4NTFA

Mus musculus ltc4 synthase in s-hexyl-gsh complex form
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
145
structure length
145
Chain Sequence
HKDEVALLATVTLVGVLLQAYFSLQVISARRAFHVSPPLTSGPPEFERVFRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLFYLFARLRYFQGYARSAQLRLTPLYASARALWLLVAMAALGLLVHFLPGTLRTALFRWLQM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Leukotriene C4 synthase
publication title To be published
rcsb
source organism Mus musculus
molecule tags Lyase
total genus 60
structure length 145
sequence length 145
ec nomenclature ec 4.4.1.20: Leukotriene-C(4) synthase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4ntfA00
5BQGA 2H8AA 4JCZA 4JC7A 4J7YA 3DWWA 5BQHA 5K0IA 4J7TA 3HKKA 4AL1A 4NTFA 4YL1A 2UUIA 3PCVA 4YL0A 4AL0A 3LEOA 4YL3A 4NTBA 4YK5A 4BPMA 5HV9A 2Q7RA 4JRZA 4WABA 5BQIA 2UUHA 3B29A 2PNOA 4NTAA
chains in the Genus database with same CATH superfamily
4Z9IA 3W2WA 3L0IA 4P6IC 2XS1A 1K40A 4ER9A 3N2ZB 2J9VA 2XLOA 3HKKA 4I1MA 4D4NA 3C63A 4PJJA 3Q7GA 3O6XA 4U5DE 5COFA 3ZVRA 5KYUB 3SZRA 5HSWA 2LIGA 3Q7LA 3GEIA 3ZWIA 1G8XA 2ZXRA 3FOOA 1S05A 4O6NA 5JVEA 1D0YA 3GORA 2HMQA 3KMIA 4MQ9F 2QY9A 3A9CA 1M2OA 2VASA 2KGOA 2LK4A 2BL2A 2NUPB 2Y3GA 2J7PD 3FMSA 3RYLA 4JJGA 2G62A 1LIHA 1TR2A 3S27A 4CS9C 4G7OF 2WB7A 1OCZC 3AOUA 4WABA 3UMHA 3JZ0A 4GEHA 1VOMA 2XM0A 2R02A 3QW1A 4JURI 3B29A 5EHHA 3EGDA 3FXHA 1Y4CA 3HNIA 2C04A 3RFYA 1L3PA 3W4YA 1R5ID 2R03A 4CDAA 4E0HA 1E83A 1ZU4A 5T1DB 3GM2A 3GODA 3B0UX 4EUKB 2HS5A 2LFFA 1VK5A 4L6RA 2FFHA 4DBRA 1XZQA 3DE8A 4AL1A 2XL8A 1NU7D 1U0BB 1BDJB 1YARO 3O39A 4YL1A 4AL0A 2GDCA 2YZSA 3JRMO 3JT1A 2OU6A 2CDQA 2PF4E 5F28E 4EBBA 3B9QA 4PJNA 2QNLA 2R7SA 2ZXOA 2HV7A 4CIHA 5KYXB 2YRFA 1QKRA 4AE4A 2YL1A 3MLGA 2L9JA 1VMAA 1Q0GA 3K1HA 5BQIA 4XPWA 1C03A 2A68F 3T9OA 2YVKA 2LD6A 3EG9B 3I5QA 4MNDA 1YDIA 4N06A 1NFOA 4U5FE 3DM5A 2KK1A 1U89A 2BC5A 2Q9CA 2R25A 2ETSA 2Y3DA 4JIOA 4W8PA 4JW1A 3WHNA 4MVOA 1LVKA 2GA0A 3RQGA 4IB4A 1T6QA 3PHF2 3J06A 1J8MF 1HMDA 2Q9AA 4IRUA 3R2PA 3C18A 4OIOF 2G3VA 1ORJA 2YLDA 4BJ5A 5JS5A 2J9WA 2A0UA 4DRHB 2KYHA 2A0BA 4B6IA 2QTVA 4ULWA 1T6IA 3MFNA 4Q4ZF 3EQLF 1LI7A 1TWCA 1DOVA 2EIKC 2J7PA 2XLWA 4JRZA 5A6JA 2WVQA 2XL6A 3FOPA 1WTYA 2P1AA 4XLNF 3NMIA 5KYUA 4E18A 3C8GD 2A6HF 2VH3A 4PACA 1RJ9B 2XLMA 5BQGA 3W2VA 1E85A 1YA9A 3DWWA 2JPUA 2HJ3A 4BG0A 1XWJA 1ZVZA 2NUPA 5K0IA 2CNWD 3UGOA 4LACB 4PFOA 3B0VC 1ZHXA 3CSKA 4NTFA 4E0IA 1CPRA 4BJ5C 2DGJA 2HSQA 2WZLA 3LESA 1SMYF 3EFOB 3DAFA 1FAPB 2Y3BA 5A6KA 4XWJA 3GWNA 1H7IA 5B3IA 3MYFA 2ZXPA 1YYXA 1FR0A 2P6VA 3KPHA 3JTLO 1A0BA 4CSAA 1BR1A 4JTAB 1HW1A 4MTGA 1IZMA 1OR2A 4G78A 3CZ6A 3SP1A 1ZHZA 1VTMP 2NPUA 1Q0MA 1O87A 1HE9A 2X0CA 4DJ9A 3W8IA 3RVZA 2H8AA 4AX2A 5A6BD 3T6JA 4DVZA 1OCOC 3OEOA 1I4YA 2R7TA 4XQ1A 3K7DA 4DBQA 1SF8A 4OIQF 1A7VA 4CBEA 4BJ1A 3GM3A 1TKNA 2AP3A 4RDAA 4U9EA 4YT5A 2Q00A 3DE9A 3IQ5A 3VAYA 1E86A 3RIPA 3TD7A 1BBHA 2QE9A 3QVZA 1DOWA 4MS2A 1HW2A 3JCUQ 4BJ6C 1VLSA 3KKBA 5AC4A 256BA 3CAXA 4YK5A 3LNMB 3RKOF 3QW0A 4CIPA 3LS1A 4JEAA 4UDVA 1Y6DA 2RSEB 1Q0DA 5JP7A 3M79A 2AU5A 3ECSA 3LEVA 2PFDA 3U5SA 4XEFA 1OW7A 5DLJA 3TULA 5F5FA 3MX3A 3OWTA 4KI2A 2R7RA 3O55A 1YAUO 3C8GA 2D5RB 2J8WA 4H4KC 2QUPA 2XRHA 3K66A 4LDRA 2R7OA 5L0GA 2VCCA 3PDMP 2HJMA 3NKDA 4LDQA 4N6CA 1OKKD 3NKEA 1E2XA 5T3WA 1JMWA 4X0RA 2CNWA 2KNHA 3VRCA 2HV6A 4DRJB 1KTMA 4FAPB 1EI7A 4IJJA 1Z3IX 3DD7A 3LLKA 2Z15A 3LLIA 5JUAA 2I8BA 3G4ZA 5E33A 1APCA 2HFIA 4DOZA 3KYIA 2W4MA 3HLZA 1MMGA 4JTDB 5HV9A 4O79A 3EGXA 3TOLA 2Q3TA 4OIRF 5DS4A 1QLEC 1NFNA 3V5YA 2NUTB 2F22A 2LQGA 2UUHA 1OCRC 4XEVA 4MTOA 2OJQA 4EBJA 3U3BA 3EH2A 3EHNA 1D0XA 1SYQA 4NC3A 4Z9JA 2IM8A 2WL8A 1LS1A 1A7EA 3H65A 5A6BA 1FNTc 3FAPB 4WJ0A 3G50A 2EPNA 2XLEA 2O9XA 2JD3A 3OA1A 4LLEA 5BUOA 2IXPA 2DB4A 2UUIA 2DYRC 1TFOB 1HMOA 3DJNB 4JEBA 1GQAA 1O5HA 3EHMA 1FFTC 4O6MA 3SXKA 4C7OB 2KC3A 3DM9B 2J9BA 1ZYRF 4BPMA 3F47A 4DXWA 2V26A 1NZEA 4HEAJ 5IY5C 1G4WR 1G5ZA 3AQBA 3A11A 3S0XA 5KYWB 3VM6A 5A69A 3EZHA 2E87A 4MVMA 2JX0A 1M2VB 3QVYA 4ZLCA 1UFBA 3W8HA 4CDYA 5JT4A 1EKYA 2H7BA 1EA8A 3VYWA 5KYYB 1OCCC 2DYSC 3ZQVA 1H9GA 3EPVA 2KJGA 1TFKB 3EJNA 3JSEO 3NG1A 4QDLA 1MMNA 2L81A 1LS4A 1ZHWA 2H7OA 1OKKA 1CGME 4FESA 4EIYA 1Z7Qc 3T6BA 2ASRA 2XXAB 3JYHA 1ST6A 1S7ZA 3PCVA 5E2QA 1AEPA 4QI0A 1HY5A 1ZW3A 1JAFA 1YZCA 3UMIA 2EINC 2V3CC 4Q7CA 2R9RB 4JKVA 5L0FA 2Y69C 2IYLD 3ABKC 5AC5A 3K1IA 5F5HA 3GANA 3HTKC 3NMJA 2IXNA 4NY3A 3SXYA 3K6BA 5E3CA 1MMDA 5CI8A 3U2LA 3V5ZA 5DQZA 5A6AA 2I15A 3U8VA 1QPUA 4ONSA 3NYLA 4OINF 5B1AC 4R32A 3L1MA 4CJGA 4IAOA 3QTHA 4EBKA 5JLIA 3G4XA 1PV3A 2DI3A 3U0CA 3VF0A 1YA7O 4ZLDA 3HJCA 2P7VA 4IWBA 2KSFA 3B71A 5L0DA 1UG7A 1FMWA 4JTCB 3M1CB 1GM5A 3IHUA 3U2MA 3R7CA 2LCHA 3N0TA 4JVSA 1Z63A 2D4UA 3S29A 5FZTA 2CYDA 2YL3A 3T4RA 5D91A 3S90A 2OJED 3AG4C 1CGNA 3GWLA 1NU9C 3E70C 3GEHA 3RF3A 3QZCA 3AJMA 4PJLA 1QZXA 3V5XA 4CS8A 3ZSUA 5L3QA 1MNDA 1Z6AA 4LLCA 1CPQA 3CQZA 1VLTA 3V7OA 1VYIA 3C62A 2G3KA 5COMA 2OEXA 5JSLA 4EKWA 4A4AA 4PR9A 4CX9A 4G7ZF 3TJ6A 2QLAA 2YHSA 1V4AA 3HNKA 2A1DD 5CI9A 2J0WA 3LUTB 3SXZA 4JC7A 1V55C 4U9DA 5COGA 1NG1A 3AG1C 4YJWA 2TMVP 3RW0A 5BQHA 4C7OA 3IQTA 3ZIBA 3Q6NA 2XL4A 4MW8A 5KYXA 3EGDB 4M63A 1TWGA 2L6FA 3TK0A 1QSPA 1YZAA 2WZFA 5E3AA 4YL0A 5KYWA 1O3UA 1AVOB 2OQMA 2W45A 3NRHA 1FTSA 4K0DA 4N4WA 1C02A 1XZPA 2R7UA 3M15A 3Q6MA 5GPGB 3MBGA 3EG9A 2IOQA 3EZIA 3IQ6A 2R7WA 3DXJF 4CS8C 4WGYA 2Q7RA 4NCQA 2MWQA 3AGUA 4W8KA 2WZGA 3JSZA 3ASOC 3M4BA 2EIMC 4CSAC 1LI5A 2PP4A 3U3FA 2A6EF 1LPEA 3RH3A 4GQHA 1OQCA 1MNEA 2GAQA 1RCPA 2Q9BA 3SYNA 2KQ9A 2EPLX 3DZAA 4MW3A 4MVRA 4C3DA 2YL0A 3BRJA 3ATPA 3C8ZA 2W9YA 3NMKA 4MVQA 1ZW2A 2R7QA 3IEEA 4U5BE 1ORYA 2NSGA 4G7HF 2J45A 1T9KA 2EILC 1PCXA 1A41A 1KNYA 2HZ8A 2B0HA 3I4UA 3X1OA 1ZZPA 1JOGA 1VYKA 3X2QC 2YLGA 4G0HA 3IQCA 2XSEA 4Z9HA 1OW6A 3JYYA 1FFHA 2NG1A 4BEJA 1RJ9A 1SZIA 2VC9A 3U9JA 4YT8A 4KNWA 4CS9A 3SEOA 2HUJA 4U5EE 2L6GA 2AVKA 2YLIA 2YL7A 4CDVA 3TQOA 3LS0A 2XLHA 3JRTA 2Y39A 4YT2A 1JPNA 2L6HA 3BEHA 2EPOA 1MQVA 5B1BC 5TJ5E 1RMVA 1T01A 2FAPB 2EPKX 3EFOA 4YN0B 1PD1A 1A7DA 2Y3HA 4I44A 3IPMO 4E7SA 4EWCA 5KYNA 5L0IA 2OG2A 3KYJA 3MYIA 3N24A 2YEVA 1YJGA 4ULVA 4XTKA 4XEKA 5CIVA 3POVA 3EH1A 3L8IA 5AGFA 2OOCA 1BR4A 1D1CA 4GYTA 2A69F 1HE1A 2H7VC 4XPXA 4YT4A 1TQGA 2ZPAA 1WASA 2AWCA 2NSFA 1ZHYA 3M4CA 4MTFA 3L34A 1GS9A 1T6UA 2VB6A 3E9VA 2MHRA 4H54A 1WWPA 4D4XA 2Q4FA 1Q0KA 3TOMA 1RKEB 4O6YA 3T6GB 1I5NA 1RXQA 1M56C 1I4ZA 1OR3A 1OXBA 1Z23A 4XPYA 2CW0F 2WVOA 4LDKA 4KNVA 1IW7F 1TWHA 3FHDA 4PJMA 2XLVA 1D1BA 2EIJC 3ZDLA 4MVSA 3S84A 3UGPA 3U8PA 1H9TA 2OEVA 2LFDA 3S28A 1JPJA 3DMDA 2GWWA 2MYSA 1SR2A 2ZD9A 4IGGA 2EPMX 1U6HA 4NTBA 1K04A 4Q5SF 3WAQA 1M6TA 2IBFA 3LNRA 4LERA 3HNJA 2GFHA 3LAYA 1W2WA 4N6HA 3SNHA 3KL4A 4K1OA 2XS8A 1J8YF 1LM3B 3ITFA 4FWVA 3RQFA 5B3SC 1JR8A 3H2VA 1WN0A 2PNOA 4JCHA 3SXMA 4CJOA 4EHPA 2VCAA 4U5CE 4F4BA 1R4TA 2LP4A 2IXMA 4JCZA 2M64A 1YYJA 3I5PA 2PX0A 5L0HA 4P9FA 3RVYA 3FVYA 2J46A 1VB5A 3GEEA 4I1OB 5T3TA 4E17A 1E84A 2HSBA 3ABLC 1MMAA 3AG3C 4JZAA 3KH2A 1WOLA 1RKCA 4P9TA 4A2NB 2YWAA 3C8GB 2NUTA 2R7XA 3UR3C 3DAGA 4AK9A 3DI5A 2B0JA 2J0XA 3QMKA 4KC9A 4K7BA 3AQCA 4RD9A 3F46A 3K1IC 4NQFA 4DVYP 4HFFB 1H6GA 2P0NA 2YKZA 3WG7C 1LKXA 3ZQYA 5DVWA 1L7CA 2ZXWC 1D1AA 3DJUB 1YLMA 1V54C 1LE2A 2BE5F 1PD0A 2CGEA 2W4BA 2WVNA 2XLDA 4CS7A 4YWQA 3L8JA 3WODF 4NTAA 2FGYA 3AGTA 3HNLA 5D92A 2X51A 3EGXB 2HKVA 3ASNC 4J7YA 1D0ZA 5DS6A 3CEXA 2CCYA 1OXKA 1WATA 4O7GA 1NBBA 1QVXA 2KW3C 4RBNA 1GGQA 4ANJA 1Q0FA 2PX3A 5FCLA 1FMVA 4PFPA 4WGZA 2OCCC 5L3VA 1TWAA 3ZTZA 1OW8A 5EGYA 1RKEA 4BJTA 5L0JA 4QI2A 3K33A 1WGWA 4BJ6A 2L7AA 1M2VA 1ZHTA 3ABMC 2R05A 3ZC4A 1V74B 3C7JA 1C17M 3ZG1A 4OD5A 3UNGC 1T5OA 1YVIA 4BEMJ 5KYYA 3RQEA 2IXOA 4XLPF 1EQ1A 3GM1A 3NYMA 2OKUA 1CGOA 1G4US 1ZU5A 2ICWG 3NYJA 2C03A 3NDBB 3U9MA 2P61A 4FX5A 4U5HA 3B0PA 2XXAA 3PMRA 1K05A 4OIPF 3LJBA 4AE4B 2J9UA 1N1CA 3UMKA 1F1MA 4HE8D 4PK4A 1JRAA 4IARA 2VCBA 4HFKB 5EK0A 4J7TA 3H2UA 4C3EA 4MVUA 1Z5ZA 1KU2A 1BZ4A 2AWYA 3ZTMA 5L0CA 1AUEA 3FDQA 4U5GA 4KBLA 3LEOA 4YL3A 1LE4A 4JE9A 5DQTA 4C3BA 2YQYA 4IAQA 1M57C 1BR2A 1QQ3A 2LSEA 4MVZA 4DRIB 2HMZA 3S9OA 3US6A 5JRAA 1ORSC 2R7VA 3DKAA 1B68A 1NSGB 5DS5A 2XM4A 4J30B 4JJFA 4OD4A 2RD9A 3FAJA 4J32B 3TJ5A 2PBEA 4I3MA 4E7ZA 3O10A 1NLXA 2M4EA 3AG2C
chains in the Genus database with same CATH topology
5BQGA 2H8AA 4JCZA 4JC7A 4J7YA 3DWWA 5BQHA 5K0IA 4J7TA 3HKKA 4AL1A 4NTFA 4YL1A 2UUIA 3PCVA 4YL0A 4AL0A 3LEOA 4YL3A 4NTBA 4YK5A 4BPMA 5HV9A 2Q7RA 4JRZA 4WABA 5BQIA 2UUHA 3B29A 2PNOA 4NTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQG A;  2H8A A;  4JCZ A;  4JC7 A;  4J7Y A;  3DWW A;  5BQH A;  5K0I A;  4J7T A;  3HKK A;  4AL1 A;  4NTF A;  4YL1 A;  2UUI A;  3PCV A;  4YL0 A;  4AL0 A;  3LEO A;  4YL3 A;  4NTB A;  4YK5 A;  4BPM A;  5HV9 A;  2Q7R A;  4JRZ A;  4WAB A;  5BQI A;  2UUH A;  3B29 A;  2PNO A;  4NTA A; 
#chains in the Genus database with same CATH topology
 4Z9I A;  3W2W A;  3L0I A;  4P6I C;  2XS1 A;  1K40 A;  4ER9 A;  3N2Z B;  2J9V A;  2XLO A;  3HKK A;  4I1M A;  4D4N A;  3C63 A;  4PJJ A;  3Q7G A;  3O6X A;  4U5D E;  5COF A;  3ZVR A;  5KYU B;  3SZR A;  5HSW A;  2LIG A;  3Q7L A;  3GEI A;  3ZWI A;  1G8X A;  2ZXR A;  3FOO A;  1S05 A;  4O6N A;  5JVE A;  1D0Y A;  3GOR A;  2HMQ A;  3KMI A;  4MQ9 F;  2QY9 A;  3A9C A;  1M2O A;  2VAS A;  2KGO A;  2LK4 A;  2BL2 A;  2NUP B;  2Y3G A;  2J7P D;  3FMS A;  3RYL A;  4JJG A;  2G62 A;  1LIH A;  1TR2 A;  3S27 A;  4CS9 C;  4G7O F;  2WB7 A;  1OCZ C;  3AOU A;  4WAB A;  3UMH A;  3JZ0 A;  4GEH A;  1VOM A;  2XM0 A;  2R02 A;  3QW1 A;  4JUR I;  3B29 A;  5EHH A;  3EGD A;  3FXH A;  1Y4C A;  3HNI A;  2C04 A;  3RFY A;  1L3P A;  3W4Y A;  1R5I D;  2R03 A;  4CDA A;  4E0H A;  1E83 A;  1ZU4 A;  5T1D B;  3GM2 A;  3GOD A;  3B0U X;  4EUK B;  2HS5 A;  2LFF A;  1VK5 A;  4L6R A;  2FFH A;  4DBR A;  1XZQ A;  3DE8 A;  4AL1 A;  2XL8 A;  1NU7 D;  1U0B B;  1BDJ B;  1YAR O;  3O39 A;  4YL1 A;  4AL0 A;  2GDC A;  2YZS A;  3JRM O;  3JT1 A;  2OU6 A;  2CDQ A;  2PF4 E;  5F28 E;  4EBB A;  3B9Q A;  4PJN A;  2QNL A;  2R7S A;  2ZXO A;  2HV7 A;  4CIH A;  5KYX B;  2YRF A;  1QKR A;  4AE4 A;  2YL1 A;  3MLG A;  2L9J A;  1VMA A;  1Q0G A;  3K1H A;  5BQI A;  4XPW A;  1C03 A;  2A68 F;  3T9O A;  2YVK A;  2LD6 A;  3EG9 B;  3I5Q A;  4MND A;  1YDI A;  4N06 A;  1NFO A;  4U5F E;  3DM5 A;  2KK1 A;  1U89 A;  2BC5 A;  2Q9C A;  2R25 A;  2ETS A;  2Y3D A;  4JIO A;  4W8P A;  4JW1 A;  3WHN A;  4MVO A;  1LVK A;  2GA0 A;  3RQG A;  4IB4 A;  1T6Q A;  3PHF 2;  3J06 A;  1J8M F;  1HMD A;  2Q9A A;  4IRU A;  3R2P A;  3C18 A;  4OIO F;  2G3V A;  1ORJ A;  2YLD A;  4BJ5 A;  5JS5 A;  2J9W A;  2A0U A;  4DRH B;  2KYH A;  2A0B A;  4B6I A;  2QTV A;  4ULW A;  1T6I A;  3MFN A;  4Q4Z F;  3EQL F;  1LI7 A;  1TWC A;  1DOV A;  2EIK C;  2J7P A;  2XLW A;  4JRZ A;  5A6J A;  2WVQ A;  2XL6 A;  3FOP A;  1WTY A;  2P1A A;  4XLN F;  3NMI A;  5KYU A;  4E18 A;  3C8G D;  2A6H F;  2VH3 A;  4PAC A;  1RJ9 B;  2XLM A;  5BQG A;  3W2V A;  1E85 A;  1YA9 A;  3DWW A;  2JPU A;  2HJ3 A;  4BG0 A;  1XWJ A;  1ZVZ A;  2NUP A;  5K0I A;  2CNW D;  3UGO A;  4LAC B;  4PFO A;  3B0V C;  1ZHX A;  3CSK A;  4NTF A;  4E0I A;  1CPR A;  4BJ5 C;  2DGJ A;  2HSQ A;  2WZL A;  3LES A;  1SMY F;  3EFO B;  3DAF A;  1FAP B;  2Y3B A;  5A6K A;  4XWJ A;  3GWN A;  1H7I A;  5B3I A;  3MYF A;  2ZXP A;  1YYX A;  1FR0 A;  2P6V A;  3KPH A;  3JTL O;  1A0B A;  4CSA A;  1BR1 A;  4JTA B;  1HW1 A;  4MTG A;  1IZM A;  1OR2 A;  4G78 A;  3CZ6 A;  3SP1 A;  1ZHZ A;  1VTM P;  2NPU A;  1Q0M A;  1O87 A;  1HE9 A;  2X0C A;  4DJ9 A;  3W8I A;  3RVZ A;  2H8A A;  4AX2 A;  5A6B D;  3T6J A;  4DVZ A;  1OCO C;  3OEO A;  1I4Y A;  2R7T A;  4XQ1 A;  3K7D A;  4DBQ A;  1SF8 A;  4OIQ F;  1A7V A;  4CBE A;  4BJ1 A;  3GM3 A;  1TKN A;  2AP3 A;  4RDA A;  4U9E A;  4YT5 A;  2Q00 A;  3DE9 A;  3IQ5 A;  3VAY A;  1E86 A;  3RIP A;  3TD7 A;  1BBH A;  2QE9 A;  3QVZ A;  1DOW A;  4MS2 A;  1HW2 A;  3JCU Q;  4BJ6 C;  1VLS A;  3KKB A;  5AC4 A;  256B A;  3CAX A;  4YK5 A;  3LNM B;  3RKO F;  3QW0 A;  4CIP A;  3LS1 A;  4JEA A;  4UDV A;  1Y6D A;  2RSE B;  1Q0D A;  5JP7 A;  3M79 A;  2AU5 A;  3ECS A;  3LEV A;  2PFD A;  3U5S A;  4XEF A;  1OW7 A;  5DLJ A;  3TUL A;  5F5F A;  3MX3 A;  3OWT A;  4KI2 A;  2R7R A;  3O55 A;  1YAU O;  3C8G A;  2D5R B;  2J8W A;  4H4K C;  2QUP A;  2XRH A;  3K66 A;  4LDR A;  2R7O A;  5L0G A;  2VCC A;  3PDM P;  2HJM A;  3NKD A;  4LDQ A;  4N6C A;  1OKK D;  3NKE A;  1E2X A;  5T3W A;  1JMW A;  4X0R A;  2CNW A;  2KNH A;  3VRC A;  2HV6 A;  4DRJ B;  1KTM A;  4FAP B;  1EI7 A;  4IJJ A;  1Z3I X;  3DD7 A;  3LLK A;  2Z15 A;  3LLI A;  5JUA A;  2I8B A;  3G4Z A;  5E33 A;  1APC A;  2HFI A;  4DOZ A;  3KYI A;  2W4M A;  3HLZ A;  1MMG A;  4JTD B;  5HV9 A;  4O79 A;  3EGX A;  3TOL A;  2Q3T A;  4OIR F;  5DS4 A;  1QLE C;  1NFN A;  3V5Y A;  2NUT B;  2F22 A;  2LQG A;  2UUH A;  1OCR C;  4XEV A;  4MTO A;  2OJQ A;  4EBJ A;  3U3B A;  3EH2 A;  3EHN A;  1D0X A;  1SYQ A;  4NC3 A;  4Z9J A;  2IM8 A;  2WL8 A;  1LS1 A;  1A7E A;  3H65 A;  5A6B A;  1FNT c;  3FAP B;  4WJ0 A;  3G50 A;  2EPN A;  2XLE A;  2O9X A;  2JD3 A;  3OA1 A;  4LLE A;  5BUO A;  2IXP A;  2DB4 A;  2UUI A;  2DYR C;  1TFO B;  1HMO A;  3DJN B;  4JEB A;  1GQA A;  1O5H A;  3EHM A;  1FFT C;  4O6M A;  3SXK A;  4C7O B;  2KC3 A;  3DM9 B;  2J9B A;  1ZYR F;  4BPM A;  3F47 A;  4DXW A;  2V26 A;  1NZE A;  4HEA J;  5IY5 C;  1G4W R;  1G5Z A;  3AQB A;  3A11 A;  3S0X A;  5KYW B;  3VM6 A;  5A69 A;  3EZH A;  2E87 A;  4MVM A;  2JX0 A;  1M2V B;  3QVY A;  4ZLC A;  1UFB A;  3W8H A;  4CDY A;  5JT4 A;  1EKY A;  2H7B A;  1EA8 A;  3VYW A;  5KYY B;  1OCC C;  2DYS C;  3ZQV A;  1H9G A;  3EPV A;  2KJG A;  1TFK B;  3EJN A;  3JSE O;  3NG1 A;  4QDL A;  1MMN A;  2L81 A;  1LS4 A;  1ZHW A;  2H7O A;  1OKK A;  1CGM E;  4FES A;  4EIY A;  1Z7Q c;  3T6B A;  2ASR A;  2XXA B;  3JYH A;  1ST6 A;  1S7Z A;  3PCV A;  5E2Q A;  1AEP A;  4QI0 A;  1HY5 A;  1ZW3 A;  1JAF A;  1YZC A;  3UMI A;  2EIN C;  2V3C C;  4Q7C A;  2R9R B;  4JKV A;  5L0F A;  2Y69 C;  2IYL D;  3ABK C;  5AC5 A;  3K1I A;  5F5H A;  3GAN A;  3HTK C;  3NMJ A;  2IXN A;  4NY3 A;  3SXY A;  3K6B A;  5E3C A;  1MMD A;  5CI8 A;  3U2L A;  3V5Z A;  5DQZ A;  5A6A A;  2I15 A;  3U8V A;  1QPU A;  4ONS A;  3NYL A;  4OIN F;  5B1A C;  4R32 A;  3L1M A;  4CJG A;  4IAO A;  3QTH A;  4EBK A;  5JLI A;  3G4X A;  1PV3 A;  2DI3 A;  3U0C A;  3VF0 A;  1YA7 O;  4ZLD A;  3HJC A;  2P7V A;  4IWB A;  2KSF A;  3B71 A;  5L0D A;  1UG7 A;  1FMW A;  4JTC B;  3M1C B;  1GM5 A;  3IHU A;  3U2M A;  3R7C A;  2LCH A;  3N0T A;  4JVS A;  1Z63 A;  2D4U A;  3S29 A;  5FZT A;  2CYD A;  2YL3 A;  3T4R A;  5D91 A;  3S90 A;  2OJE D;  3AG4 C;  1CGN A;  3GWL A;  1NU9 C;  3E70 C;  3GEH A;  3RF3 A;  3QZC A;  3AJM A;  4PJL A;  1QZX A;  3V5X A;  4CS8 A;  3ZSU A;  5L3Q A;  1MND A;  1Z6A A;  4LLC A;  1CPQ A;  3CQZ A;  1VLT A;  3V7O A;  1VYI A;  3C62 A;  2G3K A;  5COM A;  2OEX A;  5JSL A;  4EKW A;  4A4A A;  4PR9 A;  4CX9 A;  4G7Z F;  3TJ6 A;  2QLA A;  2YHS A;  1V4A A;  3HNK A;  2A1D D;  5CI9 A;  2J0W A;  3LUT B;  3SXZ A;  4JC7 A;  1V55 C;  4U9D A;  5COG A;  1NG1 A;  3AG1 C;  4YJW A;  2TMV P;  3RW0 A;  5BQH A;  4C7O A;  3IQT A;  3ZIB A;  3Q6N A;  2XL4 A;  4MW8 A;  5KYX A;  3EGD B;  4M63 A;  1TWG A;  2L6F A;  3TK0 A;  1QSP A;  1YZA A;  2WZF A;  5E3A A;  4YL0 A;  5KYW A;  1O3U A;  1AVO B;  2OQM A;  2W45 A;  3NRH A;  1FTS A;  4K0D A;  4N4W A;  1C02 A;  1XZP A;  2R7U A;  3M15 A;  3Q6M A;  5GPG B;  3MBG A;  3EG9 A;  2IOQ A;  3EZI A;  3IQ6 A;  2R7W A;  3DXJ F;  4CS8 C;  4WGY A;  2Q7R A;  4NCQ A;  2MWQ A;  3AGU A;  4W8K A;  2WZG A;  3JSZ A;  3ASO C;  3M4B A;  2EIM C;  4CSA C;  1LI5 A;  2PP4 A;  3U3F A;  2A6E F;  1LPE A;  3RH3 A;  4GQH A;  1OQC A;  1MNE A;  2GAQ A;  1RCP A;  2Q9B A;  3SYN A;  2KQ9 A;  2EPL X;  3DZA A;  4MW3 A;  4MVR A;  4C3D A;  2YL0 A;  3BRJ A;  3ATP A;  3C8Z A;  2W9Y A;  3NMK A;  4MVQ A;  1ZW2 A;  2R7Q A;  3IEE A;  4U5B E;  1ORY A;  2NSG A;  4G7H F;  2J45 A;  1T9K A;  2EIL C;  1PCX A;  1A41 A;  1KNY A;  2HZ8 A;  2B0H A;  3I4U A;  3X1O A;  1ZZP A;  1JOG A;  1VYK A;  3X2Q C;  2YLG A;  4G0H A;  3IQC A;  2XSE A;  4Z9H A;  1OW6 A;  3JYY A;  1FFH A;  2NG1 A;  4BEJ A;  1RJ9 A;  1SZI A;  2VC9 A;  3U9J A;  4YT8 A;  4KNW A;  4CS9 A;  3SEO A;  2HUJ A;  4U5E E;  2L6G A;  2AVK A;  2YLI A;  2YL7 A;  4CDV A;  3TQO A;  3LS0 A;  2XLH A;  3JRT A;  2Y39 A;  4YT2 A;  1JPN A;  2L6H A;  3BEH A;  2EPO A;  1MQV A;  5B1B C;  5TJ5 E;  1RMV A;  1T01 A;  2FAP B;  2EPK X;  3EFO A;  4YN0 B;  1PD1 A;  1A7D A;  2Y3H A;  4I44 A;  3IPM O;  4E7S A;  4EWC A;  5KYN A;  5L0I A;  2OG2 A;  3KYJ A;  3MYI A;  3N24 A;  2YEV A;  1YJG A;  4ULV A;  4XTK A;  4XEK A;  5CIV A;  3POV A;  3EH1 A;  3L8I A;  5AGF A;  2OOC A;  1BR4 A;  1D1C A;  4GYT A;  2A69 F;  1HE1 A;  2H7V C;  4XPX A;  4YT4 A;  1TQG A;  2ZPA A;  1WAS A;  2AWC A;  2NSF A;  1ZHY A;  3M4C A;  4MTF A;  3L34 A;  1GS9 A;  1T6U A;  2VB6 A;  3E9V A;  2MHR A;  4H54 A;  1WWP A;  4D4X A;  2Q4F A;  1Q0K A;  3TOM A;  1RKE B;  4O6Y A;  3T6G B;  1I5N A;  1RXQ A;  1M56 C;  1I4Z A;  1OR3 A;  1OXB A;  1Z23 A;  4XPY A;  2CW0 F;  2WVO A;  4LDK A;  4KNV A;  1IW7 F;  1TWH A;  3FHD A;  4PJM A;  2XLV A;  1D1B A;  2EIJ C;  3ZDL A;  4MVS A;  3S84 A;  3UGP A;  3U8P A;  1H9T A;  2OEV A;  2LFD A;  3S28 A;  1JPJ A;  3DMD A;  2GWW A;  2MYS A;  1SR2 A;  2ZD9 A;  4IGG A;  2EPM X;  1U6H A;  4NTB A;  1K04 A;  4Q5S F;  3WAQ A;  1M6T A;  2IBF A;  3LNR A;  4LER A;  3HNJ A;  2GFH A;  3LAY A;  1W2W A;  4N6H A;  3SNH A;  3KL4 A;  4K1O A;  2XS8 A;  1J8Y F;  1LM3 B;  3ITF A;  4FWV A;  3RQF A;  5B3S C;  1JR8 A;  3H2V A;  1WN0 A;  2PNO A;  4JCH A;  3SXM A;  4CJO A;  4EHP A;  2VCA A;  4U5C E;  4F4B A;  1R4T A;  2LP4 A;  2IXM A;  4JCZ A;  2M64 A;  1YYJ A;  3I5P A;  2PX0 A;  5L0H A;  4P9F A;  3RVY A;  3FVY A;  2J46 A;  1VB5 A;  3GEE A;  4I1O B;  5T3T A;  4E17 A;  1E84 A;  2HSB A;  3ABL C;  1MMA A;  3AG3 C;  4JZA A;  3KH2 A;  1WOL A;  1RKC A;  4P9T A;  4A2N B;  2YWA A;  3C8G B;  2NUT A;  2R7X A;  3UR3 C;  3DAG A;  4AK9 A;  3DI5 A;  2B0J A;  2J0X A;  3QMK A;  4KC9 A;  4K7B A;  3AQC A;  4RD9 A;  3F46 A;  3K1I C;  4NQF A;  4DVY P;  4HFF B;  1H6G A;  2P0N A;  2YKZ A;  3WG7 C;  1LKX A;  3ZQY A;  5DVW A;  1L7C A;  2ZXW C;  1D1A A;  3DJU B;  1YLM A;  1V54 C;  1LE2 A;  2BE5 F;  1PD0 A;  2CGE A;  2W4B A;  2WVN A;  2XLD A;  4CS7 A;  4YWQ A;  3L8J A;  3WOD F;  4NTA A;  2FGY A;  3AGT A;  3HNL A;  5D92 A;  2X51 A;  3EGX B;  2HKV A;  3ASN C;  4J7Y A;  1D0Z A;  5DS6 A;  3CEX A;  2CCY A;  1OXK A;  1WAT A;  4O7G A;  1NBB A;  1QVX A;  2KW3 C;  4RBN A;  1GGQ A;  4ANJ A;  1Q0F A;  2PX3 A;  5FCL A;  1FMV A;  4PFP A;  4WGZ A;  2OCC C;  5L3V A;  1TWA A;  3ZTZ A;  1OW8 A;  5EGY A;  1RKE A;  4BJT A;  5L0J A;  4QI2 A;  3K33 A;  1WGW A;  4BJ6 A;  2L7A A;  1M2V A;  1ZHT A;  3ABM C;  2R05 A;  3ZC4 A;  1V74 B;  3C7J A;  1C17 M;  3ZG1 A;  4OD5 A;  3UNG C;  1T5O A;  1YVI A;  4BEM J;  5KYY A;  3RQE A;  2IXO A;  4XLP F;  1EQ1 A;  3GM1 A;  3NYM A;  2OKU A;  1CGO A;  1G4U S;  1ZU5 A;  2ICW G;  3NYJ A;  2C03 A;  3NDB B;  3U9M A;  2P61 A;  4FX5 A;  4U5H A;  3B0P A;  2XXA A;  3PMR A;  1K05 A;  4OIP F;  3LJB A;  4AE4 B;  2J9U A;  1N1C A;  3UMK A;  1F1M A;  4HE8 D;  4PK4 A;  1JRA A;  4IAR A;  2VCB A;  4HFK B;  5EK0 A;  4J7T A;  3H2U A;  4C3E A;  4MVU A;  1Z5Z A;  1KU2 A;  1BZ4 A;  2AWY A;  3ZTM A;  5L0C A;  1AUE A;  3FDQ A;  4U5G A;  4KBL A;  3LEO A;  4YL3 A;  1LE4 A;  4JE9 A;  5DQT A;  4C3B A;  2YQY A;  4IAQ A;  1M57 C;  1BR2 A;  1QQ3 A;  2LSE A;  4MVZ A;  4DRI B;  2HMZ A;  3S9O A;  3US6 A;  5JRA A;  1ORS C;  2R7V A;  3DKA A;  1B68 A;  1NSG B;  5DS5 A;  2XM4 A;  4J30 B;  4JJF A;  4OD4 A;  2RD9 A;  3FAJ A;  4J32 B;  3TJ5 A;  2PBE A;  4I3M A;  4E7Z A;  3O10 A;  1NLX A;  2M4E A;  3AG2 C; 
#chains in the Genus database with same CATH homology
 5BQG A;  2H8A A;  4JCZ A;  4JC7 A;  4J7Y A;  3DWW A;  5BQH A;  5K0I A;  4J7T A;  3HKK A;  4AL1 A;  4NTF A;  4YL1 A;  2UUI A;  3PCV A;  4YL0 A;  4AL0 A;  3LEO A;  4YL3 A;  4NTB A;  4YK5 A;  4BPM A;  5HV9 A;  2Q7R A;  4JRZ A;  4WAB A;  5BQI A;  2UUH A;  3B29 A;  2PNO A;  4NTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...