4NT6A

Hla-c*0801 crystal structure
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
274
structure length
274
Chain Sequence
MSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARTAEQLRAYLEGTCVEWLRRYLENGKKTLQRAEHPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class I histocompatibility antigen, Cw-8 alpha chain
publication title The immunodominant Influenza A virus M1<58-66> CTL epitope exhibits degenerate class I MHC restriction in humans
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 73
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2013-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4nt6A02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 4nt6A01
1FFNA 5EU6A 3PXJA 3UX9B 4FQHB 3WXWH 4MSWA 2X05A 4PRBB 3TBVA 1U92A 1JZ7A 2X41A 1NCTA 3PDOA 2O93L 1T3FB 4HG4K 2OI9C 3ULUE 3PWVA 4JRXE 4KRPB 1OLZA 5M95B 5J3HD 2P45B 4DKFH 5AUMA 2BMKA 1FDLL 3NIGF 4YEEA 4MJ4A 1S9KC 2FH6A 5EBLB 3JV0A 3VXMB 2BHZA 4XPAL 4GRLA 3SBWC 3MOBH 1AQKL 4KRPD 2Y4SA 3RUGB 3UYOD 1MLBB 4RAVB 4G43B 5JIIA 4NQVB 1HQRA 4PTTA 4EVNA 1DQJB 1P7QA 3WL9A 1DE4A 1DQLH 1IEBB 1UWGH 1D6EB 2O5YL 4L1HA 1TFHA 1OL0A 4GAGL 4XP1L 1U8PB 5B3JF 2X4SB 4Z7WE 3SKMB 1F11B 5DJ0B 3JTCA 5E2WL 2DTSA 5E5MB 4POZC 4PJ9B 3EDEA 5F7LB 2E6JA 3C09C 3DVNB 4PTUB 1MFAL 5SX4H 5GRXG 3O2DA 3V6FA 3WFDH 4N0CA 3BT2L 2VB5A 2FHCA 5HHMB 1S7XA 3SO5A 3P40A 4C4KT 5EZJA 3TJEL 5JA9A 5MEOA 4AT6A 1OY3B 3MRJB 4JR9L 3S98A 4ELMF 1AGEB 1ETZA 1MCQA 3MTRA 3CU7A 4I5BB 1NBZB 1FNGA 5DRWB 3B9AA 4YHOH 2F74B 1S7UB 4HT1L 2IALB 4NNYA 4P4KB 3JBG7 5GS0C 1K8IA 1XGPB 4M6MH 3NZHL 5GRZA 3TNNA 3Q5TA 3PG2A 5FYJD 3CFBB 1Q1JL 5DQ9B 4JAMA 3VW3L 3VD3A 4PRDA 5M7QA 3FQWA 4U31A 4F33B 1XR9A 4KKLD 4PJFA 4J4PD 4Z7VE 4YDJA 4HJJH 3FO0H 4BQ9A 1MY7A 1QSZA 3H9SA 3OR6A 4NQSA 2KDGA 3QZWG 4DZBB 2UWEB 1J05A 5CFHA 3EHBD 3GMLB 5J9PA 3MMEB 3WN5C 3CSYA 1T22B 5IJVB 2XQYK 3TBWB 1BQSA 2V2WA 2VN4A 3OTTA 3C87A 4DGYH 4FN0A 4OQTL 5GSVA 3VXNA 3ROOB 2D7TL 2CDGA 1OHQA 1EEUA 4C54A 2Z31A 4HK0B 1AHWC 5DVNA 1SY6L 2IPTH 3JSSA 3QDJA 1AIFA 2DQTH 4NZUL 2GT9B 4X99B 4NGHH 4XCEB 3MJ6A 1K5NA 4P2CG 3KLHC 4MVBC 1XCQB 4GH7B 2EYSA 3AREC 1QR1B 1WCQA 1JGVL 2HJKB 3IB4A 3AVEA 4QXTB 1XH3A 1IC5L 4HDIB 4NM8H 1S9XA 5J8OA 1KSRA 2CD0A 2A6JB 2YZ1A 2R29H 1N5AB 4AJ0A 1YN6A 4M6OL 1HIML 5C08A 3C2AH 4YXKH 3QNYA 4FMFA 3SKOB 5J6GB 1RHHB 5TF1H 3GSVA 1FNSH 2DB8A 2CRYA 4QRTB 4UNVA 2VAAA 1KN2L 5B8CC 4DKEH 1P84K 4XP9H 4AEFA 4H88L 4EEEA 1JNHA 4OLXL 2YPVH 4YZFF 5DHYA 3GMNB 2R2CA 4HBCL 3ARDD 3BN9D 5ADPH 3F8UB 4KTEL 1ZLSH 3GO1L 4G8GA 4LIQH 4PG9B 1CFTB 3DRTB 3HNSH 5DHVH 4NJAH 5IQ9B 4RGNE 5HHQB 4GAYB 2CGRL 2V9QA 5HVFB 1YEHH 1UZ6F 4HWUA 1JFMA 4G9DA 5GS0H 1R0AL 2WINA 2C26A 1UB5B 1NAMA 3HZMB 1FVEB 2EDBA 3TPUE 1NGYA 1RZ7H 4KMTL 2P5WE 3VMPA 2OR9L 1OTUD 2E27L 2AQ3A 4NN7C 3LKRA 5E70A 4U6HA 4Y1AA 3DBXB 4IOFD 5JW5A 3MUHL 3GSNA 1H5BA 2A9NH 4NNXA 1N6VA 3MV8A 1C16B 4OLWL 3LAFA 5GGTL 2PW2B 1ORQB 1GJIA 4PJBB 1I9JH 32C2B 4UDUA 1OAYH 3PWPA 1LP9B 3MLSL 2XTJB 4AQ1B 4IRJD 2HMID 4WJ5B 1OGAB 1X3DA 1T5XB 1TVBB 4XAWH 3X12A 2DQGH 3H8NA 5IHLB 4C83B 2NY7H 4LRNL 1B0GA 1UH2A 1QZ1A 2ADFL 1RULH 4W6WB 3F6IA 1RZ8B 3IJYB 3T8XB 1CT8B 5FYJL 5IG7A 1RUMH 5I1CL 3MROB 1J9CT 5GZOC 4KK9C 1QBBA 4NZTH 1GGCL 3DX6A 1CI5A 2FSEB 1N0LA 1T1XB 5FHBL 1JGUH 1OWRM 4ZFZB 1UZ8A 2XZZA 3HS0B 1H15B 4LPXA 4XC1H 4IJ3C 4D8PA 3B9EA 4CJ0A 4F7CA 4XXCC 5EUOB 1SJEB 4X5XB 4YK4B 4CU8A 4TPRH 2FWOA 1X44A 4G6JH 2VR5A 3WUWG 5E8DH 3VG9B 2FEEI 5T1KA 3O3AA 4HUWA 4F7EB 2JIXA 5IJKA 1AKJD 5E6ZA 4OB5H 4RNRA 3RBSA 3L3DA 4EI5B 4OM1L 4U1NA 2F5BH 3ZO0A 1JF1B 4WNQA 4IHOA 1GZQB 4UV4H 2AGJH 4P23D 3RVVD 2CKBL 4GLRI 4MNHA 2C1PB 3QZWA 4I0PD 4LEOB 2ZSWA 2P8MB 1K4DA 4BUHA 5AWNL 1YEDA 4YFLI 4JRYA 1E28A 5BQ7A 3KPNB 5IFJA 4TULH 4LVHC 4D94A 2P7TB 2HWZH 4P5MB 5EO9B 4FG6D 2GW5A 2P8PB 2PO6A 3GSQA 2J4WH 3D18A 3EYVB 4OLZH 4AMKH 5I18L 3GRWA 5KS9B 3A6CL 5DD6A 4XVSH 4DW2L 1R6VA 1MAKA 1J1PL 1ZHBA 2BY0A 3QCUH 1AC0A 1FPTL 1RZFH 2BHUA 5CGMA 1TMCA 2XN9E 3KHOA 3QP3A 1MWAA 4ISVB 2HA1A 4ZDHA 5E24E 3KJ4B 1WSST 2BNQE 3IDIB 1TXKA 5GRVL 3G5VA 4FQCL 4PJHF 1RJCA 2VC2L 1TZIB 4UT9L 1URLA 1NMCC 1A6UH 3X3GL 1OT2A 1DUZB 4YO0A 4MQXD 4QHKJ 1A7QL 3QO0B 1YMMA 3CFEA 4RBPH 3P4MA 2DLHA 4LGPB 1F02I 5KVGL 5T3ZE 4LFHD 4D9RD 1MCEA 2HKFL 3HZYB 1S5IH 3UAJC 1JZ8A 3TWCH 1ZGLP 3WXVL 1HKFA 1QHPA 3SJVE 3PP4L 4XBGA 2FIKA 3OKEB 2C4XA 1DEEA 2AK1H 2CRZA 5ACZA 4FXKA 3HLAA 3PWLA 1A7BA 1RZKL 1FG2A 4O2CB 4D0DA 1QG3A 3CVHL 2OL3B 3MA9H 4YXHH 1MFCL 2VXSH 4HCRH 3ZKXC 1H3PL 5IMOA 3X11A 3KPQA 3LKSA 4BK4A 3SGDH 2J6EH 1G6RL 2BSRB 5HXMA 3ZYZA 2X1XR 3ARRA 1KIRA 2XOTA 4LAQH 5FKPA 5C09A 1BEYH 1KJ2L 5IB2A 5FK9A 3GI8L 5CHNB 3MLTB 1N0XH 4ZUTA 4JM2D 1R3KB 1JRHH 3MACL 4LPYA 5GGRA 1KCRL 3GMOA 2MOVA 1FFOA 3WO4C 3DARA 3PQYA 2OQJA 5F1IA 1Q9WA 1RMFL 3RGHA 2EH7L 2WQRA 1FFRA 3RVTC 3H7LA 2JB5L 3F12B 5EU3B 2ZUUA 4P46D 5TDPA 2I24N 3WD5L 5F21B 5HYQA 2VZOA 3VXSA 4ETYA 1AR1D 3FB8A 1NEZB 1L9MA 3B9KB 3SGEH 1UXWB 4CMMB 5LGJB 3CSPA 3RFZC 1T03L 3HC4H 4P2OB 5EU4B 5FO8A 1AC6A 1S7WB 4PJGB 1KCVH 4PJ7E 4GAJH 2BNUA 1IL1A 3SE8L 1U3HA 3P4OB 4LHQB 2BSSB 4L4TE 4JFDD 4GRWB 4YHZL 1J8KA 4Y5VC 4JFYB 2BRRH 5FEBA 5CEXA 2K7QA 3ARFC 1XF3B 2EC8A 1Z5LB 5FXCH 3WUWA 4BQ6A 2EDTA 3ZE2E 2EEDA 5JW4M 2VJXA 2GJZA 5IQ7H 2AQ1A 2ZG1A 2HVJA 4QHLA 2QSQA 5MI0C 2NY4C 3QQ9D 2AJUL 2FGWL 4FQLH 1JYWA 2CRIA 3TM6A 5I73B 3T1FB 3IETB 2H2SC 3MLZL 3MRPA 3QDGB 2Q1EA 4JGMA 2ZP0T 1T21B 3OB0K 2APFA 1N6QL 2R1YB 5DJYA 3LB6C 2NW2B 3SDDB 2OMBA 2R15A 4PRIB 1I7ZA 2F53B 8CGTA 1C08A 3IAGC 3FRPA 4O51B 3CD4A 2PTTB 5DD3H 4MJ6B 1LNUA 5DRNB 3W39B 4MCYB 3SDDD 2YUVA 3QDME 2EYTB 5GGSA 4OZGE 1JZ4A 2Y5TB 4JG0H 4QWWD 3W5MA 2F53D 3HMXH 3WYRA 1NGPH 1NSNH 2DWDB 4KFZC 4KK6C 5L2JB 4WFFE 4CNIA 3KPOB 4WI8A 1HHJB 1CDYA 1ND0B 3E6FA 5DJAA 4NJ9L 3LQAL 4PJDE 2A73A 5JUEL 3QEHA 3ULVF 1SEQH 3W2DL 2AW2A 5GXBB 1JFQL 4OZHF 4RAUA 5C0BB 1YY8A 3O6KL 4Y19E 3WLWD 3EYFB 4ZNEA 1VHPA 3DWTA 2VUYA 3L1OH 3RY6A 5TFSL 3U0TA 5DURB 3CC5B 5BW7C 1HYSC 1NUNB 1U9KA 5C0BD 4WRLA 3VXUA 3HAEH 5D2LB 3T0XA 1IC7H 1DBAH 2WNGA 1JPSL 4I18C 5DURD 3TEUA 2GTWA 1DQTA 2AI0H 4B7IA 4I2XA 1WLHA 2AQ2A 1FO0H 3PL6C 5F7WC 3OSKA 3CXDH 5FM8A 4HC1A 2NPLX 2DI8A 3RY5A 3MV7B 1EFXB 1JI2A 1Q9KB 2MQ3A 2VXQL 3FB6A 3QXDB 2X4OB 4LNRB 3RJDA 5IV2B 2GITA 1QBLH 2CLRB 3UMTA 1XAUA 2OX5A 3QJHB 3S34L 4OZIF 1QO3B 3L5JA 4ODSH 3O9WC 2HJFA 2EDXA 3B6SA 1EFXD 3HN3A 3QDJE 4PJXB 2MHAB 4KROC 2Z92A 3ZDYE 1CDBA 4U7MA 2P47B 4BKLB 1IGMH 3S7GA 3U0PA 5ICYA 4XMKH 5DTFA 1QSFE 4FQXB 4R6UA 5HPMB 2R9HD 1EGJH 2X9XA 2DICA 1KG0A 3NAAH 3PNWA 4MA3A 2IG2H 3C9NA 5FUOH 5FA3A 2DLIA 5ICZB 1NH6A 1AP2B 3EFFA 4Y16A 4NUJB 1RUQL 3SDCB 3QR2A 2PW1B 4I3RH 1IGYA 2QV2A 3KYNB 4RX4A 1TCMA 1OQXA 1A4KB 2WV3A 2V7HB 5E00A 2X4UA 4HPOH 1FO0B 2NY1C 1MI5A 5DUPH 3CH1A 3SGKA 5DYOA 4XH2A 2OM5A 1UM6H 4HKBA 3GJFB 3BUYB 1W72H 2AEQH 3NOIA 4OD1L 4KDWA 4UU9A 2JK5B 2B0SL 4P3DB 4V2CB 4G8GE 3BQUC 3G04B 4KKAD 3VWJC 5TQ2H 5DRZB 4JANB 3G5YB 1HH6A 5KVDH 1F3JB 2NZ9C 4LSDA 2ZNXA 2NR6C 2DTML 1EDQA 2NY0D 1JWSA 3QXAB 4HXAL 1WFTA 4IIQC 2AV7A 3C5SB 3MQIA 3V79C 4YUEH 4U1IA 1J18A 2J88H 4IOSD 3AS0A 4OKDA 5AYUL 3D0VB 4Y1AE 1WISA 2G75B 3W5NA 1M7DA 3K46A 5IFHL 4MXQD 2ORBL 3NACL 5L9DL 2X4QA 2GJ6B 5IIEB 3ULVC 3B5GA 3MFGB 5F9JA 1AO7E 3OAUH 5KJRL 3ARPA 1T89C 3P73A 3B5HA 3M17A 5BVPH 4ODWB 4BK5A 3LRSA 4L8SA 4Y4FC 4E9LA 2GJ6D 3DOSA 3L5WA 2VDRH 3IDMB 4PUBH 1UKTA 5T1LD 5C0DA 1KC5L 3TF7A 1T7WA 1HDMA 5DT1L 1Z0MA 4HEME 5HGBA 1OSPL 3VFOB 4XPHL 5F7EL 4X80L 4XNXL 4GKZA 2A6IA 2VUOA 4M7KL 1X5FA 5D7LB 4Z8FH 4GMTL 3KLAB 5D2NB 4JJ5A 4Q6YA 4MMZC 5C1MB 4JFFD 1U8QB 4K7PX 1A3LL 4H8WL 4YDVB 1WWAX 1N8ZB 1CDIA 5D7LD 2GUOA 1NANH 4LHUA 5EUKA 6FABL 1NCBL 4AL8L 1SQ2N 5DLML 1N2RA 4CVZA 2HKHH 3SGJC 4HIJA 4J3SA 1RU9L 1T0NB 4HZAA 3UPAA 3ZTNL 4JPIA 1RURL 1S9YA 1BD2B 1OAKH 4CDHA 3RWIA 3O3BB 5B38G 1P2CA 2FBJL 3MRQB 5T1DL 1BGXL 4LARH 4J2XA 5LBSH 4HUVA 3SDXB 2EC9T 5DMKA 2P4AB 4KQ3H 2OTWA 5D1QB 1SM3H 3FB7A 1BD2D 4I48A 1K6QL 5ACMA 1F13A 5T3ZL 5E1AB 4W6XB 3RDTB 1BOGA 2ADIB 3RUGF 4OCXH 3V7AG 4Y5YA 5D1QD 5IEKB 1JPGB 1LO5A 3VFNA 5EIVA 5KSBB 1CF8L 1VACA 2ICWI 4KUZH 2W38A 2XA8L 1OD7A 4Z7UA 3E6HB 1IAIM 3MNZA 5I1HL 3RAJH 4WW2F 4MD0A 1QRND 2N7BA 1S9VB 3JTSA 1YQVL 1BPVA 2KUTA 3MJ9H 4GAFB 5HHNA 1XGQB 1JPFA 4QXGH 2DQHH 1LO0H 2ZG3A 4MJIB 2JJWA 3T4YA 3Q6GL 3IFPA 1R3HB 3VH8A 4Z77B 3KPMA 1WZKA 4M03A 1OARL 1F4YH 3L3JA 4U6VL 2HTKD 5DSCB 4XB7A 4XWOC 1N3NB 1TETH 4H5SA 2KPNA 4PLJC 2BY1A 5C0AB 1B0RB 2FECL 2DBJA 2XWJB 4MYWB 2W92A 2VDPH 5TDOA 1TZHB 4P2RD 1KXQE 5DD5L 4LGRB 1VFBB 1ZWIB 2JCCA 3JWOL 5EU7C 1JBJA 1S5HB 2X2YA 3QCTL 2UYLA 2FATH 2ATPB 1J5OL 5HDBF 4Y4KC 3B5TA 4YQXH 3DUSB 3MJGX 2HRPL 3LD8C 3RGVD 4RQQB 2YD7A 5EBWB 3TBSA 3DROB 2OLDA 4C56A 2UWEF 5IBLC 1T20B 5CJBA 4HHAA 3RVUD 5HD8C 3LH2L 3CZFA 4KKCD 2B5IC 3AFLA 2VABA 3RTQD 3T77B 2J3SA 1JF5A 1FRGL 1QSFD 1SJHA 4JDTH 1CGSL 4XPAH 1OT1A 1T4KB 5JXEA 2DQUL 2F54E 4YFDB 4X6DB 3VXQB 1WWWX 4LCWD 4OAWA 3SDAD 3QNZB 5FIEA 1KEGH 1M05A 3R4DA 3QIWC 2OP4H 4L9LA 3DO7B 4G6FB 1GOGA 1VENA 2X4NB 3TVMD 4JY4B 1RUAL 5C09E 4OTXL 2ITDB 2O5YH 2VZ1A 4H26B 3HE6D 2D03H 4FMKA 2JJSC 4GAGH 5EO1B 5E6IB 4GKNB 1QFWM 3ZT7A 5E2WH 3O41B 3OGCB 1G1CA 4G6FD 2E7LE 4BH7A 2DYPB 1U8KA 5JQ6H 1MFAH 3MNWB 4TVPE 3EO1A 3IDNB 4N0UB 2W07A 5MEPB 3RL1B 1A9EB 3QDAA 4U6XA 4YGVB 4N8CL 3KS0H 3TO4B 5DD1H 3TJEH 2BVPB 3QUXA 1H0DA 4HWEH 3FONA 4DK6A 4JR9H 4QTIL 1OTSD 1RUPL 5C0JB 2GFBA 4IDJL 3C6LB 2APXA 4Y8DC 3VXSE 3TJHC 2R23A 1YPZB 4N8VG 3QNXB 2YPLA 4HT1H 4YHMH 1NBYA 1SYSB 2ZSVB 4Q9QL 3V4PL 4MS8D 5C6WH 4ODXB 2VXVL 3QIUB 3ARBA 5E99L 1Q1JH 4M48L 3VW3H 3ARUA 2FJHA 3UP1A 2VR9A 4YNYB 2C4FU 3H9HB 5CILL 3UTTD 4L29A 4L3EA 1KGCE 4OGZA 3K80A 3OJVC 3QIUD 4AG4H 2C3GA 1E27A 1XGTA 2ITCA 1G0XA 2V7NA 3T08A 4LKXA 3NIFF 4M93B 4WWKD 3UJTL 4WW2C 3BW9B 2Y7QB 1VKXB 3MV11 3VG0H 4LLDA 3DUUB 3ZMRA 2BCKB 2R56L 5BV7L 3C6SB 5DJDB 3BWAB 3CFKA 4KUCF 4OKVA 4ZTPL 4X6BB 5B38A 5C3TA 1U8JB 3REWB 4TRPL 1WTLA 4OQTH 3V2AR 4PRAA 5GGUB 1ZS8A 2L0DA 3MRGB 3H3KA 4G6MH 1F4HA 2D7TH 1WFNA 1RJYB 4G8EB 4PJBF 4FABL 5HYIA 1SY6H 5BZDA 4KKLC 4NZUH 1WK0A 1LP9F 2DWEB 4J4PC 3WIHA 3MX0A 3D48R 3VGEA 2G5BA 2I27N 5CS7A 1U91B 1UCTA 4ZPTB 1FSKB 5D4QA 4CVWA 1JGVH 4HH9B 2XKUA 2IGFL 1A0QH 5D1XD 2VSCA 2X1WL 3EHBC 4S2SA 3SOBL 4RFOL 4X7TB 5KTEL 4JO3H 1A4JB 1KJVB 4ZOBA 3RWGA 4X4XB 1ZA3B 4IRSB 4J8RB 3V6OC 4M6OH 5E5MA 1QNZH 4MX7B 3QUKB 4E41A 4GOSA 1TJIL 3DNKA 2VLME 4MWFA 5CAYB 5HJ3B 3U6RB 4PG2A 1G7PA 4IRSD 4YPGB 4WHDA 3U7YL 3RX5A 3AAZB 3D25B 3IGAB 3S96A 1T2QH 2ZUQB 4MNQA 3MUY1 4OLXH 5DJ6B 5DRWA 1M1SA 3KPRA 1FYHB 4D0BA 5EUOF 4JN2B 4G8IA 4KTEH 3V0VB 4ZNEE 1XZ0B 4HW6A 2MNUA 4AYFA 4OT1L 5F9OH 2YBRB 2FEDD 3QHFL 4K23L 4Q2ZB 5C9KA 3QULA 5C0CE 4HIXL 3MRMA 4WUUD 4F15C 3GB7A 2XNAB 1FQ9C 2OSLA 1H3GA 4DVBA 1R0AH 2HVKB 2NW3A 2YKLL 4KMTH 5I8EA 2OR9H 2E27H 5T3XD 3GIZL 2X10A 1OW0A 3K1DA 2PUQT 3BP4A 1RZJL 1EBAA 3FFDA 4OLWH 2R2EB 4X8JB 4ZS7H 3BRFA 3LDBC 5E9DA 3BH9A 1CE6A 4POYA 3ARDC 3BN9C 1X9QA 3BZFB 1KB5B 2ZWLT 2Y1VA 3L3HA 3T3PE 1QLRA 2FL5B 3MLSH 3PWJB 5DO2C 4UDTA 5L0QB 2N7AA 5KS9F 3T3MF 1EPFA 1MHHB 1EEQA 2EXYD 4NKMA 4R3SB 4ZD3L 3EGSA 1C5DA 1T83C 3MLWL 3G6JB 1M71A 5DWUH 2QLVB 1SBSL 3PE9A 2YD5A 4MDJB 1J1OL 1FL5B 1MNUH 4HKXB 4N0FA 3FT2A 3Q6FB 2PXYC 5I1CH 1OTUC 5MEND 3CMOL 4G9FB 1NMBH 4LLUA 4ZFOB 4GBXB 4FHBD 4X7SH 1GGCH 1B90A 3U48A 1X7QA 4XCYA 1ZGLA 5E2TL 1PZUB 1CGYA 3WHXB 5KSAB 2FLBT 4G9FD 3WJLC 3QPQC 3VU2A 5EULV 1PD6A 1V05A 3U1SH 4NSKA 4FFZH 4N8VA 3IJHA 4P2QB 4IRJC 2HMIC 5DQJB 4PJAA 2XWTA 2K1MA 4NHUB 3RY4A 4WO4A 5C0RL 5J57B 1R5WB 3QAZC 1SVCP 1F8TL 4X5WA 3VXTA 5AAWA 3QI9A 2F54D 4OM1H 2WBJB 3G5ZA 4OFYD 5I15L 3DUHA 4YC2B 3P30H 1I85C 5B3NA 4LF3B 2CKBH 2R2BA 3QFDA 5IW1A 1FORL 1ORSB 1CD0A 4PRHE 2Z8SA 1NDGB 3UZQA 2VL5B 5AWNH 5EOCL 2OI9A 3ETBF 5FF6B 4KH2A 3U7WL 1GHFL 1ES0A 2CDEA 4X0KB 4GO6B 2PF6A 2FZ3A 1XGUA 1YZZA 3SBWA 3S3JA 5I18H 2NTFA 2Q20A 4PGEB 3V4VH 4NQEE 4DW2H 4L4VE 1J1PH 5JOPD 3VFUA 4OLYL 2N1KA 2NY2D 4RSVA 1BFOB 1FPTH 4R97C 5INCA 2SEBB 2FH8A 3H7BA 5IMKA 3RHWF 5BS0E 4P23C 3UTZB 1A14H 3LIZL 4WY7H 5GSRB 4I0PC 3ZDXE 4UT9H 4TVSa 2EKJA 4A6YL 3VI3F 3X3GH 8FABA 5ISZD 5HI3C 2VLJE 5JXAL 4P3WA 4OV5A 1A7QH 4APQB 4LLQB 2IQAA 2XACC 3BPLC 3HI5L 1OM3L 1KLGA 1NEZG 4FQJL 4FG6C 4GLRH 5A43C 5DHVA 3LRHA 1R3JB 1GOHA 2FSEA 4LQFH 4PJGF 5C2UB 1U0QA 2HKFH 4FQ1L 2H9GB 4HUXA 4OLUH 1DLFL 3GKWL 4GRWF 1RD6A 4KVCL 5T3XL 4Q0XH 4UQ2B 1GGTA 1R24B 3W9DB 4PY8I 2AEPH 3QUYB 3L95B 1WBXA 1SJEA 5FA4B 1L0XA 2IAMB 5E4IA 5CCKH 5EBMA 5FO9B 2VDML 3UZVB 4MQXC 4BFGA 2WUBL 4UOW0 3CVHH 3M45A 1LQVA 1HSBB 3QQ4A 1UB6B 1H3PH 3UO1L 3WN5A 4X7FC 3W0WB 1WZMA 4HKZA 1KTKE 3L3KA 2W9EL 3I02B 5KVEL 4NIKB 2NX5A 4OF5A 1NL0L 5SX5K 1S78D 3DIFA 3GI8H 3NGBC 3MA7B 2DQEL 3MZGB 2VLMD 1QFHA 3D69B 5F9WB 3PWNA 1AHWA 2BC4A 3LQAC 3MACH 4J3TA 4OCRL 5EO9A 5I1LA 1KCRH 2P8PA 3JTTA 3I6GB 4JPKH 5BOZG 3HG1B 2E6QA 1RMFH 4KXZI 4MVBA 4XP4L 3MRHB 5D5MB 4PP2B 3AREA 1W0WB 5FOJA 2EZ0D 4KZDL 1DUYA 4TNVK 3ULUH 2JB5H 4AEHL 3RWCA 1TCRA 3EBAA 5E7BA 1II4E 5HYFA 5L2KE 3WD5H 2P46B 3FQTB 3QEQE 3AC0A 2WAHA 3T0EE 4JFHD 4BZYA 1EEYB 4JY6B 2G60H 4MMXC 4LKCA 5C0CD 1Z3GL 4PJCA 1EZVX 1T03H 4G7VL 1BFSA 4UBDD 1OB1A 4LCUB 2P5EE 4Z76A 1A1MB 4JCLA 5B21A 1AGFA 4QTHB 2H32H 4WEUD 2FO4B 3P9WB 4JM2C 1BWWA 4PB9L 4YHZH 3VFSB 4C58B 3O4LE 2DIJA 2DBLL 5IHBA 3MODL 1J0JA 3OAZK 5BZWB 3LSOB 4NT6B 5KVMC 2RGSA 4PJEB 4YLQT 5I30L 1CD9B 5D2LF 5DQDL 1J8HA 1MHEB 4YBQD 1CGVA 4P46C 1HH9A 3KPLA 4U1GB 1AR1C 4XVUD 1G7IA 1IMHC 4RGNC 1UEMA 4P57A 1DZBA 3CDFA 3IS0X 3TH4T 2AJUH 2FGWH 4CW1A 1LK3L 4LCCB 4Y89A 5GS3A 4JRXB 3LKQA 1HI6B 4BSWB 3MLZH 4X9FA 1FCGA 5DJXB 1VA9A 3OV6A 3P11L 5EFIA 4Z9KB 5SWSA 3PWUB 1CGWA 5HYSB 1E4XL 1KOAA 2ICEA 5IR1A 4NQUA 2J8UA 5DUBB 4JFEB 4CMHC 2YSSB 3ALXA 4PJXF 1G7QB 3RWFA 4OCYH 4FOMA 3HC0A 4PV8A 3LHPH 2H32B 3NCYS 4QRPA 3QCVL 2NXYB 2AJXL 3AMKA 1BQHB 1R3KA 2M1KA 4JFED 4Z7WB 4JVPA 2DOCA 3QQ9C 1EK3A 5J11B 1NFDA 3VDCA 4BH8A 1BMGA 5KVFL 3SE9L 2NY6C 5HY9B 4GG8A 4X5LA 1JTPA 3Q1SL 3HAEG 4BUGA 4G8FA 4NJ9H 3LQAH 4JKLA 5JUEH 1MLCA 3DSFL 4XPGH 3L3IA 2G9HA 4AIOA 3W2DH 2YR3A 5CEYB 1JFQH 3GIVB 5K9KB 1FCCA 4ZUWA 3O6KH 1YECH 3GK8H 4P4RB 1TVHA 4PRHD 5LAXA 3BHBA 3T0BA 5TFSH 1S7WA 3L7EB 4XXCA 1OAUL 3WCYA 4ERSH 1XT5A 4JFOA 4L3EE 1B0WA 1WWCA 4LRIC 4PGDB 3VGBA 2J6EA 3SKJH 4M43L 1JPSH 5CWSB 5E8PB 4Z7VB 3VGAB 4NFDA 4L4VD 1U2CA 4ZXBD 1V5JA 2DKSA 4R26L 4WTZG 4XP6L 3DTXB 4JZOA 3IDGB 4FRWA 3EOAB 4M4PA 4L8DB 4EUPB 5C2BL 1ZVSB 2EICA 4YR6B 5SWZB 5BS0D 3OGOE 1I1AB 2VXQH 4FFWD 1HHHB 3WLWC 3EO0A 1R3IH 4HAFA 1NC2A 3ZKMD 4DVRL 2LAAA 2KBGA 1DBJL 1LVEA 1VFAA 4UTBH 4E5XB 2WUCL 5AAMA 1ITCA 1A6VH 4QO1A 3PIQA 4RMTA 4UQ3A 5ADOL 5KAQF 5F7YC 4H8WC 2ILLA 2VXUL 5KAQG 1SYVA 2F5AH 3IAQA 1QOKA 1Q0XL 5F6IB 3E1F1 5CP7A 2OBGA 3T0VA 2GKIA 5DMIL 5I1DB 4POUB 3O6ML 4TUJA 1S7RB 4M1CC 1ZGLM 1RUQH 1HCFX 5C0IB 3WFCL 5A2IH 3RPIA 1MHCB 5EN2B 4E41E 4V1DA 4TNWK 3KPSA 3X13A 3NPSC 4CVXA 4AH2B 2X7LA 2UUDH 3ECBA 2H3NA 5I71C 2Q6WB 4DUXA 3HKFA 4OCSL 3RU8L 5FOBB 1P6AB 1LD9A 2DDQL 5GRWA 2VLKD 1CQYA 2YN3A 4UILL 3OF6A 3HE7B 4OD1H 3MYJA 2B0SH 3DX8A 3TBTA 1X5XA 2YD6A 2OK0L 4UT7H 3D3VE 1JMZA 4G42A 4LVOB 1CS6A 1R5IB 1MREL 2DTMH 2V9RA 2FGZA 4KKNA 3EKCA 5ESAA 4NP4L 2W65B 5E8OA 5TH2B 2VITB 4ZO6A 3SDXF 3S9DB 1D5XA 3S3SA 1X5ZA 3SDYH 3GSUB 4F8QA 2O5XL 1S9WB 5AYUH 3Q3GA 2DM4A 1AQDB 4P0DA 5HVHC 1S7VB 4JQIL 5IFHH 3UTPD 2NZIA 2ORBH 4H25A 4A2MA 1JPTL 5KSVB 1ZV5A 4DGIH 5E9DE 5I1JL 4F2MA 4G80B 1I3VA 1XF4A 1JK8B 2EIBA 2W59A 3TT3L 4WI2A 4HGWA 1N26A 3BH8A 3P9MB 4WFGE 3T0ED 5KSBF 1TLKA 4PYGA 5KJRH 4RDQF 2Z8VC 4ZQKA 5HBBA 1CLOL 3HMXA 4KKAC 4RDQG 5CJQL 3DLQR 2GSGB 2VH5L 4JGJA 4YHLL 4TTGA 4Z7QF 4EKXA 3STZA 4GUPB 2P5ED 1FE8L 2NY0C 1O0VA 1BQLL 4TSAL 3JWOC 2VDNH 1FYTD 4BKLA 3RVWD 3O4LD 1OSPH 5GRUH 4JPWH 4J1UA 5F89A 4X4ZA 3BPOC 2Y06L 4QRQA 4XNXH 1S7SB 4J6RL 3LKPB 4M7KH 3OKKA 2ADGB 3SO3C 4NWUH 5EZIH 4U49A 5E94B 2VZ3A 4MXQC 5F9AC 1XIWD 4K07A 1A3LH 3HAEA 3TYFA 1T7XA 1FC1A 1G7LA 5DA4A 1P69B 2W0FA 3KXFA 4NYLB 3AU1A 1NCBH 4AL8H 3EYUL 1V3KA 3B4NA 4PJAE 3VGGA 5DLMH 3K81A 1FO0A 2W9DL 1T66C 4LSUL 5H35A 3BX7C 4Y5VA 1S7QA 3DMMD 2DLEA 1K4CB 3ARFA 4LSSL 1PG7L 1F00I 1QSEA 2Z35B 5CEZE 5K59E 4AM0B 1FZJB 2E8ZA 1CICD 3G04A 4Y4HC 1N59A 4OI8A 5FB8B 4WTZA 1BBDL 1YDPB 5IF0B 5T3ZH 1YUHB 4ZFFB 3NCJL 3GBML 3MLPA 1JGEA 3QUZD 2JE8A 1A6TB 4X6DF 1B9ZA 3HRZA 1EGJA 5B39G 2Q86B 3EJYC 2QR0B 2E9WA 2D7OA 4X6CA 1FVDA 4GKSB 1CF8H 4OLEA 1BZ9A 1DJSA 1A9BB 2XA8H 4LSTL 2PYFB 5KANI 1FH5H 3VMOA 5IIEA 3IXTA 5EZLA 1D9KB 3AMLA 4OZFB 1FZKB 3VWKB 3Q6GH 4NO0A 3LKOA 2BNQB 4NPYB 5IW3A 1VDGA 2VISA 1RFDH 4U6VH 1W72A 4JLRB 3VWKD 1IEAB 1HHGA 3GI9L 1YPZF 4V3DB 4OCNC 2WP3T 3UJIL 1HHIA 3PGFH 5BV7C 2IPUK 2BOBA 2AK4A 5DD5H 3JWOH 2ED9A 3AB0C 1G7HA 3QCTH 3DJ9A 3F7PC 4M7ZC 4OD3L 2YZ8A 3FFCE 3BP6B 5IEHA 1J5OH 1CYGA 4KI5D 1NBVL 2HRPH 3OPZH 3BZ4A 5KN5A 3SJVB 1HHKB 1QR4A 3HI1B 3LN9A 1ZHLA 4EN3B 3P0YL 5J6HA 4I18A 1TPXC 3IU3B 2RIKA 3GJEB 5HHOA 1F6AA 4P59L 2FD6H 2H41A 4NBYB 3TNMB 3WFHA 1CGSH 5FCSH 3F7YA 5CMAB 1Y6KR 5T33L 3ARGD 4JZJB 3PL6A 5D7JB 4EN3D 1JF6A 4R4BA 2DQUH 5DEFB 4QRRE 3F6LA 1SJVA 3E3QC 3ZKND 3P9LA 1BVLA 4BSVA 3BD3A 3CX5K 3CNKA 5BRZD 1JPST 3DX7A 4S11A 1RUAH 2VQ1B 2IQ9H 4NRYB 2GTZA 3DV4B 1I1CA 1L4IA 3RGVC 2RB8A 3O9WA 2B2XL 1FL6A 2R4SL 4F3FA 1Q94B 1INDH 3UTSA 3RVUC 2XQYG 4KKCC 1A3RL 2FX7L 3RTQC 1P1ZB 4N8CH 1CIUA 1RZIA 4XPFL 5DI8B 1U2HA 4QTIH 1RUPH 4LBEB 3OKNB 4LSRL 2FHFA 1L6ZA 2ICCA 4IDJH 3WKNA 2ICWB 4F58L 1OQOA 3HZKA 4ETQA 3SDAC 1WC7B 4U1MB 1U3YA 1IJ9A 4Q9QH 4PJCE 3U36B 1DSFL 3V4PH 2ZUWA 3AGVA 3TVMC 4HLJA 4E42B 2VXVH 4JFZL 5E99H 3HE6C 4M48H 4UI2A 1RZJC 3BZEA 3V8CA 3NIGE 2X09A 5CILH 4AIZA 1H8NA 3O8XD 4AEEA 4L4TB 5ESQB 4R9HA 3MLVL 1KEMH 1LO2H 4R96B 1GZPB 1FZMA 3UJTH 4OD2A 1TNMA 3BQUA 3VWJA 1J8HE 4YHNA 2AXFA 1FFNB 1OTSC 4KJWC 2R56H 5EU6B 4WFGD 1FGVL 3DUSA 1HEZA 4NQDA 2QQKH 4ZTPH 5B3JE 1CDHA 2ARJQ 4MSWB 4BZ2L 4LVNB 3TBVB 5DMGC 1U92B 1N6UA 4TRPH 4IIQA 1PFCA 3U4BH 4OFVA 4HH8A 3BIKA 4Q9RL 2YN5A 3PWVB 4WFEE 1ZHKA 5CGYD 4FABH 4PY7B 5AUMB 3MJ9A 3QJFA 2BMKB 4M62L 4X9GA 4WWID 4ELME 4QOKD 2YD4A 4NRXA 5B39A 1JWMA 4GRLB 2P1YA 3B2VL 2Z4QA 3LRGA 1MIEH 2I26N 3G6JF 1HQRB 4PTTB 4WWKC 3SCMD 4EVNB 1INEL 2Y25A 3THMH 1P7QB 3WL9B 4HV8A 5IBTL 1KJ3L 1D6VL 4RFOH 3S6CA 3V4UL 1XR8A 5KTEH 4GRLD 1P7KA 1EV2E 4Y4FA 3C5JA 5GGQL 2WK2A 3GSRA 1HNFA 1BJ8A 1HOCA 4ODBD 25C8H 4RGOL 3I2CH 3ZTJG 1A02N 3QDMB 5EZOL 5MEPA 2BNRA 3RL1A 3V6FB 2NXZD 2R0KL 2AEWA 1S7XB 1L6XA 3VGHA 3U7YH 5EZJB 1TZGL 4NQCE 4XTRD 2XFXA 5MEOB 4AT6B 3VXPA 2XI9A 5TE7H 1ETZB 4G6KL 4F57H 1FNGB 5C07E 12E8H 4JGUA 3RKPA 5E8EA 5D1XC 4NNYB 4FQQA 4OT1H 1K8IB 4ODXA 4I8DA 3T2OA 2EXWD 2RR3A 1UXSB 3TNNB 4K23H 4IOIA 4HIXH 1O7SA 3SGJA 5IVXA 4CN4A 4JAMB 4PRDB 2KZWA 4Y5XC 2EIZA 3FQWB 2EDFA 4AY0A 1XR9B 4HIHA 5FUZL 4YDJB 2YKLH 4WV1C 1ZLVH 1CE1H 3GIZH 3BXNB 3BP5A 3H9SB 1LWRA 3WFEH 3N85L 3OR6B 3BPNC 5SX4I 4NQSB 5EWIL 1J05B 2XRAL 5D6CA 5J9PB 2HT3D 3CSYB 5SV3A 3T2NH 3NIDE 2VWEE 1GXEA 3H9SD 2P24A 4PRPE 2V2WB 5DK2B 4JHAL 4KAQL 1QFPA 2UZIL 3OG4B 5GSVB 3VXNB 1RJYA 2FEDC 1HQ4A 2Q7NA 4ZS6D 4M02A 2CDGB 4X6FA 3MLWH 3D2UA 2Z31B 2E3VA 1GPOL 3QH3A 4GW1A 4JO2L 3B3IA 4NNPH 3QDJB 1AIFB 4UNUA 3RI5K 2F58L 4R7DA 1OP5H 3VCLA 1K5NB 2EYSB 4ZAKD 1FJ1A 2Z31D 2EE3A 5IB4A 1XH3B 3EYSL 1S9XB 3UPCA 4P5TD 1DDHA 2V17L 1LQSR 3DXAA 2M2DA 1YN6B 1UZ6E 4Y8AA 3FO1B 5DF0A 3T4AA 5C08B 2PNDA 3QNYB 2FX9L 1T1YA 1I1YA 3GSVB 2EXYC 3VXRE 2X89A 4F7MA 3D39E 3I75A 4L9DA 4M6AA 2VAAB 5C0RH 3UBXA 1I1RA 5C08D 3DYPA 2A6KA 4I9WD 2PYEE 2IANA 3QQ3A 1JNHB 5DJ6A 3OZ9L 5TPWL 1JNLL 5DHYB 1EMTH 4QRRD 4HJGA 5I15H 4OQTA 2G2RA 2IFGA 4Y4KA 4G8GB 3VGFA 4WUKL 1FORH 1SY6A 1F4XL 4N1EA 1EO5A 1ACYL 2OZ4L 1TTFA 5IM7A 3P0VL 5ALBL 3GKZA 4G9DB 2HG5A 2WINB 4LDLB 3U7WH 3GMRA 1NAMB 5DFWH 1NGYB 2P42B 4L3AA 3SE4A 3LKRB 1UQSA 4U6HB 1RIUL 4Y1AB 1KYOK 4KTDL 3HNVH 5JW5B 2EDDA 3O45A 4YDLB 3GSNB 1RPQA 4NNXB 3MV8B 2A6DA 4OLYH 3QIWA 4KZEH 5T5FL 3C2SA 5BO1H 2VL4A 2NMSA 4J3UA 5CEZL 2YD3A 2XXMB 4UDUB 3PWPB 2JJSA 3VFTA 5D5MF 3DECA 4YFLF 4PBVC 3MV8D 5I1IH 3LIZH 1RZGB 2BY2A 1TTGA 3O2DL 4A6YH 3X12B 3LN5A 3CSGA 5F8RC 3PWPD 2E7LC 1B0GB 5JXAH 2P8LA 4JHWL 4CAGA 3N1QC 4UOJA 4F9PC 3GM0A 4FQJH 2MTPA 1OM3H 5IG7B 3TPKA 3FJTA 5IMLA 4UAOC 3TJHA 5JTWA 1MJ8H 2UY7A 5IK3A 3DX6B 5MHSE 5F8QC 2NY2C 4FQ1H 5I75B 4KVCH 3TIEA 1UZ8B 3T09A 3KXFE 3U2SA 4QLRA 2J2ZA 1TQCB 4D8PB 1WFOA 2E5EA 4F7CB 4PJEF 3BYTA 4OUUA 2PKDA 4QF1A 2VLRE 2FWOB 1U3JA 2JJVA 4R4FL 5IVZA 2F19L 5T1KB 3O3AB 4HUWB 2ZCLL 4HPYH 4LNVA 2JIXB 4ONGL 3QEGL 1SVZA 3QB7C 4RNRB 5FV2A 4UT6H 3QFJE 3L3DB 2J5LC 1C7SA 4GS7B 4U1NB 4XGZA 1ZA6A 1KPUA 4LF3A 4WNQB 4IHOB 3GBNH 1N5YH 4MNHB 2W9EH 4PJHE 3QZWB 3K0WA 5KVEH 1NL0H 2ZSWB 1K4DB 1YEDB 2OCFD 4JRYB 1P6FA 3CJJA 1W8NA 1E28B 5BQ7B 5IFJB 1RI8A 4YHYC 4WTWA 1JV5A 4OCRH 5HYSG 1JZ5A 4J4PA 3FO2A 4OF0A 2PO6B 3GSQB 4YX2L 2APWA 1YYLL 3D18B 4NQCD 4XP4H 4JRYD 5D71H 4AENA 5IMMA 3D85A 1QRKA 3C8DA 4KJYA 2KL6A 3TP4A 5FDYA 5DD6B 4WCYL 1ZHBB 4KZDH 5EIIA 3DI3B 4Z7WF 1TMCB 5ETUA 1BQHG 5AEAA 2C1OA 1MWAB 1MCKA 4ZDHB 3P77B 3OL2A 3V6OA 3G5VB 3ZDZF 2NY3D 3DSNA 1Z3GH 4XAKD 5FYLE 1J87A 4JREC 1H3TA 4JKWA 1S78C 1CLYL 4YO0B 2R0ZH 3LMJL 1NMAL 4PGZA 2BVYA 4U3CA 3CFEB 2AK4E 4PB9H 3MXWL 2B1AH 2CKBA 3EJJX 3P4MB 3NFNA 5DRXA 3OKLA 1EUUA 3IVKA 4YDKL 2F9BT 4TVPH 1CD1A 2EZ0C 1DN2A 5F3HA 1YMMD 5DQDH 5C7XH 5I30H 3ZSSA 3VJ6B 4NCC2 1QSVA 4MAYD 4PRPD 1UWXK 5BCAA 1YJDL 4Z7VF 5DC9B 2AJVL 4GJTB 5D96B 2CLZA 4GSDL 3V0WH 4YE4L 4XBGB 2FIKB 4JFPA 1DEEB 5JHDE 1MVFA 3TO2A 4HKJA 5ACZB 4X4ME 1LO3H 4FXKB 1MRCL 5HGDA 1NGQH 5HHOE 5FKAA 3HLAB 3O4OC 2DMBA 3PWLB 4XNQA 1S3KH 5IVNA 1MCIA 4XI5D 4RMUA 4EUPG 1FG2B 3M1BA 4D0DB 1P5UA 3P11H 3WJJC 3OJDA 3GMPB 5IMOB 4U6TA 3X11B 1E4XH 3KPQB 3LKSB 2ARJA 3ARDA 1CXEA 4XWGL 5C0ND 1P4LB 1KIRB 5I66A 3S88L 1HKLH 5FKPB 1PY4A 3QUML 5C09B 5IB2B 1QFUH 3I9GL 1IAKA 3QCVH 5FK9B 1T83A 3JV6B 3M07A 4ZUTB 1JGDA 1PSKH 2GY5A 5GGRB 4R2GB 3I6GA 3GMOB 1FFOB 3ELAT 3PQYB 5I8CA 2OQJB 5F1IB 4QHMA 5KVFH 5J1TC 1W0VB 2PXYA 2WLZA 3SE9H 5A2FA 5K93A 3VDBA 5EO0A 3Q1SH 2BK8A 3BKJL 4M7JL 4R2GD 5DK0A 3DSFH 4BQ8A 3BGFB 5TDPB 3CFDA 2YUXA 4KHTL 5HYQB 3VXSB 1KPRA 2ZCKL 3WJLA 5D93B 2XZCH 1EEZA 3SGDI 4F7PA 2Q7YA 2CR3A 3CVHA 4WEMB 5FO8B 1OAUH 2XPGA 3U7AA 3SKNA 2A77L 2BNUB 2VRAA 4K2UH 4QTHA 1IL1B 1U3HB 4MNGA 4TTDD 1IC4L 3T0AA 1G6RA 1WV7T 4M43H 4JY5L 3VFPA 1JRHI 5CEXB 4OSUH 1IM9D 1U3HD 3WUWB 1I85A 4HS8H 5HYJD 4XP6H 4NN5C 2EC9U 4PJ5A 3VI4F 2ESVE 5GISL 3WDIA 5C2BH 3R0NA 2GJZB 5EDXA 3TZVC 3O3EA 4HMCA 4WENB 5AD0A 5I19L 2HVJB 4X4YA 4QHLB 5HDLA 4TYUA 3MNVA 4DVRH 1DBJH 4RBPK 4FQPA 4DN3L 1HI6A 4U1SA 1PKQE 1UJ3B 5ADOH 2BXYA 5K9QG 1MOEA 3BP7A 1ZANL 4DOHE 3MRPB 1AKJA 3TA3D 2IH3A 4K55A 2VXUH 3ULVE 2BJML 1CG9A 3E2HC 4OZHE 4IRZH 4O2EA 1X6LA 5JHLL 1Q0XH 5DUBA 1RV6X 4ZXBC 1RUKL 5DK3A 5DJYB 3WFZA 1BQUA 4U3XA 3WV0A 5DMIH 1H3WM 4P23A 3O6MH 1I7ZB 4Y2DC 5HDQL 3CZJA 4ODUA 1AGDA 1D5MA 2R1XB 4I0PA 1C08B 2WWKO 3WFCH 1YA5A 4NHCL 1LNUB 1PX4A 1RSFA 4ZPVA 5GGSB 2BNRE 3ZKMC 3I50L 2RAMA 4W6YB 2CUHA 1E4WL 4OCSH 3OWEA 3RU8H 4CNIB 2DDQH 3E6FB 5D7IF 1HXYA 4Z78A 2VDKH 4UILH 3QDHA 2A73B 1EFQA 5IB1A 3QEHB 2CQVA 1QVOA 1I3RA 2CR6A 4WFHE 3RZCC 3MCLL 1C1EL 1UA6H 4IM8A 4NOBA 4XZUA 4RAUB 2OK0H 3CDGA 1YY8B 1E6JH 2AKRA 4URTB 1MREH 3U0TB 5IVXE 4OZIE 2CIKA 3NABL 4NP4H 4EBQH 4HQQL 3RWEA 2O5XH 3QPXL 2QSCL 3HFML 5EA0L 2C3VA 3TBYA 2GTWB 3OKOA 1IGFL 2AVGA 4XMPL 3ARYA 4RISH 3VXUD 4I2XB 1JPTH 2BZDA 1PYWA 4CBPA 4LAJH 1VPOL 1DLHA 3TT3H 1I1AA 5ICXA 1HHHA 4HJ0D 3FB6B 5D1ZD 1QBML 5FYLD 2VH5H 5JMOC 4YHLH 4H0IA 5F7DA 2XKNA 4PYHA 1FE8H 1IAIL 5DFVC 1BQLH 3FN0L 2QADB 3C8KA 2HJFB 3B6SB 1TJHL 4KJQD 2ZKHH 1G0YR 2Z92B 5HI5D 2YRPA 3FAWA 4TSCL 1HINL 1A7OL 1I1FA 5DTFB 4J6RH 5IESL 5IB5A 4PP8C 3MYZA 1KG0B 4ZUUA 3PNWB 4MA3B 4FTVD 2M8XA 3C9NB 4LPWA 5FA3B 3EIFA 4OZ4A 5C0IA 3EFFB 4Y16B 3T0EC 3BSZH 4KI5F 3RKDC 2CRMA 1IGYB 1PAMA 2Y6SD 4YHIA 5E00B 1DVFD 1F4WL 2F8XC 1MPAH 2W0LA 2X4UB 4D3CL 4JM2A 4NWTL 2YD2A 4Y16D 1YEIL 2MQCA 3FT4A 1OSZA 5E4EB 3JUZA 1DL7L 1MI5B 5JPNA 5EU7E 3T65A 3CH1B 1Z0NA 5A2KH 3F7VA 2CSPA 1A64A 4LSSH 4RMRA 4XH2B 5DYOB 1PG7H 5EORL 3RVWC 4HKBB 3LS5H 4UU9B 4RMWA 4X6EA 4P46A 1R5IA 4XPTL 1HH6B 1GIGL 1UFUA 2EE2A 3LEXA 3RWJA 1XIWC 3QHZH 2IFFL 3OR7A 4DCQA 2Q76A 2IF7A 1JWSB 3GBMH 4OQ1A 1LO4L 5J4MA 2AV7B 4Q9BA 5HSFA 1Q9OA 3B2UD 4U1IB 1HXMA 1YMHA 3BKYL 4HWZA 1F3DH 1AD9A 3TPUA 1RVFH 2P5WA 3ZE0F 4JFDA 1MCSA 2LVCA 1WAAA 1TJGH 1M7DB 4LSTH 3DMMC 4LEXL 4NQEB 3KYOA 5FGBA 2X4QB 5ABDE 3P9MA 1QFWL 1CICC 5F9JB 4M4RA 1ZE3C 3HZVA 4O58L 3P73B 3M17B 4LMQE 3LRSB 4L8SB 1C5CL 4XNZC 3L5WB 4U3HA 3BE1L 4RA0C 4W70A 3JXAA 4DGVL 3QUZC 4YHPA 5C0DB 4YBLC 2QBWA 3GI9H 1HDMB 5HGBB 4MXVF 4R8WL 4YWGH 4D2NA 3KYKL 3UJIH 2AXJA 4NUGL 4GKZB 2A6IB 1TNNA 4RZCA 1AE6L 1WZ1H 2E7MA 2ESVD 2K9UA 4JJ5B 5ENWA 4OD3H 3AM8C 5B4MC 3V52H 2DQDH 4WU7A 1H3XA 1NBVH 3IDXL 3RUGE 2GUOB 4LHUB 5EUKB 4O2FA 4LRIA 1N2RB 3LN4A 5CGTA 3CH8A 4CVZB 5JR1L 1JWUA 1U3ZA 4HIJB 2D4DA 3P0YH 4JM4L 4P59H 4NZDA 4JPIB 2R1WA 2XT1B 1G7JA 4JDZA 5FYLL 2B20A 3RWIB 5T33H 2H2PD 1P2CB 3DV6A 5D70L 4HUVB 5HHME 5DMKB 2OTWB 1UT9A 2QKIA 3FB7B 2DRUA 4I48B 5KZCB 1IEHA 1L8JA 5IFAL 3K74B 5FYJE 1DQML 3M8OL 2O5ZL 1BOGB 1YN7A 1N7ML 5EOQL 4Y5YB 2B2XH 1LO5B 4OIIL 1NANI 2HN7A 2R4SH 3U4EA 1VACB 5DA0B 4P3CL 5FM5O 2FX7H 4HZLA 4M1GL 4Z7UB 1OD9A 1KCSH 4GQ9L 2DQFA 3MNZB 4NN6C 3VDAA 4XPFH 4UIMA 4MD0B 5HDBE 3JTSB 4MAUH 2XN9A 3ARGC 3LQMA 4XXDA 3P4NA 2BVQA 5HHNB 1MFNA 2W91A 5I1KH 4JG1L 5M94B 1KPVA 1JPFB 1OTTD 1MJ7H 3MUZ1 2UWEE 4K8RD 3T4YB 2WQ8A 5IROC 3IFPB 3VH8B 3KPMB 4JZJC 4JFZH 3L3JB 5SWQA 4LDEB 3ZYJA 3AXLA 2DS4A 1DQQA 5ILTL 4PGBA 1NGXA 3ULSA 4Z95L 2RQ8A 1X5LA 4WTXA 5TDOB 3MLVH 2FO1A 2JCCB 2DIAA 1LDPH 2UYLB 4ORZC 4PS4L 4PJFF 2MSPA 3QXTA 2A1WL 3QIBD 2DMCA 2Y5EA 2E8YA 1HHKA 3ZT5A 3TBSB 3P2TA 4C56B 4HHAB 4N8PA 1L7TL 3C5ZC 4LLMB 3CZFB 3IU3A 2B7DT 4X7DC 1BHGA 2VABB 3WE6A 4OBSA 4BFBD 4M62H 1QKZH 1SJHB 5EU5A 1U8MA 1U8NA 5J12C 1KN4L 3O8XC 3S8WA 1BOYA 3CLFL 2BVOA 1MFDL 4OAWB 1NCUA 5J7CC 3IDYB 4NC1C 4L9LB 1INEH 1O7VA 1L7IH 1KJ3H 1D6VH 3DRQB 5TJWK 3V4UH 1X5JA 2EDQA 1UENA 4Z0XA 5TE4L 3ARTA 1A1NA 1DBBL 4BH7B 1U8KB 2NCMA 5LXGL 5EZOH 3EO1B 3NIFE 1HCVA 4LLVA 3GM8A 5E2UH 2R0KH 4MB3A 3KR3L 4U6XB 4QHKI 1A21A 4XX1G 5CGYC 3WKML 2ERJC 4NCDA 1TZGH 3QUXB 1H0DB 3FONB 4K3EL 4G6KH 4MXQA 3FB5A 2GFBB 4HXBH 2R23B 2ZPKL 2YPLB 2V5RA 5ID0A 2GY7B 1NBYB 2VTFA 3B43A 3QUXD 4MA8H 3SCMC 4L8CA 2WY3A 3AS2A 3ARBB 3TGXA 3QHTC 5HTSA 2FJHB 4PJ7A 1INQA 3ESVF 3KPPA 3PXHA 1CFQA 3TESA 2XTJE 4LLYA 5T1LA 1ZXQA 4FS0A 2FIRT 4L29B 4L3EB 4OI9A 5HHXL 4B5EA 1E27B 1XGTB 2ITCB 2V7NB 3NH7L 5E08L 4LKXB 1GZPA 2NXZC 3N85H 3IJSB 2P43B 3ILQD 5EWIH 4Y4HA 2XRAH 3MRDA 4XTRC 4LLDB 1PLGH 3HPJA 4R0LC 3MR9A 3CFKB 4JFFA 4OKVB 5B38B 3MV9D 4XC3L 1KELL 1A5FL 2XQBL 1FNEA 4JHAH 1KUMA 3WNKA 3K1KC 4PRAB 3HC3L 1ZS8B 2EDKA 5F1OB 2FX8L 5I16A 3NTCL 2R0WL 4PY7A 3BFOA 1I3GH 3FT3A 4ZFGH 1GPOH 5BZDB 3LOWA 3S5LA 3O2VL 2G5BB 5EUOE 1QQDB 5D7KD 1CFSA 4W4OC 1MEXL 1I7UA 4PFEA 3TV3L 4S2SB 3VXMD 1JMXA 2R2HA 5L8JB 4Q74A 3ES6A 3RWGB 2EECA 2IH1B 3UBXI 2A83A 4XVTL 4MA1C 4R90H 5LGHL 3CGTA 5E6YA 4E41B 3QDMA 4OZGA 4UIKL 2E9IA 4MWFB 4PGJA 2V2TA 1G7PB 4JO4L 3ZYIA 3FMGL 1YYML 2IADA 3D5OF 3CX2A 4TQEL 2KZ1B 4PJ9D 4BFEA 3S96B 3S35L 4MNQB 4PJDA 5TPWH 4RFNB 1JNLH 3MLXL 5GGVH 1AXTL 4JB9L 3KPRB 3L5XH 4NDMA 3MGOA 5HHMD 4D0BB 3U9PH 2APVA 1QRNA 3MRBA 4UB0L 4ZAKC 3MJ7A 4G8IB 4WHYH 3UPRA 2Z31C 1WEJL 5KS9E 3T3ME 2XG4A 3OAYH 1R5VA 1UXSA 4Y19A 4XCCH 1VSCA 2AERT 4WUKH 4P5TC 3KPRD 1F4XH 2DI7A 3QULB 1U8HA 1ACYH 2OZ4H 4Z7NF 1HZHL 3MRMB 4P4KD 5ALBH 3B8YA 1NCDL 2I07A 3GB7B 2OSLB 4DVBB 1JHLL 5IHUL 2NW3B 3AS3A 3GDBA 3BXNA 4DQOL 5I8EB 1BP3B 1GL4B 2H26B 4U4BA 1RIUH 4KTDH 3BP4B 4IBLT 4P2RA 3DVGA 1BIIA 5CBAA 3FFDB 4TUKL 3VRLE 4D9RE 5T5FH 3E3QA 2X5PA 5E9DB 3BH9B 5GQBA 1CE6B 3JZ7A 3CU1A 5DK2A 5E56A 1WITA 5CEZH 3L3HB 1QLRB 4JFXA 3N1GC 2DD8H 4UDTB 1U58A 5K9JL 2X40A 3RGVA 4NKMB 4ORGA 3EGSB 2LFGA 4J12A 1IBGH 1C5DB 1M71B 4QRUA 2X4TA 1G6VK 1GVIA 5E03A 3NCMA 4JHWH 3RTQA 4N0FB 2HFTA 1ZLWH 1PW3A 1ROWA 3FT2B 2H45A 1QSFA 2COQA 4G3YL 1YJDC 1JGLH 4LLUB 3RX8A 3C60C 4O5LL 2DQJH 2AV1A 4S1QL 4LCWA 1MCLA 3SDAA 1REIA 1X7QB 4XCYB 1ZGLB 4S1DD 1NCCL 2CKNA 4FXGA 5FYJU 1B3JA 5DS8A 3TVMA 5DDHA 3FO1A 3D0LA 4TNVF 1CVRA 4ZOEA 3HE6A 4YDLC 1H5BC 4NSKB 4N8VB 3IJHB 4PJAB 1Z9MA 2I5YL 2XWTB 4WO4B 5F1NA 4R4FH 2F19H 1G9ML 2ZCLH 3LPFA 4X5WB 2EH8H 2FNBA 3QEGH 1KTRL 3VXTB 1BX2A 1IC1A 3QI9B 1KENL 3G5ZB 1EA9C 3TYGL 1DBKH 5HI4D 4YDIL 2R2BB 1X4XA 5DVMA 3QFDB 5IW1B 1CR9L 3CFCL 3WNPA 1QUNA 2CXGA 3VI3E 1CFVH 1IRAY 3OKYA 1U42A 2OI9B 4XBEH 5JOEA 1CWVA 3WIHL 1NQBA 3RNQA 5I1EL 4JFDE 1ES0B 2CDEB 3UTTA 2H1PL 1WAAE 2VDLH 4JPVL 2CLVA 4YX2H 1YYLH 2FZ3B 1XGUB 4PJGE 4QT5A 2NTFB 3UTQA 4KUCD 1P5VA 3FZUC 1QPPA 1WIUA 3VFUB 1IVLA 4GRWE 1WBYA 3CFIC 1YEFL 5INCB 4OCWH 3U0WL 3MGTB 5JIKA 3H7BB 3ZL4L 1AO7A 5IMKB 3EJZC 1MHPH 1RAMA 1RZGA 2D31A 4LU5H 1UWXH 1G7MA 4S0TD 2ZOLA 5JORA 1GGBH 4JHBA 2CK0L 3C09B 4H1LH 1VEPA 2XTJD 1V7NH 8FABB 3WXWL 3LMJH 1U8IB 1OGAD 4OV5B 1FVCA 3MXWH 2IQAB 1KLGB 4LCYA 3V0AC 1MF2L 5DHVB 3BEVA 3NFPA 2AJZA 4WHTA 1ONQA 5D1XA 4HUXB 3QDGE 1A7RH 2FYYA 4M1DL 2ED8A 4GSDH 4YE4H 4XNUL 1WBXB 4Y5XA 3DPBA 2NY3C 5GS0D 1AXSA 2F53E 3NCEB 3STLA 2Y36L 4WV1A 3ARSA 5CSGA 5EBMB 3CPLA 3BYYA 2ARWA 3Q5OA 2OYPA 1F3RB 1NDMA 2MQ0A 2R39A 4GW4A 3KNBA 3QQ4B 3WN5B 3RZWA 1CK0L 4QGTA 1I8LC 3P0GB 3B9VA 4A6YA 5EPMA 4HKZB 1JNNL 1K9TA 3FO9A 4EI5D 3L3KB 2HT4D 5I74C 1F6LL 3MRKA 3MRNA 1YNLL 2VWEC 2NX5B 1KF9B 4J23A 4MAYC 3QUMH 3DIFB 3FL7A 5BMFH 4OBRA 5C0BE 4YHOL 3PWNB 1AHWB 1MY5A 2BC4B 4NC2B 4WUUA 5I1LB 1M4KA 4RWYL 3WDJA 3VA2C 1LE9A 2ATKA 2AABL 3JTTB 1WQVT 5FECA 5CSZA 4AEIL 4KGJA 4XI5C 3AREB 1X4ZA 5D2LE 5DR5H 3BKJH 1DUYB 3FRPG 2I9LA 3RWCB 2HAZA 1CXIA 1TCRB 4F9LC 1FZOA 4HJJL 4B41A 3P77A 3QG6A 4MVBD 3FO0L 1D5IH 3ARED 2ZCKH 4IMKC 3ME0A 3WUZA 4LKCB 4CKVX 4K71C 1NLBH 4PJCB 5I9QC 1JTOA 3G5XA 4U1JA 4QYOA 1OB1B 2A77H 4NO5A 4Z76B 5HVGB 2HJLA 5B8CB 1AGFB 1IC4H 4P9ML 4JHZA 5J13C 2DI9A 3TIDB 2YA0A 3IXAA 3W81A 1OPGL 4TNWF 1NUGA 2UVFA 5MENA 1VFMA 3VJ6A 5GRVK 1BJ1J 5GISH 1KNOA 3IDJA 4WI3A 1J8HB 2DQTL 1GOFA 4HFWA 4O02L 4LASL 4QHNA 3MSPA 1HH9B 3KPLB 2IMMA 4X9BA 1G7IB 4P57B 2VE6A 5TE6H 5C0EA 1FLRL 4CW1B 1Z9OA 4U33A 3DHJA 3EFDH 4NN7B 3LKQB 2DLFH 1RIVH 3DURA 1UG9A 2ZUSA 4TTDC 1JI1A 2CIIA 1ZLUH 3ERYA 4PP1D 4YXKL 5EFIB 2A9ML 1I8KA 1FC2D 3GMPA 2W0PA 5SWSB 4YAQB 3NFSL 2F54A 2D3VA 3CAFA 4OFYA 5IR1B 2ICEB 1RUKH 2AXHA 4HS6A 2J8UB 1P4LA 2WM0A 4YBHA 3WNLA 4OF7A 4HLZH 2BHYA 2Y23A 3RWFB 5SWSD 3HC0B 4Z0BL 4PV8B 2YPVL 2YPKA 5DXWA 1EBPA 4QRPB 4NHCH 3JV6A 3ARVA 4HGMA 1HSAB 1IGCH 4KJPD 1A6AA 4OFKA 2E7LA 3WHE1 5MERA 4EJ1C 3I50H 1RIHH 4KK5C 1W0VA 3NPZB 4Q7DA 1NFDB 4MQSB 4D9QD 1E4WH 4KRMB 3QO1B 4QRPD 4BH8B 4LLWA 4GG8B 1MELA 5KOVC 4G8FB 2L7JA 3GHBL 5GS0L 3TA3C 4MB4A 1MLCB 2HT2D 3L3IB 1C1EH 1VEOA 2G9HB 2Z8WC 5IW6A 2XKSA 4ZUWB 5GZOD 4KK9D 1ZSDA 2PETA 1TVHB 4IJ3B 5LAXB 4N9GA 4LQ1A 1OAXL 3BHBB 2GJ6E 1XGRA 4DKDC 4PJIA 1R3LA 2YC1A 3NABH 1PG7X 3B9KD 1AGBA 1AY1L 4JFOB 1IZJA 1I9JL 3ILPA 2LTQC 4WDIA 5ISZA 4P2OD 5I6XC 5EC1A 1SMOA 3QPXH 5EA0H 3ARQA 1VFUA 2C3XA 3UYPA 3W9EA 1MRDH 2VZSA 2BSED 5IT2L 3HHRB 3DGGA 1VPOH 4JFFE 4JZOB 5F9DC 2YHGA 1RULL 4I3GA 5ESVA 1GAFH 2YRLA 2CDFA 3LQZA 5D7LE 2DN7A 1CLZH 2ZCHH 1KLUA 4NQXA 3S37L 1QBMH 3EO0B 1NC2B 4M6NL 4LVHB 1IAIH 1VFAB 2RFXA 3FN0H 3OXSB 3G08A 3BMVA 1TJHH 1UJ3A 1DEDA 4GMSL 3PIQB 4UQ3B 4XC1L 2C7UA 1MAJA 4TSCH 1HINH 1A7OH 3IKCB 2QQQA 5IESH 1SYVB 1KTDA 4O00A 2AAVA 5F97E 4J3WA 2ZOKA 3ZDXF 4DJMA 5HYEA 3ORJA 4G6JL 5CP7B 2MJWA 3QDGD 1BD2E 2R1XA 4TUJB 3VE0A 3EW3B 4NKOA 4HULB 2F5BL 3RPIB 4LSQL 4OI7A 4PRID 1TQBC 4KPHL 1FFQA 1NMCB 2Z8RA 2YK1H 4V1DB 5D1ZC 3KPSB 2AGJL 1F4WH 1MFBL 1EVTC 4D3CH 3X13B 4CVXB 4NWTH 3VXRB 2X7LB 3ECBB 2GJJA 2H3NB 5IGXL 4OLVL 1DL7H 1LD9B 2W1NA 4KJQC 5EORH 4V1DD 1KJMA 3KPSD 5HI5C 5F6HJ 1ZT7A 2PYEB 3QRGH 1QRNE 3MYJB 4LHUG 3FKUS 4TULL 5FYKE 2Z91A 3FOLA 3L3GA 3DX8B 1T1ZA 2DM2A 4KU1A 3TBTB 4XPTH 3HNTL 4G42B 4OLZL 2IPUG 3OF6D 3SY0A 2IFFH 2NNAA 5GJSL 5C0CA 3QCUL 4HWBH 3UAJD 5ESAB 1LO4H 2X42A 5E8OB 2MMXA 4GQPH 3UDWC 3MBEC 1EVUA 2OL3L 1KT2A 1D5XB 2FRGP 3BKYH 2Y6SC 2PTUA 4L4JA 4AZ8A 5HGHB 3BN3B 1DVFC 5K9QI 3Q3GB 1N4XL 3WJJA 1AD0A 4P2RE 4YXLL 5JOFA 3ZKXB 3WSQL 2NLJA 5DGRA 3E3QE 4H25B 1D7FA 1JYNA 4X7EC 4F2MB 1XF4B 4IMLA 4U2YA 1QFWH 4HGWB 3BH8B 3CVIH 4ZQKB 2ZUXA 1LILA 2DIBA 4K3HA 4O58H 4Z7UF 1CBVH 1IT9L 4NCC1 3OBAA 1EERB 3Q2CA 4PR5A 4YJZL 3NZ8A 2GI7A 1C5CH 2QQNL 1LK2A 3STZB 3BE1H 3MV7D 4XPBL 2Y72A 3WO4B 4DGVH 5F70A 3IF1A 4RGMC 2AJYH 3B2UC 3R06B 4R8WH 5C71A 3KYKH 3VFRA 1EHXA 4J1UB 5F89B 4CRPA 3RIAK 4QRQB 4OGAC 3G6DH 4NUGH 1ZVHA 5KANG 3LS4H 5C0GA 1AE6H 3OKKB 4ZYKA 2QHLA 3P4LA 3VH8G 4HK3J 4BSJA 4LCWE 5LG1A 2YUWA 2I9TA 1MCRA 5JZ7C 4FQXD 1NPUA 3HAEB 3TYFB 4DZ8A 1G7LB 3MA9L 3IDXH 2W0FB 4YXHL 3RRQA 3HUJA 2VXSL 3KXFB 4HCRL 4NRZA 3AU1B 3MRIA 3BO8A 2JCCF 1ZOXA 1IQWL 4CN6A 2ZUTA 2Z93A 1CQKA 4I77H 3SDCD 2UZXB 4JM4H 5H35B 4LSPL 2D7MA 4LAQL 4Y5VB 5B22A 1S7QB 2D0HA 2IBGA 3ARFB 4K9EL 1QSEB 5FYLH 4L8SC 1N0XL 4Z18A 4N0UE 3TZVA 3MLRL 1N59B 1F2XK 1QSED 5CJXC 2E9BA 4PJHB 2HFEA 3BGMA 4PRHA 2NTSP 3IT8D 1DQMH 5MI0B 3M8OH 2UUDK 2NY4B 3TH3T 2GIYA 1MFEL 1JGEB 4XRCA 5EOQH 5BOPA 5H94A 3HRZB 4OIIH 5C9JA 3UTTE 5I17B 4UINH 43CAA 5D9SA 2RCSL 3HR5A 4X6CB 1FVDB 4FZEL 4XCFH 5ACLA 1IGIH 3KDMA 1BZ9B 2FJGA 3HC4L 4M1GH 3BJ91 4GQ9H 3E2HA 2EKSA 1PVHA 4NQEA 5J89A 4GAJL 3H2WA 4L4VA 5A2LH 3PHQA 4ZXBA 2H2SD 2YUZA 3BISA 5F93C 2H2PC 4QNPF 5F88A 3IXTB 4Y2DA 3B8SA 4JG1H 5EZLB 1WCBA 2BRRL 1KIPA 5BS0A 4NO0B 3LKOB 1I4FA 3K8MA 2C9AA 3I6KA 2VISB 2HLFD 1W72B 1NBQA 4MD5A 1WICA 1HHGB 4Z95H 2VLJA 4LSVL 1D3CA 2MPAL 4JO1L 1HHIB 3PABA 1KB9J 2BOBB 3L7FA 5ALCL 2AK4B 3JVGA 3ZHDA 3OHXA 1EHAA 1MSPA 4FQLL 4ELKA 2BRQA 4ALAL 1CDJA 1G7HB 3RZCA 1ZTXH 2OMNA 2JLLA 4PS4H 5IEHB 1HNGA 1X6NA 5CBEA 2A1WH 3RA7L 1XCTA 5CZXC 3CFJA 5CZKA 1U93A 3BZ4B 3WO3B 1YEJH 5KN5B 4P49A 3WNMA 4NKDA 1F90L 2AJ3A 5CZVL 3HRPA 4DTGH 2VXTH 3GZKA 5EOTA 3DX9A 1ZHLB 2PCPA 1MJUH 1KCLA 3O6FC 5J6HB 4I18B 3LKNA 5HHOB 1F6AB 2B8OT 3QT2A 1MRFH 3WFHB 2VLKA 3JV4A 2ENSA 3F7YB 4QY8A 2BERA 3PL6B 4U0RC 5I1GL 3CLFH 2FECI 4R4BB 2JELL 1MFDH 2R8SL 1NSNL 3P9LB 1BVLB 4BSVB 3DX7B 3V7MA 3MLUL 3LZFH 5KSUA 2G5RA 4MQTB 5FGCE 5DJCA 3QIBC 2GTZB 3R1GL 3PUCA 5JW4Q 4WUUE 4GG6A 1B4JH 1SEQL 2CPCA 3O9WB 5ID1A 1IGTA 1FL6B 4KROB 5LXGH 4F3FB 3UTSB 3RDTD 5JQHC 3FN9A 5T3XE 3KR3H 3L1OL 1DN0A 4FZ8H 4MD4B 4MLSA 4UV7H 2VERN 3WKMH 1KXVC 3O9WD 4PJ8A 1RZIB 3H3BC 1K3IA 4K3EH 1PEZA 4KROD 5FYKD 3UTSD 1J88A 3BD4A 5L2KA 5CD3A 4UNTA 3VFVA 3RI5F 3GBLA 3HZKB 2A2QT 3QEQA 4ETQB 1KBGH 3MFFA 2ZPKH 5JLZA 4QHUA 3T0EA 5K9OA 5I8KH 3ULVH 3HB3D 1FO0L 2XA3A 3TN0C 3O81A 3L5HA 3CXDL 4MJID 2P5EA 3BZEB 2VOTA 4AIZB 2NY1B 5HHXH 2HFGL 1I9RL 1T6VN 1FYTA 2JF1A 1EUTA 2E7CA 4KRLB 3U30C 3O4LA 3NH7H 5E08H 5MENE 3G6JE 4MDIA 3GEWB 5C0AD 1FZMB 4CADA 1JL8A 4OD2B 4OJFH 4ODSL 1WF5A 3BQUB 3VWJB 4YHNB 2AXFB 1MUJA 4NQDB 1HEZB 3U9UA 4EXKA 1SJXA 1IGML 4YIQA 4XC3H 4WU5A 1KELH 4G9FE 5FO7A 4B53A 2QTEA 4YGAB 4DN4L 1EGJL 4F37K 4IIQB 2VSDA 2M26A 3WNNA 3HC3H 4LLMA 3V5HA 2X4PA 4NQDD 3KLSA 3BIKB 1JHTA 2IG2L 3VD5A 3NTCH 4XNMA 5FUOL 1A6ZA 1ZHKB 1FDLH 1A1OA 3QJFB 5FV1L 5D7IA 4XVJL 1D5ZA 4ESKA 1P9MC 4UTAL 3E8UL 3DMMA 3O2VH 4P2QE 1J0ZA 5E7FA 4NRXB 1AQKH 4QGYA 5GGRY 5B39B 1JWMB 1BJ1H 4DOHB 3KJ6L 4NHUE 1MEXH 5GS2D 2Z4QB 1CICA 3ILQC 1Q38A 2Y07L 3FCTA 4C55A 3TV3H 3DRQA 4HV8B 1XR8B 1P7KB 4XP1H 4XCNA 4Y4FB 2AEQL 3C5JB 3H9ZA 5DJZA 3GSRB 5GS1C 1JJUA 4WHYG 4XVTH 1G9MC 1HOCB 5LGHH 2HFFB 4EI6A 1IILE 1KTLA 3QUZA 3G9AB 5FM4A 3BT2H 2BNRB 5E6ID 5J3HC 4TQEH 4UUJA 1FN4A 3U46A 2DYPD 1WTGT 1BF2A 1CL7L 1V3JA 1NGWA 2XFXB 4WIQA 3S35H 5JOPE 1BWMA 3VXPB 4YUEL 4YH6A 3MLXH 5JPMA 1AXTH 4KRPC 1ZT1B 3ZSTA 2YEZA 4PJAF 4UB0H 1I3UA 3TO4D 5E8EB 3NVQA 4PBWD 1FIEA 3EYQD 1WEJH 3FQXA 4FQQB 3NZHH 1A7NL 5EC2A 4I13B 3C6LD 2R0LL 4PJIE 3GSWA 5A3ID 2E6PA 1T0PB 4IOIB 5IVXB 1HZHH 3GSXA 3S3PA 3RP1A 2EIZB 5ISZE 5IHUH 4HIHB 9CGTA 5BVPL 4ZOCA 3BP5B 3IJSA 5ERWA 3DO3A 4HD9A 1U6AL 4PJ9C 3L5IA 4TUKH 5D6CB 4ZTOL 1SHMA 3RL2A 3K4DA 2BOCA 2P24B 4M7LL 1GSMA 1XF2A 1NGZA 4Z8FL 5K9JH 5FYKL 5IBUB 1DCLA 1HQ4B 1BBJA 2UV3A 4X6FB 3D2UB 3JUYA 1JYXA 5AZ2L 5AZEL 4P4KC 3QH3B 4GW1B 3B3IB 4R7DB 5DGQA 1QQDA 5GGSY 1Q72L 5E8NB 5T1MA 3VCLB 4EZMA 4G3YH 1FJ1B 5C0FA 1M7XA 3KHQA 5IB4B 1IC5H 4Q6IA 2VLLA 4O9HL 1DDHB 2B4CL 3DXAB 5IROA 2IH1A 1OAKL 3F62A 1HIMH 2BSTA 3W0WE 2XG5A 3T4AB 4DFIA 1T1YB 1I1YB 1WZLA 3BKML 1DBML 3DXAD 5DFTA 4F7MB 2QL1A 3I75B 1KN2H 5C70A 4DUVA 3QEUA 3UBXB 3MCG1 1BVKA 5IOPA 1F45A 4H88H 1P53A 1JN6A 2A6KB 2XTLA 2DMKA 2IANB 3QQ3B 4HBCH 3VGDA 2X89D 5DUML 1M6OA 4HJGB 1S7TB 3TYGH 2G2RB 3GO1H 3HG1E 1IFHL 5D5ME 4Y4KB 4KUZL 3D3VA 4JFHE 3LD8B 2IAND 2J12B 4S1DC 1CR9H 2R4RL 3CFCH 2CGRH 2X4RA 1F6FB 4ONHA 3C5ZA 4LCIL 2X9WA 5IM7B 2B1HL 1EHLL 2FR4A 2B5IB 2HG5B 3UTOA 3GMRB 2APTA 2H26A 4XHJD 4JPVH 3BKCL 3WMSA 1U95A 1UQSB 3I6LD 3O8XA 4H1LG 4NKIL 2VIRA 3O45B 3PGCA 2WBKA 2A6DB 3QIWB 5GGTH 4EDWL 1D5BB 2DM3A 3U0WH 1B88A 2DQCL 5HI4C 2CMRL 3GSOA 3IFLL 3VFTB 4PJEE 3QIWD 4ODHL 4KY1L 5GIRA 1U36A 1ZLVK 1F2QA 2CK0H 3LN5B 4LRNH 1FFPA 4N1HB 3ZE1F 3PP3H 2ADFH 4YQXL 1KCUL 4WW1A 1QEWA 2P8LB 4LPCA 3BDYL 5FYJH 3N06B 4MA7L 3L6FA 4QOKA 1MF2H 4PJCF 5IMLB 4B7LA 4IOFC 4PLNC 3EZ8A 3IU4L 3A0OA 2XICA 5HGAA 3RX7A 2Z0BA 5IK3B 2OZ4A 3VXOA 5FHBH 1MIML 3SCMA 1ZT4A 5J1SC 1IAOA 4M1DH 4JDTL 4PD4J 3HUJE 3TIEB 4GBXD 3U2SB 1RZKC 1T5WA 4B0MM 3TJHD 4XNUH 1KEGL 4JFEE 1HWHB 5C92A 2OP4L 1ZMYA 1OP5K 5KSAD 4OUUB 5FDWA 4JKPL 5AYQA 4QF1B 2Y36H 3ROLA 3MRCA 5BVJA 5DC0A 2XTJC 5IVZB 1LE5A 1NC4A 1BZQK 2D03L 3V5KA 4P2QD 2Q87A 3MOAL 4WW2B 1VADA 4XGZB 5F1SA 1CK0H 1KPUB 1ZA6B 3MLYL 5JQ6L 2LU7A 4R0LA 1JNNH 1XF1A 3ZDZE 2WBJD 2YWYA 1YNLH 5DD1L 4HWEL 1PZ5A 1I75A 4MQ7A 3N50A 4QEGA 4WI7A 1Y0LA 3QWOA 2J8UF 1JV5B 4RWYH 4YHML 2AABH 3FO2B 1OP9A 5HHVL 5JW4R 4AEIH 4AENB 3A6CH 5IMMB 1AGCA 3D85B 4NOFA 4W4OA 4KJYB 4ONFL 2AXGA 5EIIB 4M5ZL 4YK4C 5ETUB 3MGTA 2C1OB 3VG9C 4KV5F 4AG4L 1NFDF 5L88L 1I7TA 3D85D 3RVVC 4FQCH 1GGIL 1BM3L 1Y18A 2VC2H 1NCAL 3O6LL 2HT4C 3LPWA 4EI5C 2VQTA 3VG0L 5SWZE 1MCDA 3L9RA 3MXVL 1U8IA 1XMWA 3WIFA 5C6PB 2VNCA 4HAGA 4P9MH 5F7UA 2BX5A 2CKBB 4WI6A 3NFNB 4I0CC 5KVGH 5DRXB 1OPGH 3OKLB 4G6ML 4ZAKA 4APQD 4HUKB 5MP6L 3IVKB 2XZAL 5F3HB 1CD1B 5JA8B 4GRMB 4HK3N 3FFCA 3WXVH 4NO3A 4KDTC 4LASH 4O02H 4PLKD 1A6WL 4P5TA 3PP4H 2CLZB 3S4SB 1NKOA 4HLZG 1A0QL 4JFPB 4F15B 3TO2B 4HKJB 3MRRA 2VN7A 3FN3A 1FLRH 3FTGA 4GXUN 1FL3A 5HGDB 3KJ4C 1RZKH 5FKAB 3U82B 1I8MA 3QUYD 4XNQB 4JO3L 4HUUA 3NIDF 2VLKE 3M1BB 4RFEA 1QNZL 2A9MH 1MFCH 4S0UC 2IAMD 3OJDB 1KB5L 2Q3AA 3LDBB 3NFSH 2UY6A 1G6RH 4QRRA 1EH9A 1UCBL 2ARJB 3ARDB 2HLAA 4H1LA 5I66B 1H3UA 1CGXA 1T2QL 4Z0BH 1Z9SA 2DM7A 1KJ2H 3W0WD 1HYRC 5I2IA 4GG6E 1IAKB 1BZ7A 1JGDB 1JZ3A 5DO2D 3CUPA 5IHZA 5DEGA 2H6PA 5F9OL 2A74A 4D9LL 4ZFOL 5I8CB 1K8DA 3BPCA 1MQ8A 2P49B 2EH7H 1NCNA 4QHMB 4M5YL 1UACL 2PXYB 4OGYL 3VI4E 5EO0B 3UTPE 5CJOL 3C60A 2O61A 3GHBH 4PP1C 5DK0B 3HG1D 1CXHA 2EDOA 4U6YA 1G1YA 3CFDB 3IFNL 2PXYD 4ZUSA 4WEBL 3BDBA 3WS3A 1KPRB 4ZO9A 1EEZB 4G7YL 5F3BA 1E4XI 3GMQA 3O11A 1OAXH 3UC0L 3CCHA 4F7PB 4ZS7L 5H2BA 2Q7YB 3CVHB 4IRJB 4XBPA 3BEWA 2XPGB 3SE8H 2CK2A 3SKNB 2DJSA 4FP8L 1AY1H 5B8CA 4ENED 2XZQL 4MNGB 4KJPC 1FYTE 3WS6C 3QPQD 3QAZB 1G6RB 3TIDA 1U8LA 3J8F7 3VFPB 3MO1A 3QUMA 3BIAX 1KJ2B 5DWUL 5FFLA 4PJ5B 5IT2H 3ARWA 1MNUL 4J3VA 5DVKA 2GSIB 2HT2C 3O3EB 4OF8A 2PN5A 5FGSA 5AD0B 1NJ9A 5CP3H 1NMBL 1SEBA 4PJ5D 3S37H 4X4YB 5IB3A 3MNVB 4X7SL 4M6NH 1MCCA 3CXHJ 1MJJA 2V2XA 1BREA 4V3EB 3B9KC 1S8DA 5D7IE 3NA4A 4U1SB 3LVEA 4GMSH 4PRNA 3BVNA 4ELMA 3BP7B 3AY4C 1O5DT 4P2OC 1AKJB 3PHOA 2IH3B 3U1SL 4YAQA 1N6QH 4FFZL 3JWDL 3ULUD 1CG9B 1FAIL 4JRXD 4R97B 4O2EB 2BXZA 1MCWM 3KYMA 4P2YA 1Q9LA 3TFKD 4P23B 5TGBA 2HRLA 3VFGL 4ODUB 3V5DA 1AGDB 1D5MB 4I0PB 3QWRD 4JZNA 1L0YA 2GCYA 1HSAA 3O2WL 1V7ML 4LSQH 2ZJSL 3VRIA 3P30L 4KPHH 4ZPVB 4K9EC 3DVIA 1RK1A 1MFBH 3QO1A 5IGXH 2NXYD 4F7TA 1E4KC 3BPLB 3BGAA 4OLVH 1X4YA 2N4IA 2GK0B 1HXYB 4Z78B 4NQCA 1JNJA 4FFVD 5HI3D 4L8BA 5IB1B 3BMWA 1QVOB 5C07A 5I73C 1I3RB 43C9A 4XZUB 5ITBL 3IYLW 4M3KB 3CDGB 3X14A 3HNTH 4HG4J 4RMSA 2AKRB 3V4VL 2X1PA 2ED7A 5GJSH 1RHFA 2CIKB 3U83A 2GHWB 5JMRA 3SDDC 4NKQB 2OL3H 4QWWC 3RWEB 1A14L 4RMVA 2C3VB 1OF2A 1N4XH 4FFEX 4WY7L 2FEEL 3TBYB 3OKOB 4YXLH 3WSQH 3B83A 1I8LA 4XNYL 1PYWB 4TUOA 1DLHB 3RWHA 3BESR 4KI5E 4PBXA 5ICXB 1A47A 2V5TA 4X6CF 4MAYA 4PRPA 4MGXA 2RHEA 4F80A 1IT9H 3MUGA 3NGBB 4K7PY 4LQFL 2QQNH 5F7DB 2XKNB 5SWZD 3S34H 3OXSA 1I1AD 3RWDA 1F58L 4XPBH 4PB0L 3C8KB 1MVUA 1E6OL 4OLUL 2A0LD 1YY9D 3SPVA 1MCFA 2XV6B 4Q0XL 3A6OA 3TCLA 3L3OA 2AEPL 3IKCA 1I1FB 5INDA 1KACB 1X5AA 3ET9F 2OJEA 5IB5B 4O4YL 4F9LA 2EE9A 2FB4L 2QQLL 4ZUUB 5CCKL 1LEIB 3QA3A 4KQ4L 5BRZE 4IMKA 4OZ4B 3PV6A 3KS0J 2EIEA 4BQBA 4GRWH 4YHIB 4S1RL 5EOCJ 1IQWH 4QRSA 5I1AA 3VXRA 3ZE0E 4JM2B 3D39A 4LSPH 3FT4B 1OSZB 3ZKQD 5JPNB 4KMQA 4R7NA 3T65B 3VFWA 5CKAA 1NUFA 3F7VB 2MCG1 3FQUA 4K9EH 5GHWL 2PYEA 5H37H 2X6MA 2R9HC 3UJJL 1G9EA 5DJ8A 2LE9A 4ZODA 1MH5A 3MLRH 4X6EB 4JPKL 4EIGB 4P46B 4PPTA 4X98A 3HE7D 3LEXB 1OP3H 1LEGA 4FQXC 3RWJB 3OR7B 4DCQB 2Q76B 4L5FL 4RGNB 4HXAH 2VO5A 3ULUL 1G9NL 1MFEH 3OJ2C 1UWEL 1WT5C 3OKDA 3OX8A 1BAFL 4MXVE 3WEXA 2IPKA 1Q9OB 2EDHA 5HGHA 4U1KA 1HXMB 1YMHB 4Z5RA 4HWZB 3O0RL 1M7IA 1AD9B 3TPUB 2G60L