4NU7A

2.05 angstrom crystal structure of ribulose-phosphate 3-epimerase from toxoplasma gondii.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
225
structure length
225
Chain Sequence
QLKPIICPSVLASDLSSLASDAKRMVDAGCDWLHLDIMDGHFVPNISFGPGVVKALRGHLKSAFFDVHLMVSEPEKWIQPFADAGANSITFHWESVGGDLQRAAELAKRIQARGIKAGLAIKPATKFEDLGEALAGDNFDMLLVMTVEPGFGGQKFMADMLQKVRTARSLFPKLNIQVDGGLDGETVKPAASAGANVIVAGTSMFKAENPAALMTFMRDVIAASD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.05 Angstrom Crystal Structure of Ribulose-phosphate 3-epimerase from Toxoplasma gondii.
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
molecule keywords Ribulose-phosphate 3-epimerase
total genus 84
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2013-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nu7A00
4UTTA 3BLEA 1TPH1 3L5AA 5EPDA 4R33A 1O5KA 3HG4A 4FX7A 1FWSA 2X16A 4IMCA 1NF0A 3CT7A 4MPQA 1YDVA 1W8SA 4ORMA 2DZUA 1TTIA 4BFAA 4NVTA 3PUEA 1JCYA 3P5ZA 3E0IA 2Z1BA 2AQWA 4MY8A 3W7JA 4IXHA 2GVGA 5LZLA 1X1OA 4IXXA 3LCGA 1X7FA 1KM3A 3PR2A 4LV9A 3OVQA 2V5LA 1KM4A 1EUNA 1K8ZA 2E5CA 2OX1A 3Q94A 2J9XA 4LRTA 2FDSA 3CIWA 3W73A 2V2CA 1SU5A 1ZJIA 3THAA 1M7PA 3I7QA 4JYDA 1ME7A 1I45A 3IIXA 1TCDA 4XTIA 3TUUA 1KW1A 1LROA 4UXDA 3SGUA 1ICQA 3QRHA 3OG3A 3LI1A 1W3IA 3W2KA 4K39A 1SO5A 1SSGA 4DO5A 3W84A 3NA8A 3C52A 1O60A 3PG8A 3LRLA 4RJEA 1XI3A 3UWWA 1FCQA 1KLYA 1HO1A 1ICPA 1K02A 4PL2A 3BK0A 2QUUA 3QF0A 2DJLA 2FTPA 1IF2A 4O12A 2BX7A 4FX6M 5CZSA 5LHEA 4PCFA 4Y6GA 2NWSA 2ATMA 3W7NA 4Z1CA 3NL3A 3ZS4A 1W3TA 5FF0A 2VEIA 1H62A 4ZQOA 4CNNA 1WX0A 2HS6A 3WJZA 1EA0A 8TIMA 2V0TA 2X1SA 3AJXA 4OU1A 2ZTJA 4AMAA 5C2XA 4NQ1A 1JCLA 2ABAA 4DQWA 4HKPA 1KFKA 2E6FA 3A9IA 3GAKA 4O14A 1EX5A 4MZYA 3M1ZA 3W1AA 4PL1A 3TK7A 1TTPA 2CLOA 2YCEA 4MJMA 1TPVA 4O8RA 3VE7A 3BG9A 3C4UA 2YW4A 2DZTA 3UZJA 3G8EA 3G18A 4JGDA 3W2NA 1JUEA 1V7YA 1L6WA 3N34A 1QDSA 1TPWA 1EP2A 2W0UA 1XCFA 4JEQA 3NO5A 3L9CA 1ZCOA 1DQXA 3CWNA 2P10A 3CTLA 2GJNA 3EWBX 4EOUA 2E6AA 3G1AA 3HG3A 1JCMP 1L2UA 1OF6A 5DY3A 2RFGA 5A5WA 3GB6A 4PEKA 3EX6A 3HO8A 4MIMA 3K30A 4WQ6A 1F76A 1VGAA 2JKAA 2PRLA 1MSSA 2GOUA 3YPIA 3TJXA 4AHQA 3S9YA 1HFBA 4UFIA 3L65A 5FEZA 1RV8A 1G4SA 3NM1A 5KZMA 4AVFA 5BMWA 3MO7A 2E1DA 4DO4A 3WK2A 2CLEA 4XZ9A 1XM3A 1F6PA 3NQVA 3PG9A 1F7BA 1J2WA 3O6DA 4UTTC 1GTEA 1PHWA 1RVGA 3Q37A 1YDOA 1QNVA 2EPHA 3MP4A 1Q6OA 1GWJA 4KWWA 3E12A 3TJLA 2Z6JA 1N8FA 1KV8A 4FNUA 3EWUA 3F03K 4CLMA 2E5DA 1TIMA 4BF9A 2VEKA 1R2TA 2CFFA 4N02A 1LRNA 1XUZA 2PCQA 3P67A 4BR1A 1FY6A 5H91A 1VS1A 1J5TA 4IPJA 5MHBA 4A22A 3NDOA 1WA3A 4IX0A 4CCEA 3MP3A 3T7VA 2PURA 1WOBA 3O15A 3C3NA 2G97A 3MWAA 2CLLA 4BI5A 1JVNA 2GQ9A 4ZQPA 1KM6A 2Y70A 2DJXA 4JTHA 3W87A 4AHPA 4EVZA 5FF3A 3FKRA 1OFEA 1K7XA 2Y6ZA 3W7GA 2OT0A 3EB2A 3LXBA 3P7YA 4O18A 1NSJA 4RZ6A 5G2IA 1F73A 3IVTA 3GYEA 1VLIA 2Y62A 2Q3RA 1H7NA 1SW3A 5T26A 3M47A 5I3IA 3NVTA 4ALDA 3LX9A 4HNTA 1GPWA 2Y7EA 3HF3A 3G1VA 3O05A 1QPQA 2O7QA 2VFGA 2YDAA 4IPIA 1OX4A 3B03A 1AW1A 1GVFA 2BTMA 5C54A 3A5VA 1HUVA 3M41A 2VFDA 3O6YX 3S1WA 4XBKA 1I2PA 2WSRA 3DHDA 2H90A 4IJBA 3LHWA 5HMSA 4ADSA 4UTMA 2A7NA 3MUXA 1KV5A 2NXIA 3FJ6A 5GVJA 3ZWSA 2DZWA 4RZ5A 1PIIA 1L6SA 3M0ZA 1YADA 2VFFA 1KFJA 2VOMA 1OFQA 4AAJA 4FO4A 3DFPA 4GXMA 2TSYA 3TROA 2QAFA 1LRQA 3VNDA 5K4ZA 5G2HA 3TQ0A 5DCDA 4UTKA 2NXHA 3BW4A 5LSMA 2P1FA 1EWEA 3S42A 5K7JA 2ZDRA 3NXFA 1UBSA 5LKYA 2QCDA 1H7WA 4K8HA 3LB0A 1PCWA 3U8GA 2A21A 1R30A 4JY9A 5CZ0A 4JIQA 4MFEA 5G1TA 3KVJA 3FLUA 4JTIA 5LNRA 2V5BA 2XFWA 3W7IA 3TSMA 3LCHA 4A2SA 1SO4A 3N9RA 2A2IA 2F84A 2FFCA 4M6QA 3KVLA 4YMZA 1ONRA 3N73A 4J9JA 2ZFAA 3QYQA 3LHYA 5D09A 2XN2A 1SZEA 3IIZA 4MLJA 3ATZA 3H55A 5BW6A 3NZRA 3GIYA 4OE7A 3W2LA 3LV6A 3O63A 3SR7A 5EYWA 3CHVA 2PRMA 3W83A 3W7DA 1DHPA 2C6QA 5LGZA 3DFQA 4E38A 3V75A 1KFEA 4OHQA 2YW3A 5HWMA 5AC7A 3TX9A 3WJWA 5F2LA 4IUOA 4EIVA 3TW6A 2RDUA 3P84A 2RKXA 1Q45A 1LBFA 1O4UA 5F1VA 1TQXA 4IGHA 4AWUA 3W6YA 3QMRA 4NU7A 1TRDA 2YR1A 2C14A 3ZWTA 4Z1AA 2OCZA 4NXKA 4LVAA 3NM3A 4X9SA 3O6CA 3D0CA 2QEZA 1DVJA 1AG1O 3N2XA 3KRZA 4N4PA 5AHFA 2YX0A 4GNJA 4JDYA 1WV2A 1UB3A 3C2EA 3S5YA 4GJ1A 1GJPA 3SSJA 3IGUA 1LRTA 1OYBA 4ADUA 4S2BA 5EMUA 2J6XA 3VFLA 1OVDA 5IBXC 3MMTA 2R91A 4WX2A 4UTJA 4O13A 4WZHA 3LCIA 3PVFA 3NQFA 4O1BA 5AYXA 2NLIA 2ZBTA 4UR8A 4NZJA 1VLWA 3PSVA 4WY0F 1XUUA 1X1ZA 4MZ1A 1B3OA 1R47A 3W1XA 3BW3A 2QF7A 2DZPA 4K37A 4GUJA 4GE8A 3R13A 4LC6A 1S3HA 1WBHA 2PE4A 5E93A 1TMHA 2B7NA 1SPQA 3RU6A 3HPSA 1K3UA 3G3MA 4XBSA 2NUWA 3IV3A 1WDWA 3W9ZA 4LOCA 1QO2A 1SFJA 3BPWA 1KBJA 2CWNA 4JICA 1OF8A 5CGQA 5K9CA 4DF2A 4R7JA 5D37A 1H1YA 3DAQA 3LHZA 1A5CA 4I7WA 4NJJA 1LLWA 4AF0B 1P1XA 5AYZA 1QOQA 2QJIA 1BWLA 1OHLA 1W5OA 2TPSA 4RKAA 3GXTA 2WNNA 1EEPA 3LTSA 4AH7A 1LP6A 4N9CA 3ABOA 1AL8A 1DQWA 1TREA 3IRDA 3V1PA 2JGQA 3G0SA 1TPC1 3QH2A 5D2TA 1PHQA 3NQEA 4FX8A 1LOQA 3EXSA 1PE1A 1W54A 3TQVA 5F2MA 5F4SA 3OVRA 5KZEA 4OBTA 2OMAA 4NX5A 4A3UA 3C2RA 4JTFA 3G0UA 1TJRA 4GFSA 2DZXA 5SWUA 3PB2A 2EAWA 5A8GA 2GPTA 3GAYA 3Q2DA 1WOAA 3NG3A 3TV8A 5I3JA 3W72A 3F4WA 1QPRA 3IVUA 1KM1A 3ABQA 5LNUA 4Y90A 4HT3A 4RX0A 2QCFA 3EWYA 3ELFA 4CCDA 4LU0A 2ZA2A 2GJLA 1TPDA 4AXKA 1SW7A 2NWRA 1ZAJA 3MI6A 3W22A 3B04A 1WQ5A 3O1NA 1F6KA 4WXZA 1GVSA 1SZNA 2A1YA 2X30A 4KFPA 5D2VA 5KZDA 3HMJG 1JCJA 1DBTA 1TV8A 3LXAA 3DGRA 5D33A 2H8ZA 1LBLA 3TDFA 4UMBA 2ZA3A 1B9BA 4OQVA 4WOQA 1TJPA 4K7VA 3MI3A 1MO0A 3A24A 5K4XA 4Z08A 3T78A 2ZTKA 1I2OA 4JTTA 5C5YA 5D32A 4QM1A 3S1XA 1W5NA 4PC8A 2ISSA 1N55A 1SZFA 2NV1A 1TRIA 1BKSA 1W1ZA 1PS9A 2VXNA 3UWQA 4LS1A 2A7RA 3LTYA 3QPYA 2NX3A 1OFBA 2X2GA 2R94A 4IX2A 3NQGA 4MJZA 3I68A 5EL1A 5AOUA 5I3FA 3W2UA 4YLWA 3NL6A 3KVMA 1JJKA 3BGGA 1QOPA 5U4NA 3VI2A 2CLFA 3QQ1A 3KRUA 3DKLA 5AHMA 3KHJA 3NPVA 1XL9A 1GG1A 1D3HA 1AW5A 2ZZ6A 4JX4A 1Z41A 4L4MA 3G1FA 2ZZ1A 4QISA 2ZQ0A 2FIQA 3L5LA 3GXNA 1IXPA 2Y7FA 1A50A 1TV7A 4KWVA 2TYSA 5FF7A 3SJ3A 3EKZA 4NNAA 3PUOA 4OV4A 4GUIA 1FWNA 4LNYA 1F5ZA 1H7PA 2VELA 1TTJA 1MXSA 4JD4A 3L21A 4JTJA 3STEA 1ALDA 2ZRUA 3B06A 3CB8A 5BOOA 3FJLA 3W85A 3B05A 3RF9A 2ABBA 3JS3A 4NJKA 4R34A 3LLDA 5D2YA 1OG0A 3P80A 4O28A 1GVRA 1W5PA 1H51A 3W07A 2E6YA 3G1SA 4RCXA 2Y88A 1ZNNA 4M7TA 3MBFA 4DO6A 2JK2A 2YPIA 4IQLA 3S5ZA 3QSRA 5CZTA 4UTUA 4GRSA 1GQNA 4LVFA 1T8XA 1NVMA 4GWEA 4JX6A 1H7OA 1EP3A 4MUZA 3BLIA 3M7WA 5HUPA 4X2RA 5CPOA 2EHHA 2FLIA 1WAUA 3P8JA 1OABA 1FWWA 3EXRA 4AEOA 2J24A 1NFBA 5KMYA 1XDLA 2VKZG 3FA5A 1P5BA 1UASA 4NJIA 1ZHAA 3BG5A 5C6MA 3MHUA 3UY7A 4HPJA 2V81A 1OFPA 3TMLA 2IQTA 3I7RA 3LCFA 1KTNA 2D73A 1XBVA 2GQAA 3F4NA 3NQCA 1WXJA 1SSDA 4W9TA 3BGJA 2GVJA 2FPVA 1NF7A 1YXCA 3TU9A 1G4EA 3BG3A 1QO5A 1YLVA 4QAIA 4ZVJA 3P60A 2Q8ZA 3GVGA 4RXGA 4YCOA 1I8JA 2V2HA 2QR6A 5DELA 4LV4A 4LT9A 2QCHA 3HQ1A 1YPFA 1TQJA 2WSQA 3UPBA 3PM6A 4UTHA 3LLFA 2FB3A 2ZRWA 2QDHA 3QEZA 1YTKA 3GX9A 4ZZ9A 4JYFA 2E5BA 3S1VA 3LCWA 3DKJA 5TQLA 3L0NA 2RH9A 1GZGA 2ZZ5A 2YFNA 3OEXA 3TA6A 3M6YA 3GR7A 1T96A 2B7OA 4KFNA 3WFAA 4NT0A 4WD0A 2E6DA 3O07A 4M6VA 3HPXA 3L0GA 5D30A 4POCA 3ZFHA 4O11A 4HIBA 4EF9A 3N2MA 1B4KA 1JCXA 1FXQA 3DFTA 1F2JA 4HSNA 1A5AA 4Q33A 1XBZA 1TYGA 2Y89A 3LHUA 3FFSA 3SFKA 3MHFA 3TE9A 3DI0A 1ME9A 3MHGA 2ISVA 1EUAA 2WNZA 4UNLA 5E0KA 1VZWA 4GBUA 4TO8A 1ZALA 1PCKA 4NNBA 4O54A 2ZA1A 3W7PA 5HNRA 4Y8FA 3FEMA 3T44A 2OJPA 3PBUA 3QMSA 3C56A 3DHFA 2JGYA 2J9YA 4X22A 3SZ8A 4ZQNA 3USBA 4O1AA 3W70A 3INPA 3E49A 4FB7A 3T55A 4A29A 3BW2A 1DKWA 3MBDA 2WV8A 2EGZA 1U83A 4A2RA 1IXNA 5CKSA 3EX1A 5AHIA 3ABRA 5F2GA 5J5DA 1KM0A 2HTMA 2UV8G 1KFBA 4TMBA 3MYOA 5IBXA 1DL3A 2A85A 4NX0A 3LTPA 5CZJA 4E2DA 5LNWA 3C2OA 3NQAA 3IIOA 5D05A 1CW2A 1SUXA 3DBPA 5G5IA 3GR8A 1RPXA 2GVLA 4HNUA 5EKYA 2NUXA 4DF1A 1FXPA 1LM1A 4M19A 5D03A 4B5NA 2A6NA 2A0NA 4IMFA 1HG3A 4O4WA 5F2IA 5TBOA 3M5YA 3W1TA 3NR0A 2H6RA 1UUMA 3TFXA 1MZHA 1HTIA 3UZ5A 4DBDA 2C0AA 4HN4A 2BZNA 1P4CA 4HNNA 4C1LA 3S0CA 1RZMA 3P82A 2ZYFA 3S1UA 1AMKA 1XFBA 2VFHA 3G1YA 2Y63A 3KOFA 3W86A 3A22A 5EA9A 1S5VA 1BEUA 1Q6RA 3A5FA 4CQ8A 3PUDA 2QCLA 1ADOA 2E77A 5FF2A 1QFEA 2CZDA 4FNRA 5CPNA 3L2IA 3U6WA 5KTLA 3SY5A 5DBUA 2G5WA 1LTDA 4BWLA 4QNEA 1EP1A 1UJPA 2Z0IA 3LRMA 3PAJA 4O17A 3QM3A 3U2OA 5CSSA 2O7SA 4OWGA 4U28A 2VEPA 2QUTA 2V2DA 4LTSA 2PC4A 1TV5A 3G1XA 1JULA 4UFMA 1Y0EA 1GVOA 2W6RA 4UC5A 1OFAA 4H6KA 1FCUA 2QKFA 5BMXA 3W1LA 4UFLA 4BI6A 1WBJA 5L6UA 2DZSA 4MOZA 4N6EA 3GDMA 4EWND 1SFLA 3BVJA 4CQAA 2WKJA 1XDMA 3EKLA 2FPYA 3EXTA 3PY2A 2E09A 2A7PA 1NEYA 4PODA 1O94A 4I9AA 2I14A 1RQBA 4P61A 1M7OA 3UD6A 4UFHA 4JN6A 3W7EA 3IIPA 3DFNA 1CI1A 1JCNA 3P8IA 1O5XA 3GZ3A 4JS3A 1Q6QA 3TSDA 3RNDA 2CZ5A 3C61A 3HOJA 3W2JA 3B4UA 5FEXA 4FXSA 3I6RA 3RLVA 2VEMA 4JR5A 1C8VA 3W74A 1SR9A 1OX5A 4O52A 4BI7A 1DOSA 1R2SA 2W79A 4FEZA 3O06A 2YSWA 3R8RA 2QCDB 4JIPA 4ZMGA 3NPWA 5K9XA 4FIRA 3B0PA 2P0OA 3F1QA 3QW4B 3PSWA 4UUIA 2QUVA 5HUOA 3BV4A 4TMCA 3RLUA 4GUHA 1QPNA 5CPLA 3NEVA 3I7SA 3BLFA 4O53A 5DLCA 4RV8A 2CZFA 1SQ7A 4JDBA 4ADTA 4LUIA 3G1HA 4MY1A 5K2ZA 2WO5A 1VYRA 4WUIA 4Y96A 3B0UX 1OFOA 3QMTA 1L9WA 3R5EA 3HG5A 3WJXA 4UNKA 4N4QA 4Y9AA 4Z0SA 3MJYA 5FF4A 2QJHA 3C2FA 2RHGA 3LHTA 2C3ZA 1VQTA 3UYCA 4DBEA 2BXVA 1S5TA 2X1TA 4O16A 4ORIA 5G2WA 4S1FA 3W23A 5KINA 3DFOA 4K38A 3NQ2A 3C2VA 3EX2A 1LOSA 2BWGA 3MP5A 5DN1A 6ALDA 5E1QA 4CNOA 3DU0A 4WOZA 1QWGA 5AHLA 2ZZ2A 4IOTA 2A4AA 2C18A 7TIMA 1EPXA 1TO3A 2BSLA 4I7VA 5I3HA 3LV5A 1Z48A 2NXGA 3EWXA 4HSOA 4JXCA 4LVGA 1H5YA 1Z44A 4OT7A 3ATYA 3UWVA 3LHVA 3TW7A 3W7KA 5K3VA 3LM7A 3LBMA 2XN1A 4UMCA 1P0NA 3QPZA 1GYNA 4XKYB 4UCGA 4DEFA 4K8EA 4JTEA 2VFEA 1QAPA 3OBKA 2RDWA 3BARA 5HWJA 3LGEA 4LVDA 3B8DA 1RQHA 5CSRA 4ZQCA 4X3ZA 4MYXA 1GOXA 3VKJA 3GLCA 1VYPX 3KVKA 1LDCA 2CLKA 2Y7DA 3S5OA 1DV7A 3QFEA 3HPZA 3DXIA 2GUUA 1UCWA 4H3DA 3G3DA 2QCMA 3HGJA 1XXXA 2QCCA 4DPPA 5KSWA 1ML1A 4I7UA 3NQMA 3TQKA 3NPUA 2G95A 4O19A 5L9FA 3EWWA 1GVQA 2J88A 1VHCA 5U7SA 4ZQMA 2H3DA 3UXDA 1FDJA 5TIMA 1L6YA 4ONVA 1A5SA 1KM2A 1T0OA 1QMLA 2NX9A 3HBLA 4IWWA 3TSBA 3O16A 2J27A 3O8AA 3HGOA 1I2RA 3TAOA 1K7FA 1G69A 1I4NA 1MEIA 3C8FA 1G7VA 4RR4A 4UIOA 4JTUA 1B4EA 4ZL1A 2R14A 1CX9A 1MEHA 4JYEA 1OX6A 3LCXA 2V9DA 1IIGA 5LNVA 2CW6A 1XBXA 1THFD 4PA8A 4Q32A 2DORA 5DXYA 3PBYA 3IEBA 5G4EA 3TCEA 2NV2A 1K8XA 2QCEA 4MVAA 1XKYA 3W1NA 1FCBA 3W7CA 3NZ1A 2WSYA 3DI1A 3W1RA 4DXVA 4L4LA 2ZZ4A 4WJEA 4AF0A 2V8ZA 4MYAA 5HJLA 3G24A 1IGSA 3QZEA 2NX1A 3TIMA 3EX4A 2B4GA 4YXGA 5CG7A 2C15A 4DPQA 1Z42A 5DBTA 3GKFA 1GTHA 2Q8LA 1ZAIA 3DZ1A 4MZ8A 4NNCA 1OFRA 2ZRXA 1I2QA 3C0JA 2E68A 6TIMA 5EY5A 1OFDA 1KTBA 1KM5A 1VCGA 3W7QA 3STFA 2R8WA 4NJHA 1DJQA 1W3NA 3OVPA 3G1DA 1H61A 1WYIA 1A5BA 3G0XA 2WJZA 3IVSA 4FNQA 1PL9A 1W31A 4E2BA 3BO9A 4LC8A 2B0MA 3N3MA 1W37A 2C19A 3CU2A 3UPWA 3RMJA 4FNPA 4O0KA 1AW2A 3IIVA 4N9BA 4N2YA 2NUYA 2YXGA 5EBUA 1PV8A 1QR7A 3CQ0A 1OJXA 3NYZA 2WPBA 3B0VC 2B7PA 3QSTA 2CLHA 3S5NA 3KAOA 1LZOA 4QJ1A 2CZEA 3M43A 2WQPA 3NQDA 3FS2A 1EB3A 4IMGA 2QCNA 2QAPA 1TB3A 4HHPA 2C16A 3UWUA 4UFJA 1LORA 2TRSA 4LVBA 5LNSA 1YXYA 4UR7A 3W7MA 1VC4A 3JR2A 3L66A 1VCVA 4TU1A 5H2ZA 4D2JA 5FESA 4KKXA 3LBCA 5HINA 3W7HA 4LS0A 1D3GA 1JQXA 3ABSA 1YPIA 3P61A 3FIGA 4XQ6A 1RQEA 5D2XA 1JR1A 3W1QA 3NAVA 1YDNA 3N19B 5J5RA 3E02A 1FDYA 2ZRZA 3WJYA 3PB0A 1H7XA 3L68A 4JTLA 1G7UA 1JRBA 1LCOA 1XC4A 3CM4A 3NQ7A 1LOLA 5FEPA 3OHIA 3P5YA 3P62A 3L67A 1DORA 5DCEA 3LXCA 3ANYA 4LUJA 1VR6A 5LGXA 2PRHA 3GDTA 3TR2A 1QCWA 3M9YA 3A23A 4O50A 2WOQA 3CWOX 3PBWA 5HR6A 1H1ZA 4N6FA 4AWSA 1YTDA 4FHAA 2YYTA 3QW3A 1A53A 3S6DA 5C55A 4YL2A 1LBMA 3W7LA 1W56A 1TPB1 3Q58A 3NQ8A 4N9DA 5AHNA 4FNSA 3T4CA 4O15A 2A6LA 4O10A 1FWRA 2Y85A 4HPXA 4O1CA 1GG0A 4NJGA 5F4WA 1K8YA 1F05A 4O1DA 4LW7A 5DY2A 4RK8A 3PWAA 3M16A 1G4TA 2DZVA 3UXAA 3TXVA 1PVNA 2NZLA 4UTWA 2LLEA 4LRSA 4Z1BA 3TKFA 4WY0B 4JTSA 3SECA 3W75A 4RLIA 2B7QA 5AYYA 1DJNA 1VPXA 2EF9A 1TPUA 3M5XA 3W76A 2ZCGA 3MI2A 4PH6A 1FUYA 3GDRA 2V30A 4IMEA 2YZRA 3P81A 3CC1A 2AAMA 3EX3A 4XTDA 5F1UA 2YFOA 4UTLA 1ZAHA 4UMAA 5I3GA 2OZ0A 1I2NA 4QIUA 3DENA 3TC7A 3M5VA 3SGZA 1BWKA 4DELA 2TMDA 2OT1A 4FNTA 2CLMA 3HG2A 1VCFA 2FJKA 1JUBA 4G1KA 5FI8A 3LERA 3NNTA 2YGYA 4JTGA 3OA3A 2CLIA 3NL5A 1FX6A 1SO3A 3MYPA 1JRCA 3CEPA 2ZZ7A 1T99A 1FQ0A 5AC8A 1AK5A 1VRDA 3T40A 4RZ4A 5CPMA 1HL2A 1OK6A 3PC0A 3HGRA 3NQ6A 4S2CA 1H50A 4MKNA 1ME8A 4M7SA 1SW0A 4LY8A 2I1OA 3C6CA 1VJIA 1ZFJA 2DP3A 4ICNA 2Q3OA 3UWZA 5ABTA 3ZR4A 3TNOA 4UTWC 1GYLA 2Z2UA 4AB4A 3QC3A 3M44A 2Z6IA 3TH6A 4TX9A 3S8HA 4Q4KA 5AB3A 1R46A 3QQ0A 3HGSA 2H3BA 5BNKA 4Z0JA 3G8RA 3TXZA 3MW7A 2KZHA 5AFDA 4R53A 1IXOA 1H7RA 3N14A 2J9ZA 3AO0A 3W1UA 4CQ9A 4AWTA 4LWWA 1OYCA 3LDVA 1KTCA 4JTKA 3SW6A 1C29A 1H63A 3SIZA 2G96A 4C1KA 1ZY9A 5AC6A 1EWDA 2C13A 4TR9A 4AHOA 1MEWA 5F4XA 3LRKA 3RFAA 3STCA 2ALDA 1YTEA 4FIQA 2ZZ3A 5I3KA 4N9EA 1LYXA 4M6PA 2GQ8A 4OV9A 1OX4B 1KBIA 3CEUA 1BTMA 1IIHA 4QITA 3STGA 1W0MA 4PTNA 2FQIA 2HS8A 2ZRVA 3FOKA 5D2WA 5HWNA 5HULA 3W1MA 5D02A 3KFTA 5FEWA 2C1HA 4TIMA 1C9DA 2X1UA 5D04C 2FPTA 3UNDA 3CLMA 3GNDA 4CCCA 1VH7A 1Q6LA 1G6CA 2ATSA 5G1YA 2Y7GA 3GNNA 1J4EA 1M6JA 3H54A 1JQVA 3W71A 3FYOA 3GKAA 1AL7A 1X8FA 1FCVA 3W88A 3SI9A 3N9SA 4H4IA 3FYPA 3HJZA 3THQA 2XN0A 1RD5A 2QJGA 4PFMA 1R2RA 5AN7A 5HR7A 4EF8A 4YCPA 1UUOA 2CU0A 3DFSA 1SO6A 2A5HA 2VFIA 4HNVA 1KLZA 4P2VA 3M5ZA 1GT8A 2WNQA 4QNWA 1K7EA 4MY9A 4O57A 4O4VA 4QSHA 1K03A 4QQ3A 5DXXA 3WK1A 3PF3A 2EKCA 1IXQA 1HO4A 3EWZA 3NL2A 4XKYA 3R12A 3IGXA 3E9AA 1TSIA 1KFLA 4Z1DA 3R89A 3W3OA 2JKPA 4XUGA 5LHFA 4UFKA 3CPRA 3L0KA 1V5XA 1TPFA 4JNMA 4IMDA 2ZRYA 2HSAA 4K7YA 3W7OA 2BLEA 4U4MA 5K9DA 2I9EA 3PBVA 2H8XA 1O95A 4ML9A 2DU2A 4BWLC 3GK0A 3OIXA 3UY8A 2Y61A 3KXQA 1KFCA 4NUWA 4WXYA 1M5WA 1F74A 3QJAA 3GDLA 3H53A 1FDZA 4K6AA 3GXPA 3RK8A 3UQNA 1H60A 4JX5A 4YWIA 2RDTA 1W5QA 4A21A 3L5MA 3W7RA 1N7KA 1U5JA 3KRSA 2JBMA 1G4PA 3A21A 3VE9A 3UWYA 1GEQA 1G67A 1S5WA 1NAL1 4JY8A 3VCRA 5KITA 1OK4A 5BRBA 5DCBA 3G22A 3NGJA 4BK9A 2VC6A 4GUFA 1QPOA 1ZENA 5G4WA 2HMCA 2ISWA 3P74A 2F7FA 2AGKA 2VENA 3I65A 4FXRA 4DF0A 3HB9A 4XWUA 3PS7A 4M5PA 1LLZA 3NOEA 1OYAA 1KA9F 1W5MA 1YYAA 3E96A 4KFOA 3LCLA 3WJSA 1RR2A 4LS2A 2YYUA 4O0ZA 2FB2A 3IGSA 1Q3NA 1FWTA 1EIXA 4K36A 1E51A 1JUKA 3WK0A 2X1RA 3FKKA 3DH7A 5AHEA 4E0CA 3JRKA 1P0KA 1VYSX 1TTQA 1SZGA 4GUGA 2JKEA 1YXDA 4WY0A 1FBAA 3TAKA 3LI0A 4MLRA 4FF7A 1VHNA 5D38A 4ZQRA 3GDKA 3R2GA 4RXFA 1B57A 5HQEA 3WK3A 3TMQA 3W2MA 1TPEA 3NPXA 2QCGA 3W1PA 1ICSA 4GC4A 4OGZA 2QDGA 4UTIA 3KX6A 3LOTA 3CIXA 1XBYA 5IM51 3TFCA 3HIJA 3EEGA 4NXSA 3PULA 4CNPA 1D9EA 3TC6A 2V82A 4NZFA 4MFDA 1X6UA
chains in the Genus database with same CATH superfamily
4Q7BA 3BLEA 3UBPC 2J6VA 1NY1A 3FXGA 4F9JA 1U30A 4U3CA 4AIBA 4BEQA 1V4YA 1BXBA 3CT7A 3OZYA 4MPQA 3I10A 2POTA 2XSAA 5M5DA 2IPWA 2PWGA 1E1FA 3A64A 2BOFX 4NZ1A 3WQEA 4C60A 3E0IA 1H1NA 4GZEA 3MCOA 4IXHA 1B9ZA 2XHYA 3VPLA 1X7FA 1UBPC 1KM4A 2ZUSA 1K8ZA 3Q94A 3W26A 4LRTA 2J8TA 1RH9A 2FDSA 1SU5A 5AYBA 3P6LA 4IUGA 2VC5A 3CPGA 1I75A 1X7IA 5CJMA 1I45A 1Q8AA 1VB9A 4UXDA 1ICQA 3KL0A 4CVWA 6XIMA 3SCSA 1BPLB 4DO5A 3W84A 5D9NA 1W1B1 2OEMA 4QR6A 3C52A 3GH4A 3PG8A 3B0YA 3UNTA 1KB3A 3W6LA 3O2LA 3WQVA 4DIAA 1NDVA 1EJSC 1HO1A 2AKMA 1L6GA 1IT8A 4PL2A 1ONEA 2QUUA 3B8IA 3OZMA 5KETA 2FTPA 1J5SA 4O12A 1A3XA 4FX6M 3SCTA 4PCFA 4Y6GA 3SURA 1MVYA 4Z1CA 1PDYA 3QGVA 2E9LA 3NL3A 3SRDA 1W3TA 2VEIA 1H62A 1R5YA 3CZLA 1WX0A 1YE4A 4KCVA 3H2NA 4XX6A 3L4ZA 2V0TA 2PDCA 4PTDA 4OU1A 2AGTA 2ZTJA 1PB0A 4W87A 1R7OA 2Y5JA 4UBPC 1KFKA 1KWGA 2J7BA 3GAKA 4MZYA 5J8LA 1DJHA 1E56A 2ZX6A 3TK7A 3A4JA 3CUIA 2BG5A 1A3WA 3SN1A 3VA8A 5HJXA 2HROA 2DZTA 4FOJA 2PWDA 1KR0A 3W2NA 4HHHA 1L6WA 1TPWA 4JEQA 3OW1A 1WNOA 3V7PA 4AEFA 2OZTA 2DUAA 2E6AA 3G1AA 3HG3A 4AIEA 4MJ4A 2RFGA 3ITVA 1KWKA 1UJQA 5A5WA 4MIMA 4WQ6A 4ATDA 3EB4A 2JKAA 2PRLA 3JUGA 3DCPA 3TJXA 3UG8A 3L65A 4D1JA 2OVLA 1RV8A 4IL2A 2IKGA 3MO7A 3WL0A 3SY1A 2W61A 3ARVA 5JBDA 1F7BA 5DT5A 3FDKA 1F4AA 1RVGA 1BQGA 4QE4A 3Q37A 1QNVA 3QHNA 1P6BA 1Q6OA 3RR4A 2Z6JA 3NEHA 3F03K 1MW0A 3FHQA 1HQTA 4N02A 1LRNA 2PCQA 4YU1A 3DERA 4EACA 3AXHA 4C6JA 1S5MA 1S5NA 4NZ3A 5MHBA 2NV9A 2O9TA 1WKFA 4CCEA 3Q45A 2XVPA 1N8WA 3UCQA 4DUVA 3RYSA 1RXOB 4G7EA 4BI5A 3DYPA 4ZQPA 1KM6A 2DJXA 3W87A 1ZU8A 5FF3A 1OFEA 2QJJA 5C9WA 3W7GA 2OT0A 3BTNA 3QLLA 1FFRA 1DWIM 5G2IA 1FOBA 1F73A 2VOTA 5XINA 4RDVA 3WX7A 4HK5A 1EHNA 1MW2A 3NVTA 3BH4A 4AZIA 4QBXA 1Y5VA 4HNTA 1O5QA 3WNMA 4KEVA 2VFGA 4UQ9A 4RW5A 2BTMA 3LN3A 1JZ7A 3BUVA 1UP0A 4HOWA 1HUVA 1FKWA 4XBKA 3DYOA 1EF2A 1SJCA 4A8IA 3SRFA 4TXEA 1AQHA 2A7NA 2DSZA 3N29A 1KV5A 4KIEA 5CGMA 4H04A 1PIIA 1L6SA 1YADA 1OFQA 4FO4A 1ZQ5A 4GK8A 5FSDC 1LRQA 3REQA 5G2HA 2ADAA 3TQ0A 4UTKA 2FDMA 4Y2WA 1POJA 3AYTA 7ODCA 2Y8VA 5LKYA 4AZBA 2C91A 2QCDA 3EMZA 3VC6A 3E0FA 4LX4A 4JY9A 5CZ0A 3RRXA 4DBUA 4MFEA 5G1TA 1M9HA 3FLUA 2V5BA 2XFWA 3PNZA 3LCHA 3Q67A 2A2IA 4H83A 1GVIA 4YMZA 1HL8A 4C6PA 3CL7A 3OVGA 1NU5A 5BW6A 3NZRA 3GIYA 4AG0A 2QS8A 3W2LA 1J0YA 3SR7A 1GOIA 3WH5A 2HK0A 4WJXA 5LGZA 3REQB 3ITOA 4E38A 3V75A 1KFEA 3F7JA 2YW3A 3TX9A 3WJWA 5F2LA 1PO9A 3P84A 2YDSA 1X98A 1CXLA 3R43A 2AL1A 1OIMA 4FR6A 4NU7A 4J3VA 2XFYA 1J2BA 2C14A 4LCSA 3ZWTA 4Z1AA 2OCZA 4NXKA 1PKYA 2WMHA 1TMQA 1OSEA 3NM3A 4P7QA 4CU8A 2FVLA 3F2DA 2QEZA 1DVJA 1GEHA 1W8GA 3KRZA 4PMRA 2YA0A 2X0YA 3C2EA 3S5YA 2BOGX 3R79A 3XIMA 1LRTA 1OYBA 3KL5A 5EMUA 2RGMA 2J6XA 3VFLA 5IBXC 3MMTA 1FH8A 4U31A 1JXJA 1RY0A 4WZHA 3F5LA 1OINA 3BMWA 3ZLGA 2VDHA 2FZ9A 1VLWA 4N0RA 3H7UA 2JIEA 4WKAA 2QF7A 4KPLA 3ZYZA 4GE8A 4L6HA 4UB9A 2WSKA 4AZ5A 1ZCCA 3CZKA 1AZ2A 4JNYA 1F61A 1OCJA 3I6TA 3HPSA 3OODA 2ODOA 3G3MA 4OUIA 4XBSA 3IV3A 3OGRA 3VOFA 1WDWA 4LOCA 1QO2A 3BPWA 1KBJA 3KTSA 4DF2A 1BVZA 1S46A 5D37A 3DAQA 1A5CA 1KCKA 4I6KA 4I7WA 2PZ0A 1LLWA 1S2UA 5A6SA 4KBXA 1BWLA 4RKAA 3UVAA 2NW0A 1PKNA 2WNNA 3VNIA 2RJHA 1LP6A 4N9CA 2OEJA 3ABOA 3KM8A 2YZ5A 1G01A 3M7SA 4UZSA 2Y5SA 4RE4A 1K9TA 1KR1A 1TPC1 3QH2A 5D2TA 3CAKA 3E2QA 1I0DA 2Z1VA 1Z3NA 2YKKA 5F4SA 3OVRA 4MPKA 5GNYA 4NX5A 4H8HA 3DHUA 4A3UA 4B2DA 2ONEA 5T91A 1TJRA 3RM4A 3TONA 1XLIA 1E1CA 3P93A 2Z2AA 2CXGA 3PB2A 1CB2A 1REQA 1PZ0A 3GAYA 3Q2DA 1WOAA 3KZPA 4NZ4A 1W1A1 1QPRA 2XGBA 2PI6A 3ARRA 4KH2A 2PGWA 2QCFA 3EWYA 5LIUX 5I02A 2BDQA 1ZAJA 3WQWA 1WQ5A 4U2YA 1DQUA 2XVKA 2Q02A 1DIOA 2A1YA 2PC8A 1IT0A 4L5ZA 3AMKA 4PSRA 4GD0A 5KZDA 4ZXOA 1M41A 1JCJA 5ECVA 1PEZA 1XIJA 1SMDA 1I60A 5A8NA 1DBTA 4ERIA 1TV8A 3WLNA 3OZOA 5D33A 2ZE3A 4M29A 2H8ZA 1B9BA 4OQVA 2CBUA 1V8EA 5C71A 2WZHA 1KNWA 4G6CA 1NFPA 1I2OA 3F2CA 1PJ9A 4PC8A 2ISSA 4W88A 4CNSA 2GK1B 1PS9A 4JQAA 3GNXA 3M0LA 4MUPA 3VOGA 2BVYA 3KRBA 5C2CA 3I68A 1O1ZA 1JDCA 1BYBA 3ICJA 1VEMA 4QDWA 3W2UA 2VVNA 3NL6A 3KVMA 3H21A 3PBMA 1OT1A 5B80A 1LL6A 2HE5A 1VIWA 3DFYA 2XIOA 1Z41A 3WF2A 4MTVA 1E6NA 3KBMA 2VJXA 1S1RA 2QVHA 3L4UA 2EG7A 4V2XA 1JAEA 5FF7A 4NNAA 4OV4A 3TJIA 3IUDA 3GHTA 1FWNA 1F5ZA 1H7PA 2AQOA 3CMJA 4JD4A 3DEQA 1RLCL 1BHGA 3VD9A 2PU0A 3C0SA 1GNXA 2JFEX 1XRVA 1DWFM 5I24A 1QATA 3CB8A 3IUIA 1XH0A 3WNOA 1VFFA 3W85A 3RF9A 4NJKA 2DVUA 3TOYA 4TV6A 3THUA 1YMYA 2A3HA 1V3MA 4MG4A 6PTDA 3IS4A 2QGHA 4O28A 1BGAA 1W5PA 2G3IA 2FZNA 2Y88A 4Q7NA 2QW5A 1RPKA 5HXMA 3ABZA 4DO6A 4F0RA 3Q4DA 1AH4A 2YPIA 4IQLA 3S5ZA 3GR4A 5I0DA 3MB9A 5CZTA 1Q6CA 1W1PA 3OPSA 4GRSA 5FJUA 3BICA 1NVMA 4MUZA 1H7OA 4ZA0A 3RUBL 1AODA 2J7HA 3M7WA 2PGRA 5KZ6A 1IZJA 2FLIA 1WAUA 3AXMA 1FWWA 5H8PA 4AEOA 1FWDC 2J24A 1S3TC 3FA5A 1Z7AA 4NJIA 5C6MA 2BFGA 1VPYA 4HPJA 4C7FA 3I7RA 1C91A 2R24A 3F4NA 3NQCA 1NM9A 2GVJA 1NF7A 2VR5A 3BG3A 2FH8A 3ME3A 4YCOA 2QR6A 3L4WA 4LV4A 5FKYA 1RK5A 2OQLA 5IXEA 2BVDA 4CEXC 1GJWA 1TQJA 1RD6A 2WSQA 5H1WA 3C3UA 1S38A 2ZC8A 4CVUA 4GX9A 4ML4A 1V6TA 1R0MA 4GZIA 3QEZA 2VGBA 1FWEC 7REQA 3GX9A 4ZZ9A 4GA8A 2PBOA 3LCWA 4QAWA 5TAOA 2YL6A 2E9MA 3AMGA 5TQLA 4OFCA 4PUKA 2ZZ5A 4WK9A 3VX0A 3M6YA 4HB7A 1IGWA 3WFAA 1ZP4A 2WVUA 2E6DA 4M6VA 1FH9A 3NUKA 4POCA 4G7EB 3WFZA 2POZA 2DT3A 1B4KA 1XW8A 3AIWA 1FXQA 4KEZA 2DVTA 4IMAA 4K3ZA 4XV0A 1TYGA 3FFSA 3TE9A 3DI0A 1Q2RA 1O12A 1EUAA 2WNZA 4ZFCA 1VZWA 2HK1A 1ZALA 4IZGA 4O54A 2ZA1A 1EZ2A 4Q22A 3VGDA 4Y8FA 4AD5A 3B8TA 3H24A 2GJXB 4A6GA 4HJWA 3H12A 1XIEA 2GUBA 4PUJA 2VVSA 3K13A 3GH5A 3KL3A 2PDMA 4F0MA 3E49A 4FB7A 3T55A 1GCYA 4NL1A 2DH2A 1ONWA 3MBDA 2VC9A 5AHIA 1XIBA 5JIWA 3IJDA 2VRKA 1C8YA 3UR7A 4CKQA 1DL3A 1FWIC 1YDYA 4GO9A 4E2DA 5LNWA 2VGGA 3DBPA 3NOYA 2XVNA 1BVNP 5G5IA 3GR8A 1YBQB 3CLWA 5DFAA 4AUBA 2AAAA 5D03A 2PS2A 1S2TA 2CHRA 1KGXA 4MB4A 2ACQA 4HTYA 1HG3A 3VUPA 2J7FA 1NIUA 2VI0A 3M5YA 3NR0A 1C7SA 4S3AA 4HZMA 4BJHA 4DBDA 5BXPA 5LIXX 4J3WA 2BZNA 1QI0A 3N6HA 3RX2A 4HNNA 4C1LA 3S0CA 4H9UA 4GHRA 1C90A 3UR8A 2WMIA 2ZYFA 2L5HA 5DT7A 4G2DA 2G3FA 2X40A 4TX8A 3G1YA 2Z24A 3MDUA 1S5VA 1BEUA 4PCSA 4PBEA 4IIEA 3C0QA 4CQ8A 3UPMA 3AMLA 4WEVX 4DJFA 4NYUA 4C1NA 1Q13A 2XH4A 1LWHA 3SY5A 2G5WA 2WBGA 2Z4GA 1TMLA 3VMOA 1XLDA 2F8QA 2PP0A 1EP1A 4S3EA 1UJPA 2Z0IA 3PAJA 5FJRA 3SCPA 1E6PA 4ZO6A 4REQB 1XWYA 5ABFB 3U2OA 5CSSA 1F3WA 1XLAA 1UP3A 1JZ2A 1TWIA 4GI4A 2INFA 4LTSA 4HNCA 2PC4A 1UZHA 1JULA 2FH6A 1OFAA 1FCUA 3L23A 4ERGA 3ZXWA 4FZIA 4UFLA 4BI6A 5L6UA 4MOZA 3GDMA 1SFLA 1XLKA 1JNDA 4KIRA 3PY2A 1NEYA 5XIMA 4FA3A 2NQ9A 1TG7A 2QVNA 3BZJA 5CAKA 3UD6A 4JN6A 2XTKA 3IIPA 1CI1A 1JCNA 1GHSA 3P8IA 1O5XA 4Z2JA 1MUMA 2CZ5A 3W2JA 2VEMA 5EMYA 4UOQA 3W74A 1DEDA 3HJEA 2W92A 3GVQA 4I8YA 2VR4A 5GPRA 3MVIA 4FEZA 4GQBA 4YWSA 3O06A 3K4WA 1IEQA 4KRTA 4OUEA 2P0OA 1VJSA 3BCJA 3F1QA 2DIEA 3FX4A 2QUVA 5IOBA 2GSEA 5GJMA 2C71A 3LEPA 4TMCA 4GUHA 4CU7A 3RPDA 3I7SA 3BLFA 5DLCA 5C9UA 3WN6A 3MC5A 2CZFA 4ADTA 4IJCA 4WUIA 4Y96A 3B0UX 1OFOA 3WJXA 4UNKA 3ONCA 3RILA 3LBOA 5FF4A 1EOKA 5JIPA 2RHGA 2TODA 2VR2A 1G94A 3LPPA 1M7XA 3CL6A 4LFYA 4O16A 4ORIA 2WHLA 1YHTA 5BOFA 4AQLA 4S1FA 3W23A 1NWTA 1OC6A 3T4WA 2G8ZA 3C2VA 3VMNA 3EX2A 2FZ8A 1A0DA 2OSYA 3MP5A 4YHGA 5FOOA 4LB3A 4CNOA 1FP9A 3LG3A 4MB5A 3BAXA 1HKVA 4HPGA 4MWAA 1JGMA 1EPXA 1TO3A 3LV5A 3EWXA 4H19A 4JXCA 4LVGA 2VQUA 2OYMA 2Z1KA 3VVGA 4ZE5A 1OG6A 3LBMA 4S23A 3O6AA 4UMCA 3H7RA 3WDHA 3BDKA 4RE3A 1GYNA 4XISA 4D72A 5MKGB 1KCLA 3BARA 2BGSA 1VENA 1SVDA 4GVFA 3V36A 2GDUA 1VYPX 2XVLA 1LDCA 4ZFMA 2WANA 3S5OA 3VUSA 3PZGA 4QG9A 4W93A 4H3DA 1H2JA 1XXXA 2QDDA 2QCCA 3BQ6A 4DPPA 3FSTA 4LYPA 2VUYA 2BY0A 3EWWA 1KRAC 8XIAA 1JEZA 2R9RA 1NP2A 1RBAA 4GVGA 2Z29A 3O0FA 4ONVA 4Q3MA 4IWWA 3MVTA 3TSBA 3O16A 3BAIA 4HCHA 1V0NA 1Q6FA 3ZSSA 3M0IA 1G69A 4H01A 3ZJKA 2WHJA 1I4NA 5A8QA 6TAAA 2QGYA 2UBPC 1MEIA 4GLEA 5C7HA 2ZUUA 2Y4SA 4JTUA 4J3TA 3GD6A 5LNVA 2YA2A 1X1NA 2Y24A 3LY0A 4PRTA 4DZAA 5DXYA 2RAGA 4M82A 3KE0A 3IEBA 3WNPA 5G4EA 2XINA 2NV2A 1XGDA 1FCBA 3BLOA 2OXNA 1HP4A 2J25A 4Z2HA 3A3HA 4UQDA 1ZRQA 4H9ZA 2ZZ4A 4S3KA 2NX1A 7ENLA 4C90A 4YXGA 1K77A 5CG7A 2J78A 4ZBCA 1R8LA 2OTDA 1OEPA 1T7LA 3GKFA 4F48A 1O6IA 1GTHA 3ZQ9A 1E6RA 4GI6A 1NOFA 3UXKA 3B8SA 3P0WA 3VZYA 1XIHA 3WLQA 1EXBA 1VCGA 1W9DM 4NJHA 3ZT5A 1XYFA 3E5PA 4L1XA 3CV1A 1WYIA 2VL4A 1A5BA 5E9XA 4RPQA 1HZYA 4NAFB 1W31A 4LC8A 3WLIA 2C19A 3CU2A 5CXPA 3EB3A 3ZJ8A 1PTAA 1VFOA 4F2BA 1OIFA 3CQ0A 2EKGA 2B7PA 3SQMA 1LZOA 4QJ1A 1NFGA 1Q65A 3NQDA 1EB3A 4D71A 5A8MA 4Q8MA 5LNSA 4UQEA 1UD8A 3W7MA 2HXTA 4LBRA 3L66A 3GDBA 4CQDA 5H2ZA 1YBQA 2V63A 4KGLA 2PDUA 3M0HA 3AICA 2VYOA 1OGBA 4QX4A 3MS8A 2FHCA 1NOWA 4EXAA 1XD0A 1FRBA 1U1UA 3NAVA 1YDNA 1HF6A 4IJRA 4GH3A 2Z00A 4L9ZA 2ZRZA 4IP5A 2FJUB 3QV9A 2F2HA 2GJXA 1G7UA 1LCOA 3KP0A 3NQ7A 4XUYA 3P62A 3AXXA 1UROA 5DCEA 3LXCA 5LGXA 1E9YB 3TR2A 1QCWA 1CGTA 3A23A 4O50A 4PUEA 4HNOA 5TF0A 3PBWA 4N6FA 4JQ2A 1TZZA 1JGIA 3UXLA 5C55A 4YL2A 4Z2IA 2F6UA 2VGFA 1RVKA 3APGA 3ISIX 5AHNA 3T4CA 1NP0A 3MANA 2Y85A 3NSNA 1TJ1A 2R82A 2ZXQA 5D8ZA 1F05A 3CL8A 4LW7A 4O0QA 3ZVHB 4RK8A 2R6OA 1DXEA 3PWAA 4JCLA 4IGNA 4UTWA 5HNTA 2LLEA 3WQ8A 4Z1BA 4WY0B 4JTSA 3GWQA 1S2AA 3W76A 2ZCGA 1RJPA 2DT1A 2GZXA 2Q6ZA 3CC1A 4XTDA 2YFOA 4LAZA 4UTLA 1I2NA 3II1A 3TC7A 3M5VA 3QC0A 4DELA 1EA9C 2FFIA 1K70A 6ENLA 1RY8A 1JUBA 4ICCX 5FI8A 3NNTA 4JTGA 1B3VA 3VM7A 2CLIA 3AOFA 1FX6A 4V27A 3MU7A 1T99A 3BJTA 1FQ0A 5CPMA 4PCPA 3BWWA 1EBGA 3NQ6A 3QY6A 1QI2A 5A8PA 3PTQA 1H50A 3C6CA 1ZFJA 3TTQA 3AMCA 2Q3OA 1W1YA 3UJFA 3UWZA 2IPFA 4UTWC 1PBGA 4L64A 3GYCA 2Z2UA 1K6AA 2Z6IA 1XX1A 1OBAA 4Q4KA 2GSHA 1AH3A 2J7CA 4U10A 1X6NA 1H09A 4QGCA 4AD2A 4QCEA 1KTCA 2CPUA 3H2EA 5REQA 3SIZA 2G3MA 3N13A 3W02A 1MEWA 5C8BB 1HJXA 3A3WA 3SQSA 3MCMA 3PAOA 5I3KA 1LYXA 4DB7A 3GW3A 1OX4B 1KBIA 5HNNA 1BTMA 1IIHA 3PPCA 1TCMA 5HWNA 4Y7EA 1U1JA 3TEVA 3BAJA 3KFTA 5FEWA 2C1HA 4PFHA 1QU4A 4M1RA 5BROA 3CLMA 3ID7A 2PTZA 3SUVA 1L8PA 2ATSA 5HAOA 1JQVA 4DNMA 3N9SA 3FYPA 3HJZA 1RD5A 5CBBA 4Q4PA 5AN7A 4EF8A 1KCZA 4YCPA 3AUJA 2C1IA 1SO6A 2XPKA 4HNVA 1KLZA 4P2VA 3GHRA 1GT8A 1Y5XA 1ESWA 4QNWA 2F6KA 1K7EA 2QPUA 1V93A 4EXBA 4O4VA 4FP1A 1K9DA 4QQ3A 5DXXA 2EKCA 2XSXA 3NL2A 4XKYA 1E0TA 1DWGM 1KFLA 2XVGA 3CHCA 4Z1DA 3R89A 3W3OA 3UVIA 5LHFA 4UFKA 3OYXA 4I9JA 1E9LA 1TPFA 3M6DA 4IMDA 2ZRYA 5GJNA 4K7YA 3ARSA 1S2CA 5K9DA 4K2SA 1AA1B 4O8AA 2I9EA 3PBVA 2H8XA 3LZ5A 1LQAA 4J5NA 3OIXA 4J27A 3AJ7A 2J4GA 5D9OA 1F74A 4GINA 2PTWA 1WO2A 1UR9A 3BJSA 1H60A 4YWIA 5I3DA 3WCZA 2HJPA 2JBMA 4KW2A 4NSBA 3ES7A 4R7WA 1G67A 1S5WA 2VMFA 3EGJA 4A3YA 4JY8A 3AU6A 3HURA 8A3HA 1WDSA 1N82A 3ZR5A 3G22A 1O7AA 1GVEA 3HB9A 3BURA 3LS9A 5HPCA 1YYAA 2QULA 2QDEA 4MMWA 4XZBA 4CU6A 1DJWA 3OIHA 1OC5A 2MANA 4J2PA 3WK0A 3B8VA 3MQTA 1VEOA 2EJAA 3FKKA 8CGTA 5AHEA 1GHRA 4E0CA 2Z25A 3UG4A 1SZGA 1A47A 1E72M 1FBAA 3F2BA 1J12A 4IP4A 3LI0A 4F2TA 3R2GA 1PZ2A 3GTIA 2WMFA 4HOXA 1P0EA 3WK3A 1TPEA 1C93A 4KCUA 4DJDA 1JL8A 4PUUA 2OELA 3T6CA 1WZMA 2F61A 5FJJA 3LOTA 3L4VA 2UY2A 3PNUA 3NDZA 2EG6A 4JPGA 3IJQA 2G3NA 3TFCA 3HIJA 2YIHA 3CB3A 3EEGA 3FEQA 5FAGA 3WMSA 4CNPA 2OKOA 2ZDSA 2V82A 4NZFA 3RDKA 2YCLA 5EMJA 5AY7A 1TPH1 1VIZA 1UD2A 3V0UA 4R33A 4F40A 4FX7A 1OM0A 2X16A 2I7GA 1EGZA 3PP7A 1UKPA 3BMXA 4Q8WA 3RMEA 4IMCA 1NF0A 1RJRA 3R6IA 5AECA 4QJ3B 3N4EA 1YDVA 4J35A 3CAQA 4BKNA 3NSXA 3UP8A 1ZBVA 4R88A 2P50A 3K5XA 3W7JA 1PIGA 4LAOA 1X1OA 1UPMB 1H0GA 3LCGA 4BF7A 5C9XA 1Z89A 4DO7A 1KM3A 1XRFA 3F5KA 2D24A 3PR2A 4QSFA 3S6TA 5CC6A 3M4HA 2E5CA 4JL2A 2J9XA 1A3HA 1GGOA 5A6AA 3R7MA 1EO5A 3BLLA 5TNVA 2V2CA 4ECLA 2XIQA 1LL4A 1M7PA 3I7QA 4JYDA 1ME7A 3ALGA 3TUUA 4XD5A 1KW1A 4C6BA 1EDTA 3CHEA 3SGUA 2O92A 1F3XA 4O1EA 1W3IA 3JVAA 1DTUA 4QG6A 1SO5A 2FZDA 4YYCA 1C7TA 1LG2A 1R87A 4MNLA 1PUDA 3LRLA 4EPKA 3VIHA 3AS0A 3UWWA 4GMEA 1FCQA 1KLYA 1OCNA 2BY1A 4WR3A 1K02A 3QF0A 4J3ZA 2DJLA 2BX7A 2V38A 4D6DA 5CZSA 3SBFA 3T07A 3EOOA 3ZS4A 2DUXA 1KBKA 4DX3A 3HQOA 3EOEA 1OCQA 3V0SA 2X1SA 4AMAA 1FFQA 3A4XA 2VURA 4DQWA 4HKPA 1HP5A 1X6LA 3GFZA 1EX5A 2VCCA 1TTPA 2YCEA 1TPVA 2W9MA 4O8RA 3VE7A 2HEJA 4JHMA 3ZOAA 3BG9A 1XV8A 5E0CA 2HXUA 1DIDA 1V7YA 1UR3M 2WYSA 5BCAA 1EP2A 4PMJA 3L9CA 3TZFA 4Q4MA 4V33A 2J7GA 5JH1A 2D1ZA 2P10A 3CTLA 2GJNA 3EWBX 1FHVA 1Z32X 1JCMP 5DY3A 4AZHA 4C6OA 3QBUA 1LUCB 1GZJA 3YPIA 1HFBA 1MDLA 1XJBA 1T6MA 3NM1A 1TUFA 5CEWA 1L0PA 5CC7A 1JDDA 1F6PA 1XH1A 4H9TA 1BSIA 3VIMA 5A3HA 1PHWA 2DW6A 1EHAA 3N18A 4KWWA 3E12A 1UKSA 3TJLA 1N8FA 2NVDA 1KV8A 1EXPA 2PDKA 1PAMA 1TIMA 3SM0A 2VEKA 1K1DA 3AXKA 4P7OA 1RBOB 2WC4A 4G8TA 1V0LA 1FY6A 4R3UA 3V1HA 5H91A 1R38A 4GI9A 3EDFA 3VDAA 4PMQA 3VNYA 3NDOA 1WA3A 3QV8A 1RHCA 3MP3A 1WOBA 3O15A 4RUBA 1UWUA 2G97A 3MWAA 3SQLA 2CLLA 4F66A 4L80A 5BYWA 2QF8A 2GQ9A 2VDGA 3ORWA 3BSGA 3FKRA 3L4TA 3EB2A 2XH7A 3RCMA 1HKJA 2O56A 2Y62A 2Q3RA 1SW3A 5T26A 1BXNA 5I3IA 1S2WA 1Q63A 4ZSTA 5A69A 3LX9A 4LUYA 1GPWA 2Y7EA 2I5QA 3G1VA 1EH9A 2YDAA 4IPIA 1GQJA 1OX4A 5BOEA 1GVFA 2EJ1A 3SEPA 5AC5A 1B0IA 3H70A 3LGGA 1K4GA 5C54A 4DJDC 3A5VA 3M41A 2VFDA 2D0HA 3B8UA 3BMVA 4ADSA 3QV7A 2YB1A 4UTMA 4MB3A 3BAYA 3MUXA 3MZ2A 3ZWSA 1J9YA 3M0ZA 3R10A 5CC3A 2IKIA 3VKDA 3TROA 1SFTA 3LSBA 1DTNA 1P7TA 1XLHA 3K1DA 5K7JA 3T08A 3GSMA 4K8HA 3WBEA 1PCWA 4KEUA 3U8GA 4JIQA 1WAWA 3WNKA 3W7IA 1GOOA 3THDA 3TSMA 4A2SA 3WF0A 3APTA 5AVHA 4MDPA 3S4TA 3CUZA 3GXFA 1ZB5A 4XZIA 3FSUA 3GRIA 4J9JA 4WLCA 4XSLA 3RRAA 4D9PA 2DSWA 3LHYA 5D09A 2XN2A 1KBBA 3IIZA 1MFUA 2CXEA 3RPTA 4JBRA 1LG1A 1Y5WA 5EYWA 2PTDA 1WP6A 2ICSA 4IP7A 1DHPA 4JTAA 2C6QA 1XCWA 4WDXA 5DX7A 3QZAA 3TN4A 4FOKA 5CG0A 3MV11 2V3FA 2D2GA 4XZMX 4LQ1A 4HZ8A 1O4UA 3TWBA 1QTWA 1TQXA 4IFKB 3QMRA 4HYWA 2ZX8A 3TTOA 3FAWA 2W62A 3NGFA 4NRRA 1B3YA 2QLYA 3ZT7A 4H2HA 4P8WA 3LMYA 4PMOA 3AHVA 4AU0A 3WLTA 4UQCA 3N2XA 4ZOAA 3M07A 4C7GA 1VFHA 3RO8A 1QPKA 4GJ1A 2YB4A 4D8ZA 1GJPA 3EDEA 3DC8A 2BY3A 2J47A 1ZSXA 4ADUA 4LF2A 4JL1A 1Q2SA 1BGGA 2R91A 1CZ1A 2QV5A 4UTJA 3LCIA 4L9YA 1CPUA 5AYXA 2ZBTA 4UR8A 2E67A 3PSVA 4WY0F 5C70A 4MZ1A 3W1XA 2DZPA 4GUJA 3POCA 3R13A 3HV9A 3NFUA 1XGZA 3DOPA 4E3VA 2PE4A 1V03A 1TMHA 3RU6A 4CQBA 2V68A 1B2YA 2QPSA 2CWNA 4JICA 5K9CA 3WD4A 4R7JA 1TA3A 3PK7A 3LHZA 3WY1A 4K1GA 2FGZA 4PCNA 1XQLA 3WUEA 4GGHA 4B5SA 5AYZA 3VOHA 1OHLA 2TPSA 3IJLA 3GXTA 4W5UA 1EEPA 1ZBCA 2YCLB 4AH7A 3M64A 1DQWA 2O9OA 1TREA 4GCXA 5I2UA 2IPJA 2JGQA 1UWRA 3G0SA 1D7FA 3NQEA 2GDVA 3ZJ7A 4FX8A 2DH3A 3N2BA 3T2OA 1R3YA 4GKTA 2I57A 1TR9A 1FTXA 4OBTA 4RNFA 4OZOA 2XJ7A 3U2EA 1D8WA 3MV01 3E2VA 1QWKA 2E28A 1M53A 1IEWA 3FV9A 4FLQA 3WMBA 3U4AA 2V5CA 2DZXA 6REQA 2OQYA 5EU9A 5SWUA 1PWMA 3NG3A 5I3JA 1XYAA 4LAKA 4AXNA 3W72A 3F4WA 1E5JA 1KM1A 3RGTA 4QDMA 3ABQA 5EGRA 4TVCA 2XH2A 4Y90A 2ZA2A 2GJLA 3W28A 4AXKA 1SW7A 2PTYA 3W01A 3ARTA 4Z42C 4WXZA 5ENLA 4IIFA 4KFPA 1AQFA 4Q8NA 1PTDA 4H1ZA 3DGRA 1GKRA 1HKIA 1LBLA 1QHPA 2ZA3A 4UMBA 3TYAA 4K7VA 3MI3A 3VKCA 2OWCA 3BCFA 3A24A 2D0GA 1TV4A 3T78A 2ZTKA 4JTTA 5C5YA 2WMIB 1N55A 1SZFA 1TRIA 3DG6A 2VP8A 2FKPA 3U3HA 4DJEA 4KT2A 4YS1A 3UWQA 4LS1A 2A7RA 3LTYA 3FHAA 5LA2A 4LUTA 5EL1A 1VPQA 5I3FA 1C9WA 1R6WA 1RUSA 3E38A 3N6QA 3BGGA 1QOPA 3OOQA 5U4NA 3VI2A 3URBA 3S9IA 3PWGA 3QQ1A 3NPVA 1NELA 1QXLA 2ZZ6A 3B97A 4WVXA 3OJGA 3SGGA 4F0KA 2NT0A 3G1FA 3FA3A 2ZZ1A 4YN5A 4QISA 3ZVHA 1BF6A 2ZQ0A 3GXNA 1UD6A 1A50A 5HNUA 4B3ZA 3EKZA 3UEQA 1MXSA 2YL8A 1E9IA 2E1WA 4MB1A 4JTJA 4H2CA 2QUNA 3BLPX 3STEA 1ALDA 4XD3A 4XZLX 4ZB2A 1CNVA 4D6HA 1V0KA 1GPFA 1KRCC 3FJLA 2PWVA 3ARUA 5JXQA 1R9XA 3JS3A 4HSHA 4GNVA 4FXFA 3LLDA 3N15A 3ZLFA 3A4WA 1OG0A 3P80A 3WDQA 3AIUA 2E6YA 3G1SA 2XZ7A 4RCXA 4J7RA 3OU8A 1FVPA 2JK2A 3GXIA 1FP8A 3K4AA 3QSRA 2VX5A 3HFYA 3WNLA 4JX6A 6XIAA 4AX7A 3BLIA 1OZMA 3VDGA 4QG8A 4GIAA 2CHNA 2XM1A 3MSYA 3EXRA 1QNRA 5KMYA 3IAPA 1P5BA 1UASA 3CBWA 2IQTA 3T81A 5ABHA 1JD9A 1KGWA 4S3JA 3T8QA 1Q6DA 1PTGA 1GVYA 1YLVA 3H2AA 4QAIA 2Q8ZA 4RXGA 2V2HA 3HQ1A 1XYBA 4UTHA 3LLFA 2FB3A 1EPVA 2BNJA 4W8BA 4JYFA 4KWUA 3BAKA 3DKJA 2RH9A 1GZGA 1NWRA 3QGKC 2VDIA 3OEXA 2WAGA 2B7OA 1MFVA 4MWAB 3O07A 4DVOA 3HPXA 3TTSA 4DWDA 4HIBA 1E0VA 4EF9A 3N2MA 1M3UA 3DFTA 4Q33A 1XBZA 2Y89A 3W0KA 3LHUA 2D2OA 4JQ3A 1REQB 3WH8A 3MHGA 3GU9A 3EEZA 3R25A 3S2JA 3LLXA 3TOPA 4UNLA 4PUMA 1HJVA 3C8NA 4NNBA 4OECA 2PDGA 3T2PA 2WVVB 5HNRA 3GC4A 4AD4A 2WWDA 3PBUA 2HVNA 4WSKA 4C6CA 3RAOA 4MNKA 4QS5A 2BVWA 3CV7A 1I6NA 3BW2A 4AIUA 1GOWA 1MNZA 2EGZA 1U83A 1WXZA 3ABRA 4JKKA 2YL9A 5J5DA 4G1NA 2GOKA 1BVWA 1KFBA 4TMBA 1JZ3A 1WXYA 4GXWA 3SCWA 3MYOA 4NX0A 5D05A 3NQAA 4NASA 1SUXA 3AROA 3WMCA 2GVLA 3NCOA 4DF1A 5A1AA 4B5NA 3R8HA 4R7OA 3EDKA 1RCXB 1EJRC 2A0NA 1RK6A 4LJ3A 2X2YA 4O4WA 5F2IA 3W1TA 4ZSUA 1UUMA 3TFXA 1HTIA 5M2FX 2CETA 2X1IA 4HN4A 4IISA 1P4CA 1RZMA 8XIMA 1E55A 3R94A 5A6BA 1EIBA 3S1UA 1G5AA 1AMKA 5A6KA 2BGNE 5FL0A 3V35A 2Y63A 3W86A 5EA9A 3GVWA 2GUYA 3W38A 3SCQA 4CEUC 3A5FA 3VYLA 2QCLA 5FF2A 3HU7A 3VFCA 3KTXA 4FNRA 3L2IA 5KTLA 5T8GA 4D6CA 2PWHA 5DBUA 3EAUA 3IRSA 3UXIA 4BWLA 4HU0A 3ARWA 4GIYA 4AD0A 3CQIA 4NF7A 4MAZA 1XIMA 3A3XA 2V3GA 4LEQA 2O7SA 4CD5A 4DZ5A 2QUTA 3QPEA 1UZDA 2UWFA 4UFMA 3OLEA 1Y0EA 3SN0A 2R1LA 2GGHA 3ZO9A 1GVOA 2PGFA 4K68A 3GNPA 6REQB 2GVYA 4HA4A 1A5KC 1IQ8A 1WBJA 1J0IA 2WNWA 3OA5A 1DXFA 4EWND 2WKJA 1ADSA 4MKSA 2FPYA 1A5UA 2X05A 1JZ5A 4WRHA 4DYEA 2I14A 1LL7A 3VXGA 4UFHA 3S83A 1WZAA 3KW3A 2DZAA 5EB8A 3CUJA 3GZ3A 1Q6QA 4PGLA 3C61A 1FWHC 3HOJA 1EF3A 1XF0A 5FEXA 4FXSA 1XLLA 3I6RA 1GKQA 3RLVA 1X38A 4JR5A 1C8VA 2DFAA 4DXKA 1UKQA 1OX5A 2YXXA 1DHKA 1R2SA 2W79A 2JF6A 3R8RA 5DRCA 4HK7A 2QCDB 4JIPA 5K9XA 4FIRA 3TC3A 5A2AA 1ELSA 3C0LA 3S5SA 3PSWA 4HTBA 3RPMA 3NEVA 1VP5A 3BJFA 9CGTA 4LUIA 3D46A 1FA2A 4MY1A 2QXWA 2W63A 2B31A 3QMTA 3UA4A 3PWIA 1E9ZB 4J3UA 2QJHA 3KOYA 4BA0A 3UESA 1TFVA 1VQTA 4DJED 3QN3A 3PZMA 3H26A 1CLVA 2PF8A 2BXVA 1XFCA 4DBEA 4OKDA 4WDWA 1DIKA 3A9BA 4GBDA 3VU2A 5KINA 5C9RA 3DFOA 3G77A 1UWSA 1LOSA 2BWGA 2F38A 3D3FA 4LYRA 3ZVIA 3DU0A 5AHLA 4WKHA 2BSLA 2R1MA 1E70M 4AWEA 4DWSB 3RO6A 3T9PA 3ATYA 3LHVA 2XN1A 4WF7A 1E73M 3S46A 3GFYA 3QPZA 3VIOA 4UCGA 5HMDA 3ECQA 4K8EA 3D6NA 2QZRA 4JTEA 2VFEA 1QAPA 4M3PA 2ZXDA 2IKJA 3POHA 5HWJA 1NOUA 4MYXA 1GOXA 4YPJA 3GLCA 3KLLA 1XQKA 4EP8C 3KVKA 5LXXA 2CLKA 2Y7DA 7A3HA 2BBFA 5A95A 1UCWA 2R1KA 3URAA 1V3IA 5CJNA 1IWPA 3G3DA 1G0CA 3HGJA 4NHVA 3AS1A 5KSWA 1KFWA 3AISA 3NQMA 4REQA 2OSXA 1ISYA 4L9XA 5L9FA 2J88A 1JZ6A 5U7SA 3UXDA 1A5SA 1KM2A 1T0OA 2ANUA 3EWDA 3VTRA 1QMLA 1EYWA 2J8FA 3MJMA 4WHBA 2P8CA 4IPNB 1C92A 1VF8A 2H9AA 1CENA 3MSGA 4IIDA 3CASA 3OQ8A 1G7VA 1ZBKA 4RZBA 4UIOA 2WBKA 4ZL1A 2R14A 4JYEA 3KEHA 4GPNA 3QV6A 5BXRA 3GG0A 2CW6A 5A2CA 2VEGA 1DWHM 2CESA 2VQTA 2DORA 2DSUA 5BZAA 1F3EA 4M24A 3CGTA 3TCEA 3AHZA 1W1TA 5KEZA 4IL0A 3SDOA 4BZYA 2BP1A 3W7CA 3R58A 1UWTA 3WQ4A 2BHYA 2Q01A 3PTMA 3W1RA 1W91A 3CYVA 4WJEA 1X8CA 1RA0A 3TIMA 4C6DA 2IQ0A 1NQ6A 2C1GA 7XIMA 1ZAIA 3DZ1A 1OFRA 1M68A 2ZRXA 1E1CB 3C0JA 4E6MA 1JYNA 1RAKA 1CYGA 5EY5A 1OFDA 4X60A 3STFA 1OT2A 3OVPA 4PTWA 2CIPA 3G0XA 5D9MA 2QJMA 3LYEA 1PL9A 2J79A 2B0MA 3B4YA 3K1GA 5HA7A 5GJPA 4FNPA 4JIRA 1AW2A 3IIVA 4PE8A 4FPSA 2NUYA 5I07A 2YXGA 5LYRA 1EC8A 1QR7A 4WIWA 3NYZA 2OG9A 3B0VC 4W86A 3KAOA 1PDZA 3UYIA 2CZEA 4I6VA 3U4FA 2QCNA 1TB3A 2J74A 2C16A 1B3WA 1LORA 3PANA 3KUMA 1YXYA 1VC4A 3JR2A 1VCVA 4LB4A 2VWTA 2W4XA 1E3ZA 4KKXA 4W7VA 5HINA 3W7HA 4LS0A 1V6YA 1D3GA 3L12A 4GVHA 3UZWA 3PPHA 1XIFA 3P61A 4XIAA 1CXIA 1JR1A 1E1EA 6CGTA 3N19B 5J5RA 1JYWA 3MDWA 2OGJA 1NDWA 4EPDC 1XC4A 3CM4A 1QW8A 2Z27A 3VKAA 1PX8A 3OHIA 1NH6A 3L67A 1DORA 4D6EA 4URIA 4RW3A 4LUJA 4V1YA 3WQ5A 2PRHA 3GDTA 4NP7A 3M9YA 5DQPA 4XIMA 3ZIZA 3H2FA 4OBSA 3MKVA 3WUBA 2X41A 5HR6A 4JIIX 1YTDA 2YYTA 4GACA 4QP0A 1A53A 3S6DA 1YRRA 2WSPA 4MWAE 1YQ2A 3Q58A 4N9DA 4O15A 1NJJA 2A6LA 1FWRA 1GG0A 3W24A 2YDQA 3KWXA 4I5XA 2Z28A 4HA3A 2J77A 1MRAA 1G4TA 1Z9AA 2DZVA 3UXAA 1PVNA 3CH0A 4LRSA 3IACA 2PODA 2X42A 3WLSA 1V51A 3SECA 4RLIA 4LUSA 2PDIA 2EF9A 2CEQA 3ARZA 5A8OA 3NO1A 4HU3A 4PH6A 1FUYA 1QOXA 4LAUA 3AZRA 4PRWA 4DWSC 3AZTA 3M0KA 3KOZA 4QIUA 3DENA 5G4HC 5CC5A 1BWKA 1HJWA 1IEIA 1K9EA 2WM1A 3LERA 4S38A 1NWUA 1JRCA 1SJDA 4RZ4A 3E2SA 3WH7A 5MF5A 3AU2A 1KO0A 1JCTA 2E40A 4HU4A 1SW0A 4M7SA 2ZIDA 2DP3A 4LALA 1TZ7A 3LZ3A 4ICNA 1I9CB 1E6SM 3ZR4A 3TNOA 2Z7KA 4H6QA 1V6WA 3QC3A 3TH6A 4TX9A 4HMNA 4A4AA 1MYRA 5A6LA 2H3BA 5BNKA 1U33A 3QHOA 5AFDA 5IFPA 4R53A 1IXOA 4G5DA 3OZPA 4E8CA 3AO0A 3W1UA 1VJZA 1OYCA 3QXBA 1C29A 3VD7A 2G96A 4C1KA 1XINA 5AC6A 5AKQA 1MWOA 4N7QA 3GXMA 3SADA 2PDYA 1VFSA 4I8DA 2PLMA 1Q8JA 4N9EA 4YHEA 3KWSA 1WDQA 4OV9A 3P2VA 3MPGA 3STGA 4CGTA 4QITA 2R1NA 3LGDA 2HS8A 1GOMA 5D2WA 2JE8A 3W1MA 1Y8BA 3E0WA 2GQ3A 2C7FA 5GQBA 2NVCA 5D04C 2FPTA 3UNDA 3PPFA 3MMDA 2OYLA 4E4FA 1ZJAA 4BY3A 3GNNA 2ZUMA 4HMEA 1J4EA 1M6JA 4IPPA 3W71A 2WHMA 3JZUA 3UETA 4RDWA 1X8FA 1PPIA 2ZWZA 4PFMA 4P8VA 1H3GA 5HR7A 1ZZMA 4WSJA 2A5HA 1NTHA 3H4XA 4KCTA 3S1GA 3DX5A 3ARPA 1OGSA 3TNBA 5I06A 1YPXA 4M81A 2WM0A 1BRLA 4JCMA 4EWJA 3WK1A 5CH9A 3PF3A 3O3RA 1IXQA 1HO4A 4AW7A 3EWZA 3N2CA 3H4WA 3CUFA 3E9AA 1TSIA 4A3HA 3CZEA 3CK5A 2EPLX 3AI0A 2JKPA 4L61A 3WBWA 4A3RA 3CPRA 4J40A 4DLMA 5XIAA 3FXYA 2HSAA 1US2A 2BLEA 4LPCA 4GO8A 3VGFA 3WD3A 4ML9A 4WDUA 2DU2A 4BWLC 3UY8A 1B30A 4I9MA 4NUWA 1U5HA 2VC7A 3OLGA 5BWAA 3T05A 2E7FA 4KF1A 3CZJA 4K6AA 3GXPA 3L5MA 4JAWA 4YTQA 1G4PA 5LA0A 3UJSA 2BB0A 1CDGA 2O55A 4DN1A 1ZJHA 1FKXA 5D8WA 3BLKA 3ITTA 1WB0A 1A80A 3EDJA 1OK4A 5BRBA 4Q8TA 4Q8VA 1QHZA 4F9DA 5DMLA 5DCBA 5E5CA 4ZGYA 4BK9A 4IIHA 3UGRA 2HMCA 2VENA 4FXRA 3VO0A 1A5LC 3F5JA 4XWUA 4PMNA 4I5RA 1ODUA 2X0HA 4AZ6A 3ES8A 4KFOA 3E96A 5CBIA 3LCLA 4LS2A 4Q4SA 3IGSA 1FWTA 4ASTA 1J79A 1E51A 1HX0A 1JUKA 3AWNA 4B16A 1EC7A 2WKGA 3DH7A 1RA5A 5REQB 1V7AA 2FTYA 3JRKA 1P0KA 3QR0A 3U2CA 3CUXA 1TTQA 2V67A 4GUGA 1W17A 2JKEA 3T0TA 3SY8A 3RR1A 1IEXA 1VHNA 2DVXA 4RXFA 4ERAA 1K6WA 4XAZA 7PTDA 2QCGA 3NZPA 4NG3A 3CS2A 4UTIA 2VWSA 2AKZA 1XBYA 3A47A 3B3DA 3AIQA 4JFTA 4QHRA 4NXSA 3PULA 5IDIA 1D9EA 1F9CA 2OLAA 1CB7B 2O0TA 3TC6A 2OMAA 1V6VA 4MFDA 1X6UA 4UTTA 5E9AA 3HG4A 2I16A 1JFHA 4CCZA 4H8NA 4JEJA 5DANA 4U2ZA 2ZWYA 4AFYA 1PZ3A 3ITGA 3BCDA 3LENA 4CD8A 2Q09A 1TTIA 4NVTA 3MSRA 3PUEA 5FD0A 1PYFA 1WCGA 1RCQA 1US0A 4U33A 4MY8A 3WDIA 3AXIA 1UD5A 4IXXA 4B9YA 1XLGA 2OO0A 4LV9A 9RUBA 4TOQA 3T0CA 1EUNA 2QJNA 3SCVA 2OX1A 3KDOA 3IJ7A 3LQLA 2SFPA 2WCAA 3W73A 4TUFA 3WQPA 1ZJIA 3THAA 3NWRA 4BQ3A 2QIWA 4XTIA 3UWEA 1LROA 4J28A 4U5KA 3QRHA 3OG3A 3W27A 4M1BA 3F4VA 3UZXA 2ACRA 4F0SA 3NA8A 1AD1A 3UFYA 8RUCA 1O60A 2JIWA 1UR4A 4ACZA 2XIMA 4JFWA 1UKTA 4RJEA 1OWQA 2D3LA 2D23A 1CBGA 1ISZA 1ICPA 1DJZA 5AZ0A 3RXZA 3KBJA 2ISFA 2XM2A 4JFUA 1V6XA 4Q8UA 1A5NC 2WVVA 2WPGA 3B9EA 5LHEA 2ATMA 2ZXBA 5FIPA 3W7NA 4QE1A 2YBVA 5ABGA 2HS6A 4HMCA 1ECEA 5C2XA 4NQ1A 4WGXA 3A9IA 5HQMA 2HQAA 3W1AA 2PU1A 1EEXA 3PZOA 2EPNA 1UYQA 3WLRA 3HPAA 1OQFA 3FYYA 1DJGA 4F2UA 2E9BA 2D22A 1JPKA 3UZJA 3G8EA 3G18A 4JGDA 3VDCA 3N34A 4NAEB 1XCFA 1ODZA 1DQXA 2WCSA 4XBJA 4DXXA 4FI4A 1BLIA 4DJDD 3WZ0E 3CYJA 4I3GA 1JYXA 4HBKA 1XG4A 3IK2A 4MJ2A 3EX6A 1J11A 4ZTXA 1F76A 5CSYA 1IWAA 1VBHA 1FWJC 5LXEA 2GOUA 2HNHA 4AHQA 4UFIA 3R1ZA 5FEZA 1T41A 3MUZ1 1G4SA 4AVFA 2E1DA 4DO4A 3WK2A 2CLEA 4GYKA 4W4QA 4XZ9A 1XM3A 3PG9A 3M0VA 1GTEA 4XZHA 3BAWA 3BXWA 2EPHA 3AS3A 2CBIA 3MP4A 2O4MA 3OP2A 4PMYA 1ITCA 3EWUA 2KAUC 4CLMA 4XVEA 3GG8A 2E5DA 2VD8A 3WSUA 2CNCA 4MM1A 4ATLA 3NJ3A 1R2TA 2PTXA 3EMQA 3P67A 3BE7A 2WC3A 4X9YA 3T0DA 3GUGA 3IUHA 4IPJA 1DJYA 4A22A 4IX0A 3WBXA 4NIRA 3VD4A 4S3CA 3AHTA 1HW6A 3VNLA 1A0EA 3C3NA 5FJOA 2PEVA 2Y70A 4NZ5A 4JTHA 4EVZA 3EBVA 3XISA 4ES4A 4UZUA 1J96A 3WUFA 4XD4A 4Z2LA 1ZS2A 4XAPA 1L6FA 4F79A 1IE7C 4O18A 1NSJA 2BHUA 3IVTA 2DPEA 3EZ4A 3MWCA 3GYEA 3WLLA 1VLIA 2VTFA 2OSWA 3M47A 2D69A 3R4IA 1V3LA 4C6IA 3BOLA 3OBAA 4AC1X 3HN3A 2EBNA 3HF3A 1UH4A 1QPQA 5G1MA 2EPOA 4C5ZA 4EK7A 1DWAM 2PBGA 4NY2A 3SIMA 1UQYA 1W1VA 3S1WA 3O6YX 3DHDA 1AQ0A 4I5UA 2H90A 4IJBA 5HMSA 2AQVA 1XRTA 3WQCA 2NXIA 3FJ6A 5GVJA 3EDDA 2DZWA 1KFJA 4RDYA 2VOMA 1JXKA 4AAJA 1PWLA 4GXMA 1DXIA 3UGVA 1AUSL 4H7VA 3QQWA 3VNDA 5K4ZA 2NXHA 2NT1A 5LSMA 2V5KA 3PJXA 2YBTA 3S42A 2ZDRA 4OVXA 4UOZA 3ZMRA 1GUVA 1PXGA 1Q5MA 1WZKA 2HNEA 1XLMA 2A21A 1R30A 1CXHA 3L4XA 1AFSA 2GYIA 2ASHA 4H9VA 5AC4A 2IQDA 3N9RA 2F84A 4M6QA 3VDBA 5FSEC 1ONRA 3D5HA 5AZ1A 2XIBA 1SZEA 3S9ZA 3ATZA 3H55A 1DWJM 4E8DA 1FWBC 3O63A 3Q65A 2PRMA 3OGSA 3SJNA 3W83A 3W7DA 4XAYA 1MDRA 3DFQA 5HWMA 5AC7A 4L1WA 3UZZA 4GISA 3WF3A 2ZC1A 4IUOA 4EIVA 3TW6A 2RKXA 4C6NA 4XO7A 2C79A 1LBFA 3CMFA 2WVTA 5F1VA 3C5QA 4IQJA 2PDFA 4AWUA 2GWNA 2VM8A 2C8NA 1TRDA 2OEKA 3I3DA 2IUZA 3FVDA 3I4EA 4FMVA 4Q6XA 4LVAA 3SUWA 4PUDA 4E4UA 3ALFA 3SUTA 2GLKA 3D0CA 2I17A 1AG1O 2G41A 4N4PA 4GYPC 1EO7A 2YX0A 3EKGA 3FN9A 4GNJA 1M03A 4JDYA 1WV2A 1UB3A 3A13A 3AYVA 3OG2A 3SSJA 5DO8A 4S2BA 1LUCA 2WC7A 3WEMA 2A79A 2OOFA 4P7LA 4WX2A 1JPHA 1E4NA 5E0FA 1XDJA 2XGIA 3GTFA 3NQFA 5HBFA 2XZ9A 2NLIA 4JOMA 3AIRA 3AIVA 1VFMA 2D0FA 4JNZA 3K8LA 1E0WA 1XUUA 2GGEA 4PMVA 1B3OA 3BW3A 4C6FA 4K37A 1EGMA 1LQ2A 1WBHA 4IQEA 5LIKX 2CHOA 1KGUA 1SPQA 2NUWA 4DI9A 3UJRA 3TP4A 3W9ZA 4S3GA 3DG3A 4LYQA 5CGQA 1POKA 4HCLA 4M80A 3SRHA 4I9TA 3LM3A 1VFUA 4X61A 1QOQA 1NDZA 2Q8XA 3LTSA 4E2OA 1XYLA 3IRDA 1J18A 4W5ZA 3V1PA 5D4YA 1P7TB 1R3QA 3LNMA 2W27A 1LOQA 3EXSA 4JTCA 1W54A 3TQVA 5F2MA 3DHPA 3GY1A 1J6OA 1WKDA 1XICA 3MUAA 2PP3A 3G0UA 1FHUA 3EMCA 1WUFA 4GFSA 4EAYA 3R0UA 2V3EA 3VGEA 1UH2A 4INFA 5A8GA 2QYGA 3TV8A 1A4MA 3ARXA 2Y8UA 4X2PA 5LNUA 1EQPA 4HT3A 3BV7A 4CCDA 3MY9A 2PCEA 3BOXA 3NQBA 2NWRA 2PPGA 3MI6A 3W22A 3B04A 2JQXA 4K8GA 3O1NA 1F6KA 3N11A 1XD1A 4D6GA 2X30A 4Q4QA 4G7FA 1Z69A 2GK1A 3HMJG 1PKLA 1Q4NX 3VIPA 4XAFA 3LXAA 1RBLA 3NURA 2PDJA 2I5GA 2QNEA 4WOQA 2YBUA 4Y9MA 1TJPA 4FK9A 1CGVA 4LYKA 1V3JA 5K4XA 1PSCA 1X39A 5D32A 4QM1A 1ECQA 1QNPA 2NV1A 3WELA 5B7YA 3V18A 1B3XA 2VXNA 4PTMA 4GQRA 4YIWA 3L4YA 4UTFA 5HOSA 3QPYA 1WDPA 2NX3A 1J01A 1OFBA 2RJGA 4IX2A 3NQGA 3C86A 4MJZA 1Y7VA 1JDAA 1XSKA 3MSDA 3UCCA 3T0BA 3ITLA 3WQFA 4S3DA 3DUGA 2WQDA 3KHJA 3VD5A 2EG8A 2OGYA 1GG1A 1AW5A 2VHLA 4EX4A 4JX4A 3OBEA 3O7UA 5EMMA 3WG6A 2OZ3A 3W00A 4B4FA 1TV7A 4KWVA 2CKRA 3MT1A 3KZSA 2P88A 3AZSA 4LNYA 2Z1WA 4B90A 4GJJA 4LNCA 1TTJA 4BCEA 2TAAA 2NQJA 5A2BA 3CNYA 2CC0A 3RJYA 4B3KA 2PP1A 3WLMA 1VFTA 4H00A 3D47A 2ZRUA 3B06A 4V15A 2GDQA 3B05A 2ABBA 3EOLA 4R34A 2BHZA 2E0PA 5FCZA 1TJ0A 1UQZA 1W3KA 1B90A 4X63A 3PZTA 2J62A 1W3HA 3WDPP 3O9NA 4M7TA 3MBFA 3DBNA 1KXVA 4FXJA 2XGZA 4HN8A 2HPMA 2PB1A 5I77A 1GQNA 5BXTA 5CLWA 2WK2A 3GG7A 1EP3A 3SSZA 1UOZA 1RCOB 4PTXA 1A0CA 5HUPA 5PTDA 3BZGA 4DM2A 4HNLA 2EHHA 2QQ6A 3P8JA 4NAFA 3J7HA 4DZHA 3B9AA 1E3XA 1YKWA 2YOCA 1ZHAA 3MHUA 3UY7A 1OFPA 3TMLA 3LCFA 3HTWA 1KTNA 4QLLA 3FGCA 2CCRA 1WXJA 1SSDA 1JG9A 4W9TA 3BGJA 4DWSD 2G4FA 4M0XA 2FPVA 3DC0A 1TWSA 1YXCA 1G4EA 1EX1A 3P60A 1V0MA 3GVGA 5DELA 4YVVA 3V5FA 3GNOA 3B9OA 4WGHA 1V3KA 4W8LA 3PM6A 4N42A 3G2GA 3VNMA 2ZRWA 1YTKA 3S1VA 4OIFA 3WD0A 3GO2A 1ZBWA 3PZVA 2YFNA 1CGWA 3N4FA 3DIPA 1T96A 2PAJA 4NT0A 1HKWA 3AYRA 3PPGA 5A6JA 3DFHA 4BF5A 1WPCA 4H7ZA 3L0GA 5D30A 3MCNA 1HJUA 2X8RA 3ZFHA 3EYPA 3TYZA 1JCXA 4GVIA 3CV2A 3RN6A 2HRWA 4TX6A 3FGCB 3U2ZA 3SFKA 3MHFA 3M46A 1ME9A 3OB8A 2ISVA 5E0KA 1VD6A 1P48A 5I03A 4GBUA 4TO8A 4WSHA 1PCKA 2ZE0A