4NTFA

Mus musculus ltc4 synthase in s-hexyl-gsh complex form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
145
structure length
145
Chain Sequence
HKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title To be published
rcsb
molecule keywords Leukotriene C4 synthase
molecule tags Lyase
source organism Mus musculus
total genus 60
structure length 145
sequence length 145
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4ntfA00
4WABA 3PCVA 3B29A 4JCZA 2Q7RA 2PNOA 4YL1A 3DWWA 3LEOA 4JC7A 4NTFA 4J7YA 2UUHA 3HKKA 4NTAA 4BPMA 4NTBA 5HV9A 5K0IA 4YL3A 4J7TA 2H8AA 4YK5A 4AL0A 5BQIA 5BQHA 4AL1A 2UUIA 5BQGA 4JRZA 4YL0A
chains in the Genus database with same CATH superfamily
2XLOA 1CPQA 2YEVA 2ZXOA 2PNOA 1A0BA 3NKEA 1KTMA 1F1MA 1SF8A 2OEXA 3BEHA 3CZ6A 3M1CB 3RVZA 2A1DD 3HKKA 2HMQA 4JTCB 3W4YA 4U5BE 2YLIA 5AC5A 3GORA 3VM6A 4AE4B 4OIRF 3U9JA 4E17A 2DB4A 5K0IA 2A68F 4XPWA 4ER9A 2PF4E 2EIJC 4YL3A 3F46A 3FMSA 3G4XA 4J30B 1QQ3A 3QZCA 5DQTA 2EPMX 1FMWA 3O55A 2J9UA 4Q5SF 1SR2A 1BZ4A 3NYMA 4JJFA 4L6RA 1E85A 2V3CC 3IEEA 3UMKA 1ORSC 2NG1A 2XXAA 3NRHA 4EBBA 2J0XA 2P7VA 4O6MA 3TJ5A 3UMIA 3NYLA 1BDJB 3K1HA 1YYXA 3KPHA 3SXYA 3U2LA 5T3WA 1XWJA 3T4RA 4UDVA 2MHRA 4DRJB 1O5HA 5COGA 3RW0A 1GQAA 4JW1A 4YT2A 1C02A 3JSZA 5TJ5E 2YVKA 3EG9B 3RKOF 2JX0A 5E33A 1OW7A 3ABKC 1HMDA 4I3MA 1RXQA 4MVOA 1YYJA 3CSKA 3SZRA 1Z63A 1T5OA 4PJJA 1NG1A 3TK0A 2CCYA 1LS4A 1O87A 4CIPA 4CSAC 2VASA 1I4YA 4NQFA 2J9WA 2B0JA 3N2ZB 5DS4A 3A11A 1U6HA 4JVSA 1BBHA 4XWJA 4X0RA 4CX9A 3VRCA 1ZHYA 3JRMO 3PCVA 2AWYA 1K04A 2GA0A 5L0GA 1EQ1A 4Z9HA 4DXWA 3FXHA 2LSEA 3PDMP 4IGGA 5F5HA 3QTHA 2EPNA 4GYTA 4A2NB 4CBEA 3ASOC 4MVUA 2OQMA 1VMAA 5T1DB 5A6KA 1FMVA 3S28A 1IW7F 1R5ID 2AU5A 2EIMC 3HLZA 3MLGA 2XS1A 3ASNC 4PJNA 4CS8A 5B3IA 1OXBA 5A69A 2R7TA 3LJBA 2J9BA 5COFA 1DOWA 1JRAA 2R05A 3RQGA 2OOCA 3K1IA 3ZSUA 4YT4A 3QW0A 3MX3A 5JRAA 2OJED 1CGME 4QI2A 1OCCC 1NSGB 2WB7A 2OJQA 3B9QA 4C3DA 3POVA 4E7ZA 4DRIB 2R7WA 3B0VC 3LS0A 4CS8C 2KQ9A 1G5ZA 2XM0A 4HFFB 4Q4ZF 3AGTA 1OW6A 4O7GA 3WODF 1SZIA 3AG3C 2Y3BA 1ZU4A 3ATPA 3SXKA 2AWCA 2A69F 4NCQA 4CJOA 1BR2A 4OIPF 1PD1A 1E84A 1NFNA 2WZGA 1SYQA 2FAPB 4BEMJ 3RF3A 1LVKA 4JEAA 4YJWA 3G50A 2XXAB 1M57C 4DOZA 4CIHA 4IJJA 4LDKA 2IYLD 3K7DA 1HMOA 3LLIA 5DLJA 3M4CA 1T6IA 2GFHA 3C8GA 3DAGA 2L6GA 2HJ3A 4R32A 1TWCA 2A0UA 2Y3HA 3O6XA 3UMHA 2Y39A 2NSGA 1ZVZA 3DKAA 1WWPA 3EFOA 3NMIA 4IB4A 5KYYA 3HJCA 2CW0F 1A41A 1OCOC 3DI5A 3DE8A 2LD6A 2J46A 3F47A 1RKEB 3H2VA 2HV6A 3N0TA 4EKWA 5L0DA 4IARA 3JTLO 1OW8A 5BQHA 4MVSA 3TULA 1Q0DA 2Q3TA 1Z23A 3ITFA 2YWAA 2EPLX 1LPEA 5L3QA 1VLTA 2A6EF 3R7CA 1Z3IX 4QDLA 4K1OA 1UG7A 1VOMA 1LI5A 5L0CA 2HUJA 4EBJA 1L7CA 5KYWA 3ZIBA 2Q4FA 2YHSA 4NTAA 1G4WR 3W2WA 1TFOB 1QPUA 4DBQA 2X51A 5JVEA 4MS2A 3M15A 4JURI 1XZQA 5HV9A 2Q9AA 4YWQA 4ULWA 2M64A 4RBNA 4BJ1A 2YZSA 3EHMA 2DI3A 3AG4C 1EI7A 4DVZA 2Z15A 5BUOA 1CPRA 5T3TA 5JLIA 3RH3A 1N1CA 3QVZA 2LQGA 5CI8A 5KYXB 4MVZA 2QNLA 2MWQA 5CI9A 3JYHA 3MYIA 4XLNF 5KYUB 2R7SA 1JR8A 4O79A 1QSPA 2MYSA 2PX3A 4OD5A 1ZW2A 2CDQA 1MMAA 1NU9C 2LIGA 2W4MA 4JCZA 2CNWA 3UGOA 2B0HA 3LEOA 4JC7A 1YAUO 1D1CA 1U89A 3AGUA 5B3SC 1FR0A 2O9XA 3Q7LA 1TKNA 4OINF 3KKBA 1A7DA 4EIYA 3FVYA 2H7OA 3X2QC 2L6HA 3K1IC 3MYFA 1LI7A 2P61A 3E70C 4I1MA 4E0HA 4WGZA 5A6BA 1TQGA 1A7EA 4O6YA 4BJTA 5E2QA 2EPOA 2NUPA 1Q0KA 3GM1A 1HY5A 2HV7A 3EH1A 3TJ6A 4ANJA 1PD0A 1QKRA 3B0UX 2XLWA 2XS8A 2VC9A 2R7XA 4YN0B 3S9OA 5BQIA 3OEOA 1V54C 5JUAA 4J32B 1WOLA 4CDAA 5KYYB 2OU6A 4PJLA 2BE5F 5L0HA 2UUIA 1OR3A 1ZHXA 1BR1A 3QW1A 3FDQA 2EIKC 4JIOA 2KK1A 3U0CA 4D4NA 3C18A 3LLKA 2YL1A 4JCHA 2J9VA 3DWWA 4DBRA 4KNWA 3KMIA 4NTBA 2G3VA 2VCCA 3IQ6A 1D0ZA 5GPGB 2ASRA 4U5HA 3FHDA 1M2VB 3S27A 1JOGA 3EZIA 1RJ9A 2I15A 3RQEA 1FNTc 3JYYA 1AVOB 2BL2A 3L34A 2XLMA 2P1AA 4KNVA 3IQ5A 4K7BA 4M63A 2DYRC 3K33A 2L7AA 4IWBA 2IXNA 1J8YF 5D91A 2Q9BA 1OKKD 1S7ZA 3EGXA 3GEHA 4LDRA 4C7OB 4H54A 3IQTA 3ZTMA 4B6IA 1GM5A 1H9TA 4N6HA 1UFBA 2WZFA 4BPMA 2R7VA 4MVMA 2V26A 3U8PA 1NFOA 3LNMB 2NSFA 1Z7Qc 2KSFA 4CS9C 5JSLA 3ZQVA 2UUHA 1JPJA 3EGDA 4EUKB 2M4EA 2W4BA 1MMGA 5EGYA 2YQYA 1L3PA 2XL8A 1QZXA 4LACB 3GEIA 2P6VA 4JZAA 2XL4A 2YRFA 4WGYA 2TMVP 1ZU5A 4F4BA 1R4TA 1T01A 1ZYRF 2KC3A 3I4UA 3C8ZA 1MQVA 2ZXPA 4DJ9A 1YDIA 5JP7A 1VLSA 3LUTB 5IY5C 3M4BA 1Y6DA 2RD9A 4RD9A 1ZZPA 1C03A 1KU2A 2D4UA 4Q7CA 4U9EA 4G7HF 2ETSA 1BR4A 5B1BC 4C3BA 1OR2A 3C62A 5F5FA 4G7ZF 5L0IA 2J8WA 4PFPA 2NUPB 2YLDA 1M2OA 3O10A 5L3VA 4HFKB 2YL3A 3JCUQ 3SYNA 1ST6A 2ZD9A 2QLAA 4O6NA 1YZAA 2RSEB 3W2VA 2P0NA 3ZWIA 3ZVRA 2NUTA 1HE1A 4J7YA 5D92A 2G3KA 3AG1C 2C04A 3US6A 3JRTA 4Z9IA 1WASA 4GQHA 3PHF2 1CGNA 1H9GA 2CNWD 2XLVA 1TWGA 2ZXRA 3ZTZA 4P6IC 4FWVA 3IQCA 3TD7A 3J06A 4BJ6A 4E7SA 2YL7A 2XLEA 3B71A 1J8MF 4I44A 3DE9A 2LP4A 1WATA 2VH3A 1Z5ZA 3AG2C 1G8XA 1K40A 1YLMA 1GGQA 1YZCA 3CAXA 3HTKC 4JTDB 5A6BD 1RKCA 2KW3C 2PX0A 3HNJA 1U0BB 3U8VA 1YA7O 4PJMA 4YT5A 5EK0A 4H4KC 2WZLA 2XLDA 2A0BA 5BQGA 4ZLDA 2GAQA 2ZPAA 3ABLC 4JRZA 4AE4A 3NDBB 3C7JA 5DQZA 1T6QA 3ZDLA 3SEOA 2YKZA 4KI2A 2J7PA 4XPXA 5A6JA 2KJGA 1E83A 3EJNA 2VB6A 2Y3DA 3K6BA 3BRJA 3DD7A 4E18A 4EHPA 2VCBA 1MNDA 1TWHA 4JJGA 3M79A 5F28E 2FFHA 3W8IA 3WG7C 4A4AA 4G7OF 4CDVA 1QLEC 3GM2A 4CS9A 3DM9B 1CGOA 3RFYA 3SNHA 3R2PA 2YL0A 2HSQA 2OCCC 4P9FA 4CDYA 1RMVA 3U3BA 3TOMA 2PFDA 3T9OA 1D1AA 3SXZA 3PMRA 5HSWA 1Q0MA 3Q6NA 3NG1A 3NMKA 5L0JA 4HE8D 3T6JA 3T6GB 3RYLA 3I5QA 1I5NA 3DJUB 4OIQF 5B1AC 4U5DE 1AUEA 1HE9A 1HW1A 3MFNA 4JKVA 2R7RA 3AOUA 1XZPA 3GANA 4U5CE 1OQCA 3GEEA 2YLGA 4MW3A 3B29A 3EG9A 4D4XA 5E3AA 1ORYA 1M56C 2IBFA 3GM3A 3VYWA 2VCAA 4EWCA 2EILC 3KL4A 4NTFA 2IXMA 3UGPA 3SP1A 4E0IA 4MTFA 1LS1A 1WN0A 1JAFA 5AC4A 3DXJF 3JT1A 2QUPA 2LCHA 4WJ0A 4QI0A 2PP4A 3KYJA 3LESA 3S29A 4W8KA 2KYHA 3S84A 2OKUA 2FGYA 3LAYA 1HW2A 1YARO 4RDAA 3ECSA 1B68A 1H7IA 4MVQA 4XEFA 4XEKA 3C8GB 3U3FA 3EQLF 2A6HF 2ZXWC 2Y3GA 2HZ8A 2CYDA 1PV3A 4JE9A 3EFOB 5DS5A 1V4AA 1LKXA 5COMA 3W8HA 2KNHA 4DVYP 2XSEA 4YL0A 3EPVA 1E86A 1LIHA 1NZEA 2Q7RA 3ZQYA 2W45A 3KH2A 3A9CA 4PK4A 3U2MA 4OIOF 2WVNA 1TFKB 2BC5A 4G0HA 1NU7D 5E3CA 4ONSA 1NLXA 3DZAA 4BJ6C 2QE9A 2XM4A 1APCA 4LERA 3EZHA 1S05A 1TR2A 3E9VA 2X0CA 4C3EA 5KYWB 1OCRC 4MW8A 2R9RB 1IZMA 3V5XA 2Q00A 3U9MA 3L1MA 4AL0A 2Y69C 3IPMO 3C8GD 4XQ1A 3LEVA 3L0IA 3H65A 3RQFA 2C03A 3VAYA 3VF0A 2OEVA 3DM5A 1AEPA 1ZHTA 2R7QA 2WVQA 3LS1A 4N06A 4KC9A 1VTMP 1WGWA 4WABA 4IAOA 3TOLA 1LE2A 3FAJA 4BJ5A 2XL6A 1V74B 3QVYA 3NMJA 4NC3A 3RIPA 4GEHA 1RKEA 3N24A 4EBKA 2J7PD 4U5FE 2J45A 4NY3A 2KGOA 3G4ZA 4OD4A 2DYSC 4W8PA 5FZTA 4J7TA 2H8AA 1D1BA 4FESA 2R7OA 3NKDA 2I8BA 2R02A 2XLHA 1MNEA 2IXPA 3CQZA 4PACA 2W9YA 2AP3A 4I1OB 1LE4A 4CSAA 3EH2A 2OG2A 4G78A 5KYNA 1WTYA 1OXKA 1E2XA 2J0WA 3DMDA 4LLEA 5L0FA 3H2UA 4BEJA 3ABMC 4JTAB 3GWLA 3FOOA 4U9DA 4ULVA 2L6FA 2L81A 1ORJA 1RCPA 256BA 2GDCA 1O3UA 4YT8A 2QY9A 2QTVA 3GODA 4HEAJ 3C63A 3I5PA 4N6CA 1PCXA 3UR3C 4N4WA 2F22A 3MBGA 4KBLA 5JS5A 3L8IA 2JPUA 2HSBA 5KYXA 5FCLA 2E87A 4IRUA 1C17M 1D0YA 2H7BA 4PR9A 1EKYA 2HJMA 5KYUA 1ZHZA 1JPNA 1GS9A 3JZ0A 3SXMA 4XLPF 1W2WA 3K66A 2G62A 2HKVA 3HNKA 4MTOA 2WVOA 1RJ9B 3IHUA 3AQBA 2AVKA 2R7UA 5CIVA 1TWAA 1JMWA 2R03A 1YVIA 1QVXA 2WL8A 3ZG1A 4AK9A 2DGJA 4JEBA 1OCZC 4YL1A 2LK4A 1MMDA 1V55C 3OWTA 1VK5A 2IM8A 2ICWG 1M6TA 3EHNA 3EGXB 4LLCA 4MVRA 3U5SA 3V5YA 4CJGA 5A6AA 1G4US 4XEVA 4XTKA 4CS7A 1VYIA 1ZW3A 4Z9JA 1A7VA 4AX2A 5EHHA 1I4ZA 2EPKX 5AGFA 3TQOA 4YK5A 3LNRA 4P9TA 4BG0A 2GWWA 2PBEA 1H6GA 1FFTC 1K05A 1OKKA 3DAFA 1Q0FA 3EGDB 3OA1A 4MTGA 3UNGC 1SMYF 3FAPB 4IAQA 2XRHA 3V5ZA 5JT4A 3Q7GA 2LFFA 3WHNA 4FAPB 1T6UA 3KYIA 4U5GA 3AQCA 3GWNA 3S0XA 3CEXA 1YJGA 2HFIA 4ZLCA 1Y4CA 3Q6MA 4U5EE 1ZHWA 3FOPA 4BJ5C 2R25A 1M2VA 1EA8A 3NYJA 2IXOA 4K0DA 3V7OA 1FTSA 4XPYA 1LM3B 1VB5A 1YA9A 1KNYA 2Q9CA 3ZC4A 3T6BA 1D0XA 3QMKA 2LFDA 3RVYA 4MQ9F 1FFHA 2HMZA 1MMNA 2H7VC 1Q0GA 3DJNB 2L9JA 5DS6A 5DVWA 2EINC 1DOVA 2NUTB 4LDQA 4MNDA 1Z6AA 2JD3A 2D5RB 4C7OA 1FAPB 3L8JA 3X1OA 3HNLA 1VYKA 3JSEO 3B0PA 4DRHB 2IOQA 4PFOA 2HS5A 2NPUA 4FX5A 3O39A 3WAQA 4AL1A 2CGEA 1NBBA 3S90A 3AJMA 1T9KA 3HNIA
chains in the Genus database with same CATH topology
4WABA 3PCVA 3B29A 4JCZA 2Q7RA 2PNOA 4YL1A 3DWWA 3LEOA 4JC7A 4NTFA 4J7YA 2UUHA 3HKKA 4NTAA 4BPMA 4NTBA 5HV9A 5K0IA 4YL3A 4J7TA 2H8AA 4YK5A 4AL0A 5BQIA 5BQHA 4AL1A 2UUIA 5BQGA 4JRZA 4YL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WAB A;  3PCV A;  3B29 A;  4JCZ A;  2Q7R A;  2PNO A;  4YL1 A;  3DWW A;  3LEO A;  4JC7 A;  4NTF A;  4J7Y A;  2UUH A;  3HKK A;  4NTA A;  4BPM A;  4NTB A;  5HV9 A;  5K0I A;  4YL3 A;  4J7T A;  2H8A A;  4YK5 A;  4AL0 A;  5BQI A;  5BQH A;  4AL1 A;  2UUI A;  5BQG A;  4JRZ A;  4YL0 A; 
#chains in the Genus database with same CATH topology
 2XLO A;  1CPQ A;  2YEV A;  2ZXO A;  2PNO A;  1A0B A;  3NKE A;  1KTM A;  1F1M A;  1SF8 A;  2OEX A;  3BEH A;  3CZ6 A;  3M1C B;  3RVZ A;  2A1D D;  3HKK A;  2HMQ A;  4JTC B;  3W4Y A;  4U5B E;  2YLI A;  5AC5 A;  3GOR A;  3VM6 A;  4AE4 B;  4OIR F;  3U9J A;  4E17 A;  2DB4 A;  5K0I A;  2A68 F;  4XPW A;  4ER9 A;  2PF4 E;  2EIJ C;  4YL3 A;  3F46 A;  3FMS A;  3G4X A;  4J30 B;  1QQ3 A;  3QZC A;  5DQT A;  2EPM X;  1FMW A;  3O55 A;  2J9U A;  4Q5S F;  1SR2 A;  1BZ4 A;  3NYM A;  4JJF A;  4L6R A;  1E85 A;  2V3C C;  3IEE A;  3UMK A;  1ORS C;  2NG1 A;  2XXA A;  3NRH A;  4EBB A;  2J0X A;  2P7V A;  4O6M A;  3TJ5 A;  3UMI A;  3NYL A;  1BDJ B;  3K1H A;  1YYX A;  3KPH A;  3SXY A;  3U2L A;  5T3W A;  1XWJ A;  3T4R A;  4UDV A;  2MHR A;  4DRJ B;  1O5H A;  5COG A;  3RW0 A;  1GQA A;  4JW1 A;  4YT2 A;  1C02 A;  3JSZ A;  5TJ5 E;  2YVK A;  3EG9 B;  3RKO F;  2JX0 A;  5E33 A;  1OW7 A;  3ABK C;  1HMD A;  4I3M A;  1RXQ A;  4MVO A;  1YYJ A;  3CSK A;  3SZR A;  1Z63 A;  1T5O A;  4PJJ A;  1NG1 A;  3TK0 A;  2CCY A;  1LS4 A;  1O87 A;  4CIP A;  4CSA C;  2VAS A;  1I4Y A;  4NQF A;  2J9W A;  2B0J A;  3N2Z B;  5DS4 A;  3A11 A;  1U6H A;  4JVS A;  1BBH A;  4XWJ A;  4X0R A;  4CX9 A;  3VRC A;  1ZHY A;  3JRM O;  3PCV A;  2AWY A;  1K04 A;  2GA0 A;  5L0G A;  1EQ1 A;  4Z9H A;  4DXW A;  3FXH A;  2LSE A;  3PDM P;  4IGG A;  5F5H A;  3QTH A;  2EPN A;  4GYT A;  4A2N B;  4CBE A;  3ASO C;  4MVU A;  2OQM A;  1VMA A;  5T1D B;  5A6K A;  1FMV A;  3S28 A;  1IW7 F;  1R5I D;  2AU5 A;  2EIM C;  3HLZ A;  3MLG A;  2XS1 A;  3ASN C;  4PJN A;  4CS8 A;  5B3I A;  1OXB A;  5A69 A;  2R7T A;  3LJB A;  2J9B A;  5COF A;  1DOW A;  1JRA A;  2R05 A;  3RQG A;  2OOC A;  3K1I A;  3ZSU A;  4YT4 A;  3QW0 A;  3MX3 A;  5JRA A;  2OJE D;  1CGM E;  4QI2 A;  1OCC C;  1NSG B;  2WB7 A;  2OJQ A;  3B9Q A;  4C3D A;  3POV A;  4E7Z A;  4DRI B;  2R7W A;  3B0V C;  3LS0 A;  4CS8 C;  2KQ9 A;  1G5Z A;  2XM0 A;  4HFF B;  4Q4Z F;  3AGT A;  1OW6 A;  4O7G A;  3WOD F;  1SZI A;  3AG3 C;  2Y3B A;  1ZU4 A;  3ATP A;  3SXK A;  2AWC A;  2A69 F;  4NCQ A;  4CJO A;  1BR2 A;  4OIP F;  1PD1 A;  1E84 A;  1NFN A;  2WZG A;  1SYQ A;  2FAP B;  4BEM J;  3RF3 A;  1LVK A;  4JEA A;  4YJW A;  3G50 A;  2XXA B;  1M57 C;  4DOZ A;  4CIH A;  4IJJ A;  4LDK A;  2IYL D;  3K7D A;  1HMO A;  3LLI A;  5DLJ A;  3M4C A;  1T6I A;  2GFH A;  3C8G A;  3DAG A;  2L6G A;  2HJ3 A;  4R32 A;  1TWC A;  2A0U A;  2Y3H A;  3O6X A;  3UMH A;  2Y39 A;  2NSG A;  1ZVZ A;  3DKA A;  1WWP A;  3EFO A;  3NMI A;  4IB4 A;  5KYY A;  3HJC A;  2CW0 F;  1A41 A;  1OCO C;  3DI5 A;  3DE8 A;  2LD6 A;  2J46 A;  3F47 A;  1RKE B;  3H2V A;  2HV6 A;  3N0T A;  4EKW A;  5L0D A;  4IAR A;  3JTL O;  1OW8 A;  5BQH A;  4MVS A;  3TUL A;  1Q0D A;  2Q3T A;  1Z23 A;  3ITF A;  2YWA A;  2EPL X;  1LPE A;  5L3Q A;  1VLT A;  2A6E F;  3R7C A;  1Z3I X;  4QDL A;  4K1O A;  1UG7 A;  1VOM A;  1LI5 A;  5L0C A;  2HUJ A;  4EBJ A;  1L7C A;  5KYW A;  3ZIB A;  2Q4F A;  2YHS A;  4NTA A;  1G4W R;  3W2W A;  1TFO B;  1QPU A;  4DBQ A;  2X51 A;  5JVE A;  4MS2 A;  3M15 A;  4JUR I;  1XZQ A;  5HV9 A;  2Q9A A;  4YWQ A;  4ULW A;  2M64 A;  4RBN A;  4BJ1 A;  2YZS A;  3EHM A;  2DI3 A;  3AG4 C;  1EI7 A;  4DVZ A;  2Z15 A;  5BUO A;  1CPR A;  5T3T A;  5JLI A;  3RH3 A;  1N1C A;  3QVZ A;  2LQG A;  5CI8 A;  5KYX B;  4MVZ A;  2QNL A;  2MWQ A;  5CI9 A;  3JYH A;  3MYI A;  4XLN F;  5KYU B;  2R7S A;  1JR8 A;  4O79 A;  1QSP A;  2MYS A;  2PX3 A;  4OD5 A;  1ZW2 A;  2CDQ A;  1MMA A;  1NU9 C;  2LIG A;  2W4M A;  4JCZ A;  2CNW A;  3UGO A;  2B0H A;  3LEO A;  4JC7 A;  1YAU O;  1D1C A;  1U89 A;  3AGU A;  5B3S C;  1FR0 A;  2O9X A;  3Q7L A;  1TKN A;  4OIN F;  3KKB A;  1A7D A;  4EIY A;  3FVY A;  2H7O A;  3X2Q C;  2L6H A;  3K1I C;  3MYF A;  1LI7 A;  2P61 A;  3E70 C;  4I1M A;  4E0H A;  4WGZ A;  5A6B A;  1TQG A;  1A7E A;  4O6Y A;  4BJT A;  5E2Q A;  2EPO A;  2NUP A;  1Q0K A;  3GM1 A;  1HY5 A;  2HV7 A;  3EH1 A;  3TJ6 A;  4ANJ A;  1PD0 A;  1QKR A;  3B0U X;  2XLW A;  2XS8 A;  2VC9 A;  2R7X A;  4YN0 B;  3S9O A;  5BQI A;  3OEO A;  1V54 C;  5JUA A;  4J32 B;  1WOL A;  4CDA A;  5KYY B;  2OU6 A;  4PJL A;  2BE5 F;  5L0H A;  2UUI A;  1OR3 A;  1ZHX A;  1BR1 A;  3QW1 A;  3FDQ A;  2EIK C;  4JIO A;  2KK1 A;  3U0C A;  4D4N A;  3C18 A;  3LLK A;  2YL1 A;  4JCH A;  2J9V A;  3DWW A;  4DBR A;  4KNW A;  3KMI A;  4NTB A;  2G3V A;  2VCC A;  3IQ6 A;  1D0Z A;  5GPG B;  2ASR A;  4U5H A;  3FHD A;  1M2V B;  3S27 A;  1JOG A;  3EZI A;  1RJ9 A;  2I15 A;  3RQE A;  1FNT c;  3JYY A;  1AVO B;  2BL2 A;  3L34 A;  2XLM A;  2P1A A;  4KNV A;  3IQ5 A;  4K7B A;  4M63 A;  2DYR C;  3K33 A;  2L7A A;  4IWB A;  2IXN A;  1J8Y F;  5D91 A;  2Q9B A;  1OKK D;  1S7Z A;  3EGX A;  3GEH A;  4LDR A;  4C7O B;  4H54 A;  3IQT A;  3ZTM A;  4B6I A;  1GM5 A;  1H9T A;  4N6H A;  1UFB A;  2WZF A;  4BPM A;  2R7V A;  4MVM A;  2V26 A;  3U8P A;  1NFO A;  3LNM B;  2NSF A;  1Z7Q c;  2KSF A;  4CS9 C;  5JSL A;  3ZQV A;  2UUH A;  1JPJ A;  3EGD A;  4EUK B;  2M4E A;  2W4B A;  1MMG A;  5EGY A;  2YQY A;  1L3P A;  2XL8 A;  1QZX A;  4LAC B;  3GEI A;  2P6V A;  4JZA A;  2XL4 A;  2YRF A;  4WGY A;  2TMV P;  1ZU5 A;  4F4B A;  1R4T A;  1T01 A;  1ZYR F;  2KC3 A;  3I4U A;  3C8Z A;  1MQV A;  2ZXP A;  4DJ9 A;  1YDI A;  5JP7 A;  1VLS A;  3LUT B;  5IY5 C;  3M4B A;  1Y6D A;  2RD9 A;  4RD9 A;  1ZZP A;  1C03 A;  1KU2 A;  2D4U A;  4Q7C A;  4U9E A;  4G7H F;  2ETS A;  1BR4 A;  5B1B C;  4C3B A;  1OR2 A;  3C62 A;  5F5F A;  4G7Z F;  5L0I A;  2J8W A;  4PFP A;  2NUP B;  2YLD A;  1M2O A;  3O10 A;  5L3V A;  4HFK B;  2YL3 A;  3JCU Q;  3SYN A;  1ST6 A;  2ZD9 A;  2QLA A;  4O6N A;  1YZA A;  2RSE B;  3W2V A;  2P0N A;  3ZWI A;  3ZVR A;  2NUT A;  1HE1 A;  4J7Y A;  5D92 A;  2G3K A;  3AG1 C;  2C04 A;  3US6 A;  3JRT A;  4Z9I A;  1WAS A;  4GQH A;  3PHF 2;  1CGN A;  1H9G A;  2CNW D;  2XLV A;  1TWG A;  2ZXR A;  3ZTZ A;  4P6I C;  4FWV A;  3IQC A;  3TD7 A;  3J06 A;  4BJ6 A;  4E7S A;  2YL7 A;  2XLE A;  3B71 A;  1J8M F;  4I44 A;  3DE9 A;  2LP4 A;  1WAT A;  2VH3 A;  1Z5Z A;  3AG2 C;  1G8X A;  1K40 A;  1YLM A;  1GGQ A;  1YZC A;  3CAX A;  3HTK C;  4JTD B;  5A6B D;  1RKC A;  2KW3 C;  2PX0 A;  3HNJ A;  1U0B B;  3U8V A;  1YA7 O;  4PJM A;  4YT5 A;  5EK0 A;  4H4K C;  2WZL A;  2XLD A;  2A0B A;  5BQG A;  4ZLD A;  2GAQ A;  2ZPA A;  3ABL C;  4JRZ A;  4AE4 A;  3NDB B;  3C7J A;  5DQZ A;  1T6Q A;  3ZDL A;  3SEO A;  2YKZ A;  4KI2 A;  2J7P A;  4XPX A;  5A6J A;  2KJG A;  1E83 A;  3EJN A;  2VB6 A;  2Y3D A;  3K6B A;  3BRJ A;  3DD7 A;  4E18 A;  4EHP A;  2VCB A;  1MND A;  1TWH A;  4JJG A;  3M79 A;  5F28 E;  2FFH A;  3W8I A;  3WG7 C;  4A4A A;  4G7O F;  4CDV A;  1QLE C;  3GM2 A;  4CS9 A;  3DM9 B;  1CGO A;  3RFY A;  3SNH A;  3R2P A;  2YL0 A;  2HSQ A;  2OCC C;  4P9F A;  4CDY A;  1RMV A;  3U3B A;  3TOM A;  2PFD A;  3T9O A;  1D1A A;  3SXZ A;  3PMR A;  5HSW A;  1Q0M A;  3Q6N A;  3NG1 A;  3NMK A;  5L0J A;  4HE8 D;  3T6J A;  3T6G B;  3RYL A;  3I5Q A;  1I5N A;  3DJU B;  4OIQ F;  5B1A C;  4U5D E;  1AUE A;  1HE9 A;  1HW1 A;  3MFN A;  4JKV A;  2R7R A;  3AOU A;  1XZP A;  3GAN A;  4U5C E;  1OQC A;  3GEE A;  2YLG A;  4MW3 A;  3B29 A;  3EG9 A;  4D4X A;  5E3A A;  1ORY A;  1M56 C;  2IBF A;  3GM3 A;  3VYW A;  2VCA A;  4EWC A;  2EIL C;  3KL4 A;  4NTF A;  2IXM A;  3UGP A;  3SP1 A;  4E0I A;  4MTF A;  1LS1 A;  1WN0 A;  1JAF A;  5AC4 A;  3DXJ F;  3JT1 A;  2QUP A;  2LCH A;  4WJ0 A;  4QI0 A;  2PP4 A;  3KYJ A;  3LES A;  3S29 A;  4W8K A;  2KYH A;  3S84 A;  2OKU A;  2FGY A;  3LAY A;  1HW2 A;  1YAR O;  4RDA A;  3ECS A;  1B68 A;  1H7I A;  4MVQ A;  4XEF A;  4XEK A;  3C8G B;  3U3F A;  3EQL F;  2A6H F;  2ZXW C;  2Y3G A;  2HZ8 A;  2CYD A;  1PV3 A;  4JE9 A;  3EFO B;  5DS5 A;  1V4A A;  1LKX A;  5COM A;  3W8H A;  2KNH A;  4DVY P;  2XSE A;  4YL0 A;  3EPV A;  1E86 A;  1LIH A;  1NZE A;  2Q7R A;  3ZQY A;  2W45 A;  3KH2 A;  3A9C A;  4PK4 A;  3U2M A;  4OIO F;  2WVN A;  1TFK B;  2BC5 A;  4G0H A;  1NU7 D;  5E3C A;  4ONS A;  1NLX A;  3DZA A;  4BJ6 C;  2QE9 A;  2XM4 A;  1APC A;  4LER A;  3EZH A;  1S05 A;  1TR2 A;  3E9V A;  2X0C A;  4C3E A;  5KYW B;  1OCR C;  4MW8 A;  2R9R B;  1IZM A;  3V5X A;  2Q00 A;  3U9M A;  3L1M A;  4AL0 A;  2Y69 C;  3IPM O;  3C8G D;  4XQ1 A;  3LEV A;  3L0I A;  3H65 A;  3RQF A;  2C03 A;  3VAY A;  3VF0 A;  2OEV A;  3DM5 A;  1AEP A;  1ZHT A;  2R7Q A;  2WVQ A;  3LS1 A;  4N06 A;  4KC9 A;  1VTM P;  1WGW A;  4WAB A;  4IAO A;  3TOL A;  1LE2 A;  3FAJ A;  4BJ5 A;  2XL6 A;  1V74 B;  3QVY A;  3NMJ A;  4NC3 A;  3RIP A;  4GEH A;  1RKE A;  3N24 A;  4EBK A;  2J7P D;  4U5F E;  2J45 A;  4NY3 A;  2KGO A;  3G4Z A;  4OD4 A;  2DYS C;  4W8P A;  5FZT A;  4J7T A;  2H8A A;  1D1B A;  4FES A;  2R7O A;  3NKD A;  2I8B A;  2R02 A;  2XLH A;  1MNE A;  2IXP A;  3CQZ A;  4PAC A;  2W9Y A;  2AP3 A;  4I1O B;  1LE4 A;  4CSA A;  3EH2 A;  2OG2 A;  4G78 A;  5KYN A;  1WTY A;  1OXK A;  1E2X A;  2J0W A;  3DMD A;  4LLE A;  5L0F A;  3H2U A;  4BEJ A;  3ABM C;  4JTA B;  3GWL A;  3FOO A;  4U9D A;  4ULV A;  2L6F A;  2L81 A;  1ORJ A;  1RCP A;  256B A;  2GDC A;  1O3U A;  4YT8 A;  2QY9 A;  2QTV A;  3GOD A;  4HEA J;  3C63 A;  3I5P A;  4N6C A;  1PCX A;  3UR3 C;  4N4W A;  2F22 A;  3MBG A;  4KBL A;  5JS5 A;  3L8I A;  2JPU A;  2HSB A;  5KYX A;  5FCL A;  2E87 A;  4IRU A;  1C17 M;  1D0Y A;  2H7B A;  4PR9 A;  1EKY A;  2HJM A;  5KYU A;  1ZHZ A;  1JPN A;  1GS9 A;  3JZ0 A;  3SXM A;  4XLP F;  1W2W A;  3K66 A;  2G62 A;  2HKV A;  3HNK A;  4MTO A;  2WVO A;  1RJ9 B;  3IHU A;  3AQB A;  2AVK A;  2R7U A;  5CIV A;  1TWA A;  1JMW A;  2R03 A;  1YVI A;  1QVX A;  2WL8 A;  3ZG1 A;  4AK9 A;  2DGJ A;  4JEB A;  1OCZ C;  4YL1 A;  2LK4 A;  1MMD A;  1V55 C;  3OWT A;  1VK5 A;  2IM8 A;  2ICW G;  1M6T A;  3EHN A;  3EGX B;  4LLC A;  4MVR A;  3U5S A;  3V5Y A;  4CJG A;  5A6A A;  1G4U S;  4XEV A;  4XTK A;  4CS7 A;  1VYI A;  1ZW3 A;  4Z9J A;  1A7V A;  4AX2 A;  5EHH A;  1I4Z A;  2EPK X;  5AGF A;  3TQO A;  4YK5 A;  3LNR A;  4P9T A;  4BG0 A;  2GWW A;  2PBE A;  1H6G A;  1FFT C;  1K05 A;  1OKK A;  3DAF A;  1Q0F A;  3EGD B;  3OA1 A;  4MTG A;  3UNG C;  1SMY F;  3FAP B;  4IAQ A;  2XRH A;  3V5Z A;  5JT4 A;  3Q7G A;  2LFF A;  3WHN A;  4FAP B;  1T6U A;  3KYI A;  4U5G A;  3AQC A;  3GWN A;  3S0X A;  3CEX A;  1YJG A;  2HFI A;  4ZLC A;  1Y4C A;  3Q6M A;  4U5E E;  1ZHW A;  3FOP A;  4BJ5 C;  2R25 A;  1M2V A;  1EA8 A;  3NYJ A;  2IXO A;  4K0D A;  3V7O A;  1FTS A;  4XPY A;  1LM3 B;  1VB5 A;  1YA9 A;  1KNY A;  2Q9C A;  3ZC4 A;  3T6B A;  1D0X A;  3QMK A;  2LFD A;  3RVY A;  4MQ9 F;  1FFH A;  2HMZ A;  1MMN A;  2H7V C;  1Q0G A;  3DJN B;  2L9J A;  5DS6 A;  5DVW A;  2EIN C;  1DOV A;  2NUT B;  4LDQ A;  4MND A;  1Z6A A;  2JD3 A;  2D5R B;  4C7O A;  1FAP B;  3L8J A;  3X1O A;  3HNL A;  1VYK A;  3JSE O;  3B0P A;  4DRH B;  2IOQ A;  4PFO A;  2HS5 A;  2NPU A;  4FX5 A;  3O39 A;  3WAQ A;  4AL1 A;  2CGE A;  1NBB A;  3S90 A;  3AJM A;  1T9K A;  3HNI A; 
#chains in the Genus database with same CATH homology
 4WAB A;  3PCV A;  3B29 A;  4JCZ A;  2Q7R A;  2PNO A;  4YL1 A;  3DWW A;  3LEO A;  4JC7 A;  4NTF A;  4J7Y A;  2UUH A;  3HKK A;  4NTA A;  4BPM A;  4NTB A;  5HV9 A;  5K0I A;  4YL3 A;  4J7T A;  2H8A A;  4YK5 A;  4AL0 A;  5BQI A;  5BQH A;  4AL1 A;  2UUI A;  5BQG A;  4JRZ A;  4YL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...