4NTFA

Mus musculus ltc4 synthase in s-hexyl-gsh complex form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
145
structure length
145
Chain Sequence
HKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title To be published
rcsb
source organism Mus musculus
molecule tags Lyase
molecule keywords Leukotriene C4 synthase
total genus 60
structure length 145
sequence length 145
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4ntfA00
4J7YA 4J7TA 3PCVA 5BQIA 2UUIA 5K0IA 4YL0A 4NTBA 5BQGA 4YL3A 4BPMA 2Q7RA 4NTAA 4JRZA 2H8AA 3HKKA 4NTFA 3LEOA 4YL1A 3DWWA 2PNOA 4WABA 4JCZA 4JC7A 5BQHA 4AL1A 2UUHA 5HV9A 4YK5A 4AL0A 3B29A
chains in the Genus database with same CATH superfamily
4O7GA 5KYYA 1ORSC 5F5FA 4J7TA 5L3QA 2H7OA 2C03A 1HMDA 4MTFA 4KC9A 4IB4A 5DVWA 2CNWA 1EA8A 2XLEA 4XEKA 3GANA 3T6GB 1ZU4A 3B9QA 2ETSA 2CW0F 5EK0A 3B0UX 1ZHWA 5FCLA 2AWCA 1Z63A 2HZ8A 2YLIA 2OU6A 2R7QA 1K05A 4NCQA 1H7IA 3RQFA 2J45A 2L7AA 1VOMA 1JAFA 2YL0A 1M2VA 1RKEA 3LEOA 1VYIA 2Y39A 4HEAJ 4YL1A 3V7OA 1FFHA 1YA9A 2LIGA 2YLGA 3GEHA 1IW7F 2F22A 1VB5A 3LS0A 2AWYA 4LLCA 2ICWG 3OA1A 4IJJA 2J7PA 4JIOA 2HSQA 1K40A 4U5EE 1WASA 3VAYA 3I4UA 1YARO 3FVYA 3DI5A 2HKVA 3I5QA 4J7YA 1QSPA 3EQLF 1OCZC 3O55A 4O6YA 2J7PD 4OINF 2OG2A 2DGJA 2OJQA 2QY9A 2UUIA 2VCAA 3EZIA 3SNHA 1UFBA 4E7ZA 1WWPA 1G4WR 3CEXA 4YT5A 5A69A 5IY5C 2LK4A 1FFTC 2YVKA 4PR9A 3C18A 4P9FA 2Q3TA 3DD7A 4KNVA 1DOVA 2VH3A 2GAQA 2Y3HA 1M2OA 1ZHXA 1JPJA 1TFOB 2AVKA 2EIJC 2FGYA 2G62A 1A7VA 2L6FA 2YLDA 3EFOA 3NKDA 3T4RA 4EIYA 5B3IA 2LP4A 1VLSA 4LLEA 2D5RB 4NTFA 2XXAA 2YZSA 2R03A 4DBQA 1BR2A 3DAFA 2J0WA 3Q7LA 2XLVA 1LM3B 2BC5A 1ORJA 2OQMA 2V26A 5JRAA 2RSEB 3ZQYA 3WODF 5CI8A 1F1MA 1JOGA 1D1AA 3W4YA 2XS8A 3ZVRA 1D1BA 1TWAA 4YN0B 4OIRF 2P7VA 4CDVA 1G8XA 3QZCA 4IAQA 2WL8A 5A6BA 3QVZA 4LDRA 2R25A 3ABMC 3EG9A 3O6XA 2Q7RA 4DVZA 2A0BA 3SEOA 1LE2A 3UGPA 1G4US 4JE9A 2EILC 4JTAB 1N1CA 4QDLA 2R7XA 4JZAA 2Z15A 1Z7Qc 3AG2C 4XPYA 4JJGA 4O6MA 1QZXA 3PMRA 3JYHA 4P9TA 2CYDA 2JPUA 2EIMC 4U9DA 2LSEA 4EWCA 3MLGA 3IQ6A 4XLNF 3W8HA 5L0JA 1OW8A 4D4NA 5L0DA 3RKOF 5KYYB 1SR2A 3JCUQ 4K0DA 1OCOC 1OW7A 1V4AA 4CS8A 1LI7A 1TFKB 1S05A 5JVEA 1QLEC 4JURI 2ZD9A 1Y4CA 2KW3C 2J9UA 3T6JA 3GM1A 3MYFA 1T9KA 4U5DE 3TJ5A 1C03A 3HNLA 1C02A 1LS4A 1LIHA 4MVMA 5GPGB 3B71A 3MBGA 3KMIA 4FX5A 4JEBA 3B0PA 4DOZA 3A11A 3LUTB 3G4XA 3QVYA 2H7VC 3N2ZB 4MQ9F 3ASOC 4NY3A 3TOMA 1HW2A 3LS1A 3FXHA 4MW3A 2IM8A 1PD1A 1NG1A 3JTLO 3ZQVA 4ER9A 5TJ5E 2IXMA 2Y3BA 3K1IC 3JZ0A 3RIPA 4OIOF 2DYRC 3HNJA 4EHPA 3EZHA 1Q0KA 1JR8A 4J30B 1A7EA 2AU5A 2IBFA 3H2VA 4B6IA 1FAPB 3MX3A 2NPUA 1BZ4A 2M64A 5DLJA 1MNEA 3PCVA 4BJ5C 4OIPF 2P1AA 3DM9B 3B0VC 2I15A 5L0HA 4BJ1A 3O39A 4ULWA 1ORYA 3NG1A 3VM6A 2TMVP 2PF4E 2XM4A 2YRFA 1YDIA 1YZAA 1G5ZA 2IXNA 5A6AA 1JRAA 4FWVA 5L0FA 1YZCA 4I3MA 1RJ9A 4EBJA 3TQOA 3LNRA 4E17A 4PACA 3EFOB 1V54C 4G78A 5D92A 4JCHA 3G50A 2AP3A 1ZHTA 3CAXA 5L0GA 3POVA 3UGOA 5T3TA 1FNTc 2YL3A 2XRHA 1JPNA 3EPVA 2VASA 3S84A 4ZLDA 1U0BB 3B29A 3ASNC 5A6BD 3UMKA 1E83A 1OKKD 3LLIA 4JEAA 2Y3GA 3T9OA 5BUOA 2IYLD 1SMYF 2WVQA 5AC4A 1H9TA 1L7CA 2OCCC 3E70C 4BJ6A 1ZVZA 4O6NA 3U8PA 2HJ3A 2HS5A 4GEHA 1SZIA 3JT1A 4YWQA 5T1DB 2NUTB 4NTAA 4XQ1A 2WVOA 4DXWA 1C17M 2NUTA 5KYNA 2XLHA 3AQBA 3X2QC 5EHHA 2ZXWC 2Q4FA 3ITFA 3U8VA 4K1OA 2PNOA 2OEXA 2EPNA 4AX2A 1MMNA 2P6VA 3HTKC 5D91A 3TJ6A 1ZU5A 5JP7A 3RQGA 1FMVA 3LAYA 4RBNA 1Q0GA 1VLTA 4W8KA 1TKNA 1M2VB 3IQCA 3M4BA 3RF3A 4XLPF 2KK1A 1U89A 1V74B 3QW1A 3SYNA 3W2VA 3H2UA 1RKEB 2NG1A 1ZW3A 3ATPA 4YJWA 1HE9A 3R7CA 1YJGA 1HMOA 3GEEA 4WJ0A 4X0RA 3BEHA 5EGYA 3VRCA 3TULA 2J8WA 1ST6A 1XWJA 3DXJF 4MTGA 1KTMA 1VMAA 2G3VA 1A0BA 3MYIA 2XLOA 4JRZA 1LS1A 3Q7GA 4DBRA 2C04A 1E86A 4H54A 2BE5F 2A1DD 4PJLA 3SZRA 4BJ6C 4C3EA 2A68F 5JSLA 1CGME 2G3KA 3FAJA 4ONSA 5KYUA 4XTKA 2Q00A 4M63A 2YQYA 4BJTA 1OCRC 2KJGA 4AL1A 1BBHA 1MMDA 3U3FA 3SXYA 4IWBA 1Q0FA 3L8IA 3TD7A 2KNHA 3FHDA 2J0XA 4J32B 2A69F 2GA0A 4O79A 3GEIA 3DJUB 4YT2A 1M6TA 2ZXRA 1OW6A 4MVUA 3U2MA 3T6BA 2HMQA 1NBBA 4JW1A 3PDMP 4EBBA 2PX3A 1ZZPA 1E84A 1QVXA 3QMKA 2XL4A 4JJFA 4W8PA 2Y69C 3DM5A 3I5PA 3K33A 3KPHA 2GFHA 2WZGA 3UMHA 3V5XA 3WHNA 1T5OA 5DS4A 4Q4ZF 4NQFA 1XZQA 3NRHA 3ABKC 4U5FE 4G7OF 2HV7A 4G7ZF 3AG1C 1PD0A 5A6JA 4WABA 4WGYA 4DJ9A 3RYLA 4LERA 3GWLA 4H4KC 5B1AC 1YAUO 4BJ5A 2X0CA 3TK0A 2R7VA 1GGQA 1ZW2A 1Q0MA 2DI3A 4GQHA 2PP4A 3DE8A 4DRIB 4RD9A 5B1BC 4CDAA 2GDCA 2R9RB 4PFPA 2KC3A 2PBEA 1D1CA 3C8GD 3IEEA 3SXMA 4ULVA 1CPQA 5KYUB 2P0NA 3GORA 2Y3DA 2R7WA 1QKRA 5DQZA 3TOLA 3F47A 5BQGA 1FR0A 4MVOA 1YVIA 2EPOA 1EKYA 3C8GB 1D0ZA 4L6RA 4KI2A 1R5ID 1NLXA 4ZLCA 4G0HA 2XLWA 3EG9B 3DZAA 4QI2A 5AGFA 2J9WA 2JD3A 2L6HA 4PJNA 5L0CA 4WGZA 3E9VA 1WATA 1B68A 1RKCA 4C3BA 1AVOB 4MVRA 4CDYA 5BQHA 1W2WA 1T6QA 2WZFA 5F28E 3WG7C 4UDVA 2MYSA 4BEJA 3U5SA 1UG7A 3FDQA 3NYLA 2NUPB 4K7BA 4LDQA 2LQGA 2KGOA 3F46A 3RW0A 1BDJB 3C8ZA 3W8IA 3CSKA 2R02A 4FAPB 3U0CA 3IQTA 2Q9CA 1MMAA 2XL6A 4FESA 1T01A 4LACB 3RFYA 2ASRA 1HY5A 3C63A 4C7OB 5CI9A 3ZC4A 2H8AA 2LCHA 3HNIA 4I1OB 3VYWA 1YLMA 4E7SA 2L6GA 4R32A 5E3AA 2LFDA 2ZPAA 5JT4A 4D4XA 4I1MA 3S29A 1ZHZA 2GWWA 1BR1A 3KYJA 1Z23A 2HFIA 1ZHYA 1H9GA 1WN0A 3M79A 2CGEA 2UUHA 3EHMA 2WB7A 3IQ5A 4MVZA 2OOCA 1RMVA 3K7DA 2VB6A 2W4MA 1Y6DA 4XEFA 4CJGA 1O3UA 2X51A 3RH3A 4CIPA 1D0XA 3ZG1A 4PFOA 2BL2A 1WOLA 2XXAB 2NSFA 1OXKA 3CQZA 2H7BA 3NDBB 4E18A 2V3CC 1APCA 4CS9C 2FFHA 2YL7A 3L8JA 1YYJA 4YL0A 5AC5A 3O10A 4XPWA 2QUPA 3PHF2 4KBLA 2HV6A 4MTOA 4YL3A 5COMA 2IOQA 2WZLA 3AQCA 4EBKA 5T3WA 2R7TA 4U5HA 3VF0A 2P61A 4CS9A 4CSAC 3LJBA 3JSEO 3QTHA 3HKKA 1TWGA 4EUKB 3NKEA 3M15A 4IAOA 2R7SA 3FMSA 4U5BE 2M4EA 4E0IA 1Z6AA 1CGOA 5KYXB 4JC7A 3LNMB 1I4YA 1OKKA 1T6IA 3K6BA 3JRMO 2QLAA 2HJMA 1QPUA 1R4TA 1OCCC 2J9VA 3GWNA 3LEVA 1CGNA 4JVSA 3UNGC 2YHSA 1SF8A 2CCYA 4G7HF 4N6HA 1S7ZA 3KH2A 2ZXPA 2YL1A 4DRJB 4MNDA 1OXBA 1E2XA 3G4ZA 4GYTA 1E85A 3UMIA 1LKXA 2E87A 3NMKA 4NTBA 3EJNA 1KNYA 3C8GA 2R7UA 4U9EA 1BR4A 2RD9A 2R05A 3EGDB 3MFNA 2EPKX 1T6UA 4Q5SF 1M56C 4LDKA 1PCXA 1O87A 3ZDLA 1LVKA 3JSZA 2XM0A 5JUAA 4N6CA 3J06A 4P6IC 1NFOA 1Z3IX 2W9YA 4U5GA 3RQEA 2B0HA 4CS7A 2QE9A 3KL4A 4NC3A 3S0XA 3N24A 2IXOA 5KYXA 5HV9A 4YK5A 1FTSA 4U5CE 1Z5ZA 1EI7A 1WTYA 2XLDA 2FAPB 3OWTA 4N4WA 3U9JA 2R7RA 3NMIA 1QQ3A 2EPLX 3SP1A 3ZWIA 3X1OA 4HFKB 3K66A 3Q6MA 5CIVA 3LESA 5COGA 5K0IA 4Q7CA 1OQCA 1YA7O 3R2PA 4C3DA 1L3PA 4JKVA 4E0HA 5JLIA 1K04A 3EH1A 2MWQA 1WGWA 3W2WA 1D0YA 3IHUA 4A2NB 4BPMA 2EIKC 1DOWA 1VYKA 1EQ1A 4AE4A 1CPRA 2W45A 3AGTA 1Q0DA 1MMGA 5F5HA 1TR2A 3S9OA 5COFA 2W4BA 3WAQA 1HW1A 4XWJA 1PV3A 3EGXA 1YYXA 4I44A 4CBEA 4CJOA 4XEVA 5DS6A 2DYSC 2J46A 3ZTZA 4IGGA 3ECSA 3US6A 2B0JA 4F4BA 4MVSA 1J8MF 1H6GA 1MNDA 1ZYRF 2OEVA 2ZXOA 3SXZA 3Q6NA 3AJMA 2PFDA 4CIHA 4XPXA 2CNWD 1OR2A 3HNKA 4AL0A 5L3VA 4Z9JA 3K1IA 3ZIBA 4IRUA 5L0IA 2IXPA 4PJMA 2EINC 1NZEA 1LPEA 2VCCA 2HSBA 3KKBA 3EH2A 4MVQA 2A0UA 3S28A 3AG3C 3U2LA 3JRTA 4YT8A 1RCPA 1XZPA 3FAPB 4CX9A 1GM5A 1A7DA 3HJCA 3KYIA 1TWHA 3H65A 4OD5A 3V5YA 3IPMO 4MS2A 2OKUA 3M1CB 5JS5A 4DVYP 3A9CA 3EGXB 4JTCB 4JCZA 4CS8C 2XLMA 4BEMJ 1I4ZA 1V55C 4C7OA 3L1MA 1JMWA 3RVYA 4AE4B 2KYHA 4PJJA 2NSGA 5HSWA 3AGUA 2Q9BA 4HFFB 3NYJA 4OIQF 2XL8A 3L0IA 4Z9IA 2QNLA 1RXQA 5KYWB 1TWCA 2NUPA 2A6EF 3K1HA 5E2QA 4PK4A 2A6HF 2EPMX 3DKAA 3EGDA 2VC9A 1LI5A 2OJED 1A41A 1NSGB 3AG4C 5A6KA 3S27A 1I5NA 3DMDA 4MW8A 4RDAA 1VTMP 1RJ9B 3OEOA 2D4UA 2R7OA 2YKZA 5E3CA 3U9MA 2LFFA 3DWWA 1IZMA 3GM3A 2YWAA 5FZTA 1M57C 2J9BA 4EKWA 3GM2A 4BG0A 1GS9A 2DB4A 4ANJA 1MQVA 1FMWA 3ZSUA 5DS5A 2KQ9A 3NYMA 1NFNA 1AEPA 4JTDB 2QTVA 3AOUA 4CSAA 5BQIA 3BRJA 3C62A 3DJNB 3QW0A 2I8BA 3S90A 3DE9A 3ZTMA 2CDQA 1AUEA 256BA 4YT4A 3FOPA 4QI0A 2LD6A 3SXKA 4DRHB 1HE1A 1J8YF 2VCBA 2KSFA 1NU9C 3L34A 2Q9AA 4N06A 3UR3C 3C7JA 1LE4A 1O5HA 3V5ZA 1U6HA 2JX0A 2MHRA 3HLZA 3NMJA 3DAGA 2O9XA 3U3BA 1SYQA 1VK5A 2HUJA 2L9JA 2XS1A 1GQAA 3EHNA 3GODA 4OD4A 5DQTA 4A4AA 2XSEA 1NU7D 2PX0A 3FOOA 3N0TA 4Z9HA 3ABLC 1OR3A 2WVNA 2YEVA 4KNWA 1TQGA 2L81A 3LLKA 3RVZA 3CZ6A 4AK9A 5KYWA 3M4CA 1KU2A 4HE8D 5E33A 5B3SC 3JYYA 4IARA 2HMZA
chains in the Genus database with same CATH topology
4J7YA 4J7TA 3PCVA 5BQIA 2UUIA 5K0IA 4YL0A 4NTBA 5BQGA 4YL3A 4BPMA 2Q7RA 4NTAA 4JRZA 2H8AA 3HKKA 4NTFA 3LEOA 4YL1A 3DWWA 2PNOA 4WABA 4JCZA 4JC7A 5BQHA 4AL1A 2UUHA 5HV9A 4YK5A 4AL0A 3B29A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7Y A;  4J7T A;  3PCV A;  5BQI A;  2UUI A;  5K0I A;  4YL0 A;  4NTB A;  5BQG A;  4YL3 A;  4BPM A;  2Q7R A;  4NTA A;  4JRZ A;  2H8A A;  3HKK A;  4NTF A;  3LEO A;  4YL1 A;  3DWW A;  2PNO A;  4WAB A;  4JCZ A;  4JC7 A;  5BQH A;  4AL1 A;  2UUH A;  5HV9 A;  4YK5 A;  4AL0 A;  3B29 A; 
#chains in the Genus database with same CATH topology
 4O7G A;  5KYY A;  1ORS C;  5F5F A;  4J7T A;  5L3Q A;  2H7O A;  2C03 A;  1HMD A;  4MTF A;  4KC9 A;  4IB4 A;  5DVW A;  2CNW A;  1EA8 A;  2XLE A;  4XEK A;  3GAN A;  3T6G B;  1ZU4 A;  3B9Q A;  2ETS A;  2CW0 F;  5EK0 A;  3B0U X;  1ZHW A;  5FCL A;  2AWC A;  1Z63 A;  2HZ8 A;  2YLI A;  2OU6 A;  2R7Q A;  1K05 A;  4NCQ A;  1H7I A;  3RQF A;  2J45 A;  2L7A A;  1VOM A;  1JAF A;  2YL0 A;  1M2V A;  1RKE A;  3LEO A;  1VYI A;  2Y39 A;  4HEA J;  4YL1 A;  3V7O A;  1FFH A;  1YA9 A;  2LIG A;  2YLG A;  3GEH A;  1IW7 F;  2F22 A;  1VB5 A;  3LS0 A;  2AWY A;  4LLC A;  2ICW G;  3OA1 A;  4IJJ A;  2J7P A;  4JIO A;  2HSQ A;  1K40 A;  4U5E E;  1WAS A;  3VAY A;  3I4U A;  1YAR O;  3FVY A;  3DI5 A;  2HKV A;  3I5Q A;  4J7Y A;  1QSP A;  3EQL F;  1OCZ C;  3O55 A;  4O6Y A;  2J7P D;  4OIN F;  2OG2 A;  2DGJ A;  2OJQ A;  2QY9 A;  2UUI A;  2VCA A;  3EZI A;  3SNH A;  1UFB A;  4E7Z A;  1WWP A;  1G4W R;  3CEX A;  4YT5 A;  5A69 A;  5IY5 C;  2LK4 A;  1FFT C;  2YVK A;  4PR9 A;  3C18 A;  4P9F A;  2Q3T A;  3DD7 A;  4KNV A;  1DOV A;  2VH3 A;  2GAQ A;  2Y3H A;  1M2O A;  1ZHX A;  1JPJ A;  1TFO B;  2AVK A;  2EIJ C;  2FGY A;  2G62 A;  1A7V A;  2L6F A;  2YLD A;  3EFO A;  3NKD A;  3T4R A;  4EIY A;  5B3I A;  2LP4 A;  1VLS A;  4LLE A;  2D5R B;  4NTF A;  2XXA A;  2YZS A;  2R03 A;  4DBQ A;  1BR2 A;  3DAF A;  2J0W A;  3Q7L A;  2XLV A;  1LM3 B;  2BC5 A;  1ORJ A;  2OQM A;  2V26 A;  5JRA A;  2RSE B;  3ZQY A;  3WOD F;  5CI8 A;  1F1M A;  1JOG A;  1D1A A;  3W4Y A;  2XS8 A;  3ZVR A;  1D1B A;  1TWA A;  4YN0 B;  4OIR F;  2P7V A;  4CDV A;  1G8X A;  3QZC A;  4IAQ A;  2WL8 A;  5A6B A;  3QVZ A;  4LDR A;  2R25 A;  3ABM C;  3EG9 A;  3O6X A;  2Q7R A;  4DVZ A;  2A0B A;  3SEO A;  1LE2 A;  3UGP A;  1G4U S;  4JE9 A;  2EIL C;  4JTA B;  1N1C A;  4QDL A;  2R7X A;  4JZA A;  2Z15 A;  1Z7Q c;  3AG2 C;  4XPY A;  4JJG A;  4O6M A;  1QZX A;  3PMR A;  3JYH A;  4P9T A;  2CYD A;  2JPU A;  2EIM C;  4U9D A;  2LSE A;  4EWC A;  3MLG A;  3IQ6 A;  4XLN F;  3W8H A;  5L0J A;  1OW8 A;  4D4N A;  5L0D A;  3RKO F;  5KYY B;  1SR2 A;  3JCU Q;  4K0D A;  1OCO C;  1OW7 A;  1V4A A;  4CS8 A;  1LI7 A;  1TFK B;  1S05 A;  5JVE A;  1QLE C;  4JUR I;  2ZD9 A;  1Y4C A;  2KW3 C;  2J9U A;  3T6J A;  3GM1 A;  3MYF A;  1T9K A;  4U5D E;  3TJ5 A;  1C03 A;  3HNL A;  1C02 A;  1LS4 A;  1LIH A;  4MVM A;  5GPG B;  3B71 A;  3MBG A;  3KMI A;  4FX5 A;  4JEB A;  3B0P A;  4DOZ A;  3A11 A;  3LUT B;  3G4X A;  3QVY A;  2H7V C;  3N2Z B;  4MQ9 F;  3ASO C;  4NY3 A;  3TOM A;  1HW2 A;  3LS1 A;  3FXH A;  4MW3 A;  2IM8 A;  1PD1 A;  1NG1 A;  3JTL O;  3ZQV A;  4ER9 A;  5TJ5 E;  2IXM A;  2Y3B A;  3K1I C;  3JZ0 A;  3RIP A;  4OIO F;  2DYR C;  3HNJ A;  4EHP A;  3EZH A;  1Q0K A;  1JR8 A;  4J30 B;  1A7E A;  2AU5 A;  2IBF A;  3H2V A;  4B6I A;  1FAP B;  3MX3 A;  2NPU A;  1BZ4 A;  2M64 A;  5DLJ A;  1MNE A;  3PCV A;  4BJ5 C;  4OIP F;  2P1A A;  3DM9 B;  3B0V C;  2I15 A;  5L0H A;  4BJ1 A;  3O39 A;  4ULW A;  1ORY A;  3NG1 A;  3VM6 A;  2TMV P;  2PF4 E;  2XM4 A;  2YRF A;  1YDI A;  1YZA A;  1G5Z A;  2IXN A;  5A6A A;  1JRA A;  4FWV A;  5L0F A;  1YZC A;  4I3M A;  1RJ9 A;  4EBJ A;  3TQO A;  3LNR A;  4E17 A;  4PAC A;  3EFO B;  1V54 C;  4G78 A;  5D92 A;  4JCH A;  3G50 A;  2AP3 A;  1ZHT A;  3CAX A;  5L0G A;  3POV A;  3UGO A;  5T3T A;  1FNT c;  2YL3 A;  2XRH A;  1JPN A;  3EPV A;  2VAS A;  3S84 A;  4ZLD A;  1U0B B;  3B29 A;  3ASN C;  5A6B D;  3UMK A;  1E83 A;  1OKK D;  3LLI A;  4JEA A;  2Y3G A;  3T9O A;  5BUO A;  2IYL D;  1SMY F;  2WVQ A;  5AC4 A;  1H9T A;  1L7C A;  2OCC C;  3E70 C;  4BJ6 A;  1ZVZ A;  4O6N A;  3U8P A;  2HJ3 A;  2HS5 A;  4GEH A;  1SZI A;  3JT1 A;  4YWQ A;  5T1D B;  2NUT B;  4NTA A;  4XQ1 A;  2WVO A;  4DXW A;  1C17 M;  2NUT A;  5KYN A;  2XLH A;  3AQB A;  3X2Q C;  5EHH A;  2ZXW C;  2Q4F A;  3ITF A;  3U8V A;  4K1O A;  2PNO A;  2OEX A;  2EPN A;  4AX2 A;  1MMN A;  2P6V A;  3HTK C;  5D91 A;  3TJ6 A;  1ZU5 A;  5JP7 A;  3RQG A;  1FMV A;  3LAY A;  4RBN A;  1Q0G A;  1VLT A;  4W8K A;  1TKN A;  1M2V B;  3IQC A;  3M4B A;  3RF3 A;  4XLP F;  2KK1 A;  1U89 A;  1V74 B;  3QW1 A;  3SYN A;  3W2V A;  3H2U A;  1RKE B;  2NG1 A;  1ZW3 A;  3ATP A;  4YJW A;  1HE9 A;  3R7C A;  1YJG A;  1HMO A;  3GEE A;  4WJ0 A;  4X0R A;  3BEH A;  5EGY A;  3VRC A;  3TUL A;  2J8W A;  1ST6 A;  1XWJ A;  3DXJ F;  4MTG A;  1KTM A;  1VMA A;  2G3V A;  1A0B A;  3MYI A;  2XLO A;  4JRZ A;  1LS1 A;  3Q7G A;  4DBR A;  2C04 A;  1E86 A;  4H54 A;  2BE5 F;  2A1D D;  4PJL A;  3SZR A;  4BJ6 C;  4C3E A;  2A68 F;  5JSL A;  1CGM E;  2G3K A;  3FAJ A;  4ONS A;  5KYU A;  4XTK A;  2Q00 A;  4M63 A;  2YQY A;  4BJT A;  1OCR C;  2KJG A;  4AL1 A;  1BBH A;  1MMD A;  3U3F A;  3SXY A;  4IWB A;  1Q0F A;  3L8I A;  3TD7 A;  2KNH A;  3FHD A;  2J0X A;  4J32 B;  2A69 F;  2GA0 A;  4O79 A;  3GEI A;  3DJU B;  4YT2 A;  1M6T A;  2ZXR A;  1OW6 A;  4MVU A;  3U2M A;  3T6B A;  2HMQ A;  1NBB A;  4JW1 A;  3PDM P;  4EBB A;  2PX3 A;  1ZZP A;  1E84 A;  1QVX A;  3QMK A;  2XL4 A;  4JJF A;  4W8P A;  2Y69 C;  3DM5 A;  3I5P A;  3K33 A;  3KPH A;  2GFH A;  2WZG A;  3UMH A;  3V5X A;  3WHN A;  1T5O A;  5DS4 A;  4Q4Z F;  4NQF A;  1XZQ A;  3NRH A;  3ABK C;  4U5F E;  4G7O F;  2HV7 A;  4G7Z F;  3AG1 C;  1PD0 A;  5A6J A;  4WAB A;  4WGY A;  4DJ9 A;  3RYL A;  4LER A;  3GWL A;  4H4K C;  5B1A C;  1YAU O;  4BJ5 A;  2X0C A;  3TK0 A;  2R7V A;  1GGQ A;  1ZW2 A;  1Q0M A;  2DI3 A;  4GQH A;  2PP4 A;  3DE8 A;  4DRI B;  4RD9 A;  5B1B C;  4CDA A;  2GDC A;  2R9R B;  4PFP A;  2KC3 A;  2PBE A;  1D1C A;  3C8G D;  3IEE A;  3SXM A;  4ULV A;  1CPQ A;  5KYU B;  2P0N A;  3GOR A;  2Y3D A;  2R7W A;  1QKR A;  5DQZ A;  3TOL A;  3F47 A;  5BQG A;  1FR0 A;  4MVO A;  1YVI A;  2EPO A;  1EKY A;  3C8G B;  1D0Z A;  4L6R A;  4KI2 A;  1R5I D;  1NLX A;  4ZLC A;  4G0H A;  2XLW A;  3EG9 B;  3DZA A;  4QI2 A;  5AGF A;  2J9W A;  2JD3 A;  2L6H A;  4PJN A;  5L0C A;  4WGZ A;  3E9V A;  1WAT A;  1B68 A;  1RKC A;  4C3B A;  1AVO B;  4MVR A;  4CDY A;  5BQH A;  1W2W A;  1T6Q A;  2WZF A;  5F28 E;  3WG7 C;  4UDV A;  2MYS A;  4BEJ A;  3U5S A;  1UG7 A;  3FDQ A;  3NYL A;  2NUP B;  4K7B A;  4LDQ A;  2LQG A;  2KGO A;  3F46 A;  3RW0 A;  1BDJ B;  3C8Z A;  3W8I A;  3CSK A;  2R02 A;  4FAP B;  3U0C A;  3IQT A;  2Q9C A;  1MMA A;  2XL6 A;  4FES A;  1T01 A;  4LAC B;  3RFY A;  2ASR A;  1HY5 A;  3C63 A;  4C7O B;  5CI9 A;  3ZC4 A;  2H8A A;  2LCH A;  3HNI A;  4I1O B;  3VYW A;  1YLM A;  4E7S A;  2L6G A;  4R32 A;  5E3A A;  2LFD A;  2ZPA A;  5JT4 A;  4D4X A;  4I1M A;  3S29 A;  1ZHZ A;  2GWW A;  1BR1 A;  3KYJ A;  1Z23 A;  2HFI A;  1ZHY A;  1H9G A;  1WN0 A;  3M79 A;  2CGE A;  2UUH A;  3EHM A;  2WB7 A;  3IQ5 A;  4MVZ A;  2OOC A;  1RMV A;  3K7D A;  2VB6 A;  2W4M A;  1Y6D A;  4XEF A;  4CJG A;  1O3U A;  2X51 A;  3RH3 A;  4CIP A;  1D0X A;  3ZG1 A;  4PFO A;  2BL2 A;  1WOL A;  2XXA B;  2NSF A;  1OXK A;  3CQZ A;  2H7B A;  3NDB B;  4E18 A;  2V3C C;  1APC A;  4CS9 C;  2FFH A;  2YL7 A;  3L8J A;  1YYJ A;  4YL0 A;  5AC5 A;  3O10 A;  4XPW A;  2QUP A;  3PHF 2;  4KBL A;  2HV6 A;  4MTO A;  4YL3 A;  5COM A;  2IOQ A;  2WZL A;  3AQC A;  4EBK A;  5T3W A;  2R7T A;  4U5H A;  3VF0 A;  2P61 A;  4CS9 A;  4CSA C;  3LJB A;  3JSE O;  3QTH A;  3HKK A;  1TWG A;  4EUK B;  3NKE A;  3M15 A;  4IAO A;  2R7S A;  3FMS A;  4U5B E;  2M4E A;  4E0I A;  1Z6A A;  1CGO A;  5KYX B;  4JC7 A;  3LNM B;  1I4Y A;  1OKK A;  1T6I A;  3K6B A;  3JRM O;  2QLA A;  2HJM A;  1QPU A;  1R4T A;  1OCC C;  2J9V A;  3GWN A;  3LEV A;  1CGN A;  4JVS A;  3UNG C;  2YHS A;  1SF8 A;  2CCY A;  4G7H F;  4N6H A;  1S7Z A;  3KH2 A;  2ZXP A;  2YL1 A;  4DRJ B;  4MND A;  1OXB A;  1E2X A;  3G4Z A;  4GYT A;  1E85 A;  3UMI A;  1LKX A;  2E87 A;  3NMK A;  4NTB A;  3EJN A;  1KNY A;  3C8G A;  2R7U A;  4U9E A;  1BR4 A;  2RD9 A;  2R05 A;  3EGD B;  3MFN A;  2EPK X;  1T6U A;  4Q5S F;  1M56 C;  4LDK A;  1PCX A;  1O87 A;  3ZDL A;  1LVK A;  3JSZ A;  2XM0 A;  5JUA A;  4N6C A;  3J06 A;  4P6I C;  1NFO A;  1Z3I X;  2W9Y A;  4U5G A;  3RQE A;  2B0H A;  4CS7 A;  2QE9 A;  3KL4 A;  4NC3 A;  3S0X A;  3N24 A;  2IXO A;  5KYX A;  5HV9 A;  4YK5 A;  1FTS A;  4U5C E;  1Z5Z A;  1EI7 A;  1WTY A;  2XLD A;  2FAP B;  3OWT A;  4N4W A;  3U9J A;  2R7R A;  3NMI A;  1QQ3 A;  2EPL X;  3SP1 A;  3ZWI A;  3X1O A;  4HFK B;  3K66 A;  3Q6M A;  5CIV A;  3LES A;  5COG A;  5K0I A;  4Q7C A;  1OQC A;  1YA7 O;  3R2P A;  4C3D A;  1L3P A;  4JKV A;  4E0H A;  5JLI A;  1K04 A;  3EH1 A;  2MWQ A;  1WGW A;  3W2W A;  1D0Y A;  3IHU A;  4A2N B;  4BPM A;  2EIK C;  1DOW A;  1VYK A;  1EQ1 A;  4AE4 A;  1CPR A;  2W45 A;  3AGT A;  1Q0D A;  1MMG A;  5F5H A;  1TR2 A;  3S9O A;  5COF A;  2W4B A;  3WAQ A;  1HW1 A;  4XWJ A;  1PV3 A;  3EGX A;  1YYX A;  4I44 A;  4CBE A;  4CJO A;  4XEV A;  5DS6 A;  2DYS C;  2J46 A;  3ZTZ A;  4IGG A;  3ECS A;  3US6 A;  2B0J A;  4F4B A;  4MVS A;  1J8M F;  1H6G A;  1MND A;  1ZYR F;  2OEV A;  2ZXO A;  3SXZ A;  3Q6N A;  3AJM A;  2PFD A;  4CIH A;  4XPX A;  2CNW D;  1OR2 A;  3HNK A;  4AL0 A;  5L3V A;  4Z9J A;  3K1I A;  3ZIB A;  4IRU A;  5L0I A;  2IXP A;  4PJM A;  2EIN C;  1NZE A;  1LPE A;  2VCC A;  2HSB A;  3KKB A;  3EH2 A;  4MVQ A;  2A0U A;  3S28 A;  3AG3 C;  3U2L A;  3JRT A;  4YT8 A;  1RCP A;  1XZP A;  3FAP B;  4CX9 A;  1GM5 A;  1A7D A;  3HJC A;  3KYI A;  1TWH A;  3H65 A;  4OD5 A;  3V5Y A;  3IPM O;  4MS2 A;  2OKU A;  3M1C B;  5JS5 A;  4DVY P;  3A9C A;  3EGX B;  4JTC B;  4JCZ A;  4CS8 C;  2XLM A;  4BEM J;  1I4Z A;  1V55 C;  4C7O A;  3L1M A;  1JMW A;  3RVY A;  4AE4 B;  2KYH A;  4PJJ A;  2NSG A;  5HSW A;  3AGU A;  2Q9B A;  4HFF B;  3NYJ A;  4OIQ F;  2XL8 A;  3L0I A;  4Z9I A;  2QNL A;  1RXQ A;  5KYW B;  1TWC A;  2NUP A;  2A6E F;  3K1H A;  5E2Q A;  4PK4 A;  2A6H F;  2EPM X;  3DKA A;  3EGD A;  2VC9 A;  1LI5 A;  2OJE D;  1A41 A;  1NSG B;  3AG4 C;  5A6K A;  3S27 A;  1I5N A;  3DMD A;  4MW8 A;  4RDA A;  1VTM P;  1RJ9 B;  3OEO A;  2D4U A;  2R7O A;  2YKZ A;  5E3C A;  3U9M A;  2LFF A;  3DWW A;  1IZM A;  3GM3 A;  2YWA A;  5FZT A;  1M57 C;  2J9B A;  4EKW A;  3GM2 A;  4BG0 A;  1GS9 A;  2DB4 A;  4ANJ A;  1MQV A;  1FMW A;  3ZSU A;  5DS5 A;  2KQ9 A;  3NYM A;  1NFN A;  1AEP A;  4JTD B;  2QTV A;  3AOU A;  4CSA A;  5BQI A;  3BRJ A;  3C62 A;  3DJN B;  3QW0 A;  2I8B A;  3S90 A;  3DE9 A;  3ZTM A;  2CDQ A;  1AUE A;  256B A;  4YT4 A;  3FOP A;  4QI0 A;  2LD6 A;  3SXK A;  4DRH B;  1HE1 A;  1J8Y F;  2VCB A;  2KSF A;  1NU9 C;  3L34 A;  2Q9A A;  4N06 A;  3UR3 C;  3C7J A;  1LE4 A;  1O5H A;  3V5Z A;  1U6H A;  2JX0 A;  2MHR A;  3HLZ A;  3NMJ A;  3DAG A;  2O9X A;  3U3B A;  1SYQ A;  1VK5 A;  2HUJ A;  2L9J A;  2XS1 A;  1GQA A;  3EHN A;  3GOD A;  4OD4 A;  5DQT A;  4A4A A;  2XSE A;  1NU7 D;  2PX0 A;  3FOO A;  3N0T A;  4Z9H A;  3ABL C;  1OR3 A;  2WVN A;  2YEV A;  4KNW A;  1TQG A;  2L81 A;  3LLK A;  3RVZ A;  3CZ6 A;  4AK9 A;  5KYW A;  3M4C A;  1KU2 A;  4HE8 D;  5E33 A;  5B3S C;  3JYY A;  4IAR A;  2HMZ A; 
#chains in the Genus database with same CATH homology
 4J7Y A;  4J7T A;  3PCV A;  5BQI A;  2UUI A;  5K0I A;  4YL0 A;  4NTB A;  5BQG A;  4YL3 A;  4BPM A;  2Q7R A;  4NTA A;  4JRZ A;  2H8A A;  3HKK A;  4NTF A;  3LEO A;  4YL1 A;  3DWW A;  2PNO A;  4WAB A;  4JCZ A;  4JC7 A;  5BQH A;  4AL1 A;  2UUH A;  5HV9 A;  4YK5 A;  4AL0 A;  3B29 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...