4NT6A

Hla-c*0801 crystal structure
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
274
structure length
274
Chain Sequence
MSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARTAEQLRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The immunodominant Influenza A virus M1<58-66> CTL epitope exhibits degenerate class I MHC restriction in humans
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HLA class I histocompatibility antigen, Cw-8 alpha chain
total genus 73
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2013-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nt6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4nt6A01
3MZGB 3AREC 4DOHE 6FABL 5CJXC 4XAWL 5F7MC 2VLMD 4NP4H 1RULL 4JKLA 3UTTE 3VFSA 1UM5H 5SWQA 5HVHC 4HFWA 5I1GH 5E7BA 5FYJH 2AV1A 4DN4H 4JG1L 3BRFA 1X7QB 1BAFL 3IDNB 1WZ1H 1P7QA 5IVZA 5EZJB 1MCWW 5EPMA 2NY5H 3CJJA 3QG7H 1MELA 1Q1JL 2OK0H 3HUJB 3LIZL 1RZFL 2APVA 2Q8BL 3OR6B 4ERSL 1V3LA 3MA9L 2NR6C 1TZIB 5C0CB 2Z35A 4RFNB 5ESVA 3ISWA 5GZND 4HIEA 3RY5A 5ESQB 1TJGH 3KPLB 2VE6B 1NCBH 4WU7A 2BJML 1M6OA 2NY2D 3GIVA 1ACYH 1KN2L 5FKAA 4Q9QL 4I18B 3AU1A 4X99B 4LCCC 1KSRA 5EFIA 3LKRB 4L29B 1AR1C 4ELKA 4P5TB 5BS0A 1L7IL 4ZYKA 1AXIB 3O6FB 4FZEH 5LGJA 5GS1C 3AROA 2R9HC 5J06A 4OSUH 1CGWA 5CWSB 3BVNA 1X3DA 3AM8A 5GGTH 4RFOL 2VYRE 1U8HA 1H3GA 3ARDA 3T65A 5GPRA 1I4FB 5E4EC 4Y16B 5F1KC 3V95A 4EIGB 4ZUTB 5DA0B 1N2RB 1I1CA 1BGXH 1EVUA 2NXYC 4NRYA 5KVEL 2IH3B 3FONB 4HH9A 3D39E 1BZ7B 1LDPL 2ZKHH 4YHML 5GGQH 1WVZA 2X40A 2R0KH 2EYTA 4RFOH 1KB5A 4K94C 4GSDH 3ZT5A 3OPZL 4X6CE 3TCLA 1SYVA 4IJ3C 1GJIA 1AR1D 4TSBL 1Z0NA 1OSZA 2ENSA 5KG9A 5C3TA 1MHEA 1JTPA 3WNOA 1NSNL 2DQGL 3FN0H 5C86A 1T03H 4M62H 4ZFOA 5M94B 5CEZE 4X6BA 1YUHA 4K9EL 1P7KA 2YS4A 1KCVL 3OX8A 1MFDL 5F21B 2H3NA 5TQ0L 5F7UA 1K6QH 2Y9RT 1KIQB 3A6CH 3N50A 4R3SB 5ACZB 3TN0C 1WITA 4XP9L 3ESVF 3S88L 4CRPA 4Y5VC 5IJKA 1OVZA 3MUGA 4OFKA 3FQWB 5EOCH 3VXSA 2O5ZL 5L2JB 2EKSB 3QWRA 3FT4B 3NFNB 5CJQH 3MJ8A 5C0FA 4U1GC 4XTRD 2HTLD 2WSKA 1WISA 3DUSA 5IHUH 5ITBH 4PP2B 3OZ9H 4RMQA 3LQAC 1U6AL 1QBLL 4QNPF 2P44B 3CLEH 4OGZA 1JVKA 1S8DA 3QHTC 1TVBA 2YPLD 3LKQA 3IJYA 1P2CB 3FFCA 5DUPH 5D7KE 4GMTH 1JNHB 3JV4A 5C08A 4YQXH 4JKPH 1PSKL 2LU4A 5AAMA 4PJDA 4MXWL 5T5FH 3LB6C 3S96A 5FKPA 4WUUA 3IGAB 2BRRL 1UZ8B 4L8SB 2EO9A 5HVFB 3EHBD 4I13B 1JPFB 4Y2DC 3RBGA 4Z0BH 1CVRA 5IB1A 4GAGL 3HUJA 4HJ0C 4JJ5A 5CSGA 5GSVB 1SM3L 4TUKL 3UZEA 3TZVB 1TJIL 4HUWB 1UJ3B 3LPWA 1MUJB 3MNVB 3VXOB 3FOMB 3OKLB 4W6YB 4ELMF 3KS0H 1KLGB 3E6HA 2DQUL 2DJSA 2NX5D 4ZFFA 3L5IA 1RZJL 2AXJA 1FGNL 4OCXL 3VGFA 4Z76B 1JGLH 4JPKH 3C2SA 5F1IB 1FFRA 2GIYA 4P59L 4Z7UE 4NZTH 5D5MA 1MPAH 3GSQA 4P23C 3BPNC 5CBEB 1NGXB 3WUWB 1FVDA 2NLJA 1JGUH 4WI3A 3TLRA 4L5FL 3BT2H 4YPJA 2JCCB 1T5XA 4PB9H 2GJ6E 1JJUA 4GG8B 1A7QL 2R1YB 3U0WL 4Y4FA 3EHBC 2Z92A 3FRUA 3H0TB 2WMPA 4YH6A 2CRYA 3Q5YA 2WBJD 4YC2B 2IH1B 3ZKNC 3ZE1F 1KENL 2NW2A 4OGYL 1ZVHA 4XNYH 5I74B 2VDPL 3V6FA 5JQ6L 1T0PB 2BFVH 4IBLT 4M61A 3KYMB 2DWEA 4JGJA 3ZTNH 5A16B 4TSCH 1R3JA 4R96B 3RDTC 3FO2B 3O9WA 4LCIH 4LU5H 4UB0H 5EU5A 3TYGH 3DX8A 4OZHF 1MH5A 2F53D 3WS3A 3DXAE 4NHUE 2B1HL 4YHMH 1DUZA 3GBNL 1A7RH 4X4MA 4J6RL 1L7TL 1N64H 1IM3A 3KYOA 1G7PB 2KBGA 3REVB 1MQKH 4PJ7E 2OMBA 1L4IA 3RX8A 3BW9B 2A83B 4X4YB 3WHE1 1AE6H 1RIVL 2I9TA 1UZ6E 1MH5B 1OSPL 3PWJA 5SWZA 4X9HA 5IHZA 1MCOH 2DBJA 1U92A 4LHUB 2ZCLL 5A2FA 4HEME 3QFJD 4RISH 4D0BB 1CIUA 2HA1A 4PV9B 3BIKB 1UWXH 2OX5A 3MXVH 3WIIH 1S8DB 2VR4A 3QI9C 2X4UA 4X8XA 5SX4I 5C6TL 2O5XL 5F6IB 2G5RA 5TJWK 1MFCH 3CXHJ 4BZ2H 1TCMA 2CPCA 2EDDA 3HNTL 1VENA 5EORH 5CCKH 2ADJA 1DBJL 1LO5A 2X9YA 1K85A 1G7IA 3RHWF 4M4PA 1RZ8B 1U8NA 3RKDC 3PWPA 4RGNE 4DK3A 1EGJA 2XYCA 3RZCA 5J12B 3JUYA 4JB9H 3TVMB 2XZCH 4WO4A 5EO1A 5GGVL 3C5ZD 1A6ZA 2XWTA 2B2XL 1I1RA 2K3TA 2W0FA 1AHWA 3PIQB 2CSPA 3M45A 4OSUL 5HD8C 4IRSD 2Y6SC 3TH2T 2C3GA 3FMGH 4LMQE 1J0ZA 3NCJL 3HUJE 3NA4A 4LCWD 1G9NH 1RVFH 3QDGD 5I8CB 4GW1B 4HJGB 3U9PL 5CP7A 1S9YA 3VFGL 1GGTA 3QAZB 3WLBB 1XF2B 4YFDB 3WSQL 1Q94B 5CJOL 4QRRB 4XP1H 4MMZC 5FCSH 5TF1L 3B9VA 1IRAY 2AEQL 3MA9H 5GGTL 4Z7NE 3HMXH 1EHLL 1OHQA 4DCQB 5EC2A 3UPCA 3JVGC 2DQFB 2HFEB 2XN9E 4HFUH 4UDTB 5CD5C 4QF1A 3UTSE 4XBEL 3VH8B 5C08B 4J1UB 4C57C 5J8OA 4AQ1B 3QIBC 1BHGA 1MLCA 1PDKA 5C0DA 2H6PA 2R2EA 3S97C 1IKNC 2AERT 5SV3A 4G7YH 5I1IH 4UZGA 4NO0B 5IROC 1RZGB 1DANT 4ZFZA 2R2EB 3GMRA 4G7VH 5KJRL 4XNQA 3NIDE 4OZIB 1S5HB 2P43B 4ZOAA 5ANMA 1XR8B 3FO1A 2VUYA 1RIHL 1IM9B 4LP4A 4NQCD 1N0XH 1I85C 3GB7A 4PJAF 2XG5A 4ORGA 4P4KB 1I9IH 4HGWA 1VDGA 4QRSB 5FGSA 3MZTA 5C7XH 2EDEA 5HHOD 1JHLH 4Z7OF 5E4EB 4FHBD 4PGBA 4N5EA 4P4RA 4X7TB 2V9RA 1U3ZA 1U8MB 3IJHB 1Z9OA 2E27L 1WZLA 2YZ1A 1T5WA 4WJ5A 4FQ2L 4Z7UF 2H1PL 3D39A 3KJ4B 2GJJA 4XP4L 2F58L 4OZGA 3VU2A 4BUGA 5E9DB 5FM5O 3H42H 3MV9B 4G42A 1OARH 3IXTB 1JHTB 1S7QA 3HFMH 3LRSB 5MENA 2W91A 3SDAA 3BYYA 4I4WB 3T3ME 3D18B 3QPQC 5EA0H 5DD1L 1FE8H 1Q38A 1YJDC 3LN4A 2WIIA 2WBWB 4K3EL 3BIAX 4KI5E 2F5BL 5CZVL 5J6HB 2V7NA 1QPPA 1RK1A 3QWQB 3B4NA 4BKLA 4MQXD 3KYMA 3ECBA 2ATPB 4Q9RL 2OI9A 5TDNB 4NO2B 2OL3H 3FONA 4KXZH 1B6UA 1JGLL 1FZKB 1NDMA 5EUOF 4RWYL 3HE6B 2X4NB 1NC4A 3EYFB 3G6DL 1VACA 2AXFA 4JKMA 3QDJE 3DRQA 5FOBB 4C55A 3U4AA 4FQPA 3GMQA 3SCMD 4N1CA 4NWUH 4GG8A 3STLA 5KSBE 3O8XB 3KYKH 4Z5RB 3NIFE 2VH5L 2AQ2A 1J0YA 5D72H 3S34L 2A9NL 4R7NA 5IVXA 2EXYD 3HPJB 5IG7B 5IT2H 5EPMB 3EKCA 4PGZA 1IC4H 5DJ8B 5BZWA 4JFHE 1ORSA 5JUEL 5JORB 3UTTA 3NA9L 2OL3B 4NOFA 5DEFB 1RUPL 4G80B 3WS3B 5DZOA 4U2ZA 5HGBB 1B4JL 5IVZB 1EA9C 3DV6B 1F6AB 3DGCR 1MI5B 3QG6A 1JGVH 1IVLA 4NJAH 5M95B 1YYMH 4G80A 4OCXH 1FNLA 4UIKH 2IPKB 3RZCC 3RVWC 4Z6AT 1ORSB 3ORJA 5JORA 3NAAH 3L7EB 1T2XA 3VMOA 5IB5B 5FEBA 3U6RB 2HVJB 4P2OB 4I0KA 4KQ3H 8FABB 5IFHL 1YNTB 1T7YA 3HC3L 4WI4A 3ZYZA 3BE1L 5DGQA 5KSVB 1U3YA 2P8PB 3QEQB 3B9DA 4HW6A 3DLQR 3BWAB 5IROA 5JPMA 2D9QB 5CBAB 1IAKB 2OQJB 3IB4A 2R56H 3AB0B 1BVKB 3MA7A 2W0FB 3MRIA 3EYUL 1KLUA 3KWWA 1A6AA 1KEMH 5DMGD 4F7MA 4WO4B 4P4KA 3HZKB 1DEDA 5BCAA 5I19H 5JR1H 5EC1B 2FGWH 3MBED 4NO5B 3P4MA 1YQVL 1F11A 3EW3B 1BQSA 2V9QA 1UH4A 5DO2C 1JRHI 4NO3A 3QJFA 3MR9A 3CK0L 4NZJA 5JTWA 4LFHG 4Z7VF 1K4DB 2CO6B 4WNQB 2XZQL 5C9JA 4K23H 5ANME 4OCNC 1JL8A 1T7VA 1NMBH 5I76A 3FFDB 1BREA 3U1SH 2CDGA 3D2UA 2EDBA 4PGDA 4Y19A 3K74B 4QRQB 1RIHH 3MRKB 1P7QD 5DK2A 3T09A 1ZT4B 4I9WD 2IFFL 3MRBB 1LO0H 4PREA 5T3XL 2FIKA 2Y4SA 4KH2A 4WHTB 4FQJL 3FZUC 3WHE0 4CMHC 1I7ZB 1M7IB 1ITCA 3ULUL 1VADA 3OZ9L 4FXGB 1P7KB 4HZAA 1F8TH 4XH2A 2HLAB 3G5YA 3T0EC 3F12B 3U36B 5INDA 3EOAA 3F7YB 3G04A 3E2HC 4WW2A 4EDXA 1NSNH 2UV3A 2EDNA 2UWEF 2EH8H 4Q74A 3SDAD 1IGMH 2UYLA 5ICZA 3UZQA 4QRPE 1FO0L 4GG6A 1C12A 3IJYB 1QTYT 4Y7MA 3L3DB 4ORGB 3OKMB 1K6QL 3VWKD 3OJMB 5CJOH 4WUUB 3QIBD 1YEFL 3G5VB 3BKYH 4I0PB 2A6KA 3QQNA 3ZT6A 5DS8A 1X5FA 2B1AL 1RZGA 4ZFZB 2XICA 4PBVC 1V3KA 4LQ1A 1JTTA 3VRIB 1S9XB 4E41B 1SEQH 3FO1B 1NPUA 1CE6B 3DPBA 4YO0B 2DLFH 5IF0B 2GK0A 3ZE0E 3TT1H 4XPFL 4BH7B 1DBMH 3O2WH 2E9JA 4C59B 1TMCB 1ZT7B 1I8MB 2DQJH 3NCMA 1IEBA 3BP7A 4X83A 4LPXA 1AD0A 3T4AB 5FF6B 4Y5YB 1U42A 4I4WA 2CUIA 3S4SB 1YMHB 2IPUG 4LFHD 4M9PA 3QDJA 4MQTB 3UTTD 3GJFH 1QKZH 5J9PA 1R3IL 3GSUB 4LNRA 3DYPA 5JXED 3WEXB 4HUXB 5DRXB 5DJXA 5J89A 4JY6A 2ZUUA 2ZUVA 5CINH 2OP4L 1SY6H 3ZE2F 4P9HH 4F8QA 2VN7A 4D0DB 2ZOKA 1EHAA 4DFIA 3CZFB 2C4XA 4Q58C 3KPNA 5GS2H 4FMKA 1FRGL 2GT9A 4KVCL 3WIFB 3GSNA 2VXTH 1P9MA 3NZHH 1KEML 1MJJA 1XCTA 1SHMA 1YMMB 4Y2DB 3QQ9C 4OD2B 5HVGB 4B41A 4PV8A 5C2BL 4G6KL 3L9RB 4OB5H 3CNKA 4K7FA 2J1KA 4X7SL 3QPXH 3E6FB 3VG9B 1A9EB 4RZCB 3FCTA 4M7ZC 4XP5L 2Q7YA 1WBYB 3K4ZA 3ZYIA 3LAFA 1WBZB 1U95A 3BZ4A 4QTHB 3E2HB 5EB9A 4G6FB 4PRHB 1G7QA 2UWEA 1OF2B 2DAVA 4LCIL 2IQAA 1ZHLA 3MBXL 2DDQH 5A2KH 5AUMB 1CFBA 4R97C 4RZCA 2BSSA 2XG4A 2BVPB 3SOBL 3QI9B 2VDPH 4U3CA 1T6VN 4W81A 4GAFB 4YFLF 2W60A 4J8RA 3TO4C 4ENED 4FTVB 3TBYB 3RWDB 2I9TB 1A6PA 4N9GA 3U36A 5MEPA 4LLUA 3IRPX 5ESQA 4IMLA 3NFSL 4JQIL 4PRHD 1CGTA 5BQ7A 4UINL 3C08L 1IGYB 1WSST 3F5WB 3NZ8B 1X5KA 2NXZB 5F7KC 1TFHA 2VLRB 3NIGF 2DI8A 4ODVH 1IC7H 3IXAB 4G9FE 4GG6B 1OD7A 2OL3A 3Q6GH 5DR5L 1QFOA 3L1OH 4Z7UA 2DLEA 3OF6D 2AGJH 5IHZB 1V5JA 1BBDL 1CFVH 3L7EA 1CZ8H 3EFDL 4PDCE 1NLBL 4LARH 4ONHB 1C8PA 1XGTA 4AIOA 3GJFB 2D03H 4PRID 3GMOB 5ETUA 4JPIB 3ARGB 1CT8A 2PR4L 1MQKL 3PWLB 1U8LA 5T1LB 4Z7WB 5HBBA 3CC5A 2FHFA 1HILA 1NC2B 2ICES 4R8WL 3WKMH 3S9DB 4MXQD 5ELIA 1ROWA 1BBDH 1CFVL 3QUYD 5JOPE 5HJ3B 1KJ3L 4ZG1A 2A77H 1I8LA 1FGVL 2MQ0A 2HLFD 3K46A 5D8JH 3PWVB 1AJ7L 5I76B 1U8KB 1A14L 2BSTB 2HT3C 2XA8H 3GBLA 5T1LD 3GHEH 2AS5M 3RVUD 3BZFA 5J1AA 5DHVH 4PYGA 5D96B 1C1EH 5EU4B 2MSPA 1OP3K 4LNVA 3MRJA 3MBEB 2CDFA 3DBXB 4OLWH 5C0RL 3H3PH 3U7WH 1AO7D 1S5IH 1E4KA 4LGSB 2E9WA 2NZ9D 2YWYA 4CN6A 1B2WH 1FVDB 1LK3L 1G7MB 3VFUB 5B38A 5GGSY 4F9LC 3JWOH 4OV6F 2CIKB 1IGJB 5D1ZC 2VZ3A 3V4VL 1X5XA 2EC8A 4U7SA 1KELL 5GS1B 3DURB 4IHOA 3ZKSD 5IKCB 5DMKA 2ZUSA 4H5SB 3IDMB 5DWUH 4KDVA 1TCRB 4LSUH 5DUBA 5C0BA 3CFCH 1X6NA 2Q86A 4ZXBD 3IU3B 4QWWD 1HWHB 1SVZA 5EZLA 4FXKB 1U58A 3L3JB 4WTXA 1QR1A 4Y2OA 2HRPL 1FNEB 4F33B 3GNMH 4X6DF 1QBLH 3CSGA 3S8WA 2DQDH 3HC4L 4YDIH 3STLB 3PF2A 2WUCL 2ZCKL 1ZWIA 3TPUE 2V5MA 2CUHA 3D0LA 5GRXG 1YN7B 1NC2D 5D7JC 4J3WA 4XBEH 1X5JA 1JTOA 5DD3L 2N4IA 1I7RB 1Q9LB 4P5MA 3DRTA 2QV2A 3CXHK 4AT6B 4F7PA 3ZDZF 1OT2A 3L95B 2YRPA 2X4SB 4GMSL 1CF8H 3RVVC 2F58H 3UMTA 1ZLVK 3UTZA 2H45A 3T1FA 5LGJB 2IAMD 5IWLC 4PTTB 1UYWH 1N0XL 2VC2H 2DWDB 4E41A 1CR9H 4FZ8H 5GRJH 1ADQH 1GOHA 1RJZA 3TC9A 4ODTL 1HH9A 2YPVL 1TDQA 1F45A 2BVYA 2GYSA 3TNMB 4XPTH 1VERA 1WBXA 3Q3GA 4LL9A 1JHTA 3ULVC 2HT4C 3GI9H 3QR2A 2W65B 4CVZA 1JWMA 2VERN 3Q2CA 4CN1A 2ERJB 1Z9SA 3GKWH 1RPQA 4ZD3L 5IBTH 3GSNB 4XAKD 5DVKA 3ZTJH 1JK8A 1ZHBB 3OHXB 2A0LC 4WO4D 3TO2A 3D9AL 5DHXB 5HTSA 4D8PA 4PJGE 3ARUA 5FXCH 4G9DB 1JZ8A 4OLEA 4XRCB 3V8CA 4OI8A 3JWNC 4OJFL 1YEKH 5CP7B 3O6FD 1FG2B 3DROA 5IJVA 3QRGH 2VDRH 3MRQB 1AC0A 5ACMA 5FK9A 5TE4L 1KCGC 2EYTB 4JANB 4LSDA 5H35B 3HPJA 2EZ0D 5IG7A 1HSAA 2UY7A 3K7UA 2X89A 4JFFA 4U6XB 4KK9D 5C0AA 1YEEL 5KSBF 1FYHB 1O7VA 2I25N 4LBEB 5IMOB 3TBVA 3P3YA 1MCDA 3MMEA 5D6CB 3GMLB 4PRBA 4JM2F 3E2HA 3TJEL 3MGOA 3VCLA 1MRFH 3LHPL 3EO1B 1QA9B 4ISVA 5EBWA 2Q76A 5FUCE 1CFQB 2EC9U 2BNQE 1WBYA 4EJ1C 5DMIL 1LEGA 1RU9H 5DK3A 1GGYA 1S78C 1MFEH 1B90A 1FFPA 2XZAH 3BJ91 5IMOA 2WY3A 4K3HA 1U0QA 3SDDB 2MOVA 3QWRD 3VCLB 3RX5A 2C3WA 3QEUB 4NP4L 3IU3A 3NAAL 4KK9C 3PWLA 4C56E 5BOZG 4HIXL 5KSVA 2X4PB 1FIEA 3GJFA 4YBLC 3QUXB 3VFNA 5CKGA 3IDYC 2D3VA 4LGPB 3BISA 2YPLA 3PWUA 3QIUD 5KVDL 4LHUA 3MRCB 3BHBA 2ICCA 4TUJB 1URLA 4AH2B 3C8HA 1E4XH 4CL7A 1A1OA 5J12C 3RAJH 2D31B 2F74B 3PABA 4M6ML 1EEUA 5C09A 2DBLL 4XGZA 5FYLL 1A2YB 5JDSB 3TN0A 5F3HB 3MFFB 2A0LD 2X70A 4WEBH 3V6BR 3MGTA 5F96H 4NZRL 5D7LA 4U7KA 5I8CA 1CGXA 3P9MB 2C4FU 1A21A 4N0RA 4OCMC 3BPOC 1CBVL 3DVGB 4H1LG 4FP8L 4NYLB 4XX1E 5I75B 3T8XA 2CDGB 3D2UB 1AE6L 3MRFB 2FD6L 5EIVA 2F15A 3MLWL 1RZIA 3A0OA 3LKPB 3Q5TA 3ULVL 4NM8L 2ATKB 3GGWA 3CLFH 3AS3A 3CFEB 3TP4A 5E1AA 4BFIB 2HH0H 1JV5B 4YXLH 1KIPA 3O4OB 1W0VA 4M7LT 2F54D 4GG6F 3U1SL 2CQVA 1D6VH 4NDMB 2EYRB 1FIGH 3SY0A 5GZNC 4G9FB 3S36X 1TJHL 1BFOB 1QSVA 2DMBA 2FJHB 3WIHA 1LP9E 5E2VH 3S5LB 4EI5C 1D5ZB 2X41A 4MYWB 3BKCH 1OY3B 4P5KA 4HAGA 3CXDH 4OBSA 1A6WH 4U1KB 2CK2A 3RWHB 4PY8I 1JYXA 4IS6A 5FK9B 2UZIH 1PSKH 5DMYA 2PO6B 4QHNA 1YNLH 5JW4R 4JM2D 1SQ2N 5I8KL 3ROLA 3FO2A 3O9WB 3S96B 3VFRA 4EIZC 2YD5A 3CLEL 3UZVB 4ZXBC 4G6JL 4JN1L 3SDCC 2HFGH 3PDGA 2Q1EA 2FX8H 3A67L 4NPYB 1E28A 1N4XH 2Q86B 3TM6A 4OF8A 3V4VH 4DVBB 1IARB 4UT7H 1PAMA 1JGUL 2DQTH 3F7RA 4NJ9H 3RVTD 5BZDA 2BHYA 4A6YA 2JCCF 3DJ9A 2G2RB 2MCPL 3B6SA 1WTLA 4HUUA 4C83A 1GVIA 4CW1B 3OWEA 4O4YH 1BVZA 4I3GA 3RP1A 2NTSP 4HDIB 5JUEH 1V7ML 2EYSB 4L8CB 5E5UB 1A6VL 2B8OT 4LHQB 5I73C 2BOCB 1UGNA 4AK1A 1KTDA 3O11A 1JMZA 4CW1A 1UVQA 4F8TA 5MERB 5MHSE 5IVNA 4O5LL 5GJTH 1F90L 1KCLA 2P8PA 4TN9A 1FSKB 1E27A 3GMOA 3HMXL 3HN3A 3F8UB 3TH4T 1U8PA 1MNUL 2VIRA 2GI7A 1MFEL 2VL5A 2CKNA 3KPNB 3S35H 3CUPB 4HUXA 5FCUH 4BFGA 3WJLC 4QY8A 4OFIA 3RU8L 2AJVH 3LZFH 3ZO0A 3K8KA 1RSFA 1EHNA 4MAYC 2DDQL 5C0CD 3U4EA 5HHME 3MJ9H 4KI5D 4U31A 4KJPC 3MRGB 3N85H 4YHYB 1AP2B 5GGUB 3Q6GL 3QO1A 3RL2B 3UBXI 3DX8B 3VWJC 1AKJA 4DQOH 3NTCH 5FUCC 2V2TB 5J11B 5H94A 3NCFB 1QRNB 1N0LA 3QH3A 2CK0L 3WFBH 1NUFA 5MP6H 2XWBB 1YC7A 2CLVA 1A6UL 4GW5A 5IBLD 2HFTA 3SE8H 1KULA 2JIXB 3H9HB 1YEHL 1YEHH 1KFAH 3QUKB 3WFHA 5D6CA 3GEWB 3VFWB 4L4VD 1G7JB 3TO4D 4NSKB 3FN0L 5ADPL 2VE6A 1GOGA 4M1CD 4JQVA 3EJYC 3QUKA 3WFHB 3HAEH 3QP3A 4G6MH 3MV9D 2CXGA 2XOTA 3HMWL 4FOMA 3ARGD 4HAFA 5EBWB 2NXZD 3VG0H 4LGRB 2D0FA 1NEUA 1PX3A 3BPCB 4PJ9D 1PBYA 3TT3L 5IGXH 1LO4L 5I75C 1BBJB 1YYLH 3EO9L 1WLHA 4V1DD 5ID1B 3LSOB 5DJYB 3BH8B 4Y1AE 1IQWH 2CLRB 4OGXH 4QHUB 1WWBX 1KCKA 2X4TA 4P2OA 1A7OH 2Z31B 2CRMA 4NKMB 1KCUH 1KCSH 3UTPD 1DTUA 4UUJB 1NMCC 1CD1A 2XKNA 1CTNA 4XVUD 1QPXA 1DUYA 1A1OB 2W1NA 1E4KC 3SQOH 5EORL 3ZDXE 3MODH 4YK4C 3X3FL 4ZDHB 1FFNB 3ARBD 2CLRA 1XAUA 2BVTA 5CJ8A 3GHBH 4YBHA 5DJZA 3LN5A 1NFDF 2BJMH 3EOTL 2J6EA 5DUMH 1ZT4A 5JZ7C 5TF1H 2D9CA 1GGIL 3UYOD 4BH8B 5JHDA 3L3KA 1HQRA 12E8L 1CLCA 3R8BB 2G5BA 1LO2H 3SEPA 5BV7L 4F37F 4MJ6B 5JLZA 5HI5D 1FH5L 4C56D 1JWUB 1UJ3C 1G9NL 3P0YL 2QKIA 1AGEB 1AQDB 1IAIL 1IAIM 1KN4H 1RUAL 3GM8A 4DGYH 3V5KA 1KIPB 1VACB 1FC2D 4HKZA 1YEJL 3ZDYE 5E6ID 1MWAB 4U4BA 1F00I 3UBXB 5D70L 5DZNA 3VXPA 2XWJB 1MIML 4KJWC 4OUUA 1KIRB 2C1PB 3IDIA 5E24E 2NZIA 4HKBB 5ICZB 2Z31C 5GXBB 3ZKXB 2FEEL 3HS0A 5C0RH 2YD7A 2A74B 1CN4A 3HE6C 3QNXB 2H2PD 1OLZA 2W38A 3OTTA 2AV1B 4JFDE 4IM8A 1CLZH 4P2OD 5EO9B 5F88A 3BH9A 2E8YA 4L9LB 4NCC2 1OGTB 4NOBA 2XQYK 1MAMH 5CD5D 2Z31D 5C6PB 1D9KD 5C0JA 3BH9B 5CGMA 4IOFC 3HE7D 4RAUB 2B4CL 1IFHH 3MLSL 1GH7A 1MAML 4ETQB 3QUYA 1UCBL 4GJTB 5EU5B 4P9HC 3B9KA 3WO3B 1A1MA 3B3IA 4MJ5B 4AL8H 3LKOA 5LBSH 3VFRB 3BGFC 5K9KB 5I1KL 5F6IC 4AMKH 1NQBA 2FX9H 3MJ7A 4PJIE 2AK4B 3BDYL 5MERA 1V05A 2BXZA 2Y5TB 2PXYD 3QFJA 3WFCL 4YHPB 3P11L 2G75B 2B1HH 4X7CC 3T77B 1NUDA 1FAIH 5IMKB 3LS4L 1FNFA 4X4ZA 1JUFB 4G8FB 3IFOA 5D7IE 5GSRB 4W6XB 1SM3H 4AEHH 1U8IB 5HGHB 3EDEA 4TOYL 1SMOA 4U6HA 4A2MA 4XBPB 1G7IB 4PRAA 1MCWM 4CNIA 1KTKE 4O51A 2JCCE 3GK8H 5EG6C 3ZKQD 3MR9B 5IMKA 3WFEL 4MJID 4XBPA 4XCFL 3ARGA 4HUNB 5DO2D 1UB5B 2LU3A 2GTZB 3VGGA 4UIMB 2QHRL 1ZLWK 2H2SD 4JRYA 2VXSH 2X4NA 5LKNA 1HEZA 5DMJB 4YQXL 3KJ6L 1FC1A 2OM5A 3RGVC 3VGEA 4PV8B 4UQ2A 4E41E 4M3JA 2DQIL 3BKMH 2IBBA 1MLBB 3OX8B 1G7HB 3ARRA 2H26B 4CMMA 2YSSA 3WUZA 1S3KH 3RWJA 4G8GE 3QDGA 5HHXL 1D6EB 1ES0A 4F57H 1E6JH 1W72B 1CLOL 2MTPA 1QYGL 1WICA 3FO0H 4WFFE 3ARFB 5CJ5A 3RPIA 4GKOA 2C1OA 1ED3A 4Y19D 3KG5A 4U1HA 3RTQD 3AAZA 2NY4C 5DEFA 3FFCE 2ZUWA 3VMPA 4Y5YC 2GFBA 2OR9H 3SDDA 4O2EA 1MWAH 4QLRA 1PVHA 3QG6B 5IHBA 4HUVA 3U4BH 5C08D 1N5AB 2GY7B 4KPHL 1UWGL 3SGJC 1IGIH 3LKQB 4P9HL 5GRVK 3O2DA 2Q76B 2ZUXA 4C56A 4XHJC 3VFWA 4IRJD 1KNOB 4LLWA 3VXSE 3DWTA 3VXSD 1UXSB 2DJUA 1B9ZA 4JQIH 4WU5A 4JY5L 5TDPA 4NRZA 4OIIL 4EUPG 4F3FA 1QKZL 3O6MH 1C5CH 4DN3H 3T08A 1MLCB 3D3VA 1TJGL 1CE6A 4FQ2H 4DEPC 3WS6A 5IB4A 3U48A 1MHHB 1MVUB 4LLWB 1BECA 3MV8B 1BPVA 4X9FA 3ZKMD 3GMMB 5FECB 2IC2A 2J8UA 1CBVH 1FFNA 4WI5A 2OTWB 3MLUL 1A7PL 5HYSB 2VWEC 1T22A 3LD8C 3LKOB 4OLVL 1X5HA 4MA8H 1Z2KA 1FL3B 3FQUA 1HKLH 4DUVA 3ARFC 3M1BA 2V2XA 5IIEA 3HG1D 4XAWH 4HUWA 1D3CA 2X4TB 3QPQD 1XGRA 4KK5D 4Y1AA 5I1CL 5F9AC 5I2IB 3BZEA 5DLMH 3MFFA 5GS3A 2EDYA 3NN8A 2ED8A 3PGFL 5B39G 2DN7A 2LE9A 4JHZA 4S1SH 1XF2A 1YMHA 5J0BA 3MREA 4DZBA 5B38B 5BVPH 5DJ2A 5L88H 1AI1L 1XGRB 4Y1AB 3ZMRA 2OJEB 2BY2A 3MV7B 3GSNL 4QRTB 3IYLW 4KI1A 1IL1A 2ED7A 4E5XB 3H9SE 2GITA 3EFFB 4X5WA 4U6TA 2ADGA 2D7NA 4LLVB 2FO4B 4PJCE 4N0UA 1G1YA 4PGEA 3FT3A 3D85A 4RGNC 5H2BB 3ERYA 3EO0A 4OKDA 2CLZA 4HPOL 5EZIH 1DBAH 4L8DA 1RUQH 5ENWB 3C09B 4QTHA 3SPVB 4O9HL 2QQLH 3D85B 4MNQE 2NPLX 5H2BA 3SDCD 5I8OL 1FORL 1RUMH 4ODHH 4OCYL 1RJLB 4PS4L 1YYLL 2VDNH 4PJEB 5SX4H 2VKWA 1KB9J 4TPRH 4GQPH 4H26A 3UJIL 3I02A 3FQNA 3HA0A 4U2YA 5DRZA 1CGSH 3BW9A 4X4YA 3C60B 1NEZG 1UH3A 4MHHG 5LAXB 1NUNB 4ZMAT 1Q9WB 4QHLB 1Q9LA 4P5MB 2V2TA 4FXKA 5CZXD 4G6JH 5FDWA 4Q97A 4JO1L 3INUH 2Y7QA 1LO3L 2K9UA 4XP6L 5LQBL 5GGTA 1ACZA 1HNGA 4NCDA 4J7RA 4JB9L 4YIQB 3QNZA 4M1GH 5KVMC 2BCKB 4NPYA 1XZ0A 1IM3B 1MUJA 3THMH 4UILH 1WZMA 3H3PL 4OJFH 4JFDD 3FQRA 5IBUB 4I18C 5KOMC 3SE9L 4P5TD 1KJMB 1PG7L 1QD0A 4U6YA 4XZUB 3KYOB 2X7LA 2DMCA 1YEGL 4Z95H 5BQ7B 4GRWH 5C0BE 3I9GL 2VITA 2ICWA 3CX5J 5F7FA 1E4WH 5CGTA 3DVIA 2DWDA 5DQDH 3TBTA 2VL5B 2Z93B 1CFNA 5C07E 3BYTA 3D25A 4GBXA 3PQYE 1XF5A 4NQSA 1ZA3A 3DIFA 5T3XH 2FX9L 3K81A 3QHZH 1CIDA 2AEPH 2LAAA 1HYSC 2KPNA 1A6AB 1AO7A 2Q7NA 4N90E 4GMSH 4F7MB 3TYFA 3TN0B 5I1HL 4U1LA 4UU9B 3IAGC 3WXWL 1KPRB 5HJ3A 4LU5L 1U8KA 4X80H 1UKQA 4Q0XL 1HKFA 2XQBH 1MCKA 5MEOA 1TQCB 2BERA 5ACZA 4TSCL 4G8IB 1RJCA 5T1KB 3WXWH 1UXWB 2R23A 4JDVA 4JDZA 3PHQA 4QHKJ 4ZNEE 32C2A 5F1NA 4RBPH 2NR6D 5LXGH 5K59F 4YXKH 1NBQA 5L2KE 1F3JA 1Q94A 1FYTD 1N6QH 3JV5A 3SOBH 4A6YL 1BF8A 4LLUB 4LPVA 1CFSB 1MCRA 4PG2A 3H3KA 4I1NB 2FR4B 1RI8A 3L5WA 2RHEA 2F53B 3BP4A 1JPTH 3QA3A 5CUSH 4Z7WF 5IMMB 4JFPB 5B3NA 2ERJC 4M5ZH 1D5ZA 3HLAA 2BVPA 2CJUL 4Y16C 3OXSB 1W0WB 3U46A 1A02N 2C1PA 4J3UA 5EA0L 3FB8B 4JHAH 2QR0A 3DURA 4IHOB 2Z8RA 3UTQB 3KYNA 2GSGA 3IDXL 3EAKA 2A6IA 2VLKE 4YJZL 4ZUVB 4WW2C 1VEPA 5I8OH 4HGWB 5FHAH 4ACPA 4ZS6D 4H8WH 4UQ3B 2E7LE 3TJEH 5K9OB 1PQZB 1BFSA 4MNHB 4GH7B 1BQHA 1CG9B 1JFQL 3HE7B 3X3GL 1P2CA 3FFCB 3WL9B 1FV1B 4KDTC 2L4OA 4TSAL 1UM6L 1DBBH 3IDGA 1OP5H 1QFPA 2BOBB 1T0NA 2GJZB 2OS7A 1EZVY 4R4FL 5B8CC 3LQMA 4NN5B 4IRZL 1VFBA 2Z35B 3RBSA 1UT9A 3LN5B 2F8XC 3RIFK 2OTUA 5L8LB 2H32A 1KEGH 4K07A 2YUXA 1QFWM 4CVXB 4XC1H 4XMPH 4KTDH 4HIJB 1YY8B 5IUSA 3FOMA 3HZVB 2WIIB 2DQHL 2YPLE 4M7JL 5D9SA 4M1DH 5EWIH 4F58L 2BNUA 3DMMA 4P4RB 3VXRA 5JIIA 5HPOA 1U6AH 2W9DH 4G7YL 2G60H 3DSFH 4QRRA 1CE1L 1WK0A 3BXNA 4TVPH 3NABH 3UCRA 5IW6A 1JHKL 3SE3A 4M8QA 1T7WA 4LASL 1MRCH 3V79C 1KN4L 2ADIB 3UO1H 4WY7H 2ZSWB 2N56A 2QTEA 1DQMH 4LLYA 2JB6A 1IC5H 1GPOH 1DSFH 4YR6B 1KIRA 2XY1A 1YEDA 2CKBL 2QEJA 4N90D 3C60C 1E4XL 1BFOA 5ISZE 3OJVC 4R4BB 4WV1A 4RBPK 4JRXE 1TTGA 5F7WC 3MMEB 3ZSTA 1B0RB 2HJFA 4Z7OE 3HR5A 2CDEB 3FQNB 5CIPH 4UOW1 1OAKH 2A6KB 3UJJL 4F80A 4X6FA 3P73B 5D2LA 3SKNA 1U3HC 4LKCB 1FFOA 3I6GB 3JWDC 4F15B 4F7TA 1A3RL 4GSDL 2DJ4A 1I9IL 1IKFL 5DFVD 4GXVH 2ORBH 4APQD 3O81A 3QH3B 1JI1A 4XAKE 4KV5F 4HPYH 1WWCA 4OCWH 4DAGH 3HKFA 5C0CA 4KU1A 2GJ6B 3CH1B 4J3TA 1JBJA 2ED9A 2EKSA 3KPLA 1VKXB 2IFFH 4L3ED 2VSCA 2HVJA 1LP9A 2VLRD 1NCDL 4KRLB 4NQUA 5DTFB 4GKSA 5KAQG 4G43A 1E4XI 2Y5EA 2HJKB 4YDVA 2IPKA 4NNPH 1C5BL 1GZQA 2XZQH 1NKRA 1JWMB 1A8JH 1M71A 4YIQA 3VGHA 1KJ2B 1QRND 1T89C 1O5DT 3T2NL 4AM0B 4D3CH 1A47A 2XRAL 3QQ9D 3R1GL 3KPSE 4WFHD 1RUKL 5KS9A 2YPKA 1JCKA 3CFBB 2GTZA 1G84A 1AH1A 3FL7A 5E0QA 4EDWL 3CUPA 2HLFC 1R5WA 4JFEA 4R90L 5L8KB 3GM0A 2HKFL 5I9QB 2XTJB 3BVNB 5FHAL 5I1LB 3U2SB 2Q8BH 5HGHA 3PWVA 3WFEH 5TPWH 2NXYD 4NBZB 1AY1L 1G6VK 2J8UB 4OFYD 3PP4H 4ZO7A 4LQFH 5C8JA 4GOSA 1I3UA 4MNGE 4GLRI 4PJBF 1EJOH 3E3QA 1NCTA 3TZVC 5ILTL 2P5ED 5TE6L 3O6LL 2QKIB 3O3BA 4UBDD 3HCVA 15C8H 3F6LA 3OXRA 4LVHB 4U1MB 2JJUA 2AXHA 2VLKB 3RWEA 4NZTL 1IM9D 4H88H 3U0TA 2XZCL 1YEIL 3Q5OA 3V0VA 4LVEA 5I15H 1JF1A 1JZ2A 3SDYH 4JPKL 2A38A 1VSCA 5DJ2B 2GFBB 3RIFF 3QO1B 1AGCB 3ZTJG 1WZKA 2P24B 4JFXA 3P9LB 4GS7B 3I3BA 4Y4HA 5I16B 5CP3H 1D9KC 1XR9B 3BP4B 4R4FH 5BV7B 4Z9KB 2A9NH 4WEUD 1QLFB 3ULUD 4OD3H 4O58L 1F6FB 4NN6C 3AS1A 1CDGA 4O02L 2R8SH 3N85L 2A6JB 1O7SA 4GLRH 1XIWB 2BNQA 1A6VH 4G6AC 5BRZB 3DXAD 4KXZI 4KRPC 1QQDA 3MRRA 2IQ9L 5ITFA 5HYJD 1M1SA 2HKHH 2N7BA 1FPTL 5E8NA 2X4QA 4FQLH 1BQHG 2FIRT 1BZ9B 5DJ6B 1AGBB 5C0AE 1N59A 2PO6A 4MXVE 5L2KA 4KTDL 5BO1H 4GRLB 3CGTA 5I66A 4LSTL 1MJ8H 2LFGA 1L0QA 3KXFE 2CH8A 5EOTA 3VWKA 4JY4A 3QIWA 4MWFA 4KKAD 5GS0D 4J4PC 5IR1B 4LCYB 1F5WA 1MCQA 4F7EA 1K9TA 1XCQB 2E6QA 4PRIE 5E70A 4NZRH 4FQHB 2XKSA 3JV6A 4K3JH 2HRLA 1DN0B 1JYVA 5BJTB 1MJUL 4URTB 4YK4B 4GRLA 1FLTX 3GIZL 1S9KC 3RA7H 3QIWB 2VAJA 4Z7QE 4MCYB 4Z76A 4WRLA 1NGXA 2FGWL 3NGBC 2FHBA 1I3GL 1T4KA 5DK0A 5D5MB 3QXDA 2NX5E 5MENB 1HQRB 5A43C 3MV7A 4K7PY 1I1AC 2X05A 4D9QD 2ZSWA 3ILQD 3RFZC 1HK6A 4H25A 2RGSA 3WHXA 5E00A 5KS9B 4KK5C 3ROOB 2NY6B 1T5WB 1DVFB 4IDLA 4L9DA 3NCYS 4Y4KB 5LVEA 4O2CB 3KLHD 1H3PL 4XCEB 1FG2A 4QOKD 1RJYB 4G42B 4WVRA 2VRAA 1UEMA 2O5ZH 5IKCA 1ZKAA 1DBKL 2IF7A 2HH0L 4YXLL 1Q9KA 1K3ZA 2VDNL 3L5XH 4J12A 2IWGA 3BO8A 2XACC 4XCCH 4P3WA 1K4CA 5HYJA 3UDWA 4GKZB 1ND0A 3CCHB 5C0EA 4R96A 1J10A 4KTYA 3U7AA 2BK8A 4BSWA 1RZJH 2D03L 3RWFA 4M61B 5CLWA 3HS0B 5EO0A 2FJHA 1OGTA 4Z7VA 1A6WL 5D1QD 5D2LB 1OGAB 5KANG 3VWKC 3IDJB 1TJIH 2IAND 3TIEB 4RGMC 5AUMA 4Z7VE 3BN9D 3QIUA 4F7TB 5DS8B 5EUOE 3ES6A 5IQ7H 2HJFB 2APXA 4W4OA 3OKDA 4XB8A 1A1NB 4OLUL 4PRHA 2RAMA 3PP3H 4Z77A 1NAMH 3LKNB 3A6OA 1A6TB 1BM3L 1I9JH 5I17A 4MA7H 3VXNA 2AEQH 4FQXA 2GUOA 4X6FB 3THML 5D2NE 4PJCB 3OKDB 4UTAH 1CGVA 4Q6YA 1DLHA 1S9VB 4FA8A 4GMTL 2APTA 2X4UB 1WJ3A 3GSWA 3H9YA 3FZUD 4YHPA 4FTVD 3VFGH 2ICWB 4M03A 3WLWD 3LV3A 5LQBH 4D0BA 1KXQE 1X5YA 4HWUA 2DD8L 1YC8A 2MPAL 2VXUH 1U8LB 2R0ZL 3SCMC 4KJPD 1TZIA 1OQXA 2ZOLA 2VZOA 5DVLA 1JYNA 4OTXH 3PWJB 1B3JA 2BZDA 3C9NA 4I3SL 4UOW0 4BSVB 4OI9A 2JLLA 3EOYG 4HIIB 2QQKL 3ULUH 1FBIH 1H8SA 3LPFA 5CJBA 3C87A 2DQEL 3FOLB 5JMOC 1V8HA 4HF5H 4YAQA 3C8KB 1OTTC 3O41A 3RGVD 5F9DC 5FIEA 2W9EL 1CR9L 2QQNH 3OF6A 5K59E 1JWSA 1NFDE 1S7XB 1LVEA 1K4DA 3TGXA 1DUYB 1AD9A 3IJSB 1J8HD 3V9FA 1FN4B 1YPZF 1KJ2H 3PIQA 5DURD 5CINL 4GW1A 3LVEA 3TH3T 2OTWA 4TNVK 4IMKC 4E9LA 4M7LH 1FL6A 3GJEB 3BDXA 4UV7H 5C70A 2IANB 4UIMA 1ZGLM 1Z3GH 4L3CA 1UKTA 2DM4A 1W0VB 3MYJB 4JO2H 1CXKA 2FX7L 4TULH 4RIRB 5HYIA 4LLQA 3FT3B 3OKEA 3PJSB 4MD0B 4PJ8B 2AP2A 3I2CH 3QXTA 4I5BA 4AENA 3VH8A 4P2QB 3DO7A 1OB1B 5ID0B 5AWNL 3FB6B 4MJIE 3QA3B 4RSVA 3OL2A 3T0EE 5JLZB 4ZXBA 5EC2B 2A1WH 4S0TD 2OJEA 4EDXB 4QXGL 3QXVA 4M8QB 1QLEL 4ZTPL 4NNYA 4WWKC 5E2UH 1NFKA 1QRNA 2UYLB 5JIKA 2NY6D 2YHGA 2CRIA 3P9LA 4ZNCD 4GW5B 4PJ7B 3HE7C 4IOFD 4G9FD 1GIGH 1YN7A 3RQ3A 4BZ1L 3VFTB 1AGCA 1AXSB 5F70A 4LPUA 4XH2B 1WAAE 2P49B 5AD0B 1NCUA 4OQTA 5EZJA 4P5KB 4NHUB 1MCPH 3SKOB 3PGFH 4G8GB 1LE5B 1P84J 3IF1B 2FWOB 1FZMB 5F7LB 4PYHA 3E3QC 4MJIB 3ZDYF 2UWEE 1KCRL 3ROLB 4HG4J 1KT2B 5DRWB 1YQ2A 3QG7L 2PTUA 3ULSA 2NY0B 3S34H 4GKNB 1VGKB 4FFZL 3N0PB 4PJHF 2O61A 4ZODA 3MQIA 3I6KB 1HH9B 4KVNH 1R3KA 2QLVB 2VQTA 4XWOD 4X8JA 5FGBA 4WI7A 4KROC 5IB4B 1J1PL 3L3IA 3VGAB 4KGLA 2D2OA 2HT2C 1JGDA 2B2XH 4MNQD 3WL9A 1UB6B 5MEQA 1KACB 3P4NB 5HHMB 5I66B 1CYGA 2DTMH 1DCLA 3CFJA 4UBDC 2AW2A 3PHOA 4WTWA 4MAUH 4Y4KC 4CNIB 4NHCL 4Z7WE 1M6OB 4PJFB 3TZVD 4ODUA 1YECL 1C5CL 4DN3L 4F57L 1KEGL 2BOCA 4YWGL 5ESAB 1JGDB 4FNLL 3MLVH 4XNMA 4J3OC 3BPOB 1IL1B 4FN0A 5GHWH 4LRIC 4L8CA 4ONGL 3LMJH 5B4MD 4PGCB 5L7XL 3C5ZC 3O9WD 4Q9BA 1EDQA 3DX9A 5E08H 4NZUL 4JO4H 2YMXL 4ZS7L 5JHDB 2C5DC 3PWNB 1Q9KB 5T33L 2VLRE 4NWTH 4YWGH 2R1XB 2GTWA 5BS0E 2F19H 5HYSG 3QIUC 3QEGH 2RR3A 4QHKI 1G9MC 3VWJB 5C9KA 3RWJB 5D5ME 3GNML 1T66D 3HG1E 1ZANL 2AXGB 4WW1A 1QBML 4K8RC 4BUHA 2PW1B 2EDJA 4QHNB 2NX5A 4XVSH 1K8IB 4HMEA 1MIMH 4QY8B 5F89A 2VDQL 4EVNB 4K94L 3W9DA 4EOWH 1KPRA 4QYOA 2D7PA 1WFTA 1WQVT 1J0HA 3LQAL 4KRPD 4LIQL 2WV3A 4R7NB 3DVNA 4GQ9H 2BDNL 4ONFL 4U1MA 3H6JA 1RUAH 1RZ7H 3GSWB 5FDWB 3OBAA 2W60B 1N6VA 1CICA 1QBAA 3QUZC 4M1CC 5C2BH 5MEPB 4L4JA 2E3VA 4JZNA 3KXFA 5DD5H 1NEZB 4S1QL 3TPUB 3R4DA 1CFQA 3ESUF 3HRZA 3GSRA 1FZOB 1YPZB 2KQNA 1A1NA 4L29A 4UDTA 1CDYA 4HGKC 3L3HB 4W70A 4BK5A 1TZGL 4AG4H 2YPKB 4PJXA 1D5MB 4AEHL 4Q0XH 5F93C 2P8MB 2I60L 3G9VA 3O2VH 3VXRE 1KJ2A 5GGRY 3RVXC 2PW2B 3HAEA 3LS4H 4PJ9A 2AJZA 4N5EC 1CD0A 3IKCA 3U2SA 3BSZH 2A1WL 1I7TA 2PF6A 5AWNH 3ARQA 1ZLSL 1S7XA 5FYJD 2FBOJ 4HKXA 3WXVL 1H3TA 2DIJA 1I7TB 4PR5B 1RFDL 2HWZL 5E6IA 5HPMA 2HKFH 5E9DE 4YAQB 4OLXH 1GHFH 4TTGA 3BN3B 1BMGA 1OSZB 2NXYB 5F1OB 4ZD3H 3GMMA 4K3DH 2PNDA 5HPMB 3DHMA 2BOBA 3GKWL 3TCLB 2JJWA 2MQCA 3RWIA 5IW1B 4NGHH 2YD1A 4PJGB 2P7TB 2QHLA 5JDJA 1JF1B 3IJHA 3I3DA 3IETB 1EO8H 1W72L 4AENB 5GGSB 3NFSH 1WEJH 3BMVA 3B5TA 2BSED 1TENA 5TE7L 4PJ8A 5DEGA 2BVOA 1Y6MR 4YZFF 2C3VB 2NQCA 4P48A 3KLAB 3IFLH 4MAYA 2OXGA 3D48R 2X42A 2Y07L 4JHWH 5I1DA 1BFVL 1NJ9A 3FRPG 5FO7B 5FDYA 5BRZD 1F4WH 4XC3H 2L7UA 3HNSH 1XT5A 2K7QA 3TNNA 4C56B 4DKFL 3L5WB 5KSAB 4HS3A 2ZG2A 4APQC 2N7AA 5I1AA 3G5VA 2LVEA 4JRWA 5T3ZL 4BA8A 1HH6B 2B4CC 1XF1A 1BJMA 1MHPH 2DKMA 2GW5A 1N5YH 2Y07H 1MHPL 1PLGL 2VQUA 4W6WB 3BRDA 1PLGH 1UFUA 3R06A 3SGKA 2W9LA 5FYKL 2YN3A 5GS1A 4F9PA 4Z7VB 1N64L 3L3JA 5EU6D 2HTLC 3BUYA 4PJ5A 5C71A 3L3DA 1T0MA 1LHZA 3ZKND 4CU7A 3S3PA 3PP3K 3VG0L 5F7DA 5D1XA 4MA3A 5C0JB 5C2UB 1MF2H 4KKCC 1DN2A 3L7FB 1MREL 4DGVH 4HXAL 4WI2A 3C5SB 5KW9H 1FL3A 4L8SC 5BXFA 3NIGE 2APFA 2OTUB 5FM5M 2EXWD 3FFCD 3QIBA 4R97B 4YHLL 4PGBB 4ALAH 1JFQH 3KPOB 1Y6KR 3RWDA 1NCNA 2NY5C 1D5IH 2NY1C 3LEVL 4XNYL 4S1SL 4GW4B 4LSQH 3PHOB 3G9AB 3PWPE 3QEHA 4NM4H 1EEYA 2WW8A 1NGPH 3MOBH 5E2JA 2D7OA 2HT3D 3P0VH 4CVZB 1NLDH 5EIQA 4MCZB 1J1OH 3L5JA 4JRXA 1CXFA 4P5TA 3TT3H 4YBQD 1BOGA 4XC1L 4XMPL 3CFJB 4ZUTA 4I77H 4U0QB 5CJXA 3NPSB 1A6ZB 2XWTB 2ZPKH 1VEOA 3VXUE 4GRWB 3TWCL 3ZE1E 2PO6C 3OKKB 3HR6A 4WFED 3I50H 1J8HB 3T65B 4POZD 1QFHA 1KJ3H 2FEDC 5FGCB 3Q0HA 3VE0A 5CWSA 3VFOA 2FH6A 3GMPB 3EYOB 1RZ8A 1U8NB 2QBWA 5GJSL 1NH6A 1U8IA 4P46B 1RK1B 3AREB 1CFNB 2WANA 3GSXB 4R0LB 4NN7B 5F9WC 3RIAK 5AZEL 1SJEB 1QNZH 4I0CC 5DRNB 1MI5E 5IESL 5GGUA 3RL2A 4I2XE 1DDHB 4WHYH 1EFQA 1I1FA 4YGVA 1IC4L 1KBGH 4PJ8D 4RNRA 5J6GB 3DROB 5IJVB 3UXFA 3WJJA 4OLUH 1A14H 1CD8A 2P24A 4Z0BL 5D8JL 2ITDB 1IBGL 4MDIA 2WLYA 1MCIA 4J8RB 4JFHD 2ESVB 5ECJE 1WCBB 4ZTOL 1UZ6F 4YPGA 2AXGA 4WW1B 4EBQL 1OW0C 2R23B 3MOAH 5FA4A 3IFNH 1RJLA 4XX1G 4OAWB 4PRDB 2D7TH 1VA9A 1X4YA 3Q1SH 5GRYA 2D7QA 5EBGA 2P5EA 1D5MA 5BRZE 4K9EC 3CVHA 3B2VH 3UTSA 4RDQG 1NAKL 1CLOH 2XN9A 3V6OA 3FT2A 4AYFA 4NWTL 2DM3A 1YPZE 5FAAA 4PP1D 2DQTL 4NJ9L 5DQJA 1F97A 3N9GH 5LWYL 2P46B 3KDMB 4ONOA 1WV7T 2YUVA 3P4LA 4P49A 3IDYB 1LMKA 2EDHA 1TVDA 4J3XA 2BHUA 2IG2L 3VRJA 1QBMH 5T1KD 3KYNB 3KLSA 1HYRC 1ZA3B 3DIFB 5DJAA 3OKNA 2EICA 3A6CL 4PV9A 1RHHB 1P4BL 2IPTL 1FQ9C 2DKUA 1T21B 3GBML 1K3IA 2E27H 3FRPA 3QUMB 3MLZH 4Y5VA 3D69B 1HINH 1FN4A 2J8UE 5GSVA 1S7WA 4KUZH 4IRJA 3O4LA 1NANH 1FJ1B 1EO5A 4X80L 3MNVA 1DEEA 3VXME 3IXTA 4NKMA 3MACL 1OW0A 5FECA 3PDOB 1QEWA 5IW3A 4MX7B 4HIHB 1EFXB 4V3DB 2PO6D 1CICD 2F5AH 4ELMA 4Y5VB 2WBKA 1QO3B 5DJ0B 4HEPG 1YY8A 3CIQA 4AIZA 3ULUE 4WCYH 3EYSL 4YX2H 2AK1L 2UZIL 5JHLH 4FRWA 3OB8A 5T3XE 1MWAA 4FMFA 4KK6C 3K4AA 4QXUL 2X09A 3QDMA 4CUCA 1CQKA 3RVVD 5KZCB 3FB7A 1EUTA 4KVNL 3PJSA 4MQSB 3NBNA 4NSKA 3BP5B 1F4YL 1NCAH 2VZ1A 5GISH 2VDLH 4Y1AD 3ULUF 5E2UL 4ZPTA 1YEDB 1BIIB 3JZ7A 5L88L 5JOPD 3AVEA 5CKAA 2FO4A 1XCTB 4WFEE 3CCHA 4TUOA 5C0EB 1GXEA 1A3QA 3MROB 1U91B 3V4PH 4NQXB 2HFEA 1X4ZA 4L8BA 1P7QB 3T0VA 4WFGE 3I3EA 5I15L 1YEIH 4FTVE 1EK3A 3GHBL 5HHQA 4HLZG 1GIGL 4P2RD 2Q7YB 2FBJL 4MHHI 3E0GA 3D0LB 3RGVA 2KUTA 3G6JB 5EUOA 1INDH 4OM0L 3FN3A 4WWKD 3T0ED 4K3EH 4JG1H 4NN5C 5TE6H 1I1YB 1TZHB 3FB5A 5IEKB 5F72S 4KGJA 3IF1A 1N7MH 1CD1B 1EAJA 4HZLB 4ZDHA 4Y4FC 1YMME 7CGTA 3M1BB 2KQMA 1F3DH 5AZ2H 4BSVA 1I8KA 1FH5H 3H3BC 1N5YL 5HHVL 5C0GB 2CXKA 4KZDL 3RAJL 2AJSH 4KHTH 3WKNA 4YHZH 1A7NH 1WFNA 4QEGA 4KJQC 1EMTL 2OJZL 4JVPA 3IDGB 3RUGF 4H25B 1IAII 3WHXB 4APQB 1U8PB 4U6HB 2RCSH 3Q6FB 1ZT7A 1TMCA 2WQRA 4D0CA 1QSFD 2VXQH 4LVOC 5JOFB 1MREH 1OLLA 1B6DA 3IFOB 4LASH 1S9WA 5FA3B 3EYQD 3QWOB 1KYOJ 1MEXH 2R4SH 3DUUA 4YDJA 1EMTH 3O6FA 2R0KL 1NBVH 3B9KC 1EPFA 2G60L 2IMNA 1BVKA 3MA7B 4YHZL 1DQQB 3EO0B 2CKBH 3RNKB 1OTTD 2FEEI 2AJUH 4ZUSA 4KTEH 4HF5L 4MJ2A 3SDXA 2AJUL 4OLYL 1INQA 1NCCH 3SCMA 1RVFL 1U9KA 2ILLA 4LSUL 5HGAB 4OFYA 3RWFB 1XH3A 5JO5B 3VXTA 1TQBC 5DGRA 1IKFH 2R4SL 2C9AA 3CFKA 1AQKH 5F3BB 4HFWB 2FHCA 2YXFA 3O2VL 2BRQA 5DJ0A 4M02A 3MXWH 4QTIH 2VDKH 5J6GA 4ZFOB 4UTBL 2J5LC 1K8IA 1CFSA 1DDHA 4V1DA 3QEQE 4KUCD 3BD4A 2IEPA 1G7PA 1DQDL 3WDHA 4PRPB 3C09C 3DX6B 5KTEH 4HG4K 1ZVSB 3I6LD 1I7UA 3STBA 5E56A 3RDTB 1I1AB 1CK0L 1IGJA 4NCC1 2BNRE 2NY4D 3BN9C 3CVHH 4QRPB 3V0WL 4UT7L 1IC1A 1TTFA 4PJHA 4PJDB 5DJDA 3TBYA 1LNUA 4ZFGL 3GB7B 3A67H 2X4OA 3FTGB 3GI9L 4E0RA 4MNHA 3QCTL 4G8FA 3DMMD 5GSRA 4NBXB 7FABL 4MMXC 2BNRA 2DQIH 3O45A 1A0QL 3BDYH 4KJWD 2AK4D 4WTZG 4LK4A 1HDMB 1HNFA 2YD8A 4GAJH 4HS6A 3P4MB 1NGZB 4O51B 3QEQD 4NRXA 4Z0XA 5E6IC 2VXSL 4PRNA 2X4QB 3IFPA 1E6JL 3M17A 2P48B 2R39A 4L4VA 3TO4A 3QNYA 1EBAA 1VGKA 2RBLA 4AM0A 1MHCA 43CAA 2NW3B 4ELME 3MV9A 1CVSC 3BKML 2AQ3A 1ZS8A 4NYLA 1HILB 2D31A 4PJDF 4AY0A 1KLGA 4BH8A 1IGTB 4NKDA 3OKYA 1J0IA 1CU4H 2WBJB 2HMIC 3TZVA 1XIWD 5FHBL 1V7MH 1CDCA 1IEAB 4JFEE 4NBYB 1D6EA 4PY8J 3LD8B 3BZEB 5HYQA 2H41A 5F1NB 3MRHB 4WJ5B 3QISA 3K4DA 4DGIL 3D6GA 5KS9E 4FG6C 5E2WH 1RZKL 4DKEH 5AG9A 4EI5B 4HXBL 4DTGH 4AEEA 5GZOD 3RWHA 1J86A 1SJVA 3BT2L 1J1PH 2HT2D 2QADD 2DOCA 1N8ZA 5CGYC 2NW2B 5C0IB 4BQ8A 3W5MA 4P46A 5D7IB 2P5WE 4Y5XB 4FABL 2FDBP 2NNAB 1MRDH 4HKJB 5I1DB 2AEPL 2MHAA 3BD5A 5E2WL 3WN5B 5J4MA 2IBZY 4HV8A 3SKNB 2EYRA 2DTML 3SE9H 1T1YB 3MJGX 1KENH 2ATPA 5DRZB 1GZPA 1S5HA 1BJ1H 4QXTB 4ZPTB 5BVJB 4EUPH 1EAPA 1KXTB 5ENWA 4JZOB 2Z9TA 1S9XA 3SDCA 3WNNA 1HHHA 3I6KA 5C0DB 3CMGA 3HR5B 4PTUB 3QIBB 5C0AB 3O3DA 3BIBX 4ORZC 5D70H 2L7JA 4HWBL 5K33A 5L7XH 2Y25A 3W0WA 1S7SA 4HZLA 5HHMD 4PP8C 2QSCL 1PZ5B 5GS0H 5K9KA 2P1YA 3G5ZB 1E6OL 2R0LH 3SJVD 4R8WH 3VGDA 3SGJA 1KF9B 2IMMA 3LDBB 4WUKH 5GZOC 1GGBH 3IS0X 4R26L 3GDBA 1A3LH 1G9MH 3QXUA 4UDUA 5TFSL 4NKIL 5IEKA 2FD6H 5I2IA 4H1LH 1I8KB 1MI5A 4LARL 1KJVB 3RNQB 1H9VA 1KB9K 4HPOH 5EZIL 4YGAB 3KPRE 2X1QA 3WEXA 1EZVX 3C8DA 3T3MF 4L3EB 1EJ6A 3GSUA 3HMWH 3KPRA 4YC2C 2HMID 3V0WH 1IBGH 3TO2B 1X44A 1RJZB 4HXAH 4JREC 3LKSB 1Q72L 4P2RB 5CJQL 1JNJA 2EYSA 3FQXA 3V4UL 4JRYB 3U7YH 4P2QD 1NGPL 3MOBL 3TFKA 3PL6A 3B9KD 12E8H 3MO1B 4XMKH 4NKOB 5C92A 1HQ4B 4PRAB 4HC1H 4XNUL 2J5LB 1IAOB 5CAYB 1UWEL 5D93B 7FABH 1X5IA 1GRWA 4N0YL 3GMNB 5IW1A 4RAHA 3W9DB 4NQTA 3AFLA 3DVFA 3VXMA 3JV0A 3G08A 1NGWA 3MNWA 3LY6A 4NQDE 4S2SB 4WFFD 3VJ6B 1N5AA 2KKQA 4EUPB 1UM4H 4B0MM 3QUMH 4TNWF 3OG4B 1QOKA 4XNUH 1DE4B 4RQQB 3PXJA 4U6VH 5EUKB 5K9QG 4FXGA 1U58B 1ZE3C 1NL0H 1U3HA 3LCYA 4OZIE 3WLBA 4WI9A 4PLJD 4IRSB 4JZJC 1NBVL 1TTUA 1A3RH 1MFBL 3EOAB 3F7YA 4ZUUA 3VFUA 2X10A 1ZLUH 5DTFA 3DSNA 2VABB 2I27N 3L6FB 4FZEL 5GRVL 1LILA 3S4SG 3MXWL 4QTIL 4LLAA 4Y4HB 2NCMA 4IOIB 1G0XA 4JM2C 4UT9H 2VXQL 5EH1A 3TFKC 5ALBL 3VWJD 2PW2A 1NFIA 2EIZB 3K0WA 1MVUA 4KMLB 3WNLA 3CAFA 2DQDL 3HC4H 3X13B 5B8CB 3CSYA 4HS6B 4B5EA 5A40E 4PJAB 5DVMA 4HBCL 2LV4A 3VFMB 1KIUA 1RHHA 1NAML 4K55A 1IGCH 2YN5A 3RZCB 1OAQL 4M4RA 5E8OB 3EGSA 3VRJB 1F42A 3HMXA 5IBUG 1MRCL 5KSUB 1WUNT 4OF5A 3CU1A 2X70B 1TLKA 4IJ3B 3VFMA 1LD9A 3SKUD 4XXDA 1Q0YL 1AO7E 5I1JH 2EIBA 4Z8FL 1IQDA 2R0ZH 5F1IA 1GHFL 1MWAL 4K8RH 2MFNA 4M7KH 4XPTL 2VAAA 3P30H 3TA3D 1UA6H 4MD4B 3L3OA 4PJCF 4WUKL 3VI3F 3PQYA 4C58B 4M93B 3K3QA 4RFNC 1OTUC 5EU3B 2VC2L 3WCYA 2AKRB 2ZOKB 1UYWL 4PD4K 4KJQD 3P77A 1EFXA 4OZ4A 1J87A 2BC4B 3QIWD 4ZFFB 5DD6A 4LIQE 2V7HB 3NCBB 1NKOA 1HSBB 2XNAB 4Q2ZB 3LRSA 4PB0H 3QO0A 2DIAA 2I60H 2VDLL 3O0RL 4LP5A 4NKDB 2YOCA 3L3OB 4N8CH 4KHXH 1K2DA 3VXRB 1G7MA 4OCRL 4PJBA 2Q87A 2E7BA 3EDJA 2A6DB 3ALPA 1QLFA 2NY1B 2DWEB 4S1DC 2CIIA 3VE0B 3V2AR 5DK2B 4M8VA 3HI6H 3RVTC 4JM4L 3VXUA 2Z8SA 5AYUL 1HSBA 4Q2ZA 3VWJA 4KMQA 5EO9A 5F88B 5D7JA 3EYSH 2B20A 4ZUSB 4LEOA 3PWPD 5JHLL 1RFDH 3ABZA 5HHQB 2W0LA 3OKOB 1MFNA 4JO3L 4H26B 1MCCA 3WMSA 4PRBB 5BW7C 1D9KA 4Q9RH 5IQ9B 3STZB 4HS3B 4QHMA 4PP1C 3EFDH 3EYFA 4M5ZL 2XWJA 4U1NA 2F54B 3W39A 2QSTA 1ITBB 1FFPB 3VMNA 3LDBC 3RI5K 3WIHL 3TEUA 3GMQB 3P4OB 3VA6A 3V6ZB 5IMLA 3AC0A 4XVJL 4EN3D 4N5UA 2XPGB 1UM6H 4TSAH 4U1SB 4EI5D 1D5XA 4LF3B 5J1TC 3GMLA 3C08H 3B6SB 2YEZA 4XMLH 1J0KA 1JZ7A 1SJHA 5KVFH 4OLWL 4APQA 4ZUUB 4H8WL 1NBYB 4NC2B 4BYHA 1XZ0B 4TUJA 3UAJD 1GAFL 5J3HC 3RUGB 1R3KB 1OWRM 4NQCA 1ADQA 4ZSOE 3BE1H 4PJ8C 1A5FH 4G43B 3LMJL 1SEBA 2VLRA 4XNZB 3SKMA 3V5HA 1CICC 4F7CB 4QT5A 3RNQA 3O6FC 1ZGLA 3P9WB 3UJTL 4JVWA 2HJKA 3T4AA 1DQJA 2O5YH 4M3KB 3WE6A 2R29L 4NQCB 1IT9L 4HKXB 3BHBB 1JK8B 3ARDC 2DBLH 1PW3A 5A2JH 4NIKB 1PY9A 2HFFB 5E8DH 1PG7H 5I1EL 1FPTH 4Z78A 2XTJD 4M6MH 2FO1A 2OCFD 4R0LC 1R3HB 4O2FA 3UJTH 1QP1A 1FAKT 5INCA 4K9EH 1U41A 4XXDB 5T33H 1E4WL 3MO1A 3RKDD 3QJHB 4L4VE 4XCNB 2X89D 4WEBL 3OMZA 2B4CH 3DO3A 4K71B 2NY2C 3W82A 5J3HD 3EJZD 5IK3B 1OB1A 3MTRA 3MUGB 1R3HA 1FSKC 2RIKA 4OD2A 4R3SA 4DUXA 5KAQF 1QA9A 4ISVB 2VLJD 5GS2D 1KCUL 1KCSL 4NNXA 3PXHA 1X4XA 4OLYH 1DQDH 1I9EA 1R5VA 4BQ9A 3QCUH 3AGVA 3DUSB 1CL7L 5KVGL 1M05B 3G6AA 5IP4A 1EVTC 1FORH 1RUKH 3FB8A 1KIQA 4K8RL 1FL5B 3G5YB 1WT5A 3AAZB 5DI8A 3QCTH 1EBPA 3QUZA 1MFAL 3KPQA 4GXVL 2HTKD 4KJYB 1CGSL 2J4WH 1QVOA 3ARED 2OZ4A 2EEAA 3LOWA 1KG0B 5EZLB 3WS6C 5EUKA 2BSRA 3RTQB 4MVBC 1J18A 1QRNE 2AJ3B 4OCYH 1J0JA 4ODHL 4LAQH 4HK0B 3T0EA 4RGND 4NRXB 4OD1L 1DBAL 3MLRL 5CMAB 5D1ZD 2WBJC 4PJXB 4KKBD 3EOTH 3M8OL 1S7WB 5ICYB 2H32B 1Z0MA 2VAAB 4F3FB 2XRAH 3W0WB 3WDJA 4X6CF 1OP5K 1JNNH 4X6CB 2NY7H 3SO5A 3S4SA 5L6YH 1PQZA 4PB0L 4HMCA 4KKLC 3DI2B 5ERWA 3ZL4H 2P47B 1D5BA 3NFPB 1MCHA 1KCRH 3O3AB 4FQIL 4MJ4A 5H8DA 4C4KO 3MLRH 1FNHA 4POZC 5TH2A 4AT6A 2HYMA 2AJYL 5HDBE 2DM2A 2VXUL 3X14A 2COQA 2EO1A 3MJ6A 1XCQA 2BY3A 2IANE 4OT1L 5E8OA 3MJ7B 2UVEA 4K7PL 1RV6X 3UTZB 2Q20A 1DSFL 4X7DC 1IGCL 5B21A 4EI5A 2J6EH 3VW3L 2DYPA 2R0WL 2DF3A 2FJFB 2DQJL 5C0BD 1FBIL 3ARFD 3O2WL 2CIIB 3SDXF 3L3GA 1HOCA 2AJYH 2FNBA 3RWIB 4WHDA 5CIPA 2CUMA 2P45B 1ZT1B 4LHJB 5D7IA 1IGFH 5FGCE 3T3PF 5DYOB 4LLDA 1N6UA 3V6OE 4O5LH 2MPAH 1JYWA 4Y4KA 3GSOB 5AAWA 2EXWC 3G5XB 4HJ0D 1CLYL 2R0WH 5DYOA 1BFVH 5E00B 1NBZB 1FCGA 1EIBA 5HHNB 4KKCD 3CD4A 3ZYJA 5CIPB 3IFLL 2ZNXA 4O2CA 2EE2A 1OTSC 3DECA 3ARBA 4YDIL 4CJ1A 3QO0B 4KKBC 25C8H 5IVXB 1MNUH 4L9LA 5HVHB 4OLZH 1CFTB 1ZLVH 3O6ML 5A16A 3SE4A 1S7VB 4OIIH 4G5ZL 2P8LB 3QULB 3WFBL 3V5DB 2KDGA 1GC1L 4X4ME 1Q9WA 4NQED 3UO1L 4JM2B 1U95B 3BZ4B 1FP5A 4HT1H 2ARWA 3UTTB 3O8XD 1BD2A 4FTVA 4QXUH 4KQ3L 2QSQA 5SV4A 1JPTL 3EOBA 1FFOB 1EAPB 2XXMB 4JFDA 4F7EB 1K5NB 4WWID 2W9DL 5DJDB 5K9QI 4LKXB 3GSVA 1VFAB 4FQJH 2VQ1A 3RU8H 4A6YH 3S5LG 4JM2A 2Y5TA 2R2HB 3WXVH 1PD6A 1H3UA 3QCUL 4HUUB 1CL7H 4LDLB 3PG2A 4R2GC 3EYVB 2AI0L 3C6LA 3RKPA 4NQVB 5I71B 1E6OH 4HWZA 4QCIA 4U1JB 1CZ8L 3B3IB 3QDME 1DQLH 4MJ5A 1N26A 1R3LA 2HAZA 3C5SA 4M48H 5HYJE 2AGJL 1VCAA 2OQJA 4EQ3A 5EC1A 1CT8B 4I3RH 1EH9A 1MJUH 4PBXA 2O5XH 5IWLA 5C6TH 4GBXC 3MXVL 1DQJB 5I8KH 4WUUD 3K2MC 4HC1L 3TA3A 4ZOEA 5JIPA 2H2SC 3QHFL 2ZCLH 1HHGB 5KVGH 4F2MB 1HHJA 1D6VL 4XZUA 2FB4L 4JJHA 4WENB 1GZQB 3CFBA 5MEND 2D0HA 3O41B 2WBJA 4MXQC 5IT2L 3MRMB 5GISL 1TVHA 4X6DA 1G9EA 4IIQB 3SDXB 3BSZL 1AJ7H 2MCG1 1CGYA 3KYKL 1JPSH 3QDHA 5HGAA 5F9OL 1DZBA 2PETA 4Y8DC 4ZTOH 1ODAA 3BESR 1PEZA 4PRIB 4N5ED 3RWEB 3U83A 1PFCA 4ZPVB 3G6AB 5FYJE 5J1AB 1FYTA 5DDHA 3GJEA 1T1XA 4UOJA 1R5VB 3U82B 4MB3A 2DM7A 2BSSB 4HULB 2CLVB 4MD0A 3RX7A 2FJGB 3KXFB 4M5YH 5L2JA 2BP3A 3NOIA 1JWUA 4QF1B 5CSBA 1LGVA 4RDQF 4Q7DA 3GFUA 1A4KA 5D1XC 5E08L 2FATH 4HIXH 5JOEA 2XWBA 4HK3N 2BY0A 3QDMB 2Y36H 3MV8D 4I0PA 4WGWB 3U46B 3QQ3A 5JW4N 4P3CH 4CJ0A 4P2OC 1HHKA 2A73B 4JHBA 2L0DA 2ADFL 4M5YL 1H5BB 1P4BH 2IPTH 1H0DA 1NAKH 5CD3A 4KZEH 1P4LA 4L4TB 5K93A 4NC0B 1FNSL 1NMAL 4I9WE 4TYUA 1NC4D 3SGEI 5JW5A 4RFEB 5LCVH 4JN2A 3HI1B 8CGTA 1IEBB 4AL8L 1VFBB 3DUHA 5I1IL 3QEUA 5MI0C 1JF6A 2V5YA 1HXYA 3VRLE 1P4LB 2V2XB 5IIEB 1IAMA 4E42B 3O4LB 4MLIA 2YMXH 4GAYB 4OCRH 4PRHE 3D39B 3BP7B 2RQ8A 2VXVH 3GRWL 4AQOA 2YEZB 4JKWA 5JMRA 1BJ1J 4HC1A 5LGHH 1OARL 3TNMA 1DQTA 2HG5A 3I84A 3T1FB 3S88H 5C3LD 1NFDB 1EXUA 1PEWA 4OGAC 1XF4B 3CFIC 5JXEC 2EIEA 1I8MA 3L95A 3F7VB 3LRGA 4MNGA 2VXTL 3NZHL 2H1PH 3MC0A 2B7DT 4KVCH 4LVNB 2GEEA 5E99H 4BH7A 3WUWG 1AXTH 1BEYL 3HZYA 1UA6L 3MUHL 5TDOA 1WT5C 5T1DL 1Y0LB 2X9XA 5MEQB 3D3VD 3N1FC 3GO1H 3VDCA 1T20B 3LQZA 5F44A 4X5WB 4D3CL 3V7AG 4HBQA 4POUB 4LLYB 2YR3A 3MCKB 1JZ4A 1N8ZB 5GGRA 4ODBD 1CDBA 1P7HL 3TBTB 1BAFH 3L9RA 3PWPB 3S37X 1ZLUK 4WIQA 5D2NC 2NNAA 4HKJA 3UTOA 1MJJB 2O26U 4LEOB 4NKQB 3P0GB 4LEXH 4OM1H 5J11C 4A2LA 1E4JA 2NY3C 4K7PX 1C08B 5ABDE 4GAJL 2BVEA 4YDLC 3KLDA 1PKQB 1YEFH 1MRFL 2IALB 4OV5A 3BO8B 1ED3B 2IAMB 4LSQL 2ESVA 4R90H 1SJEA 1SYVB 4RMSA 3W2DL 4B7IA 3O6LH 3HPLB 3JSSA 1L9NA 2R1WB 2CGRH 4LCUA 1EO8L 1W72H 4OF3A 3H7BB 5SX5K 4CADA 3TFKD 2KH2B 2DD8H 2H26A 3V6FB 4CMMB 4U1KA 3PHQB 1W8OA 4LQFL 5SX5H 3T0AA 1JPST 1NGWB 1YDPA 4JHWL 4XHJD 2OMNA 1CXIA 1R3JB 4U7MA 5E5MB 5I71C 1VFAA 1G6RL 3BKJL 3S36L 5CEYA 1A7OL 1R3LB 4D94A 3R0NA 3WSQH 5FYKH 1SJXA 1A6TA 4HDIA 3TV3L 4NQVA 5HHOB 2PXYA 2Y06L 3B2UC 3RTQC 4RX4D 4YEFA 5IQ7L 4JRXB 1VGEL 4PJHB 4KDWA 5HHXH 1IGIL 5IEHA 3CVHB 3KWWB 3GSVB 4HK3J 5FYJL 4QRPA 1NC2A 3ELAT 3VDAA 1JGEA 1VGEH 2WWKO 2J3SA 4NQDD 4Z7WA 1F4WL 2WP3T 4EQ2A 1CI5A 1DP0A 1DBBL 2QADB 3BIKA 2V5TA 4RMRA 2RCSL 1U8JA 1AHWC 4NJAL 2M2DA 2BFVL 5HI3D 4PJAA 4P2QE 3B83A 3U6RA 4X6EB 1BX2B 5JR1L 1CCZA 4PJ7F 5IHLB 4HJJL 3RPKA 3NN8B 3W5NA 4HIHA 2X9WA 4YDKL 3PABB 3V4UH 5JDSA 1G7LA 4FFVC 3KNBB 2VLLB 1ETZB 3QCVL 1UACH 3MNZA 4M43H 4XPAL 4JDVB 4Y19E 1I1AD 3CK0H 1RURL 5DD6B 4OUOA 4ODWA 3BQUC 3KVQA 4K2UH 2ZSVA 3NCYP 4NN7C 4H8WC 2W92A 4KAQL 3L5HA 4G8GD 3S35X 3QXDB 3V0VB 1U2HA 3H8NA 1AIFB 2XFXB 4KY1L 3G08B 3MNWB 1DE4A 4DVRL 5F6HJ 1NJ9B 5EU4A 3BPLC 5E8DL 5I1EH 3U7YL 1EGJH 1E0OB 4BFIA 3L5XL 3GIZH 1ZANH 4Y0GA 4XCCL 4U0RB 1J11A 3ILPB 3QI9A 1UADC 4CU8A 4NNYB 4PJXE 5KSAA 5DEGB 2H6PB 4J4PD 5GS0C 4GQ9L 3HB3C 3HCVB 3KPTA 3TJHA 5JA9A 2FYYB 4LLQB 3FB6A 4ZSOB 2E9BA 5JNYA 1MFAH 5IOPA 2YKLL 3SY0B 3V7MA 4NUJA 2HFGL 1ZTXH 4NKIH 3H0TA 5DXWA 3IDUA 5T1DH 2PTTB 5EWIL 2BRRH 1DFBL 4HUVB 5E8NB 1FGNH 5E03A 1I7UB 1KT2A 5DRWA 5DEZA 5DT1L 2F53E 3CU7A 3NGBB 5ICYA 4RFEA 4HSQA 5T3ZD 5BZDB 4X98B 3BEVA 3WNPA 1C1EL 2Z4QA 3CXDL 4DZ8A 2A6JA 3V8OA 5DUPL 1KTRL 4RRPA 5C09B 2MCPH 3AS2A 4RAUA 1YDPB 4GAYA 2PYFA 5EZOL 3HG1B 1A2YA 2VH5H 4ZNEA 4R9HA 5H37G 1H3VA 3OGCB 4QOKE 1KPVB 3T1WA 1KJVA 1NAMA 5CGYD 1SEBB 1W8NA 4EXPX 4XPHL 1FE8L 3LSOA 5DJYA 1SMAA 5JW5B 3CH1A 5J9PB 3P11H 5D7IF 3G5ZA 4L8SA 1MPAL 2PCPA 3QFDB 2BCKA 4DGIH 4WDIB 3SJVA 3AY4C 1NMAH 3KS0J 5LG1A 1UG9A 4L4VB 3TO4B 5SWSE 4ETYA 4P23A 4QCIB 4U1JA 3QEGL 5E8PB 4EN3A 1RZJC 5CILH 3RJDA 4MCYA 1YEJH 3X14B 2C3VA 1XIWC 4MDJA 1T3FB 2MKLC 1L6ZA 4QNPE 3KPPA 4QRRD 1P5UA 1UVQB 4EN3B 1BVLB 4LSRH 2EIDA 4GAGH 1HQ4A 5C07A 4MVBA 3BGFB 3RL1B 1T3FA 3PNWB 4MS8C 1G0DA 3ARBC 5JOFA 5DC4B 3MLZL 4MB4A 3BP5A 3MRNB 4I48A 2MHAB 3K1DA 2XTLA 4Y2DA 3KXFD 4UT6L 5I1LA 2DL2A 3MREB 4DZBB 3KPPB 3E8UH 3IJSA 1B0RA 1AD9B 1FRGH 2X1OA 3EZJB 1VPOL 3IDJA 2NX5B 4H0HB 4L8DB 2DLIA 5H35A 3TBVB 1AKJB 5DMIH 5KVDH 4H88L 2DLHA 1B0GB 4D0DA 3P30L 5EBMB 1KB5H 3T2NH 3U79A 2EDQA 4FXLA 3DVNB 1ND0B 5F6HI 1ZHNA 2YSSB 1FNGA 1SYSA 3ARBB 4JANA 3S37L 5EOCJ 4O2EB 2DLTA 1QLEH 4HT1L 5F89B 4R2GD 5B39B 4QXGH 1W72A 4G6AD 5C6WH 3GUTA 4KUCF 1UC6A 5DA4A 1NCDH 3RIAF 2AEWA 4H20H 3ZDXF 5FV1L 1VESA 4PJEF 3O0RH 3IKKA 3ARYA 3ULUC 2AABL 3C5ZB 5I30L 4OB5L 3O3UN 1QRKA 2GJ6A 4HS8L 2YBRB 1S9VA 2VUOA 1LO4H 25C8L 3D0VA 2J8HA 1QSEB 4K3GA 1MFDH 2LQRA 3HI6L 1XGUA 2VMFA 3KHQA 1A6UH 4AZ8A 3DV4B 1U3HD 3IKCB 5IB3B 3O45B 5IEHB 3UDWC 4NUGL 1QFWL 5KW9L 2Y23A 3OSKA 5DQ9B 3HAEB 4N0CC 2ADJB 1HHKB 3CMOL 3CMOH 5DQJB 3LKRA 4F15C 1DR9A 4NUGH 3HRZB 2Z91B 1WC7A 3MODL 3OR7A 4M48L 3MV7E 3X3FH 4F9PC 2XN9B 2EEDA 5KOVC 2QR0B 3HUJF 4U1GB 5KSUA 4IDJH 1EO7A 2LAGB 2AK4A 4LVNC 1BZ9A 1TPXC 3FTGA 3D3VB 3JTTB 1NLDL 1ZA6B 3UYRL 4MAYD 1RZFH 3D25B 4GBXB 1LQVA 1T2JA 3T8XB 3EO9H 3INUL 4G6FD 5FYKE 5K9JL 3C5JA 4U1IB 4OFDA 3D87B 1BLNA 1HCFX 2VKXA 4X8JB 2OR7A 1S7TA 4XPBL 3WE6B 3B9EA 4FFWC 1AIFA 1DBJH 2XFXA 5F3HA 4N0YH 4OI7A 4K71C 4GXUN 3PHSA 1DEEB 1F4HA 4PJGF 2NY4B 2XNAA 2DRUA 2OBGA 4GBXD 4MD4A 2DYPD 1EEZB 3PV6A 2E7MA 4G8IA 4LPYA 5L0QB 4RMWA 4UTAL 3VDBA 4XMKL 2XV6B 4UAOB 3G5XA 3KNBA 3JXAA 4U1LB 1DL7L 4XNMB 4RA3A 3DO7B 2V7HA 2XQYG 4U6VL 1XGPA 5FYKU 1T20A 3LQZB 4H5SA 1CQYA 1MEXL 4PGCA 4Y2DD 2SEBB 3R0MA 3QUXC 1IC5L 5TGBA 5GJTL 5HGDB 2X4RA 1Z9LA 3BZFB 1Z5LA 2NY7L 4JDZB 3PV7A 2VLKD 4AEIH 2GY5A 4Y4FD 4CDHA 5ADOL 3C6LD 1JHKH 3QNXA 3OKEB 1HZHL 4ZXBB 1U93A 3UBXA 5DJCB 4X5XA 1YQVH 3DNKA 4HLZH 4LKCA 2WUCH 2ZCKH 3QDMD 3FAWA 2FYYA 4OLXL 3JV4B 1NMCB 2VR9A 3CSBA 1MCBA 2AJSL 4YBLB 4AIXA 3LZFL 2AJVL 3MUZ1 2J6EL 4NFCA 3VW3H 2C7UA 3VXPB 1A3LL 5DHYA 2HRPH 5I8EA 1LO0L 1RQ5A 1PKOA 3DOSA 2G2RA 3TBSA 35C8H 3U30C 2EE3A 5DWUL 1F58L 4A6YB 5DSCA 1NDGA 1CF8L 1JP5A 4OCSL 5HDQH 4C54A 1A1MB 1QACA 4NQDB 4FFYL 4DKFH 4X6CA 3CPLB 3DXAB 2BSRB 4GW4A 4JGMA 1HXYB 4TQEH 4Y4HC 2AV7A 4V3EB 1VFUA 4P46D 1BD2B 1IILE 4JCMA 1IKNA 1Q72H 4OF7A 2RFXA 1TZGH 5F7DB 4YDVB 3B8SA 1OGAE 4G8GA 1LE5A 2PYEA 4GKNA 1T6WA 4PJ5B 5D2LF 5F1SA 3L7FA 3QDJB 1U8MA 3AM8C 4OGYH 3PGDA 3WFCH 2BNUB 3DMMB 3F62A 3RUGA 3AB0C 3I75B 4TVPE 5GGRB 1ZLSH 5I1KH 4JRYE 3IDXH 1F4YH 1NCAL 4FQQA 2XQBL 1J8KA 4Y5YA 2VXVL 2J4WL 5KN5A 1KV3A 4I48B 4PJ9B 5HY9B 2ZJSL 1FVEA 2YUZA 4JFZH 4HH9B 5IB2B 1HYSD 3L1OL 1J1XH 3MLSH 3BZDA 3K8LA 3V5KB 3ET9F 1OAXH 5DD1H 4WCYL 4UV4L 4JQXA 1J88A 3MCLH 3KJ6H 1M7DB 3H42L 1FVEB 3CVIH 3IDIB 2UY6A 4L3EE 2FECL 2MNUA 1BVLA 1KOAA 4EXKA 1UQSA 2R9HD 4M6NL 4NC1C 4PG9A 1T1YA 4Z78B 2ICWJ 4XCFH 3RVXD 3MYZA 4GRMB 5IQ9A 3SDYL 1DQQA 4QRTA 1X5GA 1BWWA 1H15B 4O02H 2R8SL 2BVQB 2JIXA 4KQ4H 3D1MC 4N0FB 1PYWA 3FAXA 3OAZH 2CDEA 1V7NL 1YMMA