4NU7A

2.05 angstrom crystal structure of ribulose-phosphate 3-epimerase from toxoplasma gondii.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
225
structure length
225
Chain Sequence
QLKPIICPSVLASDLSSLASDAKRMVDAGCDWLHLDIMDGHFVPNISFGPGVVKALRGHLKSAFFDVHLMVSEPEKWIQPFADAGANSITFHWESVGGDLQRAAELAKRIQARGIKAGLAIKPATKFEDLGEALAGDNFDMLLVMTVEPGFGGQKFMADMLQKVRTARSLFPKLNIQVDGGLDGETVKPAASAGANVIVAGTSMFKAENPAALMTFMRDVIAASD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.05 Angstrom Crystal Structure of Ribulose-phosphate 3-epimerase from Toxoplasma gondii.
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
molecule keywords Ribulose-phosphate 3-epimerase
total genus 84
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2013-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nu7A00
1Z41A 1K7EA 1SR9A 1T96A 3HG4A 1L6YA 1BWKA 1WOBA 4FHAA 4I7WA 4LWWA 3BGJA 3PULA 3SZ8A 2DJLA 4FXSA 1VS1A 3B03A 1DOSA 2EGZA 4DF0A 3PR2A 3W88A 3W7RA 1EPXA 2PC4A 4QJ1A 4XKYB 5CZSA 1JQVA 1GEQA 1G4PA 4LV9A 1K02A 1O5XA 3UYCA 2QCDA 3MI6A 3BW3A 2GVLA 3HG2A 2V5BA 4HSNA 1QCWA 2WNZA 4KWWA 3MP3A 3QYQA 3IIPA 3GR7A 3TQ0A 2D73A 3A24A 1QDSA 2WO5A 2QDGA 3AJXA 3C8FA 2HMCA 4MVAA 2ZZ1A 3T7VA 2YDAA 3O6YX 3HMJG 3O07A 1B3OA 1W3NA 4K7VA 3O1NA 5F4SA 1IXPA 1KLZA 4JR5A 1C8VA 3TSDA 1FCVA 3IIZA 1DKWA 3R8RA 3UXDA 4XUGA 3LRMA 3W7HA 3G1HA 3GB6A 2WV8A 4ZQCA 3UZ5A 2V0TA 4CQ9A 2XFWA 5LSMA 3PUDA 5D02A 3QQ1A 2YZRA 3IEBA 3PBWA 5K3VA 4BI7A 2ATSA 1TV5A 4OU1A 1XXXA 4JTTA 2YFNA 2QJIA 5CPLA 3DFOA 3MJYA 3LHYA 4NNCA 3VE7A 3SGZA 1F7BA 2Y7EA 1ME8A 1J5TA 1G67A 5LHEA 1FCUA 2WSRA 3E12A 3IIOA 3BVJA 4L4MA 4NVTA 5A5WA 2H3BA 5MHBA 1L6WA 3TIMA 3P5ZA 4RLIA 2QCLA 2OMAA 4DO6A 2PRLA 1LCOA 1A5BA 1KFJA 1N7KA 1HG3A 3W6YA 1QO5A 4S2CA 3THQA 3ZR4A 1X7FA 2C6QA 1Y0EA 1K7FA 5DN1A 1L9WA 3LV5A 5HNRA 1F74A 4P61A 1UJPA 5DY3A 1X1ZA 3L2IA 4MZ8A 2BLEA 4YWIA 4CCEA 4NNBA 2WKJA 3QZEA 3GKAA 4FNQA 3ZFHA 1W0MA 3TMQA 3W74A 1F76A 3ABOA 3TK7A 3EWXA 1SSDA 1K8XA 3RFAA 1QO2A 2A6NA 5G2HA 3BG5A 3LTYA 2VEIA 1TPDA 1KFKA 1H5YA 1IXQA 1UUOA 4JNMA 3LX9A 1YADA 5EPDA 3GVGA 4M5PA 1H50A 4Z0JA 1KA9F 3HOJA 1G69A 3PG9A 1RR2A 5C2XA 1R2RA 3O8AA 1HUVA 1X8FA 4WD0A 2FPVA 3HPSA 4W9TA 3STEA 4EOUA 3E9AA 4BI5A 4JTHA 3KAOA 3OHIA 1ICQA 1SO3A 2V5LA 5KITA 3P80A 1GVOA 3DXIA 1SO5A 4U4MA 2V2DA 3VFLA 4O1BA 3C61A 1KTNA 3I6RA 4ICNA 1OFEA 1LBMA 1M7OA 5FF3A 4BR1A 1A53A 3FIGA 5DCBA 4HNTA 2TMDA 2C0AA 1I2OA 5AHIA 5LKYA 4NX0A 2O7QA 2B7QA 1CX9A 1S3HA 3GXPA 1LZOA 3DH7A 3CQ0A 5AYYA 5D33A 3V75A 2OT1A 2PE4A 1KM6A 2E1DA 4NXKA 2FQIA 1PHQA 3N34A 5L9FA 1SZFA 5G4EA 3JRKA 4UTJA 2EAWA 3EXTA 3LERA 4O53A 4FX6M 4MLJA 1F5ZA 4UFIA 1H61A 5K9CA 1YPIA 3E49A 2GVGA 1VJIA 3S42A 2V82A 3LDVA 5D30A 3PBVA 4JYDA 4O1CA 3QFEA 4IMFA 4JEQA 1GVRA 3NAVA 5EYWA 4OE7A 5HWNA 3OEXA 3W76A 2A7PA 1ZY9A 3G1AA 3LTSA 3RLVA 4RKAA 1TREA 4MFEA 3OVPA 1JR1A 3NQ8A 2OZ0A 1WYIA 3LXCA 3BG3A 1EWDA 1Q6RA 2R91A 1JCJA 3EWBX 3R12A 4IOTA 1W5NA 3CB8A 3D0CA 4XBSA 1JCYA 1TPWA 3W72A 4OBTA 5L6UA 1ZCOA 3GLCA 3GXNA 5A8GA 4BK9A 4Z1BA 4MYXA 4FNTA 2C16A 5K9XA 3NPWA 2E5CA 4MZYA 3FA5A 4ADTA 5FEPA 4GC4A 1SO4A 5BRBA 3KRZA 2CLMA 4UNKA 4JIPA 3L21A 4WXZA 3STFA 1XUZA 3DHDA 1S5WA 1W37A 4O0KA 1UCWA 1DQWA 3LXAA 4M6PA 4JTFA 2QCMA 3LRKA 1YDOA 3M7WA 5LHFA 4K39A 3LCGA 4KFNA 2R8WA 1AW5A 2ZZ2A 3TNOA 2E6YA 3LTPA 4OV9A 1FDZA 4DPQA 3TSBA 3G1YA 2BZNA 1TPC1 3UPBA 3WJWA 3FYPA 3GNNA 3LBCA 3NQGA 5G4WA 3Q94A 1JUKA 2AGKA 1VQTA 3W07A 1ZHAA 5IBXA 3VKJA 2TRSA 5I3KA 2PURA 1VZWA 2I14A 2Y89A 2NV1A 3UZJA 3Q37A 4CQAA 1XL9A 3DBPA 3NQMA 2V30A 2NXIA 4UFJA 3PS7A 2C1HA 5K2ZA 1KM0A 5HWMA 3CWOX 2VENA 4HPJA 4UIOA 4JXCA 3GAYA 4HNNA 5D03A 2RHGA 3CTLA 3BLEA 2Z6IA 3HIJA 1OFBA 4PCFA 5DLCA 1WX0A 5FF0A 3AO0A 1WAUA 3EX1A 5D2YA 3N2MA 4GBUA 1W31A 4DF1A 3HGRA 1KM2A 4U28A 3W7OA 4N02A 3EXSA 3NQEA 3DFQA 2JGQA 3EWUA 4QNWA 2AQWA 1W56A 2C15A 2EF9A 2FLIA 2NX1A 1TTIA 3WK0A 3GDTA 3NQCA 1GJPA 1B9BA 1BKSA 1W8SA 4IMDA 2NWRA 3W7DA 1OFQA 3W1MA 4PC8A 1KBJA 1W1ZA 3SI9A 4L4LA 5K4XA 3PB0A 2YYUA 2QUVA 2CZ5A 3W73A 4DPPA 2WSQA 2F84A 2J6XA 5HR7A 3W7NA 5IBXC 4N2YA 2DZSA 4JTUA 2GJLA 4QIUA 1ZENA 1G7UA 4WZHA 5FF4A 3QSTA 3M5XA 1TPEA 4AWUA 2Q3OA 1VRDA 1NEYA 3T55A 1YPFA 1OFDA 1R2SA 4CLMA 2YW3A 1O5KA 1LRQA 2QJHA 1YTKA 4O12A 3MW7A 3W1PA 2FB2A 1J2WA 2NWSA 4GUJA 1FUYA 2B7NA 5BMXA 3LB0A 5GVJA 3L9CA 1SW7A 4AH7A 3W87A 1VR6A 5C55A 3NO5A 3BV4A 1EWEA 1YDVA 5BMWA 3GDKA 4O50A 1W3TA 3G18A 1MEHA 1QPQA 2Q3RA 4YCPA 4K36A 4N6FA 3C2FA 2ABBA 2VKZG 3S9YA 5ABTA 1RPXA 3A22A 1AK5A 1DQXA 5LGXA 1IXOA 4QISA 5C54A 2QEZA 3W2LA 3QJAA 2QCGA 3FKKA 3WJXA 1EX5A 4OGZA 2CZFA 1MO0A 4O8RA 1K3UA 4IX0A 4WY0A 1TV8A 4AB4A 4GUGA 4N4QA 4P2VA 4LRTA 5D32A 3GDMA 3L5LA 3DHFA 4IXHA 3USBA 3S5YA 1VYSX 4Q32A 4XBKA 3P7YA 1S5TA 1Z48A 2CLKA 4X3ZA 4A2RA 3IGXA 2QCNA 3M1ZA 3W9ZA 1Z42A 3MP4A 4N9EA 3C4UA 4RK8A 1R46A 3O63A 3UPWA 3EKLA 1A5AA 2C19A 3HGJA 2DZPA 3GAKA 1PS9A 3MMTA 4LC6A 2ZRWA 1HFBA 4UTWA 5DXYA 1RD5A 1CW2A 4Y8FA 1GYNA 4QITA 3ANYA 5LZLA 2ZTJA 4RXFA 2DZTA 4JTJA 1T8XA 4ZQOA 3NZ1A 4CNOA 4LTSA 2HSAA 1KV5A 3YPIA 1H60A 2I9EA 2ZRUA 5CGQA 1R2TA 1UBSA 5G2IA 4FB7A 3SJ3A 5KMYA 3NDOA 1AMKA 1RV8A 4O0ZA 3ABRA 4JD4A 3MI2A 4LVFA 1KV8A 1GZGA 3G3MA 2R94A 4UUIA 1N55A 4HT3A 1XCFA 3H53A 4KFOA 2WJZA 5LNSA 1NSJA 1N8FA 1ZNNA 3W1XA 4JN6A 2CLLA 3FKRA 5BNKA 4UFLA 4ZQRA 2WPBA 4GFSA 1F6KA 4MKNA 4UFMA 3M9YA 2IQTA 4WJEA 1HL2A 1W54A 1DJQA 1AL7A 4R34A 2XN1A 3B0VC 3UQNA 2Z1BA 3W2NA 3QC3A 3U2OA 4QQ3A 1M7PA 3G1SA 1ME7A 1FCBA 3DZ1A 3C56A 1LOQA 2ISSA 2X16A 3GX9A 3NYZA 1LBLA 4Q4KA 2QCDB 5I3JA 1SPQA 4N9DA 1OYBA 4ORIA 3TFCA 2H8ZA 1XM3A 3QH2A 4K7YA 1O60A 3L5MA 2A2IA 4Y9AA 5KZMA 1DBTA 4O52A 1YDNA 5HWJA 1OHLA 3OA3A 4JDYA 4DO4A 2E5DA 2ZRVA 5DBTA 2FIQA 3BARA 3R5EA 4MPQA 1XBYA 1YXDA 3DKJA 1VLIA 3E02A 3LCFA 5CG7A 4XWUA 1Q6LA 2WQPA 3P82A 4FX8A 1TMHA 1U5JA 3BO9A 4E0CA 2CU0A 5DBUA 3GZ3A 1QPRA 3W75A 2YYTA 4ADUA 3W1QA 3P62A 4IMCA 3SIZA 3UXAA 5HR6A 2J27A 4RZ4A 1RQHA 3C2OA 3HF3A 1LLWA 4KWVA 2YGYA 4FEZA 3WK1A 1OYCA 2VFHA 3BK0A 3B06A 3FJ6A 2CLOA 2CLHA 4UTMA 3EXRA 3ZWTA 2W6RA 1GYLA 2Y7GA 3NXFA 5EA9A 3I7RA 2X1TA 3F1QA 2RDUA 2FFCA 3TMLA 4FNRA 3TQVA 5H91A 1EIXA 4HIBA 2DP3A 4UC5A 2VFGA 3TAKA 2RH9A 1SZNA 3LGEA 3OVQA 4HN4A 2UV8G 4WY0B 4N9BA 3R89A 3G1VA 4UTKA 2BWGA 3IV3A 3BW4A 3P67A 1JUBA 3O16A 1ADOA 2ISWA 5TQLA 4J9JA 1I2NA 3C0JA 1PL9A 1XI3A 4DBDA 3W1RA 1OFAA 3ATYA 4IPJA 4JX4A 3W7EA 4Z1AA 4GUFA 4M6VA 1O94A 4LV4A 1EEPA 1ZFJA 4E2BA 5D2WA 3DKLA 5DXXA 2VOMA 4DF2A 5K9DA 2E6AA 4YLWA 4GUIA 3CHVA 5T26A 3GIYA 3NGJA 3LCHA 1TYGA 4XTIA 2OX1A 4LVAA 5FEZA 3TSMA 2FPYA 4PFMA 2Z6JA 5AHNA 1G7VA 5J5DA 1BEUA 4O1AA 3QF0A 1DORA 3L0KA 5F1VA 2AAMA 3PG8A 2V2CA 3HB9A 1F2JA 1IF2A 1W5QA 3T78A 3NQ7A 4ZQPA 1A5SA 2YXGA 3EX4A 2V2HA 3TH6A 1HO1A 2H6RA 1S5VA 2KZHA 3HBLA 3UWWA 3QW3A 3L0NA 2BSLA 3L65A 4FIQA 4DXVA 1GVQA 1RZMA 4I7VA 3P74A 1V5XA 4FO4A 4MY9A 1XBXA 1MEWA 1FDYA 1VCGA 4O14A 1X6UA 5KZDA 5CKSA 1FBAA 1B4KA 1H1YA 3LI0A 4R53A 3E96A 4O57A 5CSSA 4DELA 3TXZA 3MHGA 2ZZ5A 4JY9A 3UWUA 4OV4A 1ZALA 4S2BA 3W7IA 4Z08A 2ZA2A 5E1QA 4O18A 2GQ8A 5E0KA 1SW3A 1JUEA 3N14A 3TKFA 4AHPA 4AWSA 1QAPA 3W7KA 3UY7A 1ZJIA 1H7OA 4TX9A 4QM1A 3UNDA 1FDJA 3C2VA 5BOOA 3C6CA 3TAOA 1FX6A 3W2MA 2J24A 2QF7A 4IMGA 3W86A 1O95A 3GYEA 5TIMA 5EMUA 4MFDA 5BW6A 3UWZA 3P8IA 4RX0A 5D09A 2NZLA 4WOQA 4MUZA 3NL2A 4NJKA 3BLFA 3G0XA 3NM1A 3W1NA 5AC8A 2VFFA 4MZ1A 1JVNA 1H63A 2J9XA 4PODA 3W1TA 1U83A 3WJSA 2VELA 1WBJA 2VFDA 4O54A 5CPOA 2ISVA 3NPVA 3C2RA 4B5NA 5FESA 5KSWA 1Q45A 5AN7A 5K7JA 3PC0A 1HTIA 4JS3A 1LRTA 1VYPX 4ZQMA 2B0MA 4MJMA 4HHPA 4MIMA 3DGRA 3T44A 4HKPA 5G1YA 1MSSA 3BG9A 4O19A 2A0NA 4C1KA 3QPYA 3HQ1A 4UMAA 3N9SA 4RR4A 1NF7A 3NL5A 1FCQA 5CSRA 5AFDA 1VCVA 4UTTA 4FIRA 1LTDA 4M19A 1WXJA 3CPRA 1YTEA 3TV8A 2XN0A 4Q33A 3PBUA 3R2GA 3GNDA 5HMSA 4D2JA 2CLIA 1EB3A 1P0NA 3TJXA 3W3OA 4A21A 4FF7A 5AHMA 2VC6A 1XKYA 3MHUA 5AHLA 1TO3A 3LCIA 4Y96A 5DELA 3TW7A 2P1FA 3PWAA 2NUYA 1LRNA 4H4IA 3DFSA 2A7RA 4RJEA 2W79A 3RU6A 4BI6A 5AHFA 4I9AA 4LW7A 3FLUA 3WK2A 2WNQA 3NZRA 4DBEA 3BLIA 5AYZA 3G0UA 1ZAHA 4OWGA 2V8ZA 4NNAA 1YTDA 3EWYA 3DFTA 1OX4A 2TPSA 3C2EA 1L2UA 1SO6A 4MY1A 1NAL1 4RXGA 5SWUA 1PCKA 2YPIA 1TQJA 4ZL1A 1ALDA 4LUJA 4DO5A 3SECA 1WBHA 3EX3A 3VNDA 3ELFA 2BTMA 3VI2A 2A5HA 1PVNA 5G2WA 3HG5A 3HPXA 1OABA 1MZHA 7TIMA 3E0IA 3LCXA 1KM5A 4TU1A 2A85A 4UFKA 3TCEA 3LM7A 4HSOA 1KTCA 2X1SA 3M41A 3NPUA 1EP1A 3L67A 4N6EA 4NXSA 4Z1CA 1QNVA 3W7QA 1LDCA 2C3ZA 3GR8A 5HUPA 1VHCA 2X1RA 3V1PA 1YXYA 3W1AA 2J9ZA 5AYXA 5G5IA 4RZ6A 2FB3A 3EWWA 2NLIA 5C5YA 1W5OA 1EUAA 4JTEA 3G1FA 3Q2DA 3S1WA 2NUXA 3LLFA 4PTNA 1PE1A 3DFNA 1G4EA 1OX4B 1I8JA 4JIQA 3L68A 5FF7A 3T40A 3ZS4A 4FNUA 4GNJA 3N3MA 4UTTC 1SSGA 5LNWA 4X22A 4O4VA 1H7NA 3CEUA 1B4EA 3CU2A 5AC6A 2JKPA 1KM4A 2CZEA 3A21A 1TRIA 3EKZA 1IXNA 3VE9A 2JKEA 3QMTA 4GUHA 1EA0A 1GQNA 5AOUA 3SW6A 2RFGA 1SW0A 4MLRA 1QPNA 4NJJA 4QSHA 1UASA 4BWLC 3NVTA 1B57A 2A21A 4TMCA 4MY8A 2DZUA 2JGYA 3O6DA 3OBKA 4H6KA 4M7TA 4JX6A 2DU2A 3QRHA 1ICSA 5C6MA 3SSJA 2Y6ZA 3PSVA 2CLEA 1SUXA 3GDLA 1KFCA 1XBZA 4IXXA 2DZXA 3A5FA 3NM3A 3O05A 3PVFA 3N19B 2H3DA 3BGGA 3U6WA 2NV2A 4WUIA 3W23A 1L6SA 4NT0A 3L0GA 3P84A 2Y61A 4AVFA 4O4WA 1OG0A 2ZA3A 3LRLA 2QAFA 5TBOA 2E6DA 3LBMA 3TC7A 1K03A 3S5ZA 5E93A 4YXGA 3ABQA 2QR6A 1TPVA 3S5OA 1F73A 4Y6GA 1OK6A 3CC1A 2E09A 4NJHA 1G4SA 5HUOA 4JTGA 2X30A 4LRSA 1K8ZA 3MHFA 3NQVA 1F05A 4LVDA 3DI0A 3H54A 3WK3A 5HULA 4IWWA 1RVGA 4OHQA 2RDWA 2ZRZA 1LBFA 4LU0A 5F2LA 3PM6A 2ZRYA 3CT7A 4PH6A 5G1TA 4YMZA 3LI1A 4MYAA 5F2GA 2ZFAA 4MJZA 3KVMA 2VXNA 3I68A 2Y70A 1P4CA 3P60A 5DCEA 3EWZA 1K7XA 1XDMA 4TMBA 4LUIA 1A5CA 2WOQA 3MYPA 1TRDA 3QMSA 3LOTA 3M5VA 3LHTA 3KOFA 3MBFA 3TX9A 2Y7DA 3VCRA 3B04A 2PRHA 5IM51 4CNPA 3LLDA 2QCCA 4XZ9A 1LYXA 3NR0A 3O6CA 5AC7A 3CIWA 3KX6A 4AHQA 5FI8A 1H7PA 1NVMA 2E5BA 5KINA 5HQEA 3W7LA 4Z0SA 1I2QA 3W7MA 2FPTA 4QNEA 3HGOA 3NQ2A 5FEWA 5CZJA 3TDFA 1VCFA 4DQWA 3HPZA 1SU5A 3W1LA 4QAIA 2E77A 1JCMP 4K8EA 3B05A 1YYAA 4RV8A 3IVTA 3Q58A 4CCDA 3IIXA 2NX9A 4GRSA 3F03K 4AAJA 1TTQA 4CNNA 4ZVJA 1R30A 1XDLA 4IUOA 2E68A 4AMAA 5D37A 4HNUA 2VEKA 1UB3A 1FY6A 3MYOA 3NQ6A 1V7YA 3SFKA 2ATMA 2GQ9A 3B8DA 4UMCA 4UTWC 3FOKA 3RNDA 3M43A 1TSIA 3S0CA 4XKYA 1A50A 2Q8ZA 3FYOA 2QUTA 4JY8A 1Z44A 1H51A 1H7XA 3W7CA 1LLZA 3LHVA 1XC4A 1X1OA 1TTJA 3DAQA 1PCWA 4TIMA 1JJKA 3TE9A 2GUUA 2FJKA 4JICA 1ZAJA 4PEKA 4E2DA 1OFRA 3M0ZA 5EBUA 1EP2A 4JDBA 5HINA 3EX6A 1I45A 4G1KA 2ZRXA 3EX2A 3QPZA 2GVJA 2VFEA 2NX3A 1UUMA 5D2VA 2Q8LA 1O4UA 2NXGA 4FXRA 2I1OA 3HJZA 5F2MA 2NXHA 5D04C 1XUUA 1TJRA 4YCOA 3NPXA 3P81A 1GWJA 1VH7A 3B0PA 3TJLA 2EHHA 1WDWA 3W22A 4ZZ9A 1FWWA 3BW2A 5I3HA 5CZTA 4AHOA 1QFEA 1AL8A 3HG3A 1GG1A 1BWLA 4O1DA 1LP6A 4XTDA 2EKCA 2QAPA 2GPTA 5I3IA 5F2IA 3T4CA 3W71A 4BWLA 1TB3A 2QDHA 4A22A 1JULA 5CPNA 1I2RA 2OT0A 4HPXA 1IGSA 4NJIA 1ICPA 4LNYA 3M47A 3UD6A 4RZ5A 4WY0F 3IVSA 2A6LA 4ONVA 3L66A 1LORA 1QR7A 3NA8A 1OF6A 1RQEA 3OVRA 3TR2A 3WJZA 3NQFA 2JBMA 1PHWA 3G8RA 5D38A 4ZMGA 2H90A 1G4TA 3ATZA 1M5WA 2A7NA 3S1XA 1LM1A 3NNTA 3C3NA 4IX2A 2Y88A 4DEFA 1XBVA 1IIHA 3NL6A 1PIIA 3OIXA 3FEMA 4LY8A 4AXKA 4JX5A 3S1UA 4NZFA 4AF0A 2ZQ0A 4LS2A 4O11A 2B7OA 4ML9A 3CLMA 1OK4A 1THFD 4N9CA 5CZ0A 2QJGA 4K38A 3KVLA 5HJLA 5U7SA 4O10A 1SFJA 1W3IA 1K8YA 2B7PA 3QW4B 4XQ6A 3LV6A 3PUOA 1FWSA 2WSYA 4NUWA 4JYFA 3GKFA 1J4EA 3N9RA 3QEZA 3IGUA 2V81A 1DJNA 5DY2A 1ME9A 4UTHA 1RQBA 1R47A 3NG3A 3STCA 5J5RA 1H62A 5F4WA 1P0KA 1QMLA 3L5AA 4IPIA 2Y85A 4NQ1A 3G1DA 3W7GA 1GTEA 1GOXA 1WV2A 4LS1A 4JGDA 4IMEA 4Y90A 1I4NA 2VEPA 3CWNA 2YSWA 3S6DA 1OF8A 2B4GA 1KTBA 1Q3NA 4OT7A 3W70A 4K6AA 3MI3A 2CW6A 2G96A 4H3DA 3PB2A 3UY8A 3C52A 4LVBA 4K37A 5I3FA 2GOUA 1EP3A 3M5YA 3QSRA 5D2XA 2GQAA 3B0UX 1VHNA 4PL1A 3IVUA 2TYSA 3FS2A 3NQDA 3UWQA 2P10A 1H7RA 3N73A 4WQ6A 2O7SA 1M6JA 5LNVA 3I7SA 3G24A 3UWYA 2ZZ3A 3NEVA 1QPOA 4UR8A 1TJPA 3PF3A 2ABAA 3A5VA 2GJNA 5AHEA 3LHZA 4WXYA 3I7QA 4OQVA 4BF9A 2QCFA 3S1VA 4A3UA 2JK2A 3FJLA 3MO7A 3TXVA 4JTSA 2ZZ4A 5CPMA 1OFOA 3RMJA 1OFPA 2ZZ6A 4KFPA 1DL3A 2TSYA 1QWGA 2CZDA 2A1YA 1KFEA 3PBYA 2DZVA 3FFSA 1NFBA 4PL2A 3S5NA 2R14A 4TO8A 2P0OA 4EVZA 3M44A 5LGZA 4KKXA 3TROA 1VYRA 4UR7A 2A4AA 1C9DA 1E51A 1I2PA 4ADSA 5H2ZA 1LOSA 6TIMA 2BX7A 4R7JA 1KFBA 1H7WA 4E38A 4JTLA 1TQXA 4AEOA 4FX7A 4YL2A 3PSWA 4LT9A 5EKYA 1VGAA 3HO8A 2ZDRA 1TIMA 1OX6A 2QKFA 2ZBTA 4NU7A 4GXMA 1VC4A 3P61A 4UTUA 3EB2A 1WQ5A 5EL1A 2G97A 2C18A 3W2KA 3O06A 1YXCA 2F7FA 5LNRA 5FF2A 3TC6A 3R13A 3INPA 3SGUA 3A23A 1PV8A 2HS8A 3IIVA 4EIVA 1W5MA 4O17A 1MXSA 3LCWA 3P5YA 2VFIA 3MP5A 2H8XA 1VPXA 3JR2A 1FQ0A 2EPHA 2W0UA 4LOCA 2ZTKA 2PCQA 2YX0A 5KZEA 4ALDA 3KRUA 4R33A 4A29A 3NQAA 1AW2A 1WOAA 1LOLA 2WNNA 1D9EA 1YLVA 4RCXA 4O28A 3TUUA 2G95A 1KBIA 5KTLA 4M7SA 3DENA 2VEMA 2J9YA 4X2RA 2X2GA 1GG0A 3WJYA 1Q6OA 3NOEA 1IIGA 4A2SA 1XFBA 3JS3A 5AB3A 1GPWA 2Y63A 5FEXA 5K4ZA 1ONRA 2X1UA 1MEIA 1DHPA 2V9DA 2E6FA 2QCHA 2ZZ7A 3CEPA 4TR9A 1HO4A 2RKXA 3QQ0A 4LC8A 3DI1A 3GK0A 1BTMA 1TPFA 4UMBA 1JCNA 3SR7A 3ABSA 3G0SA 1JQXA 5DCDA 1DV7A 1TV7A 2C13A 3M16A 5D05A 3KVJA 3P8JA 1SZGA 2CLFA 1H1ZA 1TPH1 4ORMA 1Q6QA 4FNSA 1TPB1 4EF9A 3UWVA 1QOPA 3NL3A 4AF0B 2YW4A 4JYEA 1KW1A 1DVJA 3LCLA 4UTLA 1FWTA 2Z0IA 2CWNA 1JRCA 3B4UA 1JCLA 2FDSA 4K8HA 3MBDA 1KFLA 4GJ1A 4POCA 2XN2A 5F4XA 3DFPA 1FWRA 3KVKA 2G5WA 3F4NA 3SY5A 3W84A 1CI1A 1GTHA 4EWND 4JTIA 4JTKA 3KXQA 1KM1A 4ZQNA 3RK8A 4UFHA 4LS0A 4O16A 1NF0A 1KM3A 1FXQA 1JCXA 3RLUA 3H55A 3F4WA 3STGA 1AG1O 3G3DA 3CIXA 3CM4A 1TTPA 3PAJA 1C29A 3WFAA 1VLWA 2QCEA 1TPUA 1D3HA 4IJBA 4NJGA 4IGHA 4EF8A 1FWNA 2BXVA 3TFXA 3U8GA 3K30A 3KRSA 4FNPA 4NZJA 5EY5A 2DZWA 3G1XA 2RDTA 3W7JA 4AWTA 3IRDA 5F1UA 3DU0A 4WX2A 4CCCA 3W2JA 3IGSA 3I65A 1T0OA 3G8EA 3HGSA 3W83A 3QMRA 3LXBA 2ZCGA 1SZEA 4LVGA 2Y7FA 1W5PA 2YFOA 1T99A 2Y62A 1OX5A 1GVFA 3MWAA 1TCDA 4WOZA 3TW6A 2PRMA 3PY2A 3PUEA 2YCEA 2C14A 1P1XA 3N2XA 1LROA 3W85A 4I7UA 1F6PA 2DJXA 1WA3A 3TU9A 3KHJA 3EEGA 1OYAA 4GWEA 1SQ7A 4UNLA 3OG3A 5D2TA 2HTMA 1GT8A 4BFAA 3MUXA 3RF9A 2Z2UA 4O15A 1KLYA 2NUWA 2OCZA 2HS6A 6ALDA 1AW1A 1OJXA 2JKAA 2FTPA 4O13A 4N4PA 3A9IA 2ZYFA 3W7PA 2CFFA 3W2UA 3M6YA 4GE8A 1GVSA 4C1LA 4UCGA 3ZWSA 1EUNA 3TQKA 3QM3A 4PA8A 1ML1A 1SFLA 3BPWA 4CQ8A 3G22A 3GXTA 3M5ZA 4Z1DA 4NX5A 3S8HA 1P5BA 4X9SA 1ZAIA 1OVDA 3LHWA 4S1FA 3TA6A 3KFTA 3O15A 2ZA1A 1QOQA 1JRBA 2YR1A 4IQLA 4M6QA 5U4NA 4UTIA 4HNVA 4MOZA 1G6CA 3THAA 8TIMA 2LLEA 3GDRA 2ALDA 1D3GA 2DORA 3W1UA 2OJPA 4UXDA 2J88A 5LNUA 3LHUA 5I3GA 2QUUA 1FXPA
chains in the Genus database with same CATH superfamily
1Z41A 1V6UA 3S46A 2OGJA 3SB0A 2WVSA 1T96A 4F0LA 4AMCA 1XH0A 3NDZA 2YXXA 3SFWA 1OGGA 4IT1A 2DJLA 2NQ5A 1VS1A 3B03A 1Y5WA 1DOSA 3W88A 2AMXA 4QJ1A 3BZJA 4M1RA 1HT6A 3KCLA 1G4PA 4K8GA 2QCDA 3OB8A 4V15A 2WCGA 3SGGA 1KRBC 2HE5A 1Y65A 1QCWA 1RJRA 3VDGA 5BYWA 2XZ9A 2BV9A 4KCTA 1OY0A 4KWWA 4LXFA 3QGAC 3QTGA 4RNIA 5AZ1A 1C7TA 3A24A 3KLLA 3URNA 4DXKA 4OUIA 5GJNA 3C8FA 1GKRA 3VGBA 2HMCA 3URBA 4E3VA 2PDPA 2YDAA 3O6YX 3CASA 4K7VA 3A3WA 3IUHA 1EEXA 4IPPA 4DM1A 1AH0A 4AYGA 2FZMA 4AX7A 3H70A 3UXDA 4XUGA 3LRMA 3CMFA 3D3FA 5J8LA 1J5SA 4ZQCA 2V0TA 3RO8A 1OGSA 2VHLA 4GJJA 1PZ1A 2ATSA 2G3JA 4BI7A 4OU1A 1P6BA 5CPLA 2VR2A 3NGFA 3LHYA 4HMDA 2Z25A 1OEPA 5LHEA 2Y7EA 1FCUA 4NVTA 4LAUA 1Q4NX 4RLIA 1S46A 4DAFA 1QNQA 2PRLA 1WZKA 2VUYA 3KTXA 4HMCA 1N7KA 3DG6A 4GKLA 1HG3A 3ZR4A 3UZWA 2J7BA 2IQDA 2MANA 2YL8A 3RCMA 2WLYA 2VC9A 4KMQA 1EDQA 8RUCA 2OWWA 2IS7A 2R1KA 3BCJA 4CCEA 2WSPA 4JTQA 3WYZA 2WKJA 3FSTA 4J27A 2Y8VA 4FNQA 4F0HA 3M7SA 3AS3A 4CU6A 2UWFA 2Y2WA 1HKVA 4W88A 2A6NA 3LTYA 2VEIA 3TVAA 1DWHM 1TPDA 1HL8A 3ZZ1A 3ES7A 1YNQA 2XFRA 1RBLA 1HKKA 4DZIA 4M5PA 1JPKA 1KA9F 2W67A 1PZ2A 2GJRA 1X8FA 3OYXA 4WD0A 4MJ2A 3PPFA 2HRWA 3AIVA 4QHRA 3T8LA 4H8VA 4EOUA 3E9AA 4BI5A 2XWDA 3KAOA 4HU0A 5A6MA 3DXIA 1SO5A 2C8NA 4U4MA 2QJJA 2V2DA 3DN5A 1XH2A 2O9TA 1H5VA 1ONWA 3KBSA 1RXOB 4IIHA 4UCFA 4E8CA 1LF1A 1KTNA 2J8TA 3JZUA 3CGTA 1LBMA 4MNKA 4BR1A 1A53A 4B4FA 9CGTA 4IGNA 1ECQA 4DWDA 1I2OA 2CYGA 4XD5A 5IDIA 1J8VA 2PDCA 5A69A 2PMQA 1TE1A 3J7HA 5CZKA 1AD1A 3CQ0A 4F8XA 3N18A 3RXZA 4GLEA 5HATA 3ARYA 3MSYA 1SZFA 4DJDC 4TTUA 3ONCA 2EAWA 4CNSA 1GJWA 3EWCA 1V77A 2D3LA 4MLJA 3A4AA 8CGTA 4L1WA 4UFIA 4S3DA 2GVGA 3LDVA 3PBVA 4IMFA 1GVRA 3WNOA 3OEXA 3AROA 2A7PA 2WM1A 3K1GA 3PBMA 4OIFA 1FWCC 1HJXA 4MFEA 4W89A 3LXCA 1UWUA 1Q6RA 3BAYA 3NZGA 3JZEA 1UWQA 3W72A 1JCYA 1KXQA 4XV0A 2DW6A 5L6UA 1ZCOA 3MC5A 4BK9A 4Z1BA 1EO7A 4MYXA 2C16A 2PB1A 1B31A 4OBSA 4GC4A 1SO4A 3ARUA 3PJUA 4JIPA 4WXZA 1XUZA 4L1GA 1W37A 4Z2KA 2GUYA 1ZBVA 4M6PA 4UQBA 5HA7A 2QCMA 3LRKA 4QDWA 5EMKA 1Y7VA 2ZZ2A 2E6YA 3USZA 4PMVA 2H9AB 4DPQA 5I02A 1PIGA 2BZNA 3UPBA 3H2FA 2GUBA 3PTDA 3RX2A 1K6AA 2QUNA 4H6QA 2J7DA 1XPGA 3ANVA 4RW5A 4LNCA 2PS2A 5IBXA 1DJHA 3VKJA 5M17A 3XIMA 2QV4A 5I3KA 2I14A 4IP5A 4LAOA 2X0SA 1RUSA 3BV7A 4CQAA 2RGLA 1WUFA 1JYNA 4MJ4A 3PS7A 1KM0A 5HWMA 3ZVHB 1BVNP 5D03A 4LCSA 1W3KA 2PDIA 1E6QM 1WX0A 1G1YA 2QNEA 4ZB2A 3R25A 4F9JA 1WAUA 3KE0A 3AI0A 5D2YA 3ITTA 2YA1A 3R0DA 4C6MA 5LXEA 2Q8XA 1EDTA 4U28A 4N02A 3GC4A 3RM8A 3ERPA 4J3VA 3BOLA 1UD6A 4ZXOA 2EBNA 3ZJ7A 4E4PA 1W56A 2C15A 2FLIA 1TTIA 1HJUA 5CAKA 3NQCA 1GJPA 4AD0A 4A3QA 4ZTYA 4IMDA 3GXIA 2D2GA 4PC8A 1W1ZA 2R9RA 2B81A 1XR2A 3EMCA 2YYUA 3LNMA 2OSWA 3H7RA 1EO5A 4DPPA 4GYJA 1BTCA 4KCVA 5IBXC 4N2YA 1H2JA 4YWSA 2ALRA 1XIMA 2DEPA 1CYGA 4IIFA 3M5XA 1G0CA 1TPEA 3MV01 2ZX8A 5TF0A 4AWUA 3TR9A 1CGTA 1VRDA 4S3JA 3MCOA 3AZRA 1RALA 1YPFA 3N2TA 1QI3A 1XG3A 4CLMA 2H9AA 2FH8A 4Z2GA 1LRQA 5C70A 1YTKA 3GNXA 3CV1A 4HA0A 3VPLA 4EXAA 5GVJA 1SW7A 2CITA 4JQ4A 3W87A 1TWIA 4AY1A 4ZO6A 1H0GA 3BV4A 4S23A 1YDVA 4BQ4A 1X8CA 1MEHA 2HWGA 4IF2A 4OBRA 4K36A 1B3XA 3C2FA 3S9YA 1RPXA 3VTRA 3VGFA 5C54A 4QEHA 2QCGA 3FKKA 2DV0A 3LD5A 3TN6A 4X9YA 1K3UA 5IRPA 4IX0A 2ODOA 4N4QA 4QX4A 1UBPC 4LRTA 1XYFA 3DHFA 1UROA 1UYQA 3UZXA 4Q32A 2UY5A 1S5TA 3TWBA 3TC3A 4X3ZA 4A2RA 1T6MA 1ZLPA 3M1ZA 1KCKA 3W9ZA 3C4UA 4RK8A 3O63A 3VIHA 4FLOA 3REQA 3QOKA 2C19A 1DYSA 2BG5A 2CERA 1JGIA 3GAKA 2FZNA 5DXYA 3SCNA 1RD5A 1CW2A 4K2SA 1KR1A 4OUEA 1AD4A 3WQDA 4C6QA 1OC6A 4DWSD 2ZTJA 2DZTA 4JTJA 4ZQOA 4IJRA 2WMIA 3YPIA 2ZRUA 3RPTA 4FB7A 3SJ3A 2FMOA 1GOWA 3MTWA 1YKWA 4PFHA 4JD4A 4LVFA 4FZIA 3ARQA 3GD6A 2WWDA 4PCTA 3ARRA 4KFOA 3B9NA 4KWSA 2DIJA 5BNKA 3M64A 1RA5A 1GQIA 4UFLA 1B9ZA 1TKKA 4UFMA 2PDBA 4RE0A 4JFWA 5DANA 2W9MA 4JTRA 4C60A 1UZHA 1R0MA 2PF8A 3RUBL 3OLEA 4J4KA 2HE8A 4B5TA 3QGKC 1AL7A 3WENA 5AECA 2Z1VA 4R34A 4C7GA 3QHMA 2NQZA 3UQNA 3ABXA 1H49A 1Z9AA 1M7PA 3G1SA 1ME7A 1FCBA 4NHVA 1PKMA 3WX7A 1EZWA 1LOQA 1YHTA 2A3BA 2ISSA 1LBLA 1VFSA 2GOKA 3F4DA 1LQ2A 4CNUA 4N9DA 1OYBA 4R7WA 2H8ZA 1EHAA 3AUOA 2HPIA 1KRMA 4Y9AA 4DLFA 4DI8A 3VOCA 4HVXA 4I5RA 3BARA 2OZ3A 1DJGA 3R5EA 1RCOB 2CHOA 4MPQA 5CG7A 1HN1A 3GH4A 4AU0A 3P82A 2E4TA 1GW9A 3ECQA 3GZ3A 3P93A 2EG8A 3BJSA 3LUTA 4Q4SA 3UXAA 4RZ4A 2YKKA 3HF3A 2D0GA 3W27A 1OYCA 2DUXA 3CNYA 3B06A 2CLOA 3DDMA 1E6ZA 3ZWTA 2XVKA 5A6KA 1GYLA 2ZIDA 5CBIA 3N9KA 4C1NA 2YDSA 1R3RA 2FFCA 3TMLA 1IEXA 2YCLA 4XIMA 1F3WA 2DP3A 1BHGA 2P5NA 1SZNA 4RUBA 4KH2A 4N9BA 3R89A 3G1VA 4G56A 2BWGA 3DC0A 3P67A 2ISWA 5TQLA 3JW7A 4A3RA 3EOOA 1XLHA 3BOFA 4JHMA 3EKGA 4JX4A 3W7EA 2NLYA 4LV4A 5I24A 3EA3A 3N29A 3UJEA 2E6AA 4LUSB 5G4HC 4GUIA 3CUXA 3LCHA 2OX1A 4GI9A 3OLGA 2Z6JA 1SJAA 2W5FA 3SCTA 3VNIA 5CPTA 4AVNA 3QF0A 1F3EA 3IJ7A 5F1VA 2AAMA 3SN1A 1RHCA 3HB9A 3T78A 1TJ2A 1JDEA 1MDLA 1D7KA 1HO1A 2OZTA 3GVRA 1SFTA 3QW3A 3OLIA 4FIQA 4DXVA 2X7VA 3AAMA 4I7VA 3ITLA 1FDYA 3M0LA 2FDMA 1VCGA 3MUCA 2G41A 1FBAA 1H1YA 4X61A 4O57A 4M51A 4DELA 1KKOA 3UP8A 4JHZA 4Z08A 4PMUA 3W7KA 2E25A 1UR2A 2QDEA 3VKKA 3UNDA 1WKDA 3C6CA 3TAOA 1MW0A 2PODA 1FWDC 2QF7A 1O95A 4URIA 4MADA 4HK7A 3P8IA 2P3EA 5D09A 1DQUA 4WOQA 1PTDA 3MUY1 1VFUA 1W9PA 4MZ1A 2I57A 1J18A 2A3LA 3ZT7A 3D6NA 3W1TA 1UP0A 4JEJA 1B1YA 3LSBA 3WJSA 1O68A 2ISVA 3NPVA 1Q7MA 3TEVA 2PDJA 2CESA 5FESA 4M29A 4QLJA 3EOLA 1VYPX 3WDPP 1DIDA 4MIMA 2OOFA 3T44A 1GONA 4C1KA 4AISA 4ZSUA 4UMAA 5CLTA 5AFDA 3CPRA 2XN0A 3PBUA 3URQA 2CLIA 1EB3A 3LQGA 4AY8A 5CC7A 1ZU8A 3TJXA 4A21A 5AHMA 4ZCWA 1QNRA 5AHLA 4XAYA 2Y5JA 3TW7A 1KKRA 2P1FA 3GTNA 2NUYA 3A64A 5AHFA 1V08A 4A3HA 5FSEC 2FTYA 1ZAHA 2GVYA 2YDRA 4OWGA 1T8QA 2RAGA 5E09A 1RPKA 1QBBA 2YPIA 1TQJA 4ZL1A 2R1NA 2X1IA 1A0DA 1V3KA 4DO5A 4Q8MA 3EX3A 3WSUA 2BTMA 3VI2A 2A5HA 5G2WA 1EC7A 5IHSA 3WD4A 3E0IA 3WH5A 3AYVA 4UFKA 1KTCA 2X1SA 3BH4A 4KRZA 2C3ZA 3GR8A 4MKVA 4FPSA 1CTNA 1NOFA 1VHCA 2X1RA 2D0HA 1LLOA 4IZGA 1YXYA 3EPNA 3V1PA 3W1AA 4C6OA 4DB7A 5D8ZA 1B3VA 5G5IA 2BODX 5C5YA 3Q2DA 1PE1A 1JZ4A 3ZS4A 3N4EA 2GK1B 3N11A 4DN1A 1I60A 3C0QA 4JCMA 4UTTC 3NSXA 2YBTA 5LNWA 3S6TA 2E28A 5AC6A 2NQJA 4W7VA 4Y9MA 2HVMA 3MU7A 3V16A 2JKEA 3QMTA 1QRQA 5CGMA 1RCQA 4IJCA 1F3TA 1HVXA 3M0VA 2QIIA 3CK5A 4IG2B 2DU2A 3L4WA 5C6MA 1ICSA 4LBSA 2Y6ZA 4CN4A 1FH7A 4F2TA 4BS0A 3GDLA 1REQB 1KFCA 3KL0A 1XIFA 2DZXA 4KCWA 3NM3A 4KGJA 4HHHA 4G2DA 4MPKA 1A0EA 3W23A 1UR3M 1XW8A 3W53A 2BOGX 3LRLA 1N82A 4IH3A 3S5ZA 1KR0A 2F6KA 1PB0A 2OFJA 2OX4A 3V5OA 3H4GA 3V18A 2XYLA 2VTFA 2E09A 4REQB 5HUOA 2X30A 1K8ZA 5A8QA 3MHFA 4H8HA 4LVDA 3H54A 3KOWA 4GYPA 5LXXA 3WK3A 1BF6A 1EIBA 2DW7A 2RDWA 3ITCA 1LBFA 4Q4RA 3WF1A 4GIAA 2ZX6A 5M3WA 4PH6A 5G1TA 4DZHA 3VOHA 5FJRA 2ZFAA 3GW0A 3KVMA 2O55A 4H9VA 3K8LA 3M0HA 2C0HA 3AJ7A 5DF0A 1TRDA 3M5VA 3MBFA 3TX9A 3AMCA 3LLDA 2IXUA 2QCCA 3O7UA 3O6CA 3NR0A 1M3UA 3O0FA 4MB4A 1WDSA 3CIWA 4AHQA 3BDKA 1P0BA 3F5JA 1NVMA 5ABEA 1LUCB 1XS2A 4Z0SA 5DRIA 4EAYA 3VGEA 3W7MA 4N0RA 1GZ1A 1LQAA 3VIJA 3HGOA 3BTNA 3TDFA 4ZOCA 1VCFA 3P2VA 4IP7A 3UR2A 3QY8A 3WELA 1DIEA 4EACA 3NOYA 4DO7A 1S5MA 4K8EA 1E72M 1AH4A 4RV8A 3PP7A 4CCDA 4YTRA 3IIXA 4OVXA 4F2BA 4GRSA 2G50A 4ML4A 4Q22A 3AXKA 5HMEA 4KEZA 2VEKA 1FY6A 2G3FA 1EJWC 2ATMA 3FK4A 4UMCA 3V0SA 1BG9A 3M43A 3NIYA 2CKRA 2D22A 1Z44A 5C9RA 1Q6DA 3CMGA 4JBRA 1HP4A 2NV9A 3CB3A 4EPDC 3WBEA 1UD8A 1PCWA 4TIMA 4N7QA 5LA1A 4ROPA 4PEKA 3M0ZA 2PWUA 1EP2A 5HINA 1QNSA 4BHYA 3WLKX 3DC8A 4H6EA 3QPZA 2GVJA 2Q8LA 3HQOA 4Q7NA 1KBLA 4MNJA 2DPEA 2GVEA 2W4XA 3GTHA 2NXHA 3K4AA 3NPXA 4PUMA 3U2ZA 1V4YA 1R8LA 2E3ZA 1JZ2A 2YCIX 1C91A 4O1DA 1LP6A 3U57A 5A6TC 2O56A 4BF7A 2WHLA 3CYJA 2E9LA 4I9MA 3T4CA 4BWLA 1U1UA 4J35A 1JULA 2PAJA 1XRFA 1FHVA 1ZPTA 4WY0F 1Q4WA 3ONBA 4ONVA 1YNPA 3L66A 1JZ7A 2CHRA 5H8UA 1LL6A 3I4EA 4QDPA 2X09A 1RQEA 4FK9A 3NQFA 1JL8A 2V5JA 3IJ8A 2JBMA 4ZMGA 1EJTC 1PTGA 1G4TA 3ATZA 2A7NA 4AD3A 1XBVA 2GSHA 1IIHA 1UWTA 1DXEA 1K70A 1PIIA 4LY8A 1W9VA 4AXKA 1MFVA 4NZFA 4AF0A 1KCLA 2ZQ0A 2VWSA 2GDVA 3NFUA 4O11A 4ML9A 5HPOA 3CLMA 3HQPA 2XH2A 4LYPA 5CZ0A 2QJGA 3CMJA 4PRWA 4ICCX 5HJLA 5CJNA 4PCPA 1W2VA 3B8TA 5CH9A 3VM7A 5AVNA 3PWIA 2B7PA 3UCDA 4UQ9A 4M81A 3E0WA 4EANA 7A3HA 4MWAE 4DNMA 4D72A 3C0SA 4NILA 1UP2A 2ISFA 3NUKA 2VQTA 1DJNA 5DY2A 5H8MA 1XP3A 1MQQA 4G7FA 4UTHA 4W7UA 3MUZ1 1ODUA 2WMIB 3UA4A 4ZOEA 4ZO9A 4XB3A 4KBXA 1CLVA 2NQLA 1KXTA 3STCA 4GFIA 1ZTVA 5F4WA 1P0KA 3V36A 3EYPA 3L5AA 3O6AA 4IPIA 3G1DA 1GTEA 3WKZA 3QLLA 2CXGA 4AEEA 1WV2A 1R3SA 1UPMB 1I4NA 2VX7A 3S6DA 3WQ6A 4AC7C 1DHKA 1R9XA 2G96A 4H3DA 3NZPA 4LH8A 5FD0A 2XINA 2DVUA 2EPMX 1EBGA 1OGBA 5D2XA 5JH1A 1DWIM 1EQCA 9RUBA 2P10A 2Z1XA 3N73A 2O4MA 1LWJA 4CVWA 1XSJA 4ZA0A 2R1PA 3NEVA 1AJ2A 3SQMA 1IR1A 4S39A 2HQAA 2INEA 4DYKA 2EPOA 4WXYA 4IIGA 3WDIA 4A3UA 3GG1A 2QW5A 3SEPA 1HJVA 1MYRA 4WHBA 2XG9A 4NAEA 1QWGA 2CZDA 5FSDC 5ABFA 4LPCA 2HK1A 1NFBA 5TNVA 2V38A 4PL2A 3S5NA 4TO8A 4DWSC 3BLPX 4WF7A 1NTHA 5LGZA 3KP0A 3QQWA 1VYRA 1FP8A 4L56A 1I2PA 3BL3A 5A1AA 1B5TA 5D9PA 4YTTA 1Z8AA 2BX7A 3IWPA 2Q01A 4HGXA 1H7WA 3WLLA 4YPJA 3WUFA 3KWSA 1TQXA 4AEOA 4FX7A 4TOQA 1ADSA 5FAGA 3F4VA 4GI4A 4LT9A 1TWZA 3ARSA 2D20A 1PKYA 1S39A 2ZDRA 2ZBTA 4NU7A 2QKFA 3LY0A 4WDXA 3N1AA 4AZCB 3O06A 5LNRA 4XBJA 3NJ3A 1X96A 1XRTA 3INPA 4ZGYA 1N8WA 1PV8A 5EBAA 3CLWA 3UR7A 1MXSA 5I23A 3P5YA 4X60A 5LIWX 4ZBCA 1HKWA 1VPXA 3TYUA 4NYYA 4DVOA 5MKGB 2PCQA 3A3XA 3C5QA 2YX0A 5KZEA 4Y2WA 3LPFA 4J3WA 4P5UA 3VNKA 3NQAA 3GWQA 1M03A 3M0MA 3M0YA 4DZ5A 2HZGA 2XGZA 3TUUA 4DJFD 2VEMA 3WFLA 3QZ6A 4LJ3A 3ISIX 3VAVA 2ZUUA 4C6DA 4F9DA 1IIGA 4YVPA 1XFBA 5I09A 5LIKX 5AB3A 1KC7A 1GPWA 3LGDA 1M9HA 1XLKA 3W38A 1ONRA 3WO8A 4MB3A 2OGYA 2J47A 2QCHA 1WKEA 1H4PA 1Q63A 3GK0A 4CGTA 1BTMA 1TPFA 4WJXA 2VX4A 1XISA 5DCDA 3M16A 3WBXA 1KD0A 4H9XA 4ORMA 2YLAA 4Z1YA 1AH3A 2QT3A 4FNSA 2RDXA 3UWVA 1QOPA 2GSJA 4JYEA 1KQYA 3QKZA 4IISA 2RUSA 4B9YA 4UTLA 5BZAA 4P8UA 2C7FA 3VDBA 1JRCA 4K8HA 2F61A 3DFPA 4R85A 1CI1A 1GTHA 4OJYA 5B7YA 3T0DA 1KM1A 3CUGA 4O16A 2F2KA 4NIRA 3H55A 3DERA 1JYXA 1W1PA 1XLMA 3RPDA 4GG9A 3KZPA 3PAJA 3BJFA 1J93A 1TPUA 1E6XM 2DQXA 3D5HA 2WZMA 1S1RA 4IJBA 3HA1A 4NJGA 5D8WA 3TFXA 3U8GA 3KRSA 2YL5A 4FNPA 2RDTA 3W7JA 1C8XA 1UD3A 5F1UA 3HV8A 3DU0A 4WX2A 5LYRA 3W2JA 1ITXA 4KQNA 4JN7A 4W8BA 2JEPA 3W83A 3LXBA 1W5PA 1T99A 1SYTA 1BQCA 1GVFA 3RCYA 3RMEA 3CUFA 5C0QA 3ZXWA 3PY2A 3PUEA 2YCEA 3APYA 4D1IA 1UH3A 1LROA 4CN6A 2V3EA 3VIFA 1JCTA 3VIKA 4U5KA 3U4AA 1DXIA 3AS2A 2XPKA 3RYSA 2UY3A 4D71A 2JEQA 4AZ6A 3SADA 2G3IA 5D2TA 5H6HA 4IHCA 3RF9A 2J77A 3ZLHA 3CQIA 1B3YA 1RA0A 1POJA 2GDUA 2Z28A 3VFCA 6ALDA 5BXRA 1AW1A 3AIWA 4RDYA 2FTPA 4O13A 1SR0A 1BQGA 4N4PA 3A9IA 4LUTA 2CFFA 4ZEPA 3ZWSA 1AQ0A 5A6AA 1IQ8A 4IQJA 3SCUA 3QM3A 5IFPA 1DIOA 4NX5A 1P5BA 3V4BA 3OYZA 1A4MA 3RR1A 5I2UA 8A3HA 3GFXA 2R6OA 3FGCA 1CZ1A 1JRBA 2QPXA 1BYCA 4IQLA 4HNVA 1VFOA 3THAA 4QLKA 2AL2B 1D3GA 1QW8A 5FA5A 2OJPA 5LNUA 5HANA 4AXNA 3LHUA 4PULA 4DBSA 2DT0A 2XU2A 4GIEA 5CSYA 1SR9A 1L6YA 1BWKA 3E2QA 4FHAA 3KTCA 3BGJA 3PULA 2DZBA 2PDFA 4ZXLA 1EPXA 1AJZA 1JQVA 4OFCA 3WMSA 1MWOA 4LV9A 1K02A 4G7EA 3UYCA 1Q65A 4QAWA 2YB1A 3MI6A 2FYMA 2PDUA 3VOIA 3AFBA 2Y8KA 1CLKA 1JAEA 3WQCA 3DUGA 2J7CA 5T91A 1XYCA 3MKCA 4PMJA 3MP3A 1V7AA 1P6WA 4DIAA 3VNYA 3GR7A 3TQ0A 1MQPA 3P0XA 3UYIA 3CJPA 2QDGA 3AJXA 1IV8A 5DFAA 2ZZ1A 5AC4A 4MWAB 2WSKA 4QE4A 2DVTA 3HMJG 3KCOA 2HISA 4YTSA 2YA0A 3H2NA 3A47A 1KLZA 3NURA 3PZTA 5DT5A 4MF4A 1FCVA 3PZ9A 3R8RA 2OU4A 4F79A 4DUXA 4R9XA 2WV8A 3UZ5A 3L4UA 2BB0A 4GQBA 1MNSA 3QQ1A 1MUCA 3IEBA 3PBWA 2QULA 3MJYA 4PGLA 1BPLB 5LIXX 3VE7A 3SGZA 2I5IA 1ME8A 1J5TA 1G67A 5A5WA 2H3BA 5C9XA 1L6WA 5DQPA 3P5ZA 1XC6A 2XH7A 1FP9A 5DMMA 3I6EA 2JFEX 1U1JA 3THQA 2OELA 1X7FA 2C6QA 4PTDA 1K7FA 2NQHA 2VGBA 3AOFA 5DN1A 1L9WA 4R5EA 3UZYA 3E0FA 1Q8AA 4U3CA 1F74A 4U3AA 4DJDA 3LG3A 3CZ8A 5CCZA 1UJPA 5DY3A 4J3SA 2AOSA 3AMGA 3OLDA 1D8WA 1AQHA 3VM5A 2QLYA 4NNBA 3QZEA 1SMDA 3ZFHA 3V1HA 3AIUA 1F76A 3WF2A 1CT5A 4S3GA 3RFAA 3B9EA 3RLGA 5M2FX 5G2HA 2W61A 2PDQA 2PF0A 1HZYA 4HA1A 4CD8A 3EOEA 1KFKA 1GUVA 1H5YA 4PMNA 1IXQA 4U5IA 1YADA 1R6WA 2FVLA 2TODA 3AMDA 5EPDA 4Z0JA 1H50A 3PG9A 4AIOA 1MW3A 1RR2A 1R2RA 2XGBA 2DUZA 1FWGC 4XK2A 1HUVA 5FACA 4W9TA 4GABA 3WMBA 1C3FA 4AD5A 4AVOA 1RD6A 1XYBA 3STEA 5D9NA 2DT1A 1L6GA 1VEPA 1NFGA 1ICQA 2HK0A 1SO3A 4GO9A 4ZR8A 2V5LA 2WMHA 2Y0FA 4WKHA 3WF4A 3EWDA 2GGIA 1GQLA 1OQFA 4L6OA 1UH4A 4R88A 1FA2A 1GHRA 3T08A 1FWJC 5DCBA 1SFSA 4HNTA 1HGWA 2J7FA 2C0AA 5AHIA 4C6FA 3VXGA 3FJ4A 3SUUA 1S3HA 3IJ9A 4LALA 3GXPA 3K8KA 1U2YA 3MCNA 1LZOA 1QOXA 1E5JA 3V75A 3IJIA 1KM6A 1CGUA 2W27A 2E1DA 3N34A 4PEEA 5G4EA 4GACA 3LERA 4FX6M 3RCNA 1F5ZA 5I00A 1ZSXA 4XZIA 2Z29A 3VKAA 1YPIA 3S42A 2V82A 5ECUA 2QVHA 1NIUA 3QR3A 4O1CA 4JEQA 1V79A 5EYWA 1DIKA 4A8IA 2HVNA 1ZY9A 2NQ9A 4GIYA 3LTSA 3RLVA 5LIUX 1BGGA 1KFWA 1TREA 5CQ1A 4NAEB 3OVPA 1JR1A 3B8UA 3NQ8A 3LBOA 4C65A 1EWDA 1JCJA 1I6NA 3GG7A 3GR4A 4EXBA 4IOTA 4Q6JA 3OVGA 3CB8A 1JEZA 4XBSA 4HPHA 4FNTA 3NPWA 1TWSA 4ADTA 4GI6A 2Z24A 3K4WA 5BRBA 1GQJA 3KRZA 2VNCA 4GC3A 3L21A 2OEMA 2BHUA 3DHDA 4KEMA 1S5WA 3R79A 4O0KA 1A0CA 4MAZA 4E5TA 3V3WA 1CGVA 3M7WA 5LHFA 4K39A 1TV2A 5BWFA 3V5CA 2I17A 3LTPA 3TSBA 3ZLFA 1TPC1 4DWSB 3AWOA 4DJEA 3NQGA 5G4WA 1OD0A 3WQ8A 3UVAA 4L9YA 2AGKA 1VQTA 1K4HA 1FH9A 3ZR5A 3NTYA 3R8HA 3VUPA 1XCWA 3WH6A 4H9TA 5EMMA 2D2JA 3KL3A 2V30A 2NXIA 3PANA 5HNUA 1GOOA 3CWOX 2VENA 3S1GA 4D6JA 3CBWA 3UCQA 3CTLA 3HN3A 2IKGA 1OFBA 4PCFA 3ID7A 3H7VA 1XGDA 2OODA 2BY3A 3CXOA 4DJDD 3N2MA 4GBUA 4DF1A 3HGRA 4WJ8A 4BQ2A 3NQEA 4H8UA 2JGQA 1XWYA 4D6HA 3PNZA 4JKKA 4O8AA 5EMLA 2EF9A 1F8IA 3GDTA 1E9YB 3F7JA 4WCJA 3CZKA 1BKSA 3UA3A 4Q4MA 1OFQA 1TJ1A 1E40A 4UQAA 1X1NA 3A6OA 4NAFB 1PPIA 4XZHA 1ECEA 3W73A 2WSQA 4GI8A 4FR1A 2YXOA 2WMFA 4QGCA 1DE6A 4JTUA 2Z26A 3H24A 3BZGA 2W91A 5FF4A 4WZHA 3LA4A 1H0IA 4DBWA 1RCXB 3WD1A 1QI5A 2VVSA 2VGGA 3T55A 1QNOA 1OFDA 5C9UA 3BSMA 2R82A 1ZBWA 1MW2A 2WMGA 3MW7A 4PMDA 3W1PA 2NWSA 1E6RA 1XD1A 4GPNA 1W1VA 3PBGA 3WF3A 1FUYA 3L9CA 1EWEA 2GSEA 3LPOA 3R94A 5BMWA 3URAA 2VC7A 3G18A 2Q3RA 4YCPA 4N6FA 4GQRA 3KDOA 3L12A 5KEZA 3QHNA 4NKCA 3D46A 3WLMA 1EC9A 3BLLA 3W2LA 2VGIA 3WJXA 3AWNA 2WNWA 3MT1A 1EX5A 3H23A 5EGRA 3VO0A 1MVYA 1BSLA 1DTNA 4O1EA 1M41A 3CQJA 3R1ZA 3GDMA 5IDZA 1CXEA 3VYLA 1QATA 3P7YA 1Z48A 1FOBA 3G1RA 4EPBC 5FKYA 2PGEA 4TVDA 2DSUA 4RW3A 1U22A 4E4FA 4GX9A 3UPWA 5JBDA 3QR0A 3EKLA 1A5AA 2PSNA 4XD3A 1S2CA 3TTSA 4G8TA 2FVMA 3A9BA 4GJIA 2ADAA 2VP8A 4QITA 1T8XA 1VBHA 1KV5A 2I9EA 5G2IA 4KIRA 2ACRA 5KMYA 3NDOA 3AHXA 1AMKA 1RV8A 2FGBA 3TA9A 1W9BM 4U2YA 3MI2A 2BNJA 3KBVA 1GZGA 5A8OA 2R94A 4LBUA 1Q13A 4HT3A 1XCFA 3CAWA 2JIWA 1NSJA 3W1XA 1JZ8A 2PWGA 4ZQRA 1F6KA 3M9YA 2V5CA 2IQTA 4ECLA 3AICA 4LUYA 1CXIA 1DJQA 4IIDA 3T0AA 3PZNA 1IZJA 4XAPA 2Z1BA 3S4TA 2PI6A 2B31A 3QC3A 4V1XA 3DEQA 3PNUA 4DRSA 2C79A 4A8NA 3GHTA 3SRKA 3GX9A 1NWUA 5I3JA 3IGHX 4GXWA 3AQUA 3THDA 4NAFA 1IT7A 2BY2A 3QH2A 4NZCA 3K8MA 4XZBA 1UMLA 1DBTA 2JF7A 1OHLA 3OGSA 5DBTA 2ZRVA 1FHUA 3SM0A 4GYPC 5JBFA 1Y5XA 4H41A 5A8NA 4XWUA 4JQAA 1Q6LA 2WQPA 3BCDA 4E2VA 1TMHA 5FJTA 1FWIC 3WBWA 4PZVA 1XLCA 3BO9A 1BRLA 5HOSA 4HU3A 1J0HA 2J62A 4ADUA 3FNDA 4V33A 3P62A 1AJ0A 4D8ZA 1KXVA 4B2DA 2G3NA 2I5QA 1RQHA 1BVZA 3C2OA 3D3AA 4QEEA 1E6NA 1F3XA 1TR9A 3M07A 1MXGA 3FJ6A 2CLHA 1X6NA 2W6RA 3BLDA 4M1BA 3NXFA 1XLLA 4HTYA 3F1QA 2GDQA 5I77A 4QJ4B 4HIBA 3WEOA 4Z2LA 3TAKA 2RH9A 3MO4A 3OVQA 3MB9A 2WYSA 1WP6A 5ABGA 3BW4A 3RO6A 1JUBA 1JF6A 4HA4A 1ADOA 2QMKA 1I2NA 3C0JA 4V27A 4LX4A 1PL9A 1XI3A 3KCJA 1W3HA 1OFAA 3ATYA 4IPJA 4GUFA 4M6VA 1GZJA 5IHRA 3STPA 1NFPA 1ZFJA 5D2WA 5DXXA 1M68A 4DF2A 3PTMA 2OLAA 1BYBA 7TAAA 3GIYA 3NGJA 1TYGA 3TSMA 3TTQA 1XGEA 1BEUA 3UPMA 3GNOA 1DORA 3VDAA 3L0KA 4L65A 4O1FA 4MDOA 1IF2A 3NQ7A 1A5SA 2YXGA 2V2HA 3QFWA 1R9YA 2KZHA 3VVGA 5GNZA 1GVQA 1W1A1 1VB9A 2CBVA 4FS9A 4J3UA 2P76A 4FO4A 3E1F1 1E3ZA 1XBXA 1MEWA 1IR2A 4O14A 1X6UA 2NT0A 3RDKA 3LI0A 5CSSA 4YYFA 2ZZ5A 2WVTA 3UWUA 4C6EA 4OV4A 1NP2A 3VDHA 4DJFC 4S2BA 1W6TA 1E4NA 5C2GA 5E0KA 8XIMA 2IPGA 1Z7AA 4S3BA 4P7LA 4PRTA 4HOZA 3TTYA 4RNFA 3WLIA 4IM4A 4TX9A 1WB0A 3AIQA 1FX6A 2J24A 4MFDA 3UWZA 2NZLA 1HL9A 4NJKA 1SJCA 9XIAA 3CUZA 3W1NA 5AC8A 1E1CA 1JVNA 2BY0A 5GJPA 3BE7A 2EXOA 4PODA 3QY7A 3KTSA 2VELA 2VFDA 5CPOA 1DTUA 4O54A 1R3YA 4IGMA 4B5SA 1O7AA 4XIAA 1Q8JA 3JVAA 1Q45A 4I6VA 3PC0A 3SCPA 1JD7A 3H21A 3WFZA 4O19A 3BG9A 1VEOA 1UC4A 2XIMA 4I5UA 3NL5A 5CSRA 3GU2A 3GM8A 1SZRA 4M19A 2HBXA 1A3HA 2D3NA 3H7UA 4IFKA 5HMSA 3FX4A 4D2JA 1P0NA 3BGAA 3MPGA 3W3OA 4XISA 4I9TA 2XIOA 1GOQA 4ZENA 4B3ZA 5CC3A 4JN8A 3JU2A 3BAJA 4FI4A 4Y96A 5DELA 2Y8UA 2CZVA 2A7RA 3E38A 3FLUA 3NZRA 4DBEA 1RBOB 3BLIA 5AYZA 4AZBA 4HCDA 4H7VA 4NNAA 3EWYA 1OX4A 2BDQA 3BSGA 3DGBA 1SO6A 3EA2A 3U5UA 4OKDA 1WZMA 1ALDA 3EPOA 4AW7A 4LUJA 1WBHA 4UQDA 4W84A 3TJ4A 3FAXA 1PVNA 3W0KA 1MZHA 7TIMA 1ZBKA 2A85A 3CV7A 1KXHA 3MVTA 3NPUA 3C0LA 4HJFA 1EP1A 3QY6A 4N6EA 1QNVA 3W7QA 3AYSA 4YHEA 1RY0A 1PXGA 1GKQA 1R3VA 1YX1A 2EG6A 4GIRA 3GG0A 4RZ6A 2CWXA 3WLQA 2FB3A 2PP3A 4G5DA 1W5OA 1EUAA 3G1FA 4F0SA 2PTWA 1W9XA 3S1WA 1TZZA 2PD9A 4HK6A 4JQ3A 1G4EA 4JIQA 1I8JA 4RDZA 5BXSA 4M24A 3W6MA 5KETA 2C91A 2ZUSA 4JTDA 2DH2A 4O4VA 2NVAA 1NP0A 1H7NA 3CEUA 3DHPA 2OLHA 4UZUA 3CU2A 1VKFA 1UIPA 4Z42C 2JKPA 4XVDA 2J13A 4ILSA 5FCZA 5EMYA 3Q67A 2R1LA 5CXPA 4C6KA 1GQNA 1EA0A 1EJUC 4ZO7A 4WDUA 1O12A 2RFGA 1KQZA 1SW0A 2PUZA 4QSHA 4BWLC 2X8RA 2A21A 4MY8A 2DZUA 3O6DA 3M0JA 2IW0A 4IL0A 1E1CB 3GSMA 1KO0A 4JIHA 1DJYA 3CPUA 1SUXA 4GY1A 1DJIA 1XBZA 3I3DA 4NP7A 3N19B 4QR6A 1ZJBA 2P88A 3U6WA 2CPUA 4WUIA 4PRRA 1GVEA 1J11A 5AKQA 1E9ZB 5B80A 1CNVA 3P84A 4XKMA 1BFNA 3OQ8A 3K1DA 2ZA3A 5TBOA 4NI3A 3TC7A 1K03A 1TV4A 3ARPA 4ZE5A 2GZXA 3ABQA 3AHZA 3VD3A 1OCBA 5HMDA 1KCZA 3MJMA 4Y6GA 1NARA 4QSFA 1W91A 1J6PA 1G4SA 3FA4A 4LRSA 3BICA 3A13A 3RX3A 1F05A 2RGMA 3GH5A 3VZXA 2DY3A 2ZRZA 3WCZA 3SUVA 4NRRA 4X63A 3SIMA 3BMVA 3ITGA 2VWTA 1Q6FA 4P8XA 4PB5A 3LI1A 4RV3A 4MJZA 1QASA 3VILA 4DY1A 2W66A 1LWHA 5DCEA 1VJSA 2WQDA 4PSPA 1K7XA 4TMBA 4LUIA 2WOQA 1V6WA 3MKVA 1W3JA 4LB4A 2VZVA 1UQZA 1IT8A 5A2CA 5I0DA 5BROA 5IM51 3AZSA 4XZ9A 5AC7A 4UTFA 4WKFA 3GXMA 2Z7KA 2PTDA 1I2QA 4IL2A 3C2YA 3CYVA 3WEMA 3PTKA 3GIQA 7XIMA 1JDFA 3N4FA 5HNTA 3W01A 4AD1A 3N6QA 4XAGA 1GPFA 4XUYA 4GD0A 3HPZA 9XIMA 1NJJA 4TQTA 4GZJA 1OM0A 3KL5A 4QAIA 1OD8A 4XZNX 1JCMP 1YYAA 4HNCA 3F03K 4ZVJA 1F07A 3HPAA 4HNUA 3KDNA 1E3XA 3XISA 3B8DA 3RNDA 1W17A 4XKYA 5HK4A 2BY1A 2QUTA 3GBEA 1H51A 2ZICA 4LAZA 3CS2A 3C3UA 3VK5A 3LHVA 7REQA 1XC4A 4XD4A 1EC8A 3WH7A 3FY1A 1TTJA 4DWSA 2FJKA 4JICA 1ZAJA 4RNHA 4G1KA 3P6LA 5REQB 1UUMA 5D2VA 1OADA 1DWFM 3TNBA 2NXGA 4FXRA 2BVDA 4PUWA 4U10A 2PDNA 4GISA 4ZFCA 1POKA 2VCCA 1TJRA 4YCOA 4I9JA 1VH7A 3B0PA 4AX6A 3BUVA 4CQDA 4QCEA 3W22A 3L4TA 1Q85A 1QFEA 4IGSA 2YL9A 4H01A 1BWLA 2VOTA 4K68A 2XIQA 1I75A 4XTDA 4M3PA 1K8CA 2OVLA 5F2IA 3ARVA 3G6LA 4H00A 1US0A 2RJGA 1TB3A 2AQVA 5CPNA 2OT0A 4BQ3A 4HPXA 1UZDA 3PZQA 3K2GA 3E6EA 4W87A 1ICPA 2PDWA 4BKNA 3M47A 1J01A 2BMBA 3UG4A 1LORA 1QR7A 4E8DA 4NZ5A 2V3FA 3TR2A 3WJZA 2FHCA 1YE6A 2H90A 3R11A 4BY3A 5XIAA 4PTMA 3S1XA 2G8ZA 3AMLA 3C3NA 2Z1WA 5BRPA 4ZODA 2AQOA 4DXXA 3ES8A 4JX5A 3S1UA 3CTTA 1EQPA 2WJFA 1L0PA 4LS2A 2OQLA 4PYSA 1OK4A 3OP2A 3PJXA 4N9CA 3BJTA 3RILA 1QHOA 3A4WA 4QP0A 1SFJA 1KWKA 4XQ6A 3PZVA 3GKFA 3VNLA 3RJYA 1PKLA 2ZC1A 1ME9A 1RQBA 2PTYA 1VIZA 1AQFA 1T40A 4EPKA 5JBEA 1R47A 3CT2A 3NG3A 1ITCA 1P1MA 5J5RA 2W63A 2ONEA 1QMLA 3P14A 3BAIA 4H6RA 2Y85A 2WKGA 1X6LA 1Z6KA 4JGDA 4IMEA 2PWVA 4Y90A 2PBOA 1U1HA 1I0BA 1KTBA 2ZUNA 3ZVHA 1V0KA 4K6AA 2D23A 3DYOA 1N8IA 4LVBA 4K37A 3W82A 2GOUA 1EP3A 1ZGDA 3WLSA 1BVWA 3SY1A 3B0UX 4P7RA 3UWQA 4ACZB 4WQ6A 3S6OA 3QV8A 3G24A 3I3BA 1K9TA 3UWYA 1QPOA 4UR8A 3BURA 2ABAA 3A5VA 4J3XA 3I7QA 3S1VA 3FJLA 3TXVA 4JFUA 2PTZA 1SJDA 2CETA 3WEZA 3RMJA 4C7DA 4KFPA 1DL3A 4FOJA 1NQKA 2HJPA 3MY9A 3PBYA 1VAHA 4KRTA 1FRBA 3FFSA 1UMYA 3BMXA 3M44A 4WSKA 4I3GA 3M4HA 1C9DA 1E51A 3GXDA 3E2SA 4UOJA 3WDHA 4E38A 1EXBA 4JTLA 1M04A 4LUSA 2BOFX 1TZ9A 4YL2A 1GORA 4H19A 5EKYA 4D6EA 1SVDA 1DWGM 1TIMA 1OX6A 3GHSA 3IRSA 4GXMA 1VC4A 3MSRA 2G97A 4EPEC 2C18A 3U2EA 1Q7QA 4JL1A 5FF2A 1TZ7A 2SFPA 2VDIA 1XIBA 1AZ2A 4GQ0A 3A23A 2E40A 4EIVA 3FHQA 2VFIA 1PO9A 4REQA 3MP5A 4PE8A 2H8XA 1FQ0A 1NDYA 2W0UA 4PSRA 3IJLA 2YCLB 3GNRA 4S3EA 4R33A 1BXNA 2GWGA 1WOAA 3LZ3A 2WNNA 2WJDA 1D9EA 2VI0A 4UR9A 5A6JA 1RLCL 4AZGA 3V5FA 2G95A 1ZJAA 3KRBA 3DENA 2I5GA 4CU8A 2J9YA 3V0TA 2X2GA 2D0FA 1GG0A 1LT7A 1Q6OA 4ZFMA 4GNKB 2EPKX 3JS3A 3S2MA 2FZ8A 2BXYA 5K4ZA 2X1UA 1WXZA 1MEIA 2V9DA 2E6FA 3BSHA 1BXCA 3IV8A 1EHNA 1HO4A 2RKXA 4GBDA 1B30A 3SR7A 2QMJA 3KOXA 2E9BA 1Z32X 1DV7A 1TV7A 4JNZA 4US5D 3GIPA 3KVJA 3P8JA 5AZ0A 2YDQA 1H1ZA 1TPH1 4GZ7A 4L80A 2IKHA 5LIYX 3KW3A 1JIBA 2PD5A 4ICMA 2YW4A 3ZYZA 4YTQA 2A79A 2O92A 3EDDA 3HFYA 4ZOAA 1NU5A 4E4UA 2CWNA 2FDSA 5F4XA 1WDRA 3SQLA 1QTWA 3UESA 4EWND 4JTKA 5I03A 3RK8A 2F6UA 4UFHA 3T07A 4DBUA 3T0CA 4PBEA 3H2OA 1GQKA 3A3HA 3F4WA 3STGA 1JYWA 1AG1O 3T05A 1VLWA 4Q4QA 2XZ7A 4MSSA 3H6OA 4QDMA 1KB3A 3ZOAA 3VOFA 1GYMA 4EF8A 4H1ZA 1R3TA 4NZJA 1AA1B 5EY5A 3BAWA 4AWTA 3IRDA 1FHLA 2DSVA 4Q7IA 4CCCA 3BCFA 1T0OA 3HPFA 3G8EA 3HGSA 1OCNA 1AZ1A 2ASHA 3L2MA 4Z2JA 2Y7FA 2YFOA 3GE7A 3MWAA 1TUXA 3KM8A 3UFYA 6ENLA 4PCSA 1ISYA 3N2XA 3VU2A 1ISWA 1K9FA 1F6PA 3EDEA 1UZ1A 2VC5A 2J79A 2NVDA 3UR8A 4GWEA 1SQ7A 4UNLA 3OG3A 4JKLA 1GVYA 1XX1A 4BFAA 3MUXA 4O15A 1KLYA 5DRCA 3QV7A 2HS6A 4JNYA 2X42A 4YJ5A 2BP1A 1QI2A 3SCWA 4GYKA 4FLQA 4GE8A 1PYMA 1GVSA 4XSMA 1JDCA 1NM9A 3BPWA 4CQ8A 2A3CA 3M5ZA 3S8HA 4P7NA 1XDJA 4X9SA 4GA8A 4C6LA 1OVDA 3MKKA 1XQLA 5GNXA 3KFTA 1R7OA 3WLJA 1QOQA 1LG1A 3GO2A 2YR1A 2J25A 5U4NA 4QROA 3GDRA 4DJFA 3W1UA 1IHIA 2GYIA 4UXDA 3AXXA 1XCXA 2PP0A 3UEQA 3L4XA 1K7EA 3IJDA 2VL4A 2Y5SA 2V6AA 3GVWA 4ENLA 4LWWA 3SZ8A 3WNLA 4G7EB 4UQEA 2FZDA 3PR2A 2PC4A 4XKYB 5CZSA 5E9XA 3KP1A 5C7VA 4AZHA 3BAKA 1J0KA 1E9IA 4H83A 3BW3A 1O1ZA 3WNNA 3AISA 2GVLA 3F2BA 1TV3A 3FHAA 4MWAA 1P0DA 3OBAA 4KGLA 4AIEA 1QDSA 2WO5A 4QJ5B 1V03A 1HJSA 4KEUA 4CQBA 1S2WA 3T7VA 2PGFA 3O07A 1B3OA 1W3NA 1E6SM 2ESCA 5E6YA 2KAUC 3IIZA 1VJZA 1J0ZA 3VKCA 3AXIA 3W26A 3G1HA 1US3A 4HTBA 4CQ9A 2XFWA 4AZIA 5LSMA 3KLKA 1JZ6A 5D02A 1CGYA 4GINA 3T0TA 4D8AA 2YZRA 5K3VA 2WM0A 4R7OA 1XIGA 1XXXA 2YFNA 2QJIA 3DFOA 3VC5A 3RIKA 4NNCA 3OOQA 2G4JA 1F7BA 2WSRA 3E12A 1V3LA 3BVJA 3IIOA 5MHBA 3TIMA 4LSBA 5T9BG 2Y1HA 2OQHA 1QI0A 3IK4A 3N2BA 1UR1A 3KBNA 2OMAA 4DO6A 1CCWB 1A5BA 2OTDA 1Q2SA 1QO5A 4S2CA 4C7FA 1DE5A 3GW3A 1Y0EA 4GYFA 4IQDA 1NY1A 1US2A 3LV5A 5HNRA 2DSWA 4CNTA 4IPLA 4LQ1A 1X1ZA 3L2IA 3G5EA 4YWIA 3B8WA 4A8RA 2VEFA 3GKAA 2V68A 5EB8A 1DEDA 1ZP3A 3TMQA 2PGWA 4DI9A 3AHTA 3ABOA 1NDZA 3PWGA 3RR4A 3EWXA 3FAWA 1SSDA 1K8XA 1QO2A 1LQ0A 4C6BA 1EJSC 3HM7A 4RZBA 1U5VA 4JNMA 2X0YA 1YNYA 3LX9A 2V69A 2GQ3A 1I1XA 3GVGA 3HOJA 1TR1A 4HNOA 5H8PA 1G69A 1ZJHA 3O8AA 3B40A 4J1OA 2FPVA 1MUMA 2VEGA 3UT0A 2WBGA 1HP5A 3TYZA 4JTHA 3OHIA 1ZL1A 4QXIA 1ELSA 4F3HA 4KS0A 4NSBA 1RK5A 1OFEA 1M7OA 3AIEA 4DJEC 3HV9A 2RJHA 2V5KA 3LYEA 2TMDA 1UHVA 2O9RA 4XG1A 3AZTA 1BSIA 2P3ZA 4NX0A 3MV11 2B7QA 5HQLA 1TJ0A 3R43A 1NWTA 3WLNA 3DH7A 5AYYA 5D33A 4GK8A 3U4FA 4NXKA 1J0IA 4P8WA 1PHQA 4M80A 4UZSA 5L9FA 4UTJA 1V6YA 4UOZA 3W29A 1K77A 1PSCA 2A3EA 4AD4A 2CIPA 3AHYA 5F7UA 2EPLX 2WKLA 3H26A 3QFEA 1CGWA 2X41A 2ZXDA 3VMPA 2GGHA 3VCCA 4RKAA 1HKJA 4XX6A 2OZ0A 1WYIA 1B54A 4PMXA 4IPNB 2R91A 3W24A 1F4HA 1D7FA 3IPWA 3RRAA 1EXPA 1XLFA 4AIUA 1JGMA 1XLAA 4OBTA 2V63A 5ECVA 1IWAA 1X39A 3GLCA 2PEVA 2CNCA 4S3AA 1XSIA 1OB0A 2PDXA 1EH9A 2E5CA 3FA5A 3ZR6A 4UNKA 3S3GA 3SCOA 1Z3NA 3STFA 1UCWA 3LXAA 1XH1A 2POTA 1H11A 3AALA 4U2ZA 4WSHA 1YDOA 4KFNA 3LCGA 2HROA 1AW5A 3QV6A 4H2CA 4CD6A 1XSKA 3GNNA 4TUFA 4QCFA 1QBAA 3LBCA 1C9WA 3CZGA 1UIOA 3QLDA 1JUKA 2PP1A 3W07A 2XH0A 3LSCA 7PTDA 2NT1A 5FJUA 2TRSA 3B8SA 3VGGA 2Y89A 2NV1A 3UZJA 1J96A 3IANA 4J40A 1M7JA 4F40A 4TVUA 3GFYA 3EMZA 1XL9A 3DBPA 3WQWA 3OO2A 4UFJA 3MUAA 5K2ZA 2C1HA 1JYVA 2WZHA 4Y7EA 4HPJA 4UIOA 2E7FA 2WZTA 2RHGA 5ABHA 4JIIX 3BLEA 3LMYA 1GOIA 1XG4A 2Z6IA 3NZQA 5AYBA 5HQMA 1W9UA 1IT0A 2VDGA 3W37A 1W31A 5HJXA 2A3AA 4UQCA 3LGGA 3W7OA 5FJOA 2QQ6A 3S9ZA 5C9ZA 4IQEA 2BVWA 2Z2AA 3TYDA 4PTVA 3ITYA 3K4DA 5PTDA 2PWFA 1B9BA 4PBFA 4LYRA 4J3ZA 1W8SA 2NWRA 3W1MA 3SI9A 2QUVA 1E73M 1LG2A 2AL1A 4YU1A 5CPSA 2GLKA 3SRFA 3CV2A 4Z2IA 2J6XA 3LNPA 2DZSA 2GJLA 2WVVA 3AMKA 4UBPC 1CXLA 4QIUA 1MW1A 1G7UA 3QSTA 4J2PA 1KBKA 3GTXA 1E0VA 4A8LA 3B8IA 2Q3OA 2Q02A 2QJNA 4RDVA 1NEYA 4H2HA 4ATLA 1R2SA 4H7ZA 4ZSTA 3QR1A 1O5KA 1E4MM 1GHSA 4IMAA 2QJHA 2D24A 4O12A 5JU6A 4WDTA 3U0HA 1J2WA 2O9OA 4WR3A 2J4GA 4HB7A 4GH1A 5BMXA 1UR4A 1H41A 1FWBC 1VR6A 4JL2A 5C55A 5FJJA 5AVHA 3Q45A 4WGXA 5CJ5A 1RK6A 4AIBA 4O50A 4HSHA 4XZWA 1TELA 3V35A 2ZUVA 4Q4OA 3SCQA 4CU7A 2GJPA 4GH3A 5EFFA 4Q8NA 1H09A 4HK5A 4IICA 1IXOA 1E55A 1QXLA 4HMEA 1XQKA 4QISA 1E15A 3QJAA 2HEJA 2CZFA 4Y9PA 1MO0A 2UY2A 4WY0A 2XVLA 5D4YA 1TV8A 4AB4A 1EL3A 4HCHA 4ES4A 1JPDX 3S5YA 3UW6A 1XLGA 3MMUA 1KGXA 4L1XA 4R27A 3ENLA 4ZOBA 3TN5A 1GGOA 3IGXA 1Z42A 3MP4A 4N9EA 4FXJA 3MSDA 1R46A 3ANUA 1YRRA 1Q6EA 1V3MA 5DO8A 3DHUA 1EF2A 2DZPA 1PS9A 4LC6A 1YBQA 1HFBA 5CAHA 4S3FA 1GYNA 2WVUA 3R6IA 5LZLA 4RXFA 4DJED 1TA3B 3G77A 3SN0A 1H60A 5CGQA 2WAGA 3CZJA 4XZMX 4HU8A 4O0ZA 3ABRA 3O3RA 3G3MA 5MKGA 3CHCA 4LF1A 3OG2A 2WJZA 5AC5A 5LNSA 1ZNNA 1N8FA 3R8GA 4JN6A 2CLLA 1T5AA 3TYEA 4GFSA 7CGTA 3BXWA 4GY0A 4WJEA 3NDYA 1HL2A 2GWNA 2I16A 4WRHA 2VZOA 4Q8VA 3BANA 1V93A 4UWMA 4AD2A 4ZTXA 1ENUA 3U2OA 4F0RA 2E8ZA 1XRSA 3EGJA 3WH9A 2FZBA 3FYYA 3ZO9A 3NYZA 2V3GA 1PJ9A 2YJQA 4TTGA 4PUUA 3B8VA 4HHMA 1J6OA 1O60A 1IEWA 2A2IA 3L5MA 4GX8A 5KZMA 1YDNA 3EB4A 5HWJA 2P50A 3DESA 3OA3A 4JDYA 2E5DA 3EBVA 4HD5A 1J0YA 5FIPA 1XBYA 1YXDA 3DKJA 3E02A 3UNTA 3GTFA 4JPGA 4FX8A 6PTDA 1YDYA 3TYCA 4E0CA 1VF8A 2CU0A 5CJMA 4JFVA 4HNLA 2IKIA 5I07A 2PLCA 3EAUA 5HR6A 3F4CA 3I6TA 2ZUTA 3G6MA 1P7TB 4L4OA 1LLWA 4AG0A 1C7SA 4KWVA 3VMNA 2YGYA 3UGVA 4FEZA 3SAZA 3B9DA 3WK1A 3VC6A 3BK0A 3OU8A 1VFMA 3EXRA 2J7GA 3W4RA 1ZBCA 2X1TA 2RDUA 2BGSA 4FNRA 4B90A 3TQVA 5H91A 4GY7A 3MZNA 1MRAA 4UC5A 1BGAA 2WLZA 4HN4A 1KWGA 3WBAA 2UV8G 1XPYA 3V7PA 3EMQA 3VGDA 1CWYA 3D47A 4RL3A 3QKEA 4HZ6A 4YVXA 3BAXA 3T9PA 4W85A 4A05A 3VOJA 1EOMA 1DPMA 2FKPA 3MANA 3VMOA 3F5LA 1EEPA 4GCAA 4JIEA 1VPQA 2VOMA 5K9DA 2VR5A 1YQ2A 3CHVA 2JQXA 3ALGA 2OSYA 1ZS2A 1E4LA 1PX3A 2CC0A 4PFMA 5J5DA 3PZUA 4LGXA 1ZCCA 4BZYA 3UJFA 3PG8A 2V2CA 1YBQB 4LUTB 1F2JA 1W5QA 3L23A 2WW5A 2Z00A 4E8GA 4ZQPA 4EX4A 3EDKA 3EX4A 5ENLA 5M1TA 2H6RA 1VFHA 1UUQA 1S5VA 4LANA 3E74A 2BSLA 1W9DM 3L0NA 3L65A 4KERA 1V5XA 1JZ3A 4MY9A 3TLQA 1F8MA 1QHPA 1AMYA 2J6VA 2VD9A 3DFHA 2WHMA 3T2OA 5CKSA 1B4KA 4R53A 3TXZA 3MHGA 1EZ2A 4J5NA 3C86A 1ZALA 4HP5A 3WY1A 3SY8A 4M6UA 1GVIA 3W7IA 4HMNA 2ZA2A 5E1QA 1BRLB 4O18A 3SRHA 3N14A 3TKFA 2J66A 2JIEA 1H7OA 3UVIA 1OT1A 1EOKA 1FDJA 3C2VA 5BOOA 3W2MA 3VIPA 4IMGA 3ZSTA 3GYEA 3OGRA 5BW6A 3EDFA 3NL2A 3BLFA 2V3DA 3FSUA 3NM1A 2VFFA 4HN8A 1QPKA 2QUMA 4B9ZA 2OXNA 1H63A 2XM1A 3PZOA 1VP5A 4CKQA 2J9XA 2OLSA 1U83A 2DGAA 2XH4A 4OOZA 1WBJA 4I90A 1C8QA 5BXPA 1HF6A 2CXEA 2OZ8A 1B0IA 4R9OA 4B5NA