4NT6A

Hla-c*0801 crystal structure
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
274
structure length
274
Chain Sequence
MSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARTAEQLRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, Cw-8 alpha chain
publication title The immunodominant Influenza A virus M1<58-66> CTL epitope exhibits degenerate class I MHC restriction in humans
pubmed doi rcsb
source organism Homo sapiens
total genus 73
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2013-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nt6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4nt6A01
4GW5A 4HF5H 4OCWL 4O02H 1NMAH 3FQXA 2AK1L 1U8IA 2YMXH 3MRQB 1Q1JH 5C0EA 1CGSL 1U8QB 4HUUA 5EC1B 4NM8H 3SDXB 5CEZE 1H9VA 3TFKA 1RUPL 3P0GB 3OAYK 3QDHA 4XNMA 5DJDB 5ICXB 4POYA 5JOPD 1KV3A 3TO4B 3H9HB 1A1MA 2XYCA 3CX2A 5I71C 5C0GB 3E3QE 4PJ8B 3LD8B 1G6RH 2NY0C 4ZAKD 4F2MB 4CVUA 1XF2A 1DQQA 4RAUB 1IAKA 5LBSL 1J0KA 4LRNH 1KTRL 4BZYA 3RWHA 4HAGA 3DX9A 3LN5B 4OTXL 4NNPH 3PDOA 2CKNA 1HSAB 2VLKD 4PREA 3QQNA 4GBXC 2MTPA 4RDQG 4JFQA 1H15A 3NH7L 2ZSWB 1RPQA 3MRBA 1G9MH 2R69L 1IGCH 1IT9L 4UDTB 5E6IC 3RBGA 4MXQA 2AV1A 1I7ZB 3ARBB 1MFDH 5IUSA 1B6DA 2EEBA 1F00I 5DHVB 2W38A 5EN2A 5D1ZA 1UYWL 1VGKA 1WBZA 1AD9A 2BX5A 3OXSA 2V2TA 3BPNB 4HLZH 1N26A 1MLBA 1RHHA 3P4LA 1C1EH 4X98B 3L3KA 2A2QT 3NABH 3M07A 1YEHL 4YHLH 3QH3A 4P4KC 3ZDYE 2CPCA 1OAKH 4OIIL 1DUZB 5ELIA 4E0RB 5ITFB 5I9QB 4PJFE 1MCFA 2EYTB 3EO0B 2CRMA 4KTYA 3QSKB 1LO3L 4N5ED 3L3DB 2IG2H 4Y4KA 3KJ4B 5F7MC 5IVNA 1IGMH 4P2RB 2FIKB 1OGTB 2YPVH 3WS6C 3TVMD 4KTDH 5C1MB 4UIKL 1WV7T 1NGWB 4P57B 2HLAB 1MIEH 4PGZA 5GJTL 4MHHI 4RCAA 3P9WB 1IARB 2NXYC 3S35H 2R1YA 2GYSA 3I75B 1FL6A 4NRZB 1ZV5A 5FHAL 2Q3AA 3WNMA 3WS3B 3QUXA 2MJWA 3FFCE 1WWCA 5KSVA 1MRDL 4UINL 3AS1A 3FONB 3W9EB 1DQJA 2OM5A 1A6VL 2FYYA 1WIUA 2NW3B 4FXLA 4S1QL 1QFWH 1JYXA 4UT9L 2AI0L 3MPCA 5C0CB 3CIQA 2R1XB 2CO7B 3C8HA 2ZCLH 2J7LA 4F7MA 4XP5H 1TJGL 2Y36L 4ZODA 3TZVC 5DR5H 2A83B 5LCVH 3AREB 3QDJA 5T3XH 2N4IA 5I6XB 2EDRA 3HG1B 3D69B 2EE9A 3KXFE 3A67L 3JV4A 3OGOE 1FV1B 2JCCB 1NJ9B 3EDEA 4HV8A 5DJXA 1IAOB 1X7QB 1M4KA 1DSFH 3QXUA 1RMFH 2E6QA 4P2QB 2O61B 1BVLA 1JRHH 2F54B 1IM3B 2OBGA 1F3DH 3V6FB 1DBAH 5IW1A 1O5DT 1HINH 1JHLL 3PNWB 4IRSA 1AKJA 3GI9H 3BJ91 4LIQH 5FOJA 5T5NG 4P2YA 3HPLA 3MNWA 3DUHA 3HC3L 1TVHB 4JFOA 4GRLB 2X6MA 2R9HC 1Q94A 5BXFB 5HD8C 2ARJQ 4K94L 2P5ED 1S5HB 3QJFB 2APVA 1QACA 4LLAA 1RJYB 1ZT7A 4KK8D 2OR7A 2HG5B 3QUMH 1HXMA 2B8OT 3HZKB 4DUVA 1FDLH 1FSKC 3VXQB 2GHWB 5CJBA 1YMMB 5K93A 4PRIA 2DMKA 2XG4A 4NKIL 4OQTH 4NKQB 3BP6A 4CKVX 3GO1L 4DKEH 4MNGB 2UZIH 1XF5A 4JDTH 3ALWA 4ZTOL 2OR9H 3UMTA 3QUYA 2G75A 2YK1H 4OLVH 3SGDI 3QXDA 1D5BB 4LCWA 2UY6A 3UX9B 2DLEA 4NO3B 1EHLH 1OQXA 4CNIB 4RGND 4NUGL 4Z7VE 1YQVH 4LCUA 4HBCL 3DRTB 2Y25A 5DQ9B 5HHQA 3S5LG 1IKFL 3OG4B 4NQCD 4ALAL 3K46A 4KTEH 3K8MA 4OB5H 4LLUA 2NY3B 4DVRL 3UCRA 5TFSL 3U30B 3MRMA 5FCUH 4XP4L 1GZQA 3INUL 1FH5L 5HVGB 4XMKL 3SY0A 3VGAB 1DBBL 3NVQA 4YDLC 4R7NB 4P9ML 1M1SA 3ULSA 2CMRL 4HUWA 1HHJA 4J6RL 3OWEA 5C0RL 4OI7A 1CLCA 3GSNH 5KSUA 2O5XL 3P0YH 3D85B 3ARVA 3MXWL 3L3JA 1F45A 1PJ9A 1S8DB 3QCTL 2NX5A 4L5FH 4YHNB 1RZKL 1YNLH 3EYUH 2AJYL 4I18C 2J8OA 5E2TH 3QHFH 2A6KB 3I85A 1N0LA 3O8XD 1IZJA 4YHOL 1UACH 5HHNA 2EDXA 1GH7A 1IQWL 2WNGA 3U6RA 1B4JL 2DKSA 3LKOB 5BV7C 3WKML 4JGJA 1A3RH 3IDXL 4NC1C 1KJ2H 3ZE2F 3I02A 2R0ZL 3KPRA 1E6JH 2QSTA 5EZIH 1KN2L 5F9JA 3LCYA 1DLHA 4QY8A 1OL0A 2APWA 5BCAA 1MI5D 3QYCA 4NJ9L 1SHMA 5GGTA 3BKCH 4ODWB 2VB5A 5BVJB 5FGSA 4OZ4A 3HFMH 5I8CA 3CMGA 2HWZH 5DD3H 3C6LD 5D7JB 5FYJL 2RB8A 3MRHA 1U58A 2J4WL 4QCIB 5DQDL 5F6IB 5KS9F 1N3NA 4G42B 2CR6A 3ARPA 4DEPB 1IEAA 1WSST 3HE7B 1AO7E 3JTSB 2CDFA 1JZ6A 4TVPH 4ZAKA 5C2BL 2EIEA 4X6CF 4XHJD 5D2NB 4ENED 5DWUL 3QIUB 4XXCC 5KTEH 5D8JL 1NDMA 2D03L 1Y18A 2AK4B 4U0RB 5ICYB 1EX0A 4DK6A 1R5WA 2Z9TA 2VLKA 3RWIB 5CJQH 1FIGH 3TO4D 5JIHA 1DEDA 5E95B 3KYKL 4OD2A 2JJVA 5FA3B 3WFDH 1MWAL 4MAYB 4RMVA 4BZ2H 4JANB 2RFXB 5T1KD 3SKUD 3QBTB 4H26A 4ZS6C 1BD2D 1R3LA 2VABB 4NPYA 3MODL 4L8DB 2CGRL 5EG6C 2IAMB 2VQUA 4O5LH 2YC1B 3P11L 4QHMB 2FJGB 3L5XL 3NGBB 5C7XL 2XWTB 4DKDC 1RZIB 1V5JA 4WV1C 2D7OA 5IT2H 1TPXC 2Q7NA 3ARBD 1FL3B 2XXCB 1F4XL 4PLKD 5DEZA 3DX8B 4AYFA 1T1WA 3F6IA 2AJZA 1WWWX 2OL3A 5E2VH 2ED7A 2FJFB 2ZUUA 3BQUC 4ORGA 3RHWK 1ORQA 1Q9OB 4J3OC 3KPNA 4R90H 1WFNA 2XN9B 4EDWL 4GMTH 1UH2A 3RWJA 1ZVYA 3W2DH 4N5EA 3RJQB 3BP5A 2FEEL 4Y4FC 1OW0C 1QSFA 1DL7L 2CXGA 3W9DB 3RVXD 4M7JL 3TVMA 3T0VA 1TQBB 5SWSD 3NTCH 1YEFH 4JKWA 4JLRA 1CZ8H 2OZ4H 3ARRA 4Y1AB 5BS0D 5SX4H 3MTRA 3U2SA 4ZUUB 5CBEA 1RZ8B 5E2UH 1VSCA 4S1RL 3MBXH 4WFGD 2ZP0T 4JDVA 5CIPH 5C09B 1CVRA 3FT4A 1QA9A 1ACYH 2KKQA 3GSRA 4NJAH 4E41E 1FVEB 3MO1A 4P5KA 4NC1E 5I16B 1I8MA 5DLML 3R1GL 1P7QD 3BESR 3PQYD 5L9DH 1QSVA 2XZAL 1A4KB 4RAVB 1L8JA 3NN8B 2GTWB 4XVUD 5T1LD 3E6FA 4A6YH 1CLYH 1QO3B 5FUZL 4IRJB 1JGDA 4ZFGL 1K8IB 1EEYA 2JIXA 4EQ2A 1IKNC 3RNQB 5ISZA 1TMCB 4OCXL 3MRGA 5C0CD 5GZNC 3S36X 4Z8FH 3O3DB 2F74A 4H5SA 5IBLD 1L0XA 1A2YA 3IDGB 3GIVA 3ARED 1CGWA 3KPQA 4ZUWA 4XRCB 5GRJL 1HKLL 4OCNC 4WU5A 4XWGL 3JUYA 2NY1D 2HTKD 3NCMA 5I1KH 2Z91A 3NA4A 2ATKA 3MLUH 5AYUH 4IM8A 1XGTB 5CS7A 5DD5L 3V4UL 4OLWH 2P5EA 5HDBF 4G8EB 5DQJA 2ICCA 3CZJA 3QNXA 5IQ7L 2WMPA 3U0WL 2R23B 3X12B 4YFLF 2F53D 2DF3A 1S7XB 1KIRA 1NH6A 1JNHB 4DZBB 3GSQB 4OZHF 1MWAB 4JPWL 5ADOH 1CGVA 25C8H 4WHYH 1P5UA 1CD8A 5DD1H 5E6ZA 1JGVL 2Z93B 1S9YB 3PWPD 5DMIH 2EIDA 3N85H 4JO3L 2OK0L 3CUPA 5DJAA 5E8PB 4LARL 3ARZA 1VA9A 5DO2C 2R56L 4B50A 5CBAB 1YMMD 3OKNB 4PJXB 4QF1A 4LU5H 3BH8A 3ARGC 3K4DA 4H25A 4FN0A 4EIGB 4F37F 3V52L 3ZT7A 4LCIL 1RK1A 5JW4R 5AG9A 5I75B 1N8ZA 3MRRB 1AQDB 2P5WB 4YGVB 5MI0B 1NPUA 1UWGH 1P9MC 4KK9D 5MEPB 4R26H 4XVTH 3OJVC 4EVNB 4WI3A 1AD0A 3M17B 3G5VA 3ZE0F 2YD7A 4NNXB 4WTZG 3QUKA 5GS2D 4POZD 4XBGB 1CLZH 2Y06L 2VR4A 3CX5K 1S7WA 2FEDD 2BSRA 5D7SL 1BFSA 5KAQF 5E7BA 5T1DH 2BXYA 3DO7B 1VEMA 1RURH 1TQCB 4FP8H 2GJ6E 3HMXA 4KROB 2DQFA 4F58L 1I1FA 2D0GA 5DEGA 3GMMB 5KZCD 1WGOA 2IPTH 3O8XA 1UM4L 4L9LB 1LNUA 1FPTH 3WKNA 5FO7B 2IPKA 5C8JA 3D85D 1KJVB 2Y5EA 4XPBL 1GVIA 1W72A 3FZUD 4JG1L 2CLZA 5D1QD 4HH9B 3MRPB 3EYOB 1TZHA 3QO0B 2V5RA 4K3GA 1G7PA 3P4MA 5IB4B 2MFNA 5J57B 2R29L 4LAQH 4Z77A 2BOCB 1Q9LA 1R3KB 1R6VA 1ZT1B 2DQJH 3OAYH 2G5BB 1MI5A 1WZ1H 1LP9F 2YA1A 2DM7A 3L1OH 5IP4A 1FYTB 5HPMA 4S1DD 2HFFA 2AXHA 3F7VA 4MDIA 5L2JA 4PJ8C 4J8RA 1C12B 2NTFB 2DQUL 1YEJH 2VQ1A 4K9EH 3ZKMD 5HGDA 3E8UL 4PJDB 3C6LA 3QDAA 3U46B 1E27B 3UTTB 1TFHA 3O2WH 2Q3ZA 4XMPL 5EC2A 3MJ8A 1VKXB 3HAEH 1B2WH 2H2SC 3JV5A 1CE1L 1BFTA 3CVIH 1J86A 5D96B 4HEME 5DVNA 5IW3A 4WU7B 4CVZA 2IPUG 1PG7H 1U92B 3BI9X 5D7JD 2GY5A 4PY8J 4NRYA 2VDKH 3X11A 1PKQA 2YD1A 3D3VE 3BZDA 2CR3A 3BPNC 3MOAL 4M7ZC 4DVBB 1F4WL 5TE4L 4YLQT 3SGEH 1IAIH 1A6WH 2FO4A 4F9PC 5T1KA 3CU7A 5TDNB 4BK5A 1BD2A 4XB7A 4JFXB 5IB1A 1KLUA 1MVUA 5I9QC 4IHOB 2VL5A 3VXSB 2Y7QB 1U8OA 3SE8L 4PJCA 2UZYB 3L95A 4Z7WE 5KSAB 1KEML 1X5AA 1YNTA 3D87B 3IDJA 3TBTB 3KJ4C 5GGSB 2X4PB 1GSMA 6FABL 4JZJA 1X5XA 3OGCB 2IAMD 5DYOA 5F7YC 1M7IB 3HKFA 3RUGF 3OKEB 4MXVF 1BQHA 2YZ1A 5C9KA 1J88A 4K23H 3JTTB 4XWOC 4JY4A 4PBVC 3VD9A 1WZKA 1A6PA 3MBEB 1RZJC 4MA8L 4I3SL 4QRPE 1U0QA 5HY9B 3U9UB 5SWSA 4AG4L 3MOBH 1ZT4B 1IBGL 3GNML 4I3GA 4GG6E 1TJHH 5BS0A 5F1IA 3L3HB 1LK3L 4ZFZA 1G9NL 3MJ7B 5LAXA 1MCCA 3FFDB 2IH3B 2P44B 4I0CC 4O4YL 4WO4B 1DANT 2IEPA 3BRFA 3MLRL 3TBWB 5I6XC 3BHBB 1BEYL 5LGJA 1OCWL 5ACLA 2NY4B 5DS8B 4AMKH 1KULA 3X3FH 2DLTA 1P7QA 3SDXE 2H26B 3DROB 3J8F7 4X6FA 3PQYA 4OLXH 1TCRA 4U1KA 2AS5M 1JFMA 4D3CL 4GRMA 4Q0XH 1B6UA 2DB8A 3LKNB 3V6ZA 4NRZA 5T1LA 2IBZY 4LQFL 3IDMA 1UKQA 4MSWB 4MAUH 4RGMC 1NC4B 3DXAE 4U1JB 5EBMB 1HQ4A 4YO0A 1CICA 2VLME 1U2CA 4DQOH 1CK0L 4I77H 2E27H 4LLWA 2NW3A 4UUJB 3ECBA 1LEIA 5AEAA 5E00B 4KVNL 5ESQA 1AIFB 4PP1D 5DI8A 2FD6H 4FMFA 1MCSA 1JV5A 3KLHC 1AGCA 3N1QC 4RFOL 2VDQH 1VGEH 4MNQB 4GRLC 1I3VA 3DMMB 2GSIB 1SJEB 3WJLA 1RIUH 2HN7A 3UPAA 3RVVC 2BNUB 1T5WB 1T7YA 1MH5A 4XNXH 3KPLB 1I8KB 1F3RB 4Y8AA 1JPFA 2JJTC 2X4RA 3PV6B 3UJTH 1GCFA 2NYYC 4Q2ZB 4GT7A 4Z7QF 4OBSA 5FYJD 4HUVA 4U6VL 2DQDH 2F53A 2DWDA 3V7AG 3IFLH 3S37L 3GM8A 4KKCD 2Q8AL 4FQCH 1KTDB 4MLIA 4YWGH 5FKAB 1QD0A 3GHBH 4HK0A 3A6CL 3R06B 4D0DA 3T2QA 4NP4H 4PJHF 1K9TA 3ZZ1A 4ETQA 4LLDB 3RY5A 3UROR 5HHMD 5IK3B 1MF2H 5LJYH 3PWPA 5MERA 4LBEA 3FQWA 3KYOA 2NZ9C 1KPRA 1UENA 1Z6JT 3FB8B 4NQUA 1EGJL 4J4PC 4MYWB 4P2RE 5TPWL 5ACZA 2NY3C 4GS7B 2BRQA 2PCPB 1KTLB 1ED3B 3VGAC 2DLHA 4QLRA 5D7IF 1XGPB 1QFUL 3NZ8B 3GB7B 4XC3H 3EJYD 4O2EB 4PP2A 3NCFB 3FQRA 3BAEH 1NGPH 3GKZA 1AI1H 3CSYA 4U1MB 3C2AL 3K3QA 3MV8D 5LKNA 5FGCB 3LKQB 1EMTL 4XCCL 4WCYL 5BMFH 5I1LA 1K8DA 2WLYA 1P7HL 5I1JL 1G84A 1BJ1J 4GKZA 4JFYB 4UV4H 1I85C 3V6OA 3PL6B 2DTSA 1DUYB 2ORBH 2ZWLT 4Z7NE 4J2XA 4Y19A 3T65A 2B39A 4PJAF 3UC0L 4B0MM 1KT2B 5D72H 3NMEA 1LE5A 3AS0A 1S9VB 3HG1E 2XY2A 2E9JA 4RGOL 1IGFL 2FWOB 5DMKB 2H3NB 4H20L 2JCCE 4X0KA 4UQ3B 3O45A 3EO1B 5J6GA 4P2QE 1CL7L 1A64A 2W60B 2F54E 4XCYA 2X40A 4UTBH 4YBLB 2HJLB 3TA3B 5D7LD 4ELMF 4FFZH 3H3PH 1R3JB 5JR1H 1YMHB 3S4SG 5D1QA 1S5IH 4LVOB 4ZYKA 4PGDA 2R2EA 2V17L 1FJ1A 2FX7L 3G6AB 3ZMRA 5JLZA 4RMWA 4U6HB 1GYAA 5D70L 5IOPA 4Z7UB 2A73B 1FFOB 1WEJH 4DUWA 3U82B 3ZSTA 3ZHDA 5F6IC 3L5WA 3RWGA 1JF1B 4ZPVA 3I6KA 1CFQA 2XACC 4LKXB 2I25N 4ZSOA 4PV8A 3HE7C 3SPVA 4U1HB 4N1CA 4OZIA 1I1YA 3W0WB 2LVEA 2DRUA 2FATH 1N5YL 3QIUC 1LE9B 3GMRB 1T20A 1KIPB 4U0RC 1A5FH 3UYRH 1XT5A 4GAGL 2A1WL 1HH9A 4TNWK 1S7UB 4JM4H 4KK5C 4M3JA 3D1MC 2WZPD 1UZ6F 4FG6D 3RZCD 3QRFM 4MA1B 4MNGE 2CLRA 4OLYH 2ITCB 4F7EA 4M5ZH 4MAYC 1AGBB 1A9EA 3IXAA 5I8KL 3X14A 2YA2A 1L0QA 4M1CC 3AMKA 1IGYB 4X4YB 4AEIL 1N59B 4QCIA 2R4SH 1FHGA 5JW4M 5FM8A 3ES6B 3TN0C 3TJEH 3OAUH 4U1GB 3HNVH 2G9HB 1CIUA 2GTZB 4XBEL 2JJWA 1CLOL 3RL1B 3DX6B 2H1PL 5GZOD 2IQ9L 1FO0H 3QDGD 4JG0L 4F8TA 4J3SA 1EIBA 4AEFA 3O11A 3LIZL 1ZLSH 1KCUH 3E6HA 4FQ1H 1RUQH 2PYFB 2QL1A 1OTUD 4G8FB 4JFHD 5CJ8A 3QI9D 3OKOB 1UXWB 2XTJB 5C3LD 5I1AA 1Z0NA 5HGAA 4U1IA 4JJHA 1JHTB 3GSXA 4YBQD 1MAKA 4HJJL 4KVCH 3QNYB 1TQBC 4PTTB 3G5XB 43CAA 3HC0A 4HKXB 5GHWL 4AH2B 4CGTA 2FBJH 1MJ7L 1HEZB 2ZUVA 5EU7C 3VI4E 5HDQH 4HWBL 1QRNB 1NUFA 4R97B 3TIEA 2G2RB 5B4MD 1WCBB 1MHCA 4ZUSB 4XAWH 2DQTL 4OGAD 5C92A 5F72S 1KBGL 4KKLC 1UA6L 2FJHA 5EIIB 1J18A 2IWGA 2DM4A 2AKRA 1KCRH 3KNBA 1A47A 3STLA 5CHNA 1D5IH 1NCDL 1UVQA 2VERN 3X3GH 2VRAA 1CFVL 4F3FA 1TJIH 4NKDB 4IRJC 5HGHB 1ZHNB 3CFIC 3JSSA 4EUPB 5HVFB 4RQQA 4TUKL 5C08D 2SEBB 3HR5A 5EUOA 3ZDYF 4U2ZA 3GSWA 5JA8B 2OL3H 4QEGA 2Q86A 4GW4B 3SQOL 4HLJA 1KB5B 3MROA 1FNGB 3O6KH 3HRZA 5C9JA 1HHKA 2VKXA 4EN3B 2R8SH 4PJFF 5F7KC 3VFNB 1UWXK 2WP3O 4YZFE 2CJUL 1GOFA 3N9GL 1HWHB 4J3TA 2OMBA 4F33B 1S7RA 2AK4E 3GGWB 3MLPA 4JRYB 3V0AC 3H9SB 5DHYB 4LHQB 3BZ4A 5DUMH 3V5HB 2WANA 1L4IA 5A16B 3KR3H 1HHGA 2NY5C 2NXZC 4FZEL 5DFVD 4FQLL 2V5MA 3H6JA 1BREA 4XT1C 3RNQA 2R0LL 2WWKT 4JO1H 4XTRD 5I1EL 1YNKH 2I07B 4B7LA 3EAKA 2LU7A 2YPLB 3GHEH 3BSZL 3GEWB 2NR6D 3QG6B 3D0VB 1EO7A 3DMMD 3G6JA 1NANH 3FQUA 4OI8A 4HIEA 2HJKB 1VFAB 4NQDD 4Y5YA 3EYVA 5IF0B 1MRFH 2HT3D 3SGKA 4MS8D 1AGDA 4L3ED 3KLAB 4WFHE 2Y6SC 1IM9B 4JFED 5DC0A 3T2NH 3Q3GB 4NFCA 3HS0A 4XAKD 2D7NA 3CDYA 3TBYB 4XCEA 2EH8L 2MQ0A 4AQOA 2EO9A 4Y4KC 5JW5A 2XN9E 1F4HA 1V7ML 5HHMA 3BPCA 2V9QA 1FZKB 3CFKA 3M45A 4YHPA 2VO5A 2A6IB 1QOKA 1DBKL 3OZ9L 5DT1H 3HE6D 3FTGA 4QXTB 3A6OA 3RY6A 5I75C 3QHZH 3VFRB 5JDSB 4HIJB 3VXPB 1M05B 5MI0C 3NZHL 2OTPA 3RI5K 1U3HA 1EXUB 4Y1AE 5L8JB 1MHEB 1BFVL 5EU7E 2QHLA 4JKLA 2AJVL 3VFSA 2Y23A 2B1AL 5GPRA 5HHXH 1LHZA 2WM0A 4HHAA 2ZKHL 5KOVC 3MV8A 4ZO6A 3OKNA 4PJXA 1X9QA 2O5ZL 1KENL 1J5OH 5F7DB 1AHWC 5T5FL 1TQCC 5I2IA 5K9KA 4KROC 1OLZA 5DFWH 3VU2A 3NCYS 2I9LA 5C0IA 3I2CL 4MQXC 4ZOEA 1G1YA 3G08B 1Z2KA 3HI6H 4JQXA 3O0RL 4GG8A 3TPUA 3RIAK 5EA0H 2L7UA 3MACL 1IC5L 1A7PL 4PG9B 2KPNA 1JE6A 4FQXD 1CFNA 5D4QA 1DZBA 5FIEA 2UUDK 3TC9A 1OPGH 1IEHA 4ODHL 2CRIA 3M17A 2V7HA 5CILL 2GK0B 5IESL 1PD6A 1T5XB 1QYGH 4M93B 4NZUL 5D7LA 1LDPL 4Z7VF 3IFPA 1FFPA 4M43H 4N0CD 4JR9L 4XCFL 3B43A 1UADC 3FT3A 1GJIA 3KS0H 2J8HA 1TVBA 1NSNL 1QG3A 1YJDC 1GOHA 4PBXA 2FZ3A 4KU1A 2W91A 3PWVB 2DQHL 3LS5H 4Z0BL 2NW2A 5DJ2B 3HZVB 3MCKB 3OSKA 1ONQB 3MNVA 2VAJA 4OM1H 2X9WA 3BN9C 1PG7W 3ZL4L 3MV11 3QO1B 2NY6B 4GKSB 2PTTA 3MRPA 1LD9B 4X99A 1F8TL 1JUFA 1OP5K 5IWLA 1X5FA 1FZOB 3EYFA 3NCYP 3F6LA 3QA3B 1UQSA 1CD0A 3OR6A 3ARXA 3RZCA 3ARWA 5CGYC 3UJIH 3W0WD 3QUYC 5FB8A 3UBXG 1NGYB 4UB0H 4G9FB 2EDDA 3THML 2BSTB 2G60H 1MFBH 1MSPA 3MGAA 1KELL 1JK8A 4PJDA 3UXFA 1E27A 5HI4C 4TNVF 1EJOH 4P49A 4AIOA 1WITA 2R15A 4LRIA 1WICA 3SOBL 4MNHB 4PB0H 2FDBP 2NLJA 4JFPB 4PLJC 1AJ7H 2PW2B 3QXAB 2ZUWA 5CKAA 1JMZA 5KSAC 2Q87A 4C4KO 3QDGA 4FTVB 3Q6FB 4XNUH 2P5WE 1YEGL 4HF5L 3FMGH 2AERT 4NQSB 4X7EC 3SDDD 4D9LL 1Q1JL 4PV9B 4WW2A 3QI9A 4PRNA 1JYNA 5LG1A 3B9AA 1H3GA 2OSLB 3LHPL 4ZOAA 5GQBA 5KVFL 3PJSB 2YOCA 4ZO7A 5E5UB 5GGRA 4TTGA 1N6QL 1F4YL 4R2GC 1CG9A 4DKFL 1K4CA 5A2LH 3MBEC 4LLVA 3CFJA 5IVZA 1G6RL 1QPXA 3AM8C 1NDGA 2HFTA 2NZIA 1A9BA 3O2VH 3V7AE 5IMLA 3AAZA 1QBBA 2XTJD 4I1NB 4NCC1 2OLDA 5EO1A 4RFEB 1MNUH 2AEWA 4WO4C 5IJKA 2VAAB 5DK0B 4MXWH 4N0RA 4PR5A 1W0WA 4M6ML 3WFCH 2NY4C 1RZ7H 5LGHL 5EORL 2J8UA 2C3VB 4YEFA 1D9KB 1VACB 2Z8WC 1T04B 5K9QI 3JTTA 2R0KH 1GPOL 4I9WD 1SJHA 3ULVC 3TIDA 3AVEA 3EGSB 2HRPH 3G5ZB 1RZFL 4QTHB 1FYTE 1MCLA 1PBYA 1BHGA 4PRPD 4HSQA 4YC2B 3DRQB 3L6FA 1BQSA 1GC1C 1M7DB 5C08A 5J8OA 5CKGA 1OAKL 2FR4B 3VXMB 1R5VB 3KG5A 5DHVH 5C07B 4KDWA 2I60L 3UTTE 4DCQA 3VFPB 5CEXA 3ZE1E 3TT3H 2EIBA 4KRPB 1P5VA 3RDTB 3TH4T 3MA9L 1XCTB 3VGFA 3LB6D 1QVOA 4QGYA 1Z5LB 3OKKA 3EJZD 4F7PA 4B7IA 3P30L 4YBHA 5EZLA 4DUXA 3QQ9C 3EDKA 4V3EB 2BNRE 3FO1A 4EN3D 3QG7H 1DQDH 4LCYB 1ZHLB 1BLNA 4LF3A 1IAMA 3RHWF 4ELKB 1XIWB 1T3FA 5GGVL 1IGTB 3CFDB 2AEQH 2KQNA 3LS4H 3TP4A 5TQ0L 4ONFH 1BWWA 2OJZL 5E1AA 2XNAB 3VFMA 1NCUA 4Z0XB 5DZLA 1RQ5A 4P4RA 3QIWD 4JRYD 3CLFH 1T0PB 3RWCA 3VRJB 3H9SD 5IIEB 4MGXA 4YDVB 4G80B 5GS3A 2XWJA 5JQHC 1V7NH 2OCFD 4OM0H 3VXSE 3WBDA 4NQDA 4RZCB 1RD6A 1ZEAH 2R0WH 4YDKH 1RZJH 4MS8A 4L3EA 2KL6A 1IMHC 4G8GB 4TN9A 4JFEA 5IFJA 2AJ3A 2EDWA 1XGQA 4WW1B 4YQXH 2CKBL 1UT9A 3MYJB 1ZLWK 2W0KA 4IDJH 3Q5TA 2EDNA 2QR0B 3DHMA 5E8NA 5TF1H 2FRGP 1GOGA 1YY9D 3VWJB 4QXUL 4Q2ZA 5FM4A 3QEHA 4QXWA 2VDMH 2ADJA 4FABH 2A9ML 4FQHA 5L8LB 2YBRA 5CEYA 5I0DA 4Y4HB 3HE6A 4LOUC 4MMZC 4L9DA 1YECL 3HPJB 1ZGLM 2WK2A 1ZSDA 1QEWB 1U3ZA 1KXTB 1AH1A 2BVEA 2RJMA 3ARFC 3B2UD 3GK8H 3R06A 5C3TA 3B8SA 2LTQB 5JZ7C 4JRXD 5INCB 5I1IL 4OCWH 4O51B 3PL6C 3QUZD 4CDHA 3FB5A 5JXEC 1CGSH 4HFWB 2X4QA 4LK4A 5B38B 1CD1B 3BDBA 2EDOA 4BFGA 4CADA 1RUPH 4ZS7L 4HKJB 5SWQA 1I75A 4UDUB 4P5TB 4PJ7B 4LASH 4AIXA 2IH1B 2HTLC 1S7SB 4MCYB 5H37G 2K7PA 1U8JB 2GFBB 2P8PA 3UYOD 3GB7A 4PGBB 5FUCC 3DUSB 1P4IL 5CSZB 1PYWB 1G7JA 5LBSH 2CDGB 3L3OB 3ULVE 4V2CB 1NC2D 4YBLC 5D2LB 3TA3C 5H2BB 4DKEL 4XPFL 4Z6AT 4OTXH 2CSPA 4FQXA 1P53A 4PJ5B 1EFQA 3NH7H 3UZEA 2RGSA 3EHBC 4P3CL 4YHML 4LVOC 4L8SB 3WDJA 5K59E 2OR9L 3UDWC 5E2WL 2R69H 3GMNB 4RISL 3TBVA 1IT9H 4OLVL 3JWDL 4MB4A 3TPKA 1S9XA 4MNQE 3IKCA 4LVNB 5MEND 1EAPA 3GUTA 1TLKA 2VIRA 1UYWH 3FN0L 4X5XB 4HK3N 4N0CA 2P45B 4DW2L 1G1CA 2CK2A 2E8YA 3D2UB 3PWNB 3EFFB 3RX7A 4OIIH 2PO6D 1FP5A 4MA1C 4HUXB 1C8PA 2PW1A 1T1YB 4PJ9B 4UBDD 1DN0A 1LO3H 3V7MA 1SQ2N 3WO4B 1FFOA 4P99A 4WFFE 4L5FL 4C56E 1RJLB 4UIKH 1CFSB 1F3JB 1JF1A 1YNLL 2EYSB 3WUWB 5D5MA 4HIHA 4QHNA 4U1GC 5GJTH 3UBXI 1MLCA 4FFEX 1QZ1A 4X4ZA 3MRNB 3VWKA 1NGZA 4DFHA 5IJVB 3BP7B 5EU5B 5FHAH 3W81A 3QIBB 3T4YB 4XBPA 1G7IB 3HCVA 2HT2C 1A3RL 1MRDH 5ECJE 4UINH 5EOCL 1QSFE 2A6JA 2DJ4A 2XQYK 2P8LB 3C5JA 1A6VH 3T8XB 4XHQA 5J3HD 4S1QH 2UY7A 4UT9H 2AI0H 3C60B 2FECI 4OJFH 3CLEL 2DYPA 5IMMB 3L9RB 3BD3A 3UPRB 2DIJA 5FGCE 1TJGH 2Y36H 2V9TA 5TH2A 1IILE 3SDDA 1UC6A 2CLVA 3N0PB 3PHOA 3RTQD 5FF6A 1QBLL 3BZFA 4XMLL 1U8LA 3L3GB 4YFDB 3KYNA 4R6UA 5GS0L 3A67H 5IV2B 3S8WA 4R97C 2BNQD 3GMOB 2YSSB 3S36H 5B3JE 2Q76B 3EOBA 1JHLH 1EGJA 2XWBA 3V5DA 4LLYA 1BVKB 5FUCE 4XC1L 4I8DA 4P3DB 4UT7L 2VTFA 1OQOA 5C0JB 5ISZE 1I7UA 3EYQC 3HC3H 3NA9L 3B3IA 3F7QA 1RFDH 4OCLC 4K94H 2E7BA 3LRSB 4HKZB 5DTFB 4H0GA 2XFXA 1PZ5B 1AR1D 3P40A 3T04D 3QULA 3BP4B 1PY4A 4OV5B 4Z7UE 2H2PC 4XI5D 1EO5A 1IL1B 3LQZA 1OOAA 3P73A 1EFXB 3BN3B 2AXFB 2QQKL 1UWXH 2GSGA 3HNTL 4PRPA 5FGBA 4J7RA 5J12B 2WBWB 3MJGX 5BJTA 5F3BA 3GO1H 4Z7WF 5INDA 2VDRL 4ZD3L 3LQAL 1FNEB 3B9EA 4KMLB 4X7DC 3C5SB 1ADQL 4ZTOH 2YPKB 5FYKE 4ZDHB 3UPCA 3CSBA 4YHIA 4WWID 5DJCA 4PLNC 4O2FB 4BKLA 2BC4A 4FA8A 4OGZA 1L7TL 5EFIA 4LAJH 4NUGH 5BRZD 4OQ1A 4HBCH 3T2PA 1QTYT 5AD0B 1U93A 1IKFH 2ICWJ 2EDTA 3NTCL 4GUPA 3ILQC 2VZOA 3G5YB 4EN3A 4JM2A 3U0TA 4WFED 5FDYA 4NIKB 3P4NA 3INUH 2GCYB 1FH5H 4XP4H 4GG6F 1YC8A 4M5YH 2FHFA 1DBBH 5GXBB 2CIIA 1EEZB 3H42L 4HGWB 3WHE1 4WI6A 4P9MH 3VXRB 1T0MB 2DM2A 1A21A 2CMRH 4J6RH 2R2BA 3QIWA 4JRYA 3SDAB 5C0RH 2O5XH 4AM0B 3S97C 2HLFC 2MWCA 3MXWH 5A16A 3SDXF 3SE3C 3DVFA 4FXKB 2BDNL 4P5MA 1QFOA 1MCKA 1XF4A 1ZHBB 4D9QE 3IU3B 1F90L 3QPQD 3QCTH 4DN3L 1JGLL 4A6YL 1RZKH 5J9PA 1CLYL 2ZOLB 5C0FA 2AJYH 5GIRB 3QEUA 2FNBA 1P6AB 4WWKB 5D7KD 3GM0A 1JFQH 3T4AB 1UH3A 1IQWH 5DFTA 1B4JH 1HYSD 3LKSA 4L4VD 3O3BB 3F5WA 5TGBB 4Z8FL 3FRPA 2HJKA 2EDEA 3HMWL 3WKMH 2ADGB 3WN5B 3IDXH 1QRNE 1MHHA 2R0ZH 1RZGB 4WDIA 1T03L 1KCSL 3PABA 4G8GD 4HGKC 1ZS8A 3RWFA 2AW2A 4R4ND 1HK6A 4PRHD 4X5LA 1NCCL 5IVXA 3OF6D 2VOTA 4BH7A 4G6ML 4NJ9H 3RWEB 3QFDA 4WNQB 5DD6A 3VWJD 1YC7A 4JRXA 4LCCA 5FO9B 1W0YT 2VITB 3QUZA 1BZ7B 4ZFOL 1NFIB 4Y4HD 3HUJB 5A2KH 5B8CB 5FYJH 3UTSB 3MOQA 2VYRE 1QLFA 2J4WH 3PHSA 5DQDH 4UU9A 1XZ0B 4TUOB 1MAJA 4QXGL 5IBUB 1SYVA 2UUDH 4PY7B 1SJVA 1XR9B 1FLRL 1D6VL 5C2BH 3KVQA 5DWUH 5ADOL 1OF2A 25C8L 5D8JH 4ZXBD 2BMKB 5IBTH 2D03H 2NY5H 1CICC 5E8EA 2IANB 4WUKL 1GAFL 1NC2A 4M93C 3RNKA 2D4DA 2EYRA 1AXIB 2XOTA 1BIIA 3CVHL 1UEMA 2PN5A 3L3IA 3VGBA 3IJYB 2BY2A 1REIA 3UYPA 1P6FA 1MWAH 5ESVA 3FN9A 2XPGB 5MENA 1JTPA 1FL5A 3WMSA 4B5EA 1VFBB 4N90E 5EZJB 3MODH 2CGRH 4F7TA 2I5YL 1L0YA 4APQB 5JNYA 4ZPTA 5FV1L 3P11H 4LL9A 3L5XH 1HE7A 3DUUA 2NY6C 5C7XH 2Y5TB 3K4AA 3MV7A 1HKFA 4L8BA 4WY7H 4YIQB 2YPLE 1OP5H 5TDOA 3TBSA 5AUMA 2OTUB 5K9JL 2WWMD 3H9YA 1F4XH 3WLWC 4HX1A 3KPSB 3IRZA 4XVTL 5A3ID 2KZ1B 2X4TB 2PO6A 1U42A 2MNUA 4PJHB 8FABA 5E99L 2LE9A 5SWZB 5A2IH 4Z7NF 5EBWA 4HIXL 3CPLB 4DTGL 2J1KA 4KRLB 4RNRA 5T1DL 4OUOA 3K80A 1LEKA 1DL7H 3D2UD 4F7CB 3HR6A 4MCZA 4KHTH 3QEQB 3JZ7A 4M7JH 3SKNA 3U4EB 5CEZL 2PTUA 5AWNL 4ODUB 1OT1A 4PJBA 3B2VL 1S9WA 2C7UA 2JCCF 5GS1A 3NCCB 5D7IB 1IEBA 1OP3K 5T3ZE 4PJ9D 4GKSA 5KG9A 3DX7B 5IQ9B 4S1RH 3JWOC 5IG7A 4YXLL 4R0LB 1ZHKB 5DJ8B 4NC2B 5TDPB 1U8NA 1CR9L 4MD5A 5TE6L 4PS4L 4EI5B 3BUYB 2GUOB 3MGOA 4XXDB 5DLMH 3ZSSA 3R1GH 4HWEL 3P77A 2DQJL 1JNLL 2DQEL 5J11B 1LVEA 2XZAH 4BH8A 4KJPC 3SDCB 4PJAB 2D0FA 3QIBD 4I0PD 3CDGA 1SM3L 5FUZH 2J5LB 3RTQA 3ZKND 4ZFGH 5T3XD 4HDIA 3PHQB 4YAQB 1ZLVK 4AEHH 2N56A 4P9HC 3GSUB 4HT1L 2VC2L 3PXJA 4OCXH 4XVSL 1YPZB 4MQSB 2YD3A 1Q0XL 2BNQA 3UTZB 3K81A 4BK4A 4HS6A 1B2WL 2W9DL 3ULUC 1MUJA 4ZFOB 4ELMB 3WLBA 4FFVC 2I24N 4IOIA 3I6GB 5EBLA 3VGHA 3Q1SL 3QEGL 5GRJH 2AABL 1HKLH 2BSED 4NHUA 3TO2A 4XWGH 1JJUA 2X09A 1D9KC 5FKPA 1A1NB 2E6JA 5KW9L 1OARL 1NGQL 3O3EA 1CTNA 1FORL 5D1QC 3TGXA 5CWSB 1F58L 1MFNA 4QOKA 4TNWF 5C6PB 5F70A 3QNZA 4NO2A 5D6CA 3V4UH 1GGTA 1T80A 4YC2C 4PJGF 3DVNA 5ID1A 3Q5YA 4G7VL 1II4E 5C0BA 5IQ7H 2OI9A 1B0GA 4PJEA 4L8CB 3PGCA 3OX8B 1FFQA 3CVHB 2B5IC 2WINA 4K71B 1N6UA 3MJ9L 3ROOB 3QDMA 1IVLA 4PRAA 5MP6L 4S1DC 2C1OB 7CGTA 1Q9WB 1WQVT 1MHPL 1WJ3A 1WFTA 4KRPC 1J8HD 3HZYB 4IMLB 1BFOB 4PYGA 3RDTC 2NY2D 1CE6B 4KJWC 4KKBC 1JGVH 4OZFA 3OKLB 4OF5A 1T0NB 1IGJA 4JO3H 4EI6A 3O9WB 1VACA 4BQ9A 1T04A 2W59A 2XT1B 4OCRH 3ARDB 5ILTL 2R56H 2ICEB 9CGTA 1HDMB 2XTLA 1DDHA 5KS9A 1JYVA 3R4DA 4M9PA 1G9EA 1G0DA 3DRQA 1J0ZA 1XIWC 5CZXD 3ETBF 2ED8A 3VXTA 1NUNB 3V52H 4G9FE 5F1NB 5BRZA 3IDUA 4LCIH 3OJDA 4X6CA 3WJJA 3VFUB 1JP5A 4AJ0A 3S88L 4LDOB 1T7VA 3IFNL 4WJ5B 3F58H 3MRIA 2DJUA 2Q7YA 3GIZL 3CFEA 2RBLA 2DL2A 3BVNB 2OJEA 4JY5L 1J7VR 4FTVE 3T0EB 1SEBB 1KPVB 3DV6B 5J06A 3OL2A 2JELL 2Y06H 2AXGB 2QEJA 2X7LB 3X3FL 2DD8L 4X4MA 3VXUD 3AU1B 4CN1A 3VXOB 3O4LB 1CGYA 1H8NA 3UJJH 4F58H 2R1WA 5FAAA 4TSBL 5DSCA 3BIKA 4P2OD 4KGLA 1UM4H 2GITA 3OR7A 3SDAD 2JK5A 5A2FA 4YZFF 3VFWA 2BVQB 1TIUA 4Y19E 4L4VA 1NFDA 5HI5C 1YEDA 3GMPA 2BVOB 1MFAL 1NCBL 4JG1H 5HVHB 5JHLL 1JZ3A 2OYPA 4ISVB 1E4KC 5I1HL 4BJLA 2EDQA 4KFZC 4G8GA 4KDTA 3JV6A 4L29B 4WWKD 5JUEL 3ULUE 3E1F1 3SKMB 4PRHA 4Y2DD 7FABL 1T83C 4P5TC 3OF6A 5ERWB 1HI6B 3BD5A 2E5EA 4NO0B 2EIZB 5EO9A 4BZ1L 4XX1G 3S3JA 1JGEB 2DQUH 4MMXC 5I1DA 4Y4HA 3E8UH 2Z31B 4NQVB 2Y1VA 5FA4A 5MHSE 3MFFB 4PJFB 4X9FA 3B5HA 4XMPH 3IFLL 3RKDC 1HIMH 3VXME 3BUTA 1CE1H 1KPUB 4ZFFA 2VLRD 1G6RA 5I74C 3V0VB 5C07E 3DLQR 4CVXA 4NOBA 1K5NB 4ZSOE 4ZXBA 1J05B 5DUBB 1WTLA 3S34L 4G6AC 1UXSA 2ITDB 1JWMB 3D48R 8CGTA 1OTTC 2VISB 1N4XL 1WC7B 3MOAH 5ENWB 3T0XA 1F4WH 2IH1A 1S7SA 5DDHA 5TE4H 5EU6D 1T2JA 4NCC2 2VXUL 4GKNA 4AL8L 5IMKB 1DFBL 2XXMB 2WSKA 1FE8L 3IB4A 4UZGA 4XH2B 2QJDA 3QWRD 4UQ2B 3SCMB 1I1AD 1AGEA 2GIYA 5CCKL 1IQDA 1MY7A 4HS3B 5CJXC 3GMNA 2P24A 5D6DC 3SE8H 2VXSL 5DRXB 1W0VA 3TWCL 5JW4N 4Y5VA 3RFZC 1JWUB 1KEMH 1HYRC 3WO4C 4ZNEA 4Y5YC 1DVFB 2GW5A 3SGKC 3VH8A 6FABH 3I3EA 4Y5XA 2B2XH 3KXFB 2ORBL 3DIFB 3CCHA 4APQD 2MHAB 4H1LB 1L7IL 3CDCA 3GSVA 3I50H 3MC0A 4MVBA 5ID0A 3MRJA 4S2SA 4KAQL 4NGHL 5I71B 4MA8H 5F9AC 3RVTD 4OZHA 4WHDA 3KDMB 5ESAA 3ROLA 5L6YH 4I3SH 1HXYA 3FO9A 4AG4H 4B41A 5C0NC 2VN4A 2ID5A 3WNKA 4NFDA 1J8KA 3TF7C 5SWZD 3GNMH 1IBGH 3ILPB 1FN4B 5FYJU 4W4NA 1LK3H 3C60C 4X5WB 3FB6B 5EO0B 4O4YH 1U3HC 3BO8B 5FK9B 3RIAF 3SO5A 1KCGC 3CX5J 4KGJA 3QEQD 4ODXB 4R7DA 3MLRH 4WIQA 4NKMA 1BEYH 4PPTA 1OCWH 3NIDE 3VDAA 1GL4B 3O2DL 5HYSA 1GZPA 1D5ZA 2V2WA 1A7NH 3P0VL 4D3CH 3MRKB 4LEOA 2EXWC 5JMOC 3STZB 4I0PA 5F7EH 4NBZB 4PJ7E 3KPPB 1BOYA 2WIIB 2CKBA 5DEFA 5IB2B 1CK0H 5AAWA 4V2BA 2APXA 5E56A 3L7EB 1RU9L 4RSVA 1SY6L 4KVNH 4HJ0C 4MJ4A 4LSTL 4BYHA 4E5XA 1NEZB 5D2LE 4RFOH 5EUOE 1HH6A 5SX5K 4QHKJ 4PJ5E 3GBLA 4Z7VB 5J56B 3H9ZA 3E2HB 3BXNA 3H0TB 1A6TB 2FL5A 3KS0J 3DHJA 1JNNL 5LGKA 2NXYB 1CQKA 4R4BA 1OY3B 4JKMA 4U6VH 5KN5B 4D0BB 4ACPA 3MXVL 1P4LB 4K3EL 5E8DH 3JBG7 3LVEA 2YD6A 3ZTJG 3S37H 1R5IA 3SJVD 5E24E 1ES0A 4FQJL 5EUKB 5IFAL 4GQ9L 2LABA 4PRDB 3R0MA 3A6CH 2IQAA 4FQQB 1F2XK 1J8HA 1LP9A 3RGVD 1Y0LA 1NFKA 2HFEB 4U6XB 3BEVA 1CT8A 5F21B 1XMWA 2DKUA 2IADB 4L3AA 4PD4K 2QSCL 5BV7L 4X7SL 5ANMA 1XGUB 1EGJH 1HCFX 5TPWH 5LQBL 4ZOCA 3IJSB 1W2KT 2VSDA 5F8RC 1FC2D 2GI7A 4W68A 4M7LL 2AXFA 4EOWH 4DOHB 1T21B 3MZGB 4BA8A 2J6EH 1QFUH 4NQED 5F3HA 3VE0A 3X13B 3IJHA 4L4TB 3ESUF 4YFEA 4OKDA 3RX8A 2HH0L 1F5WA 2P8MB 5E6YA 4LNRB 2HT4D 3OJ2C 4R8WL 1G7LA 1KTKE 3C2AH 1KCRL 1EMTH 4XCCH 3HB3C 4WCYH 4UIMB 5BZDB 1FFNB 4JFFD 5I1JH 3PUCA 5JIKA 1KB9J 3ZLQC 3X3GL 3X17A 4J23A 5JHDD 4WW2C 1QRKA 3PIQA 3W39B 3PWJB 3UC0H 1AXTL 5GISH 5B39G 2WBJB 1AO7B 1WBYA 3VXUA 1T7XA 4BFIB 1R3IL 2DQCH 3RVUD 3PP3K 5F8QC 3DETD 1ZWIB 2BVYA 3MLYL 1IGFH 1ROWA 2Z92A 3O6FD 3WN5C 4H20H 5CEZD 4P2OA 2A74B 3ZE1F 1T22B 2Q6WA 2L4OA 4EUPH 4YDJA 1KN4L 1HOCB 4KPHL 4YPJA 3QXWA 5E08L 3S3SA 2VZVA 5C0DB 3CZFA 2KZWA 3MV9B 5F9WB 1CDJA 3CH1A 3ALXA 4KXZH 3W11D 3GI8L 1ACZA 1I8LA 4QYOA 4PBWD 2V17H 2ILLA 3RUGA 2FX7H 1IC7L 1P2CA 2M8XA 1KLGB 5F6HJ 2X4SB 2ZG1A 1H3TA 5B8CC 4EDXA 3WHXB 1CDBA 4PP8C 4Y2DA 4MJIB 4A2MA 2B20A 3KGRA 1LO4L 2EDKA 2H8PB 2ADIA 4JDZB 4WUUE 4GLRH 4LHUG 1F6AA 3DO3A 1N5YH 3H2WA 4Z78B 3BH9B 3M8OL 1HN1A 1INEL 4PG2A 5GGRY 2DS4A 4KZEL 1CYGA 2A1WH 1RI8A 4M6NL 4X6BA 5GGUA 2E9BA 4YDLB 4XPAL 5DJZB 1A8JH 5JDJA 4KQ3L 2EZ0D 3P9LB 3VCLB 1QHOA 1HILB 1JWSB 4NO0D 2Q8BH 4JZOA 4DZ8B 2VLRA 4WHCA 2HKFL 4QRSA 1E4XI 2ZG3A 2AQ3A 2IALA 4W70A 5IHBA 5C0AA 2X1OA 5IM7B 2DQGH 3BW9B 4LLMA 4F80A 1TNMA 1JL8A 3C9NA 4P46B 3FRPG 3NFPA 1CDYA 4JHAL 1LO5A 1CFTA 4CU6A 4I18B 4CDGC 3H7BB 2E7LA 4XBEH 3QHTC 4DGIL 5JA9A 1Z9OA 3LEXA 5E03A 5EU6A 1CLOH 1CTOA 4YR6B 1GGUA 2H1PH 4Y16A 2IQ9H 4JG0H 4PGCB 1R24A 3LIZH 4Z95H 5BV7B 4S11A 4X6EB 3SBWA 1V8HA 1PLGH 4PB9L 3E0GA 3WEXA 5KANI 5HYJA 3B5GA 1WWAX 3QWRA 3MMEB 3U36A 3ARYA 3FT2A 1I1AA 1FZJB 3VXRE 4Z5RA 4N8VB 2YRZA 4N9GB 4NUJA 3FFCD 3T1FA 2XPGA 3IXTB 3QZWB 5MEOA 1BX2A 2XICA 1G7QA 3G6DL 4O2CB 4NZDA 4X83A 4XPTL 4YDIH 4E42B 3DTXA 4HJJH 2Z4QB 1KCLA 2WBKA 3VXNB 1ADQA 3RRQA 5GHWH 5DD0L 3D5OF 1OGAB 2ESVB 1JVKA 1P4BL 2C3XA 1MJ7H 3ULVF 2H9GB 2RIKA 4HWBH 3LKRA 5IB5A 1NBYA 1OAYH 1XH3B 4JZNA 2YEZA 3VG9B 4TOYL 2DQTH 2EKSA 3CSGA 3S9DB 5H35B 1KBGH 4LSDA 1BVZA 2X4TA 1UA6H 3RIFK 5K59F 2QTEA 3KXFD 4PJHA 2H41A 1WK0A 3O6ML 2C9AA 2OZ4A 4TTDC 4U1SA 4EI5C 2F8OA 5J11C 2UVEA 4HMDA 3IDNB 2FSEB 3G04B 3SDCC 1FNSL 2L7JA 1KEGH 1NCDH 2W0FB 3EUUA 5DZOA 5GRUL 4M43L 5CIPA 1TZIB 4ODSL 1LK2A 2NY0D 3KYMA 1NAMB 1CFVH 2GY7B 2NCMA 3OJMB 2J5LC 4TUKH 5D7IA 3LEYL 1FBIL 3FKUS 4YE4L 5C70A 3WE6B 2WQ8A 3HUJE 3SQOH 5IQ9A 3MX0A 3I9GH 4GBXD 3UTSE 3LEVL 2J8UE 4ZQKB 5CMAB 1EBAA 1I9IH 1BZ9B 2P7TB 5DHXB 4A6YA 1HHHA 2YUWA 4NNYB 5TDPA 3WSQL 4M9OA 5FFLA 2EDJA 1T1ZB 5E6ID 2VDPH 3T77B 2CJUH 3ET9F 3ZKQD 4JO4L 3N9GH 1R3HB 1WT5C 4NYLB 4NC0B 2VZUA 1BQLL 2Z35B 2NY7H 3C6SA 1SMAA 4PRBB 1PAMA 5IEKB 2IANE 5HGBB 4WHTB 4PJAA 3TYFA 5HHOA 1X44A 1UZ8A 3BWAB 3EZ8A 4JAMB 2RCSL 4FZEH 1MFBL 4IMKC 4OGXL 4P4KD 5DVMA 2W9LA 3PHQA 2X41A 1KIQA 4I5BB 4V1DA 2R0LH 4K71C 5HVWA 5I66A 3D18A 1DE4A 1BGXL 5I1EH 1HZHH 1GGCL 5KVMC 3WFHA 3BSZH 5DRWA 3L5IA 1U95A 1HQRA 5DRNB 1K85A 4IOSD 4IOFC 3O9WC 3FMGL 2UYLA 3SJVA 1NBZA 3KPSE 5HPOA 3ARDC 1PX3A 3RP1A 2HVKB 2GJ6B 2JJSC 2EH8H 2NXYD 3RGVA 4M62H 1V7MH 1CGUA 1XGRA 3BISA 2XQBL 4G6JL 3T1WA 32C2A 1DBKH 5B3JF 1XCQB 4OKVA 4MJ6A 3REVA 2FIRT 4YHZL 4IS6A 3JVGC 3DNKA 1NL0L 4QRRB 3NZHH 1JPGA 3VWKC 5HJ3A 1ZA3A 1BFOA 1X5ZA 3SGJC 1BFVH 2V2XB 1N7ML 3C2SA 4NQEA 2AJVH 2WUCL 1T0NA 1C5DA 3TZVD 2V9RA 2B1AH 5I8OL 1C7SA 2WIMA 2X4NB 5E4EB 2OTWB 2ZKHH 5CZKA 3Q6GL 1FG2A 2O5ZH 1KENH 1S7TB 4OAWB 4Q9RL 1VESA 5TE7L 4JFFA 2KUTA 4GAYB 1HSBB 1XF3A 3I2CH 4UNVA 3AB0B 5JHDA 3DBXB 3O0RH 1UJ3A 3UTQB 2LQRA 3UO1L 1MCEA 4OZFG 3V0WL 3MACH 1IC5H 1A7PH 4GRWE 2XIDA 4HIIB 1WAAE 3T0AA 3VJ6B 4JKKA 1YN7A 3CH8A 4OZGB 3PE9A 5HVHC 5E94B 3O6FA 3BKJL 1YPZE 3QJHA 4RA0C 2R9HD 3MREA 5CILH 5HD8D 5I76B 2BSSA 3QXVA 3RWDB 2E7HA 2DI9A 3D3VB 3RL2B 4NZUH 2AXGA 2X4UA 2YWZA 1LDPH 3S98A 1BOGB 1AO7D 3E3QA 3RPIB 1X5LA 4UV7L 4PY8I 4JR9H 3FL7A 4LSPL 4X6DB 1Q9KA 3MLTA 2VDOL 2BOBB 3K7UA 1PQZA 3NFNB 2K3TA 1NSNH 2CRYA 2BVTA 3OXRA 2Z31C 3DGGA 3O3AA 1H5BB 4RIRB 5LWYL 1I3RA 3LS4L 2DQHH 1BF8A 3OV6A 3S96A 3ZTNL 4Z0BH 4PGEB 2RAMA 3ZL4H 4WGVB 2HP4A 3MLXL 1QSZA 5D9SB 4U1LB 1N2RA 4K7FA 3FO2B 3VFTA 3A0OA 1A6ZA 5JPMA 1EDQA 1B90A 1F8TH 4NSKA 1V7NL 12E8L 2QADB 1ZA6A 1M71A 2A77L 1MCDA 3QUMB 3L5HA 1Z9LA 1X6NA 2BRRL 4HUMB 4H88H 4NO0A 3HAEA 2YRLA 4IDJL 4LGSB 3D25A 3THMH 1U8PA 1MJUL 2VDML 2E9IA 3MFFA 4PJFA 3VRIB 2AV7A 4F15B 1GGIL 4GG6B 5FDWA 1N6VA 3SOBH 3GKWL 3MR9A 3SCMC 4J1UA 2BVPB 3TT1L 4JFDB 4RMRA 3PXHA 4JM2C 3EOAB 4XPHL 4KUZL 5E8OA 3KWWA 4QRQA 4ZUVB 2ATPA 2VLLB 5IROC 4RX4A 1DVFC 1YEGH 3MRFB 2UWEA 1JWMA 1SYSA 1UM5L 3MJ9A 4JJ5B 4D9LH 1MQKL 2HMIC 1S7QB 3S5LB 2X4OB 1WC7A 3LHPH 2PXYB 4MX7A 5KVFH 2KDGA 4X7TB 3T0EE 5IHZA 1N6QH 3FFCA 1F4YH 1P7KB 4LASL 4DKFH 4E41D 3DXAB 1T4KB 1CGTA 4G9DA 1DN2A 1YN6A 4KI1A 3O4LE 1V3MA 1ZLUH 3N1MC 5F89A 4K55A 3MRDA 4MQ7B 2QHRL 3GSNB 4A2LA 1DJSA 5I8EA 1I7RB 1YY9C 3IDIA 5IEHB 2YD9A 4HW6A 4NRXB 4WEBL 1ORSA 4U3CA 4M6MH 3VDBA 1QLRA 1VB9A 4S0SD 3CFBB 4NHCL 2DQIL 5LGHH 5EORH 1YDPB 4LP4A 3Q48A 3WL9A 1WZMA 4L3CA 1YZZA 2DL9A 1IC1A 3GJFB 3WCYA 4GFTB 4ONGL 5B22A 1GPOH 4ONHB 3P3YA 4M7ZB 1OAQL 4PGJA 4HLZG 1NEUA 1RZFH 3AY4C 4OFPA 1KJ2B 5EU3A 5HI3C 5C6TL 4H8WL 3U7YH 4FFWC 5H94A 4QRTB 4MA3A 4S1SL 3GMQB 3VH8G 5KVDL 3BGAA 3GJEB 3QWOB 2ARJB 2I60H 2A38A 4GBXA 5D1XC 1MEXL 2HVJB 1D6EB 4U3HA 5SX5H 3N06B 3NIGE 3VW3L 2DMCA 3LV3A 4JPIB 3MA9H 1CXKA 1YEKH 1NAKL 3HNSL 5E6IA 5F7NC 3E2HC 3P4OA 3PP4L 5HYQA 1WLHA 5CP7A 4Z76B 2VLJB 4OT1L 4ZS6D 1Z3GL 4HMCA 2H32A 3P30H 3UTOA 4KK6C 3GSOA 5L2KB 3EDDA 2ZOKA 4IBLT 2BCKB 3BGMA 3QFJE 4JVPA 1KYOJ 3QQ3B 3IF1B 5CD3A 4LKCA 4R96A 5GGVH 4P4KA 1E28B 1JGUL 5TQ0H 2OJZH 3O81A 1X6LA 1KNOB 1U91A 3HHRB 3BQUD 4CMMB 2B4CC 3MUGA 4G8IB 5EU4B 5J7CC 2NQCA 5HYSG 2W65B 4OJFL 4M4PA 4X9BA 2A6DA 2CIKA 4Y4FD 1LEGB 1GRWA 4M61B 5ETUA 3OB0K 5F7LB 2FH8A 3WS6A 5KSBE 1VADB 2CKBH 4NO5B 1G7MB 3MRLA 2GK2A 3FCTB 2GJZB 4OUUA 3FAWA 1L6XA 4XZUA 4QXUH 5IGXL 3MQIA 1Y6MR 2A9MH 3MUHL 4UNUA 3MCG1 3S36L 2D31B 2D7TL 5E5MB 1JZ2A 1H0DB 5KAQG 4RGMB 1BIHA 1YECH 5GS1C 2DIBA 3DSFL 4JPVL 3D0LB 3WXVL 2GJ6D 4UAOC 4MB5A 3IGAB 1HHIA 4X4XA 1MJJB 1JMXA 4PLOB 5I1IH 2CH8A 5HYEA 3BJLA 2DLFL 1RFDL 3TZVA 2CDEB 4N0FB 1QFHA 1I7TB 1MCNA 1ZE3C 2EECA 5I1GL 3B9KB 4Q6YA 3IJSA 4ZS7H 2WBJC 3HZMA 1D5XA 1MCIA 5A2JH 1INDH 1CF8L 4JFZL 3TNNA 5GZND 1S7VA 5IVXE 2K1MA 3D39B 1QSEE 2F15A 2GAZB 1P4IH 5BO1L 4M1DH 3BT2H 3UAJC 3C87A 4NKOB 4CW1A 4MD0A 1UB6A 3IETA 4H0HB 3B83A 4XPFH 4C83B 5F9WC 3KPOA 4G59A 1MOEA 5BZDA 2LV4A 4TUJA 4P3CH 4YHMH 2X42A 1INQA 5E2WH 4RISH 5IW6B 2EE3A 3JWDH 3C8KB 1EV2E 3STBA 3W39A 3FQTB 4HGMA 1P1ZA 4KQ4L 4PJGB 4LSUL 1N64L 5F93C 3FN0H 4DW2H 3LN4A 2Z0BA 4LDEB 4NQXB 4CU8A 1O7SA 1A02N 2GT9A 4M5YL 4LHJB 1PFCA 3D3VD 4LMQI 5DJ0A 4U1NA 2X70A 3KLDA 2VE6B 1B0RA 4I2XA 1WIOA 3OHXB 3SE4A 2IBZX 3EDFA 5BZWB 5DMYA 3C5ZA 3PGDA 4BSWA 5DO2D 4TNVK 3MNZA 3LSOA 3ARGD 1LQVA 4P46C 3WHXA 3MV7E 1SY6A 3LAFA 5GSVA 2PTVA 1K4DA 1J0JA 1JFQL 3P9MA 2YD8A 5CINL 1QFPA 3IFOB 1I4FA 1A3LH 1DR9A 3Q5OA 1QR1A 1KG0A 2D4FA 4U7SA 4M8QA 4PTUB 4DOHE 4FQIL 4KHXL 5EOCH 5HHPA 1ZAGA 3BMWA 3IVKB 2X1PA 4L4TE 4DZ8A 4CU7A 2NNAB 4PJBE 3ULUF 2QSQA 3CLEH 5IM7A 1FO0A 1DEEA 3O41A 1LDSA 1PEWA 4G43B 4QRPD 1SBSL 3LKPA 3WIFB 5DRZA 1ZKAA 5MEQB 5FECB 1H3UA 4H0IA 3LY6A 1QBLH 4QT5B 4XMLH 3REWB 1Q72L 5IMOB 5GS0H 3BEWB 4LLQB 1YUHB 3MGTB 2QQLL 3VMNA 3FRUB 3TJHC 3VG9C 4E41A 4JO2L 1SVCP 1WFOA 3VFOB 5JORA 1ZGLA 5IBTL 2NY5L 3K2UH 4W4OC 1OM3L 4MDJB 1OWWA 4AIZB 4XC1H 3KAAA 4UT7H 4BSVB 4WI5A 3QQ4B 1T66C 2D7MA 1JN6B 5IR1B 3NA9H 3DXAD 3MV9E 4PJ8D 2VLMD 3IRPX 3DVGA 4U6YB 2AQ1A 1T1XB 1MCWM 2JKXA 5J6HB 1OSZA 3U0PB 4NDMB 2V7NA 3OKMA 4XCNB 2QKIA 4LPTA 4P23B 5KJRL 4NHUE 1A7OL 3TN0B 4MJIE 1RJZB 2Z8VC 5LVEA 2H2SD 5FV2A 2QQKH 5H35A 3HNTH 1FGVL 1MCPL 2EDFA 3QISA 4WY7L 5T1MB 43C9B 4XXCA 4QRUB 1BBJA 4QOKE 1A7QL 2VDRH 3SKOA 4ZD3H 4Q7DA 5F7FA 4CMHB 1U8MB 3T09A 3LQAH 2JB5L 1D5MB 2PYEB 5BW7A 1ADQH 5FOBA 5C0BE 1FAIL 4X8JA 4PJEE 5F88A 4HC1L 5JW4Q 4GXVH 3QDME 3OKDA 3RA7L 4HJGA 4HWZB 4JGUA 1K2DB 4I4WA 1L7TH 3CC5A 3CXDL 4KHTL 1RVFL 1BPVA 5KOMC 1ND0A 2FGWL 1J0YA 1UB5A 2ENYA 5DJYA 5E5RB 2BVUA 3WXWL 5JO5B 4JY6B 1RK0B 2H6PB 1LGVA 3AXLB 3DPBA 1G9MC 2HJFB 5DK2B 3FB7B 5IB3A 4HKBA 4WV1A 4Q6IA 5JOFB 4NWUH 4YUEL 3H42H 5EPMB 1N5AA 4P2RD 2C1PB 4PJIB 3TCLB 1T7WA 5E9DB 2Z35A 3DV4B 3BQUA 4NT6B 2ZCKL 1QFWI 3MCLL 1ZANH 5DC4B 3NIDF 1EPFA 4HMEA 1H3PL 2ICWB 4NWTH 5CD5C 2IBBA 2BDNH 1C08A 4XWOD 3DURB 4IIQB 4Y4FA 1F90H 1OW0A 4GW5B 4DN3H 4N8CL 1JGLH 3B6SA 2I27N 4Y5XC 3FQXB 1A6AA 1U8IB 3JV0A 5C0EB 1PEZA 4HUUB 4PJ7F 5F96L 3J7HA 3G9VA 3RY4A 4LMQE 4AEHL 1WBXA 4MA7L 1RIHL 4MVBC 1OSPL 4XNMB 4EBQL 4NN5C 4R9HA 5GGQH 1OGAE 1UM6L 5BOZG 2ESVE 4EQ3A 2VUOA 3HMWH 1JRHI 1A1MB 2YKLL 2XKNA 3VFVA 4D8PA 5D2LF 1T03H 5EUOF 4NN6B 1XF2B 1KCSH 4MD4A 5FO8A 5ACMA 1DQQB 1IAKB 4F57L 3RWHB 1YJDL 2VXQL 3HG1D 5E4EC 3HI1A 3BX7C 1SJXA 1NCCH 4GKOA 3WNLA 4G6MH 2O26U 3PDOB 3B8YA 4AENA 4PREB 1LMKA 1H15B 4P2QD 2F54D 3MRBB 2EXYC 3MLVL 3AB0C 3BZEA 1NFDE 1AP2A 3EOTL 5EWIL 2AV1B 2NXZB 4FOMA 2I9TA 1IKNA 1J9CT 4ZUTA 4QXGH 2VZTA 5H8DA 5EN2B 5D1ZB 1VGKB 1G7HA 1WBZB 1AD9B 4N0UA 1AXSA 1FLRH 3OXSB 1U8KA 3KLHD 1D6VH 2V2TB 2V2XA 3M1BA 2VJXA 1MLBB 1RHHB 3L3KB 4GRLD 1ZMYA 3QH3B 3QB7C 2R2HA 4WHYG 3TYGL 1I8IA 4WUKH 1GAFH 4AT6A 3CVHH 1LQSR 3F12A 3PWUB 4OV6F 3RVVD 3C08L 1A1OA 1EA9C 1UH4A 2AAVA 4OCRL 5EOTA 4OD3L 1F97A 2F5AL 3MA7A 1QQDA 2NYYD 1F4AA 2OQJA 4PFEA 1H5BC 1LO0L 4Y4KB 2YD2A 4Y0GA 3TNMA 3F7YA 2I5YH 1GIGH 4NQCA 1RJCA 4GMSH 5E94A 3F58L 2E9WA 3UTPE 2R1YB 3QAZB 2BY0A 2QADC 2AP2A 5K9JH 1FL6B 4LSQL 2DBLL 3QUXB 1ITCA 1KJMA 5KSVB 2YD4A 4YNYA 1YYML 2NZ9D 2VZ1A 5E99H 2JLLA 4J4PD 1DQJB 2FLRT 4HIXH 2FYYB 2NY3D 2ZUXA 4DTGH 1U9KA 4N8PA 2QQQA 1AHWB 3ARGA 5D71L 1F11A 2P43B 1Q38A 5ABDE 5A40E 3UJJL 1FFRA 2G5RA 4F7MB 1MRCL 5CEZH 1UCTA 5AWNH 1CFBA 4F15C 1I1RA 3B2VH 4ZNEE 1TETH 3MRCA 4W6YB 3QDJB 4BSJA 4Z7WA 2UZXB 4C57C 5C2UB 2EC8A 3JV4B 2DN7A 4QRRE 4YXLH 5DJXB 4WEUD 1P9MA 2MQCA 4QHLA 5GGTL 5FCSH 5ICZB 1CBVL 1BVLB 3ULVL 1CR9H 2WQRA 4R3SA 4OIBA 3FOMA 4MJ5A 5IW1B 3NACL 5TE6H 2F5BL 4PS4H 2PXYC 4IRSB 1LWRA 1AKJB 1GC1L 3JUZA 4HWEH 3OPZL 1JNLH 2DQEH 35C8L 4GJTB 5F9OH 5DA4A 4Q74A 5DURB 4QRPA 3HPLB 3LH2L 3VA2C 3EBAA 5EB9A 3HLAA 1SM3H 1AQKL 4JFOB 5HBBA 1Q94B 1J1XL 1NCTA 4LEXL 4HT1H 1ZT7B 2VC2H 3O6LH 2E6PA 2ZSVA 4XVSH 2OXHA 3A6BL 1Q0XH 1HIML 2W9DH 2VKWA 3HAEG 5FYLE 4PRIB 4OZGE 3MRQA 1U8QA 2YXFA 3Q1SH 3QEGH 1S7QA 1P84K 2AVGA 2AABH 5EC1A 3SDXA 2CUHA 3BP6B 2BNRB 5DJDA 1XF5B 5KW9H 5ICXA 1OARH 1TTUA 3TO4A 1NGQH 3H9HA 3O4OB 1RY7B 1FORH 5C0GA 1F58H 4EXPX 3HE7D 4PJ8A 3MUY1 3QUYB 4F2MA 2G75B 4OBRA 3QXDB 3QIUD 4LCWB 4G7VH 4RAUA 1X3DA 3VRLE 4X6DE 3ESVF 2AK4D 2OMNA 1XGYL 3MJ9H 5CLTA 3LN5A 4LCUB 1HSAA 3KJ6L 4KK5D 5MP6H 5HHQB 5IEHA 3S4SB 4LIQE 2D0HA 4LLUB 3CDFA 1MHPH 2ZSWA 3KHOA 3RPKA 4W6XB 3MRMB 1X4YA 4MAYD 1GZQB 2F9BT 4UDTA 5I18L 1I7ZA 3ARBA 3SY0B 2YUVA 1RAMA 4K7PX 5ADPL 1FG9C 1A14L 2B2XL 5DHVA 4TSCL 3ULSB 3TN0D 5ILTH 4HUWB 1HHJB 1PSKL 3I50L 5KSUB 4X98A 1MIML 1JZ5A 1Z9MA 1DP0A 1NUGA 3K1DA 4WW2F 4R2GB 3L3JB 4WFHD 4F9PA 4N1HB 4QRTA 1WFUA 5L6YL 3S88H 1NMBH 5IFHH 1DUZA 3GJEA 3IFNH 4E0RA 5ITFA 5SX4I 4W6WB 2EYTA 2XN9D 2RQ8A 1FC1A 3EO0A 3I6LE 5JIIA 3U6RB 4Y16C 4EEEA 3L3DA 3GIZH 3JWNC 4HQQL 1X4XA 4JFDE 1G0XA 3LMJL 3DI3B 2ZPKL 4JY5H 3OB0H 1MREH 4P2RA 2DDQL 1OGTA 2FIKA 3I02B 2EC9U 2BP3A 3KPRB 5F9JB 1NGWA 1DLHB 4P57A 1T2XA 2HLAA 2JELH 4QY8B 5HGGS 2FBOJ 1T2QH 2DD8H 4Y1AD 3RIFF 3ZYZA 1QLEH 1A7NL 5L88L 1MAML 3I75A 3HUJF 4JHBA 1JBJA 5K33A 3WS3A 4TSBH 2J8UF 4NOFA 5F7EL 5C09D 4DFIA 3MLSH 4OZ4B 4OF0A 5I8CB 4KKLD 3FONA 3W9EA 1HWGB 3VG0L 3GRWH 4HH8A 3NBNA 3MRHB 1U58B 2W9EL 3K2MC 4M03A 3WFBL 3GJFK 2H32H 1N3NB 5C0CA 2R1XA 1IEAB 1MFAH 1NCBH 2DM3A 5JHLH 5EDXA 1X5HA 2CDFB 2V5YA 4ZAKB 1U3JA 5I1HH 1I9JL 2A83A 3AREA 4IRJD 5JUEH 1UCBL 1Y18B 3D69A 3HG1A 3B9KC 4JRWA 7FABH 1DBML 5FYKL 5DMJB 1TZGH 2VLKB 1FV1A 2JCCA 1NJ9A 1IAOA 1X7QA 4KMTL 4BZ1H 4P2QA 2O61A 2F54A 1IM3A 4OD2B 2WP3T 5I30L 3V6FA 3PNWA 4C59B 4OCSL 4X7FC 5AAMA 4H26B 2EH7L 1R3LB 4NPYB 3GFUA 5E8DL 2BFVL 4D9RE 4KJQC 2Y07L 1F42A 3MLZL 1AGFB 1TVHA 4GRLA 4H8WC 5BXFA 4C56B 3QT2A 1S5HA 3S34H 3QJFA 1RJYA 4M4RA 1T1WB 4D0CB 2HG5A 2AJZB 3HZKA 1N4XH 3LPFA 1BM3H 4ORGB 1ORQB 3VXQA 2VLJE 3KPNB 1YMMA 2VXUH 5L2KE 4AL8H 1DFBH 3RWJB 3U1SH 4EOWL 1RIVH 1GHFH 1FE8H 1BAFH 1QSFB 4TVPE 4CN4A 3QCVL 2J6EL 5C0AE 4MNGA 3V4PL 3TVMB 4WI4A 1KJ3L 2Y6SD 4N68A 4JLRB 4BFEA 5CCKH 4X80L 2MPAL 3ARFB 2VXSH 3U2SB 3TWCH 3WDHA 3HRPA 5CBEB 5I1CL 1D5BA 2LU4A 1T89C 4EKXA 4NO3A 4JDVB 4Y4KD 4LVHC 4CNIA 3FT4B 3DRTA 3GSRB 5DQ9A 3MO1B 1JZ8A 4P5KB 4J4PA 1L7IH 1I8MB 5GISL 5HYJE 2P5WD 5L7XL 4GRWF 1FRGL 2DQCL 4MHHG 1WAAF 2OXGA 4KAQH 4NGHH 3ZYOA 1A0QH 1JPTL 5ITBH 1W72L 3E6FB 2VXTL 2VE6A 4HS8L 4R7NA 1YPZF 1JGDB 1EEYB 2JIXB 2A0LC 1QKZL 5ISZB 2C4XA 3D85A 3MRGB 3R8BB 2FH6A 1KB5L 1BJMA 2FECL 2F74B 4H5SB 5CAYB 1S8DA 4KROD 1I85A 1A2YB 4YHNA 4MQXD 3GIVB 3KPQB 4U33A 4ZUWB 2A6KA 3SE9L 4WU5B 3O2DH 3N50A 4Q97A 3BGFB 3P0VH 3IFOA 4HK3J 2Z91B 3LKOA 3QR2A 2ATKB 3U4AA 4PYHA 2ZCHL 4U49A 2P5EB 4K8RC 5DQJB 3D39E 3CAFA 3QNXB 4C55A 1RU9H 1SY6H 4LSTH 1C7TA 2NNAA 2DMBA 1FYTD 1KIRB 2Q8BL 3FQNB 4ODWA 1QBAA 5BVJA 2DQGL 2C26A 2PKDA 5D7JA 5DMGC 3UTTD 4P23C 4L1HA 4G42A 4JB9L 3CUPB 5DJAB 3SDYL 4KY1L 4QKXB 4JEGB 1JNNH 3BN9D 3HE7A 3SGEI 4MWFB 1IAII 4PJGE 2ICWI 3JTSA 4QF1B 2VDLL 5D2NA 3BH8B 3QIUA 5HHOE 4H25B 5D5MF 2AK4A 4Z95L 1NKOA 3MXVH 4CMHC 5ICYA 4K3EH 4RGNB 2BNRD 1NGXB 1PLGL 4JE4B 1RK1B 3RWIA 5T3ZL 4FQJH 4V1DE 5IFAH 2ZNXA 4GQ9H 4X7CC 1N8ZB 4ONOA 5CGYD 3QUYD 5FA3A 1M7XA 4MAYA 4JANA 4K9EC 2RFXA 3SGDH 4XNYL 4YDIL 1HNFA 5BV7H 2QSCH 4X7SH 4C58B 5HI4D 1MPAL 2VABA 3G5VB 3DJ9A 4L8DA 2IAMA 3QUKB 5LQBH 2YC1A 3U7WL 3V2AR 1LILA 4QHMA 2FJGA 1ZK9A 3VXSD 4C4KT 1S7WB 4M7LH 2XWTA 4PLJD 2OR8A 6CGTA 1OAYL 1RZIA 5KSAD 4LSSL 1FL3A 2PUQT 2DQFB 3DX8A 5F9DC 1I1FB 2HH0H 5DEGB 1D5MA 2FJFA 3O8XB 4GO6B 4R8WH 1KGCE 1Q9OA 1KCKA 3OMZA 3VGDA 1LNUB 2XN9A 3MYZA 3NPZB 3UBXB 5C8JB 2IPKB 2GEEA 2R2CA 5JOEA 2DLIA 4I13B 1KEGL 1RUKL 4IIQC 4R2GD 4NBYB 1W72B 3W9DA 2CLZB 3MBED 4QWWC 1CWVA 4QNPE 4GSDL 1G7PB 1NCWH 3P4MB 4P2CG 1AXTH 3ZYIA 4Z77B 3TFKC 2P48B 1Q9LB 4Y1AA 4ZUUA 1R3IH 1MI5B 1RZ8A 2ARWA 3MLYH 3I9GL 4WO4D 5HPMB 2HFFB 1NMCB 3F7VB 4IRZL 4MDIB 4QTIL 4RMSA 5L2JB 1I9IL 5C09A 4J8RB 4NN6C 1VEOA 3NIGF 2VQ1B 1FVEA 1KN4H 5HGDB 1IC4L 2VDPL 2NY4D 3C6LB 3FHAA 4KPHH 5I16A 5E08H 3Q0HA 5DJ6B 5HDLA 5IVOA 5JHDE 5CP3H 2LFGA 2XRAL 2NY7L 3ZKXB 3GI8H 2XA8L 2P1YA 5EC2B 3MJ8B 1UWEL 1A4KA 4RAVA 3NN8A 1F6LL 2GTWA 3ZYJA 3ULVD 4KRMB 1IC7H 3HN3A 1QO3A 4CVZB 4MXQC 4IRJA 1NC4D 1F13A 2GQHA 1K8IA 3CXHJ 1IRAY 3QRGL 4XGZB 1LO4H 1TMCA 4NRYB 4LVEA 3X11B 5D1ZC 1PKQB 1HZHL 2DI7A 1DQLL 3O3DA 4MNQD 5F44A 3M8OH 3PWLB 1INEH 3IDGA 2FO4B 2WW8A 4I0KA 4KZEH 4EXKA 5SV4A 5T1KB 4XRCA 4M6NH 4XPAH 3PV7A 1BD2B 4JM2F 4KQ3H 4R4FL 5IB1B 4KH2A 4WTWA 1KLUB 3EZJB 1MVUB 5KSBF 3QQ9D 2HKFH 1OAXL 2BJML 2VL5B 4OFDA 1XGTA 1U8OB 1NLDL 2BHZA 1CDIA 2PYEE 4PJCB 3L95B 4M62L 2IPUK 5T33L 1J10A 1YNTB 3IDJB 4G8EA 3RAJL 2DLGA 3JWOL 2N7BA 4JHAH 2HRLA 2R23A 3X12A 2D9CA 4QGTA 1PKOA 2X89D 4JZJB 3PGFL 5DYOB 1S7XA 4DGIH 1JNHA 2VXVL 1J0HA 4DZBA 3GSQA 1MWAA 1BQHB 3QAZC 4WFFD 4C56D 4JY4B 2KH2B 3QUXC 1RULL 2Z93A 1FVDB 1S9YA 2B0SL 4NZJA 1HNGA 4PB9H 1ODAA 3BKML 2DAVA 3PWUA 5SWSB 5GRVK 5E8PA 2VQTA 4PJIE 5CBAA 5E9DE 4PD4J 4P9HL 5BS0B 5F1IB 4ZFZB 1L9MA 4UT6L 5LAXB 5L0QB 3G6DH 4XPTH 1QSFD 4IDLA 1ZVHA 1V3JA 2FLBT 3ULUL 1C5CL 1JI1A 5IVXF 2AJXL 3B9DA 4OLUL 5DD0H 4LOUD 5LGJB 2UWEE 4HC1A 1P4BH 5GRWA 1PZUB 3MRRA 1P7QB 1AQDA 3ARFD 2P5WA 4YGVA 4BUGA 4X6FB 3PQYB 4K7PY 1TCRB 1F3DJ 2ZUSA 4U1KB 4GRMB 3JTCA 3V6ZB 5JZ7D 2DWEB 5MEPA 4TOYH 5T1LB 2APBA 4O9HH 3IDMB 4EVNA 3PL6D 5JXED 4KRNA 4OGYL 4J3WA 3NAAL 4NNXA 3I3BA 3O6MH 2PF6A 1HQ4B 4IRSC 4YO0B 1CICB 4XBGA 3ARSA 4LLWB 3ECBB 1LEIB 5FYLH 2IC2A 5SV3A 5ESQB 2M1KA 5DI8B 1FNSH 3IS1X 1AHWA 1JV5B 5GRUH 2O5YL 3DO7A 3IDYC 1AGCB 2HTLD 1I3GL 4ODSH 3D6GA 4WEMB 2RHEA 1KCVL 3GMMA 3U48A 1S78C 1CXLA 2JIXD 3LEYH 1FBIH 4L9LA 5J0BA 4YE4H 2ZUQB 3VFGL 3TA3D 3GBNL 4LPWA 5ISZD 2HN7B 2NY1B 5FO7A 1TVDA 3RVWC 1KJVA 3LEVH 1MH5B 4UOW1 3EHBD 3GBML 5ICZA 1ULVA 4HH9A 1JPFB 2X4RB 3EYOA 3WSQH 2BK8A 3QO0A 3RX5A 5IB4A 4HUVB 4JO4H 2BOCA 2XY1A 1R3KA 1ZT1A 3T3PE 1YYLL 2F53B 1BQLH 3CFCH 2DWDB 2G5BA 3O4OC 1FYTA 4H88L 3TLRA 5CGTA 2PR4H 3QWQB 1C12A 4HK0B 5E7FA 2NTFA 1YA5A 2RCSH 3U79A 2DTML 4D0DB 3PDGA 4OGXH 2DI8A 3TEUA 4ETQB 4KC3B 3U46A 5MERB 3PWPB 4LBEB 3UTTA 5FYKD 2DKMA 3FQWB 1BGXH 3KYOB 4KV5E 1KPRB 1GGCH 2M2DA 1F6FB 4FZ8L 1VKXA 2XV6B 5ACZB 1CXIA 1MVFA 4WU7A 4PJBF 4KJYB 3WDIA 1U92A 3N1FC 5DC9B 4KI5C 2BNRA 3PDDA 3S7GA 4PP2B 3FQRB 4LQ1A 3SE4C 3C5ZC 3H3KA 5BQ7B 4DVBA 4DGVL 3CSYB 5E0QA 5I1LB 2C4FT 1K8DB 2XQBH 4HPYL 4G6JH 2IFFL 2E7MA 4GKZB 4AQ1B 3QPXL 5TDNA 2HT2D 1URLA 5DUPH 3QXTA 2LVCA 4JFXA 1Z9SA 4YHZH 2VNCA 4Y19B 1NL0H 3T65B 4S0TD 4IHOA 4WVRA 3S4SA 3VXSA 4HWNA 2Y7QA 1LE5B 4D9QD 2APTA 3QDJE 4HCRL 2PETA 2X9YA 5EOCJ 5KSAA 4OCYL 3TBTA 3V8CA 1N7MH 5GGSA 2WUCH 2X4PA 2Z8RA 5I8OH 4X0KB 3O45B 1OTSC 3OGCA 5FM5M 5DA0B 5J6GB 4OSUL 5KZCB 4XCYB 3SKJL 1M7IA 1FNLA 3Q6GH 4Q9RH 3OKEA 4FXGB 1QRND 1SMOA 5TE7H 2IJ0C 5JPNB 5D1QB 3MBEA 4ZYKB 4PGDB 2R2EB 1CGXA 1FJ1B 5HY9A 3U9UA 5JLZB 5IOPB 3AM8A 3U7YL 3NCJL 3UO1H 2JJUA 3V0WH 1OAUL 1ZT4A 3K74B 3L5WB 1CU4L 2B5IB 3GJFH 3RWGB 3L3HA 4ZPVB 3I6KB 3MJ7A 1CFQB 2IH3A 3FFDA 4LPYA 4WO4A 1FAKT 4PV8B 3BE1L 3BKJH 4ZSOB 4K07A 3SPVB 4M48L 4OZIB 1I1YB 3EYQD 4NFBA 4ZAKC 4PJEF 1BQHG 3HI5L 2ADFL 1T20B 3TBWA 1YEKL 3BHBA 4PRIE 5DS8A 1IGIL 5L8KB 3RU8H 2XZCL 1HH9B 2H26A 3DROA 3KHQA 2H2PD 4UV7H 3BIBX 3LKNA 4LSPH 4OF3A 4YXHL 4Q58C 3BFOA 2CLRB 4WI2A 2VDOH 4X9HA 5KVEL 4F7EB 4MSWA 3FJTA 1QPPA 1A9EB 1NC4A 4U1JA 4Y88A 5EBMA 3IXAB 3X14B 5LWYH 4M7KH 4UUJA 3ZTNH 4LCWE 3NIFE 5E00A 1WZLA 1AIFA 1U8HB 5J1AB 3MLXH 1WWBX 4MNQA 4K3JL 1NANI 1UG9A 3OBAA 4XNZC 3DMMA 3BDXA 2GSIA 1SJEA 4N90D 12E8H 1I9RH 1ZVSB 3O11B 3E6HB 5C6WH 2A77H 2BY3A 4HFUL 3LQMA 2BRRH 2BNUA 1T5WA 1U6AL 5BW7C 3EFDL 4OLEA 3KPLA 2YPLD 3ILQD 4KI5E 3LZFL 2YS4A 1I8KA 4HXBH 4FQ2H 4I2XE 1UKSA 3PV6A 5I1AB 2NMSA 4N5EC 5HGAB 1MJUH 4U1IB 3GSXB 3TVMC 1GGIH 2X89A 2UVFA 5F1OB 43CAB 1IM9D 3HC0B 4ERSL 3GKWH 1KTDA 2JTDA 2NX5E 3TT1H 1CS6A 5FKAA 4DGYL 4XPHH 4LSVL 4Y8DC 1AGFA 1J1PL 3LPGA 4KUZH 2HLFD 4C56A 3TIEB 4Q6IC 4LLDA 1JIBA 5D93B 1MHCB 5IK3A 1UM5H 1MQKH 4D0CA 2FJHB 3FB8A 4L4JA 5T3ZD 1NFDF 1YY8B 1OAZL 1F2QA 2AKRB 1KLFA 3KPRE 4D2NA 2PCPA 4JGMA 1INDL 1KTLA 3KNBB 1ED3A 3STLB 5CHNB 1UJTA 1XAUA 1UVQB 1XGPA 3NZ8A 5I15H 3RZWA 1IZKA 4O2EA 5K9OB 2MSPA 3H3BC 4F3FB 1W8NA 5JW3L 4M1DL 3BT2L 3U83A 4RQQB 2QHRH 3HR5B 4U1MA 5EUOB 3ARFA 3LKQA 3GSWB 2Q86B 3MROB 4RRPA 4UTAL 3HRZB 5C9JB 1HHKB 4WEBH 1NBQA 4I48B 4JFYA 5I74B 5JOPE 3PL6A