB A;  1VGY A;  1DE4 C;  2ZEH A;  1XMB A;  2K5T A;  3HLP A;  1VHE A;  3KZW A;  1OBR A;  1QSM A;  4MHY A;  3RYO A;  1GYT A;  3PGP A;  4KS9 A;  3SJF A;  4AB7 A;  4B10 A;  3B3S A;  2FIA A;  4UIA A;  4OLL A;  4MJ8 A;  3S6F A;  4YFJ A;  2PC1 A;  4IUS A;  5HXD A;  1YW4 A;  1Z4E A;  1TF9 A;  1QSO A;  2PJ0 A;  4FD6 A;  2P6E A;  3D7H A;  3I3G A;  3KHZ A;  2PJ3 A;  3FMC A;  3NE8 A;  1YQE A;  4RI1 A;  1ZG9 A;  1FNO A;  2VBQ A;  5KTC A;  3WC5 A;  4CRZ B;  2DEA A;  1Q2D A;  1WWZ A;  1IOI A;  3D7G A;  1LAM A;  4U5Y A;  2V77 A;  1M44 A;  4PSX A;  4HNX B;  4KOR A;  5F09 A;  3PB8 X;  4FD5 A;  5JGF A;  4GM5 A;  3BLN A;  1PYT B;  4YRH A;  2Y0M A;  7CPA A;  3UY5 A;  5HH1 A;  2QEC A;  5LYF A;  2VXK A;  4DJL A;  3DNS A;  4CGM A;  3TE4 A;  2ZEN A;  2RC4 A;  3QAY A;  5GCN A;  2Q4Y A;  3R96 A;  1Y0Y A;  3IGR A;  3W6X A;  4AVA A;  3NH5 A;  4TWE A;  5IB0 A;  3BXM A;  1ARL A;  2Q4Z A;  4A32 A;  2G3T A;  3D4U A;  4E2A A;  2Z3N A;  3DSB A;  1IIC A;  4NSQ A;  3IU2 A;  4NF1 A;  4DUK A;  2AFM A;  4P4I A;  4JYW A;  3BJ8 A;  3EO4 A;  3HUV A;  5LYL A;  4PXB A;  4Q38 A;  1NSA A;  3EY5 A;  3CXP A;  2P6G A;  2JLM A;  2GRE A;  3H8F A;  1Q2C A;  1YK3 A;  2F8H A;  2CTC A;  2ANP A;  2PIY A;  4Q36 A;  5IX3 A;  4M3S A;  5CNP A;  4Z65 A;  2QJ8 A;  1B87 A;  2R1I A;  1P0H A;  1QSN A;  4CAF A;  5F46 A;  3EC4 A;  2GLF A;  4F6A A;  4K30 A;  4UCN A;  3V8I A;  2HQY A;  1M1D A;  4MHD A;  2PJC A;  3KGQ A;  2Q51 A;  2O4H A;  3IO1 A;  2J8R A;  2Z3L A;  3DDD A;  4HKF A;  2PVV A;  4CPA A;  3ISX A;  4OID A;  1ARM A;  1FT7 A;  4MBU A;  2C6C A;  4C68 A;  4HNW B;  1Z2L A;  2PR8 A;  4KZT A;  3B35 A;  4ZX8 A;  5LRJ A;  4C7I A;  2FSR A;  3H4Q A;  3PB7 X;  4F9U A;  2Z3P A;  3TOA A;  3B2Y A;  2B58 A;  3TO7 A;  4A39 A;  4F0X A;  3CDX A;  1I1D A;  2J8M A;  1M4G A;  4A94 A;  3IWW A;  3SJE A;  3QNV A;  4FD7 A;  4H6U A;  4WJB A;  4FAI A;  2OH1 A;  2ZEM A;  1NSL A;  4KLW A;  2PE3 A;  4ZI6 A;  4CGL A;  4CYN A;  4E0A A;  2G9D A;  2FCK A;  1YW6 A;  2C1C A;  2Z0Z A;  3NE7 A;  3B3W A;  3FJU A;  2ABZ A;  2BOA A;  3T90 A;  4A37 A;  3QB8 A;  2Q7S A;  1N71 A;  2Q43 A;  1IU8 A;  4UFW A;  4OP4 A;  3W6S A;  3R1K A;  1F2P A;  4P44 A;  4NGR A;  5DS0 A;  3P2H A;  3KHX A; 
#chains in the Genus database with same CATH homology
 5KTD A;  3CXS A;  2FE7 A;  3PZJ A;  1P4N A;  1M4I A;  1U6M A;  2NMT A;  4A30 A;  2D4P A;  4R3L A;  1BO4 A;  3ZZI A;  4JJX A;  5H84 A;  2G3A A;  5A27 A;  1LRZ A;  1MJ9 A;  3S6H A;  1UFH A;  4EVY A;  2B4B A;  3I9S A;  1Z4R A;  4XPK A;  5AG4 A;  3B8G A;  1S60 A;  4M85 A;  1YGH A;  3E0K A;  4KVO E;  5AGE A;  2REF A;  4XNH C;  5I0C A;  3GYA A;  5C82 A;  2DPT A;  2I79 A;  1S7K A;  4XNH B;  2ARH A;  5F47 A;  4KOT A;  3FIX A;  3JTK A;  1BOB A;  3TTH A;  5DWN A;  1IB1 E;  1B6B A;  4NCZ A;  2B5G B;  2EUI A;  2Q0Y A;  4B13 A;  4B5O A;  1QSR A;  4UBR A;  2AJ6 A;  4CRY B;  3EXN A;  3G3S A;  4QUS A;  5J8C A;  3TO9 A;  3R95 A;  3S6G A;  3D2M A;  4A31 A;  3SXN A;  1L0C A;  4B5P B;  1YVO A;  2B3U A;  2Z3M A;  2D4O A;  4OAD A;  3C26 A;  1S7N A;  5FVJ A;  1KUV A;  2WUU A;  4R9M A;  2VEZ A;  2ZW4 A;  4MFJ A;  2OZU A;  3OWC A;  1YRE A;  4KUA A;  4FD4 A;  2X7B A;  4R87 A;  2PSW A;  3N7Z A;  4KUB A;  1KZF A;  4GS4 A;  1ON0 A;  4OAE A;  4C7H A;  2F5I A;  3A9L A;  3D8P A;  3FB3 A;  5H86 A;  5G1Z A;  1FY7 A;  3FYN A;  4MFK A;  2DXQ A;  4JXR A;  2HV2 A;  5BWA B;  5G21 A;  1S5K A;  3K9U A;  1MJA A;  1OZP A;  4KOS A;  2B4D B;  1SQH A;  2PDO A;  2FS5 A;  3KKW A;  4MFZ A;  2C27 A;  3FRM A;  3TT2 A;  2YNC A;  1YX0 A;  2FXF A;  4ZBG A;  1QST A;  2FL4 A;  2Z3K A;  3GY9 A;  2CNM A;  3F5B A;  4BBH A;  2OZH A;  1PUA A;  4BMH A;  4CGO A;  1CJW A;  2BUE A;  4CYP A;  2YND A;  3IWE A;  4II9 A;  4B11 A;  4UWJ A;  2HUZ A;  4NXY A;  2JDC A;  2PQ8 A;  4UA3 A;  4CYQ A;  4Y49 C;  5G20 A;  4IF5 A;  2WSA A;  2B5G A;  3DR8 A;  4PK3 A;  3TFY A;  4Y49 B;  4JXQ A;  1NE9 A;  2Z10 A;  4E8O A;  3LD2 A;  1RXT A;  2CNS A;  1YVK A;  4C2X A;  1TIQ A;  4ONU A;  1XEB A;  1XIX A;  3SHP A;  4QBJ A;  4QC6 A;  1Z9U A;  4JLY A;  1GHE A;  2QML A;  4HNY B;  1IID A;  2R98 A;  3FNC A;  2Q4V A;  2YNE A;  1IYK A;  2CY2 A;  2YGW A;  3GKR A;  3H5Z A;  2GE3 A;  4KOU A;  4MFL A;  4AVC A;  5AG6 A;  2VZY A;  2ZXV A;  3CXQ A;  1I21 A;  1YLE A;  1IYL A;  2Q04 A;  4LUA A;  4U9Z A;  2R8V A;  5DWM A;  2KCW A;  3IWG A;  1Y9K A;  3QAH A;  2ZW5 A;  4XPL A;  4L89 A;  4C2Y A;  4H89 A;  3MGD A;  1PU9 A;  3S6K A;  1XE4 A;  2Z3O A;  4F0Y A;  5J8F A;  5JQ4 A;  3F8K A;  4JD6 A;  5C88 A;  4AG9 A;  3F0A A;  2OZG A;  2Q44 A;  3R9F A;  4XPD C;  5EC4 A;  1ZO0 A;  1M4D A;  3FXT A;  4XPD B;  3R9G A;  3DR6 A;  2A4N A;  1K4J A;  3BJ7 A;  4UCP A;  2I00 A;  4CAE A;  5AG5 A;  3TCV A;  3EFA A;  1I12 A;  2VZZ A;  1Y7R A;  1KUY A;  1KUX A;  2DPS A;  4KOX A;  4L8A A;  2P6F A;  1S7L A;  1XMT A;  3WR7 A;  2REE A;  4H6Z A;  4UFV A;  5EBV A;  3R9E A;  4KSA A;  3G8W A;  2GIV A;  1CM0 A;  4CGP A;  1XF8 A;  2WPX A;  4NEX A;  2BL1 A;  1VKC A;  3LOD A;  1VHS A;  2OB0 A;  5F48 A;  2VQY A;  3TO6 A;  2CNT A;  2ZPA A;  1RO5 A;  4MY0 A;  4QVT A;  3IU1 A;  3PP9 A;  2JDD A;  4R57 A;  3SXO A;  1NMT A;  4KOY A;  4KOV A;  1S3Z A;  2P0W A;  2PRB A;  1MK4 A;  4KVM E;  2ZW6 A;  4LX9 A;  4A2Z A;  5A28 A;  4AVB A;  5E96 A;  5G22 A;  3ZJ0 A;  2JEV A;  4DNC A;  4UCM A;  3P2F A;  3JVN A;  2J8N A;  2AE6 A;  2GAN A;  4QB9 A;  2QIR A;  4X5K A;  3D3S A;  4PV6 A;  2ZW7 A;  1Q2Y A;  5JPH A;  4CAW A;  5HMN A;  4I49 A;  4B12 A;  3D2P A;  3VWD A;  4RS2 A;  2WPW A;  4PK2 A;  4A95 A;  5AG7 A;  1WK4 A;  4CAX A;  5KTA A;  4J3G A;  4UWI A;  2BSW A;  4MFP A;  2PR1 A;  3VWE A;  2IL4 A;  1J4J A;  4R3K A;  3W91 A;  2G0B A;  4B5P A;  4CS0 B;  1R57 A;  4KSF A;  4YGO A;  4CGN A;  2EVN A;  1YR0 A;  5IV0 A;  1Y9W A;  2FT0 A;  3JUW A;  3TOB A;  4KLV A;  2VI7 A;  2FIW A;  2H5M A;  2Z11 A;  4MI4 A;  1MJB A;  3T9Y A;  2ATR A;  4PSW A;  4ORF A;  4CAV A;  4MFQ A;  4MY3 A;  2YNC C;  4A33 A;  4KOW A;  4AG7 A;  1V0C A;  4KVX A;  2OU2 A;  4U9Y A;  1S7F A;  4JWP A;  2B3V A;  4B14 A;  5ISV A;  3FBU A;  2B4D A;  4CYO A;  2BEI A;  2Q7B A;  2O28 A;  4C2Z A;  2R7H A;  4UFX A;  4ZGY B;  2CXA A;  2K5T A;  1QSM A;  3RYO A;  4B10 A;  4KS9 A;  3PGP A;  4AB7 A;  2FIA A;  4OLL A;  4MJ8 A;  3S6F A;  4YFJ A;  2PC1 A;  4IUS A;  1Z4E A;  1QSO A;  4FD6 A;  2P6E A;  3I3G A;  4RI1 A;  5KTC A;  2VBQ A;  4CRZ B;  1Q2D A;  1WWZ A;  4U5Y A;  1M44 A;  4PSX A;  4HNX B;  4KOR A;  4FD5 A;  3BLN A;  4YRH A;  2Y0M A;  3UY5 A;  5HH1 A;  2QEC A;  2VXK A;  3DNS A;  4CGM A;  3TE4 A;  2RC4 A;  5GCN A;  2Q4Y A;  3R96 A;  3IGR A;  3W6X A;  4AVA A;  5IB0 A;  4A32 A;  2G3T A;  4E2A A;  2Z3N A;  3DSB A;  1IIC A;  4NSQ A;  3IU2 A;  4NF1 A;  3BJ8 A;  3EO4 A;  4Q38 A;  3EY5 A;  3CXP A;  2P6G A;  2JLM A;  1Q2C A;  1YK3 A;  5IX3 A;  4Q36 A;  4M3S A;  5CNP A;  2R1I A;  1B87 A;  4CAF A;  1P0H A;  1QSN A;  5F46 A;  3EC4 A;  4F6A A;  4K30 A;  4UCN A;  3V8I A;  2HQY A;  1M1D A;  4MHD A;  2J8R A;  2Z3L A;  3DDD A;  4HKF A;  4MBU A;  4C68 A;  4HNW B;  2PR8 A;  4KZT A;  4C7I A;  2FSR A;  3H4Q A;  2Z3P A;  3TOA A;  3TO7 A;  2B58 A;  4F0X A;  1I1D A;  2J8M A;  1M4G A;  4FD7 A;  4H6U A;  2OH1 A;  1NSL A;  4KLW A;  4CGL A;  4CYN A;  4E0A A;  2FCK A;  2Z0Z A;  3NE7 A;  3T90 A;  3QB8 A;  1N71 A;  4UFW A;  3W6S A;  3R1K A;  5F49 A;  3P2H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...