4NU7A

2.05 angstrom crystal structure of ribulose-phosphate 3-epimerase from toxoplasma gondii.
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
225
structure length
225
Chain Sequence
QLKPIICPSVLASDLSSLASDAKRMVDAGCDWLHLDIMDGHFVPNISFGPGVVKALRGHLKSAFFDVHLMVSEPEKWIQPFADAGANSITFHWESVGGDLQRAAELAKRIQARGIKAGLAIKPATKFEDLGEALAGDNFDMLLVMTVEPGFGGQKFMADMLQKVRTARSLFPKLNIQVDGGLDGETVKPAASAGANVIVAGTSMFKAENPAALMTFMRDVIAASD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribulose-phosphate 3-epimerase
publication title 2.05 Angstrom Crystal Structure of Ribulose-phosphate 3-epimerase from Toxoplasma gondii.
rcsb
source organism Toxoplasma gondii
molecule tags Isomerase
total genus 84
structure length 225
sequence length 225
chains with identical sequence B, C, D
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2013-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4nu7A00
2X16A 1I2PA 4LV4A 5G1YA 4JYEA 1ZAHA 3FYOA 3CWOX 3SFKA 2WQPA 4HNTA 3IGXA 4XTDA 3I7SA 3TFXA 1WXJA 3W7CA 5KZMA 3TH6A 3QZEA 1R2RA 4IOTA 4O4WA 3W7DA 4K6AA 1SR9A 3QMSA 1QCWA 3PR2A 3WJZA 4FO4A 2A0NA 3S1XA 3DXIA 3WK3A 1LDCA 2GQAA 3BGJA 4ZZ9A 4MY1A 3SR7A 4UFIA 4O4VA 4CNOA 3FJLA 4UTTA 2WO5A 3CQ0A 3CPRA 5F4SA 4LV9A 1QPOA 2NX3A 2QDHA 4MUZA 4O1AA 3SSJA 4Y96A 1YDOA 3F4WA 1O60A 4JTUA 5J5DA 3W1LA 4CQAA 3G1XA 1AK5A 3I7RA 5LGZA 2W79A 3NQDA 4I7UA 3LLDA 1UUMA 2QDGA 2NV1A 2V82A 1R2TA 2GJNA 3IIPA 4FF7A 5U4NA 3FKKA 2A4AA 4WY0F 1G4PA 2J24A 3TKFA 5E93A 1H5YA 3GIYA 4UXDA 4JX5A 3S1VA 1B4EA 4O1DA 4HIBA 2O7QA 3NM1A 3SGZA 4ADTA 4FB7A 3VCRA 4Q33A 3LHZA 1XUZA 2DZSA 3W07A 4Z08A 4DBDA 1SU5A 3LB0A 3QSRA 2H8ZA 2J88A 2CLLA 4KWWA 4N6EA 5AC6A 1TPUA 2HS8A 1ONRA 5G4EA 1E51A 4TO8A 1KV5A 3TX9A 3JRKA 3MBFA 4MKNA 5K7JA 1PVNA 3NEVA 2A2IA 3UWWA 4K37A 1KTNA 1O5KA 5C2XA 4NNAA 2Y7FA 1ALDA 3BW3A 1MSSA 3RLVA 4JTSA 2A1YA 1FDJA 1P1XA 3P82A 4FIRA 3TJLA 5FEZA 3Q2DA 4UFMA 4UCGA 5CZTA 1R47A 3MYOA 1SZFA 1GEQA 1A5BA 3M7WA 1FXQA 1U83A 1OVDA 3LRKA 1FX6A 1X7FA 4XBKA 1F74A 1O95A 3TE9A 4IPIA 4UR8A 4GJ1A 1JUKA 4JYDA 2B7QA 4POCA 3W83A 1PCKA 1LOSA 1QNVA 4DELA 2ZZ1A 4H6KA 1TV7A 3TXVA 5FF3A 4NZFA 1RZMA 4UTMA 3ZS4A 1YPFA 4QQ3A 4I7VA 4KFPA 3W7MA 4RX0A 3L21A 3LI1A 3TIMA 3LTPA 3MYPA 4CQ8A 3ATZA 4QNWA 3PF3A 1AW1A 1FY6A 5F4XA 1XM3A 1A5AA 1X1OA 1TB3A 3FLUA 2P0OA 3W7IA 1ZENA 4ORIA 4UTHA 4O18A 3NA8A 5LNSA 3CB8A 5E1QA 3R8RA 3HG5A 3G1YA 4N2YA 3P7YA 3USBA 1Y0EA 2J9YA 2NWRA 3UWQA 1VHCA 3HG3A 4E2DA 3QF0A 5AHMA 1W3NA 5EL1A 2Y88A 4UTIA 1T8XA 4JDYA 3HIJA 5ABTA 1VHNA 3QMRA 1W8SA 3MI3A 4C1KA 4DPQA 1VGAA 2DZUA 1RD5A 3SY5A 4L4MA 2YXGA 5HINA 1TV8A 2C13A 2RKXA 1FCQA 5DN1A 3S6DA 2OT1A 3IV3A 1JVNA 5I3KA 3L0KA 1VPXA 4AF0B 1JUBA 4AHQA 3B04A 4JTJA 3W9ZA 1P4CA 3P5ZA 4UTKA 2G97A 2PRLA 5AFDA 3L9CA 3LX9A 4OBTA 3LHUA 2Q3OA 4M5PA 1KW1A 3QC3A 4UTTC 3GXPA 4JX4A 2QJIA 4CCDA 1DHPA 2DJLA 1S3HA 5K4ZA 2YX0A 1G7VA 3BLEA 4MY8A 3RMJA 1SFJA 1NF7A 1ME8A 1XBXA 2TYSA 1D9EA 2J6XA 5FF7A 4X2RA 1Z44A 1FXPA 3BARA 1SSGA 2ISWA 2YSWA 5KTLA 2AQWA 4U28A 2VC6A 1V5XA 1KV8A 4OV9A 3T44A 3TW6A 3C2EA 3MP4A 1Z48A 2H3BA 4NX0A 1KM3A 4MZ1A 3NG3A 4UTWA 3GDTA 1M7PA 3W2LA 2GQ9A 4MY9A 4OQVA 2Z1BA 4FX7A 3MWAA 3GYEA 1SQ7A 1I2RA 2A5HA 3EWBX 3THQA 5D2XA 1VS1A 3E12A 3TR2A 2PE4A 1A53A 5C6MA 4WUIA 3NDOA 1SO6A 2A85A 4MFEA 4PH6A 1GVQA 2ALDA 2QF7A 3UZ5A 2FFCA 4JTGA 1CW2A 5G5IA 2NUXA 3MHGA 1RVGA 1EPXA 3LM7A 2ZTJA 4DQWA 3ABOA 5AHEA 2C19A 1YTEA 2QCDA 4Q32A 5G2WA 2RDTA 3SW6A 3LHWA 4FHAA 3NPUA 3TMLA 3GKAA 3LXAA 1THFD 2ZTKA 3QRHA 5HULA 4NJIA 3E0IA 1C29A 3HGOA 3IVTA 4R7JA 5D04C 5T26A 5LNRA 3EWWA 1YXYA 4I7WA 3M1ZA 2CW6A 1S5WA 5KZEA 2OZ0A 3MHUA 1SZNA 2QEZA 3PB0A 3IGSA 5C54A 1G4EA 1UB3A 3T7VA 4BK9A 4Y90A 3LV6A 1IIGA 3PWAA 1OFAA 3HF3A 1KM6A 4LWWA 4JR5A 1FWNA 5FEXA 5DCBA 1QPRA 5KMYA 3UQNA 3L0GA 1JR1A 4GBUA 4WXYA 5EYWA 4MZ8A 1F73A 1K8ZA 4DF1A 2C16A 2R91A 1G67A 1LBFA 1TTIA 4O13A 4QSHA 1J4EA 3S5YA 1TQJA 4O10A 1EP3A 2QCGA 3LTYA 4IPJA 4O28A 3CC1A 3GXNA 3KOFA 4DEFA 2H90A 4JX6A 3O63A 1OFEA 3P60A 2QAPA 3NQCA 4AMAA 2E09A 3W7NA 1WA3A 3ELFA 1ZALA 1UASA 1DL3A 2F7FA 3TU9A 4BI6A 1XBZA 2GUUA 3STEA 4HSNA 3LCGA 2ZA1A 1JQXA 1WOAA 1AW5A 4ADSA 3TQVA 3WJYA 1KFBA 4NJJA 1XDMA 2EHHA 3W1TA 3E49A 2BXVA 2EGZA 1RQBA 4MVAA 4GUGA 1K7XA 3A24A 2XN2A 1TPH1 1W3IA 3F03K 2ZRVA 3RFAA 2E6AA 5J5RA 5CPMA 3NZRA 2E5DA 3W1UA 4BI5A 1X8FA 1Q3NA 2ATSA 3U6WA 2E6YA 1TSIA 2E5CA 1LLZA 3UNDA 3C56A 1H1YA 4M19A 4O11A 5KINA 2B7NA 3KVKA 3TSDA 1FWTA 3NPWA 4YLWA 1TTJA 1XI3A 2ISSA 3W76A 2ZRXA 1YYAA 3C2FA 3ZWTA 5G2HA 3UWYA 4UC5A 5HQEA 2CZEA 4JGDA 5LZLA 5LSMA 1YXCA 3CEUA 4NT0A 4JTFA 1MZHA 4BR1A 2YZRA 3QW4B 4AB4A 1I45A 1W5MA 1IF2A 4UTWC 1GG0A 1WQ5A 1TPVA 1J5TA 3LCHA 4BWLA 1SW0A 5FF0A 3NR0A 2OCZA 1SO5A 2QJHA 3NZ1A 5D09A 4WZHA 3NAVA 1FWWA 2TPSA 5DELA 4MIMA 2NV2A 2QCLA 2ZA2A 3IIZA 3MW7A 1PL9A 5HMSA 3UD6A 4Z1BA 3TMQA 5EY5A 1JULA 1X6UA 2V9DA 4K8EA 3C52A 1ICQA 2ZRUA 3G24A 3KVLA 5BRBA 1TPB1 4A2SA 1LBLA 3H54A 4IX0A 1OJXA 4RK8A 4UFJA 3QM3A 5D2VA 4LY8A 4CNPA 3UWVA 3GKFA 3FEMA 4ADUA 1R46A 1H62A 1GT8A 3F4NA 1IXOA 1H50A 2Y6ZA 3D0CA 1C9DA 3AJXA 2E6DA 1GZGA 4OHQA 2HS6A 4CCEA 3NNTA 1XC4A 3S1WA 5MHBA 2ATMA 3DBPA 5G1TA 1N7KA 2Y61A 1GTEA 1CX9A 2BX7A 2Z6JA 3W3OA 1KBIA 2C18A 3PS7A 8TIMA 4LT9A 4I9AA 3B4UA 4MJMA 4O53A 3STFA 2JBMA 3W7LA 1QOQA 2VXNA 4QM1A 3KVJA 2WNNA 1F76A 3TK7A 5AHNA 3OIXA 4O57A 3UWUA 4JY8A 1ZCOA 3G1VA 3VE9A 5FESA 3GDKA 1YDNA 3PVFA 4HT3A 2R8WA 1F2JA 2ZZ2A 3NQVA 5BW6A 1JRCA 2JGYA 2XN1A 2DP3A 3QW3A 2YW4A 2VEMA 3FA5A 2BZNA 4FNRA 1JCMP 3T4CA 3H55A 2WKJA 3GAKA 1JCLA 3CEPA 1GVOA 5BMWA 5AN7A 1WBJA 2WV8A 4Y9AA 2FPTA 4ICNA 2A6LA 4KFNA 2ZA3A 4XBSA 3QFEA 4IMDA 3SI9A 2QKFA 1NAL1 3HO8A 3PSVA 2VEIA 2PURA 1EP2A 1LYXA 3U8GA 1LP6A 3KFTA 3IIVA 4O12A 5EMUA 5D05A 1DKWA 4ZQMA 1J2WA 2A7RA 3FYPA 4NXKA 1IXQA 3VFLA 4LUIA 1HUVA 4EF8A 4RV8A 3BG5A 5I3FA 1BTMA 2OJPA 3STCA 3QMTA 1BWLA 4PL2A 4HPJA 4E0CA 5D38A 4MLJA 4HHPA 3N73A 4HNUA 4JIPA 1ZAIA 2C14A 3LI0A 5E0KA 3RLUA 1JJKA 2O7SA 3MP3A 1ME9A 4K38A 3DFPA 2CFFA 3ANYA 1TRDA 2V8ZA 1JRBA 1QWGA 3NPXA 4XZ9A 3NQ7A 5C5YA 1SW7A 2Z0IA 4AWTA 4HNVA 3G8RA 1RR2A 3F1QA 1GOXA 1F5ZA 3GZ3A 3W2UA 1F05A 4GC4A 3CTLA 2B7OA 3NL2A 4QNEA 2VFIA 3EKZA 1EEPA 4UMCA 1VH7A 3JR2A 2FB2A 2PRMA 4M6PA 3TQKA 4H3DA 4BWLC 1AMKA 4TR9A 3W7QA 4S1FA 2FDSA 5I3GA 4LVDA 3W7HA 4PODA 5AYZA 3PBWA 4X3ZA 2TMDA 3QYQA 3I6RA 3PBUA 3W7JA 4PL1A 4JEQA 5F4WA 3GX9A 2FPYA 2R14A 1GWJA 5LNVA 4JN6A 2YGYA 4RR4A 1GYLA 3B06A 3M5ZA 5EA9A 3U2OA 1PCWA 4M7TA 4XUGA 5TBOA 2ISVA 1W1ZA 4JDBA 4LS0A 1KM5A 3O6DA 2AGKA 4JNMA 2GOUA 3OG3A 3W70A 4AF0A 3DGRA 1LLWA 2NXGA 1W5OA 2Z6IA 3LHVA 4MJZA 4IX2A 3NQMA 4LOCA 2G96A 3P62A 2JK2A 2OX1A 1G69A 4JYFA 1LTDA 4AH7A 3DFQA 1AW2A 3N19B 1NVMA 2WOQA 3I7QA 2ZZ4A 3BV4A 1R30A 3DHDA 3PUDA 3FS2A 2HMCA 3LCLA 4OV4A 2VENA 4E2BA 2V30A 1I2OA 4FNPA 3EWYA 4K7VA 2VFHA 4XQ6A 3VKJA 5CGQA 3HGSA 5BOOA 1AL8A 5AYYA 2OMAA 1IXNA 1K03A 2C3ZA 3EKLA 4ALDA 3DFNA 4OU1A 3EEGA 3P74A 4IMEA 4IMCA 3S0CA 1OX4B 1S5TA 3L5AA 1OK4A 4S2BA 1NSJA 3EX6A 4AVFA 2Z2UA 4FEZA 2Y85A 3NXFA 1OYAA 1DJNA 2C1HA 2DZWA 3Q58A 4LS2A 4MLRA 4B5NA 5HWNA 4AHPA 3HMJG 2EKCA 1W3TA 3O6YX 1YADA 1OFRA 4RCXA 4WX2A 4JY9A 1EX5A 4R33A 5EKYA 1TMHA 1DQWA 3NYZA 1VLIA 1NF0A 3S42A 3G0UA 1OFQA 4E38A 4WOQA 1XBVA 5IBXA 4GUIA 5F2MA 3ZWSA 2VOMA 3C8FA 1RV8A 3GNDA 3L65A 3LHYA 3PULA 4GUFA 3LCWA 5D03A 3EWUA 4YCPA 2GPTA 3O05A 3RF9A 2YFOA 2FB3A 3SECA 2ABBA 1ADOA 4EOUA 3MO7A 3SJ3A 3B0VC 1ICSA 3OVRA 1EUAA 4N4QA 5FEWA 1H1ZA 1N55A 5KZDA 3WJSA 4A22A 1BEUA 2V0TA 4RZ6A 3OVPA 5F2LA 4X22A 1WAUA 3TROA 5D2WA 3LRLA 2ZFAA 4Y6GA 1TPEA 4UNLA 3P81A 2VFFA 4LC8A 3W84A 3NQ6A 3EX3A 1KFKA 3OHIA 3WK0A 3RK8A 3G1DA 3W1PA 2X1RA 2E77A 1EWDA 1I2QA 3W73A 1KTCA 3Q37A 2FIQA 4ZQOA 3W71A 3W6YA 3IVSA 1KM0A 4CNNA 2FTPA 4X9SA 4R53A 1ZFJA 3C4UA 4FXRA 1KLYA 1TTQA 1OFDA 1LRTA 4NJKA 4AAJA 1C8VA 1P0KA 3KRZA 1SUXA 2A6NA 3LV5A 4JS3A 4GRSA 5CG7A 4IMFA 4O17A 1N8FA 1F6KA 4ZMGA 3NL5A 2FPVA 3M9YA 5C55A 4LVAA 3CM4A 1TCDA 1O94A 2PCQA 3MJYA 4L4LA 2DZPA 2X1TA 2VEPA 3KAOA 3LCXA 4GNJA 3OVQA 3L2IA 1QDSA 1EWEA 1Q6QA 4UTJA 3A9IA 2Y89A 5CSSA 4JICA 4FX8A 3T78A 1VYRA 3HG4A 2YW3A 1GVRA 3UXDA 2QUVA 3DHFA 3FOKA 3I65A 3M5VA 1W56A 4RJEA 3W88A 3PUOA 1H7PA 3BG3A 1OABA 2ZRZA 1VZWA 5TIMA 2ZRYA 1T99A 1L9WA 4KKXA 3C0JA 5D37A 4WY0B 3QQ1A 5DBTA 2NUYA 4QISA 4LNYA 4HPXA 1K3UA 3W2MA 5KITA 4RXFA 5AHLA 2ZZ6A 2DZVA 1KFLA 4UNKA 3GB6A 1NEYA 5AOUA 1PE1A 2GQ8A 3LLFA 4HNNA 3IVUA 3TV8A 3PB2A 5FI8A 2V2HA 5HUPA 2X1UA 3P80A 4EVZA 4OE7A 4PFMA 3G1FA 5F2IA 3WK1A 2CLOA 3C2OA 2A21A 2XN0A 3NQAA 2V2CA 3FFSA 5CPNA 2PRHA 1TQXA 3W7OA 3P67A 5D30A 1QMLA 3L68A 3T55A 4O50A 1DQXA 5HNRA 3MHFA 1PIIA 3DFOA 2A7NA 3MBDA 4XTIA 3W2KA 1W0MA 4WQ6A 3QQ0A 1ME7A 4BFAA 5H2ZA 5KSWA 1XFBA 2QCDB 3OA3A 5CKSA 5AHIA 1VCFA 2WNZA 3PBVA 4UTUA 1VCVA 1I8JA 2GVGA 3A22A 2WSQA 1MEWA 3N9RA 4IQLA 3DI1A 3TC7A 2DU2A 3TAOA 4LUJA 1GTHA 3G22A 4IXHA 4N02A 5K4XA 2NLIA 4UMBA 3THAA 3NVTA 4JTHA 3G1AA 4FNQA 4YL2A 1IIHA 3JS3A 3PM6A 1GJPA 4RXGA 5IBXC 5K9XA 4O16A 3GDRA 4MPQA 1YLVA 5DY3A 5D2YA 3DKJA 4OWGA 4QAIA 4JTEA 3GK0A 1TTPA 1BWKA 2ZBTA 1G4SA 1UBSA 3EWZA 4Q4KA 2JKEA 3W23A 4YMZA 1QO5A 3M47A 3PG8A 4MFDA 1GYNA 4O54A 6TIMA 1OFOA 2B7PA 3W87A 3KX6A 1HO4A 1ICPA 5HR7A 3G1HA 5D2TA 4S2CA 1FCUA 1ZAJA 3M0ZA 5DXXA 5SWUA 4YCOA 3L67A 3DFTA 2NX9A 3W1MA 3BLFA 4NNCA 1VCGA 4FNSA 2V5LA 4NNBA 3V1PA 1WDWA 2GVLA 4RZ5A 3PC0A 5FF4A 2FJKA 1FQ0A 3KRUA 2RDWA 2D73A 2RH9A 2ZZ5A 5BNKA 4RZ4A 1BKSA 1UCWA 3GDMA 1K02A 4XWUA 4ZQNA 4IXXA 4NX5A 3QPYA 3HGRA 2V81A 3PUEA 2QUUA 4K7YA 4Z0JA 3O1NA 1PHQA 3TJXA 4IGHA 2YPIA 3W1QA 3CIWA 3VI2A 1OYBA 5AC8A 1QR7A 2X1SA 4O1BA 2CLFA 3EX2A 3L66A 1U5JA 3A21A 4AEOA 3G1SA 1UJPA 4IJBA 3LDVA 3ABSA 1K8XA 5DXYA 4UFKA 1JUEA 3R12A 5IM51 1TPWA 3HQ1A 4LVGA 2CLIA 3H53A 1F6PA 1P0NA 2CLMA 3Q94A 1KM4A 3G8EA 5LHFA 4UUIA 3W1XA 3GXTA 4DPPA 4JTTA 3QH2A 1W54A 1G6CA 5CPLA 2GJLA 4M6VA 4LTSA 4ZQCA 1OX5A 3LCFA 4N9CA 4N4PA 1DV7A 1GQNA 2UV8G 3SZ8A 3GVGA 2P1FA 3R13A 5LNWA 3ZFHA 1M6JA 1TYGA 1TPDA 3B0UX 4O0KA 3O07A 1WX0A 2ZCGA 1VRDA 3LXCA 2PC4A 4DF0A 1MXSA 3NQFA 2KZHA 4UIOA 5HWMA 4TU1A 3O6CA 1HTIA 1LORA 2FQIA 3WK2A 3TAKA 3GR8A 4O8RA 1WYIA 3NQEA 1K8YA 2RDUA 4GFSA 1TV5A 1VC4A 2J9ZA 4OGZA 4LRTA 5I3IA 2DZXA 2DORA 3QPZA 2YFNA 3KRSA 3G3MA 2BWGA 2YYUA 2GVJA 1EA0A 3UZJA 1P5BA 1QFEA 3GLCA 4KFOA 3WFAA 2QUTA 2QCHA 1K7FA 2QCMA 2W0UA 1PHWA 3MI2A 5LGXA 2QJGA 5H91A 1KFEA 3C2VA 3W7EA 3IGUA 4PC8A 1WV2A 1HL2A 3EXTA 3INPA 2A7PA 2VEKA 1H7XA 2YR1A 1TJRA 1FWSA 3MUXA 3B0PA 3S5OA 3TSBA 3BGGA 3EX4A 1L6YA 1W31A 2WPBA 3UY8A 3UY7A 2EAWA 3NQ2A 3EXSA 4IMGA 1SPQA 2I1OA 3S8HA 1QPQA 2ZDRA 3TXZA 4XKYB 1XDLA 5FF2A 1KFJA 2V5BA 2CZ5A 2DJXA 2TSYA 1GPWA 3W2JA 4ZL1A 5K3VA 5I3JA 3DU0A 3P5YA 3TW7A 4CCCA 1H7WA 1OX6A 3S9YA 5CZ0A 3LHTA 4FX6M 4Z0SA 4LC6A 4CLMA 4GUHA 3BPWA 2QCEA 5A5WA 1SZEA 3CT7A 5A8GA 2WSYA 2CWNA 1W5QA 3W7RA 3EX1A 4JTLA 1EP1A 5HUOA 4ZQPA 2B4GA 4MOZA 3LOTA 4M7SA 5I3HA 4U4MA 1TRIA 3DENA 3TUUA 3WJWA 1DVJA 2LLEA 3UXAA 3HPXA 1LROA 1PV8A 2XFWA 2BLEA 5TQLA 1FCVA 5U7SA 4PTNA 3FIGA 1Z42A 3TC6A 4NXSA 3HPZA 1G4TA 2YDAA 2R94A 4RKAA 1YTKA 3PG9A 3O16A 3PAJA 2H3DA 3EWXA 3S5ZA 3W7GA 2QCCA 1OX4A 2I14A 3W1RA 1LRQA 3TDFA 3BK0A 1PS9A 3DFSA 4QIUA 4TIMA 4TX9A 2QR6A 5K9DA 2P10A 3G3DA 1SFLA 3NQ8A 3BLIA 5L9FA 3LTSA 3RU6A 4GWEA 1LOQA 3LBCA 1VLWA 2AAMA 1LOLA 2VELA 2WNQA 3BW4A 4JD4A 5BMXA 1VYSX 3LXBA 3T40A 3NQGA 4O19A 4WJEA 7TIMA 5LKYA 1JCJA 2Y7EA 2NXHA 3O15A 1ZNNA 3G0SA 2CZDA 3C2RA 4HSOA 4EF9A 1DJQA 2VFGA 3W7PA 3W74A 5CSRA 4DXVA 3C61A 1H63A 4WD0A 3NL3A 4MYXA 2Y62A 3IEBA 1V7YA 2V2DA 1XKYA 1D3HA 1ML1A 3TFCA 3EB2A 4Z1DA 1DBTA 3N9SA 2I9EA 1HFBA 2WSRA 5F1VA 3TCEA 3V75A 1UUOA 5CZJA 1T96A 3HBLA 1ZJIA 5L6UA 3LRMA 1VJIA 1RQHA 2Y7DA 3FJ6A 1SW3A 4O1CA 3B05A 3ABRA 3E02A 2QCFA 3M6YA 3B8DA 3DI0A 4MZYA 1NFBA 1W5NA 5D02A 3NL6A 4HN4A 2G95A 4LVFA 1WBHA 1OFPA 1X1ZA 4YWIA 1SO3A 2Y63A 4PCFA 4N9DA 3QEZA 1JCXA 4UFHA 3HB9A 2NUWA 3IRDA 2OT0A 3NM3A 4HKPA 3E96A 4ONVA 3ZR4A 5DCEA 1B9BA 3UPBA 3KHJA 4DF2A 2RFGA 2ZYFA 3ATYA 4GE8A 4A21A 4PEKA 2J9XA 1Q45A 2C15A 3NOEA 1QAPA 1XCFA 2BTMA 3NO5A 1TPFA 1VR6A 3DAQA 4KWVA 2C0AA 2VKZG 3CWNA 3KVMA 1S5VA 4UR7A 3LERA 5DLCA 2ZZ3A 3HJZA 4TMBA 3N3MA 3DZ1A 3O06A 3VNDA 5HJLA 3O8AA 4QJ1A 2ZRWA 2YYTA 4NJGA 2EPHA 4WY0A 3N2MA 3DKLA 2NXIA 1M7OA 3P84A 1FDYA 3HOJA 3W1AA 2B0MA 3GDLA 5AHFA 1JCYA 1OF6A 5LHEA 1DOSA 1OFBA 1VQTA 4NQ1A 1OK6A 4A2RA 1MEHA 3QJAA 2HSAA 2Y7GA 3W75A 2EF9A 1G7UA 1WOBA 3W7KA 3MP5A 1FWRA 1IGSA 4A29A 5AYXA 3CLMA 1K7EA 1KM2A 3R2GA 2QAFA 1W37A 4K39A 1W5PA 1I4NA 2HTMA 3OBKA 1TO3A 4P61A 3IIXA 1XXXA 1XL9A 4UFLA 4OT7A 1KBJA 2JKPA 4P2VA 1KA9F 1SZGA 1KTBA 3C6CA 3L5MA 3L0NA 3M5XA 1YDVA 1EUNA 2BSLA 2Q8LA 3WJXA 1B57A 4FNUA 4IUOA 3STGA 1FCBA 2QCNA 3A5VA 3MI6A 4EIVA 1JCNA 4LS1A 3N2XA 1QPNA 2Y70A 4DO4A 1B4KA 4ZVJA 2CLKA 1EIXA 3P8JA 1D3GA 3M41A 3P61A 1LCOA 4BI7A 1GVSA 3GNNA 1O4UA 4N6FA 3FKRA 3PY2A 5HWJA 2CU0A 4O52A 3DH7A 1SSDA 2VFEA 4A3UA 2ZQ0A 3R89A 5DY2A 2E1DA 2NZLA 6ALDA 3TQ0A 3VE7A 1A5SA 5F1UA 1QO2A 4O14A 3HGJA 3P8IA 4BF9A 1RPXA 1Q6RA 3BVJA 3A23A 1QOPA 4JTIA 4K8HA 4W9TA 1GG1A 3QSTA 4LRSA 4N9BA 4R34A 3YPIA 5K9CA 2JGQA 3CU2A 1ZY9A 1H60A 3W22A 1AL7A 3W85A 5GVJA 2YCEA 4LVBA 5K2ZA 3I68A 3UYCA 1O5XA 3W72A 4DO6A 2Q8ZA 1GVFA 3TSMA 1EB3A 4J9JA 2H8XA 1L6SA 1KLZA 4AHOA 1OYCA 4FXSA 3GAYA 2E68A 1TIMA 1LBMA 4ORMA 5CPOA 1Z41A 4G1KA 4DBEA 3OEXA 2E6FA 3BW2A 3K30A 5DCDA 2C6QA 2E5BA 4YXGA 3L5LA 4JTKA 1TPC1 5EBUA 1L2UA 1SO4A 1Q6LA 3W1NA 1XBYA 1YXDA 2CLEA 3SGUA 4O0ZA 3B03A 3TNOA 1H7RA 3E9AA 4EWND 1F7BA 2ABAA 3M43A 2CLHA 3SIZA 3AO0A 1HO1A 1DORA 4QITA 4Z1CA 1M5WA 3BO9A 5FEPA 5DBUA 4IWWA 2F84A 1YPIA 4ML9A 1Q6OA 2G5WA 3TA6A 4NZJA 1T0OA 4NUWA 3MMTA 3PSWA 4Y8FA 4H4IA 2DZTA 4N9EA 1LM1A 1HG3A 3HG2A 4AXKA 1LRNA 4FNTA 1JQVA 3G0XA 5G2IA 5D33A 4MYAA 5EPDA 1A50A 1FDZA 1OHLA 2Q3RA 1L6WA 2W6RA 2WJZA 1A5CA 1MO0A 2X30A 4WXZA 5HR6A 3S1UA 4UMAA 5G4WA 3RNDA 1ZHAA 1CI1A 4O15A 5D32A 3ABQA 5F2GA 3G18A 1AG1O 4UTLA 4C1LA 5AC7A 4NU7A 3KXQA 1YTDA 3GR7A 3UWZA 1I2NA 1TJPA 1FBAA 4JXCA 1MEIA 2TRSA 4AWSA 3HPSA 3N34A 3W2NA 1H61A 3A5FA 1TREA 1XUUA 1KM1A 5LNUA 3NPVA 3LCIA 1RQEA 2H6RA 3UPWA 4WOZA 1H51A 3C3NA 3NGJA 3BG9A 4ZQRA 4GUJA 4D2JA 2VFDA 3M16A 1FUYA 4JIQA 3LGEA 2FLIA 1LZOA 4LU0A 3R5EA 1OF8A 3IIOA 2ZZ7A 4NJHA 2X2GA 2JKAA 1OG0A 3M5YA 3CIXA 4GXMA 4PA8A 2NX1A 4TMCA 4Z1AA 4XKYA 2RHGA 4K36A 2IQTA 1H7NA 3M44A 4NVTA 2NWSA 4DO5A 3PBYA 5AB3A 2J27A 1R2SA 4AWUA 3EXRA 1KFCA 3W86A 1IXPA 3N14A 4FIQA 5CZSA 3CHVA 4RLIA 3S5NA 2CZFA 3LBMA 1VYPX 4LW7A 1B3OA 4CQ9A 1H7OA 4M6QA
chains in the Genus database with same CATH superfamily
5XINA 2AKZA 3SRHA 3FYOA 3CWOX 1CGUA 1BF6A 4WSJA 1RCQA 1K8CA 4HNTA 1V6VA 3WF1A 1GGOA 3L2LA 4K2SA 1XG3A 5KZMA 1Q6GA 3GH7A 3GW3A 4HJWA 4HPNA 4IOTA 4D6CA 3WF3A 3WK3A 2E0PA 2J75A 4AD1A 1LDCA 2GQAA 4AC1X 4ZZ9A 3SR7A 4UB9A 4CNOA 4ERIA 1ELSA 3DIPA 2QDHA 4H9TA 3SSJA 3CH0A 3W25A 3SIMA 3WBXA 2UZ9A 4FF5A 1HGYA 4TQTA 1FFQA 4I3GA 1IYXA 1AK5A 3ZT7A 1H4PA 4B2DA 2W79A 4GINA 3NQDA 2NV1A 2GJNA 1XKJA 4FF7A 1VBRA 3QGAC 4XZLX 2BGQA 5U4NA 2A4AA 2Z1VA 4WY0F 2CBUA 3FGCB 1W2PA 4UXDA 4JX5A 3L4VA 5AVHA 4FLRA 1B4EA 4KERA 3WQDA 3CASA 1F3EA 2BVTA 5BU6A 1L0PA 3VCRA 1K4GA 4AC7C 3LHZA 1XUZA 4QG9A 2DPEA 3F2DA 2WKLA 1E55A 3LB0A 4DWSD 2PEVA 4LB4A 2HS8A 1JDEA 1TV3A 1HN1A 4TO8A 1KV5A 4KRZA 4IICA 4MKNA 1NH6A 4QHRA 1X6LA 4WCJA 4K37A 2EPNA 4NNAA 1GOQA 1ALDA 3BW3A 4AUBA 5I77A 3RMEA 2A1YA 4QROA 1UR2A 4ATLA 3UF9A 3Q2DA 2G4JA 4UCGA 4XG1A 4X2PA 5DT7A 1ZPTA 3GR4A 1V6UA 1U83A 1J6PA 1X7FA 2GVYA 2IKGA 1F74A 1KGWA 4IPIA 4H7CA 4RPQA 1IE7C 2ZZ1A 4IG2B 2G3MA 2GGIA 4NZFA 1RZMA 2FVLA 4I7VA 4Q4PA 4LUTB 4PMDA 4J3UA 1ZRQA 3MYPA 4C5YA 1KXQA 4LAOA 3ATZA 1KD0A 2WJDA 3QGKC 1XM3A 2D3LA 3QLLA 4LPCA 2I56A 3WUFA 3UR5A 1FFRA 3H2AA 1DIOA 3CGTA 1D3CA 4RDVA 3R8RA 2V69A 4N2YA 3MVTA 1O5QA 3USBA 5GJPA 1LQ2A 4E2DA 2J8TA 3GE7A 1WXZA 1W3NA 3AALA 5EL1A 2Y5JA 3QMRA 1W8SA 1C8QA 2PDYA 4DPQA 3SQLA 1VGAA 2J79A 3KL0A 1BVNP 1UP2A 3I3DA 2C13A 1QASA 2O9OA 2ODOA 4RNHA 5DQPA 3BANA 1GVYA 1N2VA 3CHEA 4RPPA 3C5QA 1YBQA 1JUBA 4XB3A 3W9ZA 3WEMA 1J0IA 2GVEA 4YTUA 2PRLA 4KIRA 3A3HA 3GY1A 1X98A 3LX9A 2Q3OA 4IPLA 4AIUA 2DQWA 4JX4A 4OOZA 2DJLA 1UH2A 1S3HA 1VKFA 4RNIA 3BLEA 1SFJA 1NF7A 1XBXA 2DSUA 1D9EA 2J6XA 5FF7A 2C79A 1W3JA 4WHBA 7ODCA 2WHJA 1SSGA 4M82A 5CGMA 2VC6A 2XM1A 4OV9A 2QGHA 3T44A 3TW6A 3C2EA 1WAWA 3W37A 5D4YA 2H3BA 1F6YA 4NX0A 2Z1XA 1V08A 4PMNA 7REQB 2PGFA 3QFWA 4HU4A 1GKRA 4HA0A 2IKIA 2Z1BA 2DW6A 1XYFA 1F07A 3LPPA 1E1FA 2HK1A 3E12A 4UQCA 4U5IA 3AIBA 2VM8A 3AISA 1SO6A 2A85A 1OCBA 4PH6A 3EDEA 3THUA 3UZ5A 3GU1A 2NUXA 3MHGA 3B3DA 3ZMRA 8A3HA 3ABOA 5AHEA 1DYSA 4PYSA 4Q32A 3T42A 1HIZA 2WQDA 2OZ8A 2J13A 3MSYA 5HK4A 2G8ZA 2RDTA 4FHAA 1T7LA 4LALA 3AUJA 3GKAA 3LXAA 1THFD 6REQB 2WAGA 2HXTA 3E0IA 3KCLA 3WDJA 3R43A 1P7TA 4AQLA 5D04C 5LNRA 2VO5A 1B30A 3M1ZA 3OJGA 3MHUA 2NW0A 1UA3A 2JF6A 3T7VA 3NO1A 3GHSA 2CBIA 2FZMA 4LWWA 5FEXA 5DCBA 1E6RA 1IWPA 2VCCA 3T8QA 2QMJA 4MZ8A 3REQB 1U1UA 4P5UA 1K8ZA 5A2CA 1OD0A 1WB0A 2C16A 1G67A 4O13A 1J4EA 3KBVA 3R0UA 2AQVA 4QR6A 1X39A 2BFGA 5T91A 3S5YA 4K1GA 1TQJA 2ALRA 1Q63A 1EP3A 4DM1A 1E15A 1CIUA 1TFVA 3O63A 4PB3A 3OBEA 3P60A 3W7NA 3CL8A 1DL3A 3I4EA 1EC8A 2PDFA 5B7ZA 3FDGA 4WDXA 4Q8QA 1K70A 3T81A 9RUBA 2ZA1A 3QR0A 4AEFA 1WOAA 3EPNA 4HQVA 4GI4A 3TQVA 4ZOCA 4NJJA 2EHHA 3W1TA 2V6AA 3E49A 3GQYA 4MDOA 2EGZA 1RD6A 1W3IA 3F03K 4PMYA 2BVWA 4NL1A 5CPMA 1R5YA 4BI5A 1PKMA 4HMCA 2Y4SA 1Y8BA 4WGHA 3IUHA 1LJYA 4JL2A 3VGFA 1Y65A 1LLZA 4FI4A 1UP0A 1F3TA 4K68A 2Y8VA 1MQRA 4GQBA 5CAHA 2PWDA 2NQ5A 1FWTA 5DRCA 4M80A 1XI3A 2ISSA 4FA3A 3AAMA 5G2HA 3UWYA 1UZ4A 4PB5A 2ON3A 1IEQA 2CZEA 4R7OA 5LSMA 5IDZA 1XQKA 4BR1A 1I45A 2WM1A 5XIAA 5D9MA 4BWLA 2OCZA 3DESA 3NZ1A 1Z89A 2GUBA 4MIMA 2QCLA 4M8UA 2ZA2A 3PFRA 4KESA 4E3TA 3RPTA 5G4HC 5HMSA 2EEXA 4Q7NA 5BRBA 1IZJA 1BFNA 3IAPA 3KTSA 2V68A 2Z1WA 4RK8A 4MWAD 4E3VA 2GWGA 4CNPA 3UWVA 4CD8A 3FEMA 1GT8A 2Z24A 5HMEA 1W32A 3ARZA 3S1WA 2EJAA 3WQGA 5MHBA 1KRBC 2BMBA 2OVLA 4LUYA 1CX9A 1JL8A 2BX7A 4IUGA 4DWSA 4F79A 2ACSA 3W3OA 1YNPA 2C18A 1EHAA 1NDWA 3TN5A 3WMSA 3STFA 1QOQA 4QM1A 3S2MA 4ZODA 4C6CA 3CS2A 5AECA 2PDQA 4PN2A 2ZIDA 5AHNA 4O57A 1NDVA 4JY8A 2PDPA 5FESA 1Z9AA 3HQPA 3GIQA 1YDNA 4HT3A 5CXPA 3DG7A 5AZ1A 4HCHA 2JGYA 2XN1A 1FHDA 3S2CA 3T4CA 3H55A 2WKJA 1UZ1A 3CEPA 4H9UA 4DUVA 4KFNA 2WMHA 4XBSA 4REQA 2XVPA 3HO8A 2VEIA 3GU2A 1EP2A 1LP6A 1R8LA 4D6JA 2OQHA 1NDZA 3EPOA 1DKWA 1VBGA 1V03A 3BLPX 3AU2A 4GJJA 5I3FA 2OJPA 1HJVA 4YHEA 3MTWA 3VK5A 1VFLA 3N73A 4JIPA 3LI0A 4YJ5A 2TAAA 4P7OA 2WK2A 3DFPA 4YTSA 2V8ZA 3GG8A 3NIYA 3RGTA 1PPIA 3PTKA 9CGTA 1HZYA 3FCPA 2Z0IA 1EO7A 2VRQA 1AQMA 1F8IA 4HNVA 2ZKMX 2P3EA 5IXEA 4GVFA 5CQ1A 3G77A 2REQB 3RJYA 3TN3A 2XTKA 4DYJA 4HYVA 4Z2JA 2R82A 3VOGA 3ZM8A 1DE6A 3JR2A 1LQAA 1ZB5A 2FGZA 3EDKA 1PIGA 3KZSA 4W93A 3VIIA 4TR9A 3W7QA 2WMGA 2FDSA 3T6CA 4W86A 1KCXA 2ZC1A 3CV6A 4KRTA 3N13A 3PBUA 3BURA 3W7JA 4EPDC 1RK5A 2FPYA 1QWKA 2YGYA 1PCWA 2QT3A 4XUGA 1DIEA 1W1ZA 2CESA 4LS0A 1KM5A 1QHPA 3WF0A 4W84A 3POCA 3GTIA 5MKGA 3NQMA 4L1XA 2YA1A 4JYFA 1XD1A 4PTMA 1LTDA 4AH7A 2FYMA 3PPFA 3N19B 4IGMA 3TA9A 1A5NC 2XU2A 3NGFA 3WDPP 3I7QA 3BV4A 3IK2A 3BOLA 1R30A 3DHPA 3P14A 4OV4A 1JPHA 2YL8A 3POHA 4TXEA 4PSRA 5JH1A 5DT5A 4B5SA 3OQ8A 1VFHA 5FJUA 4U33A 3VOFA 2EPOA 1IXNA 1JDAA 1K03A 1KWKA 3EKLA 4ALDA 4OU1A 1FH8A 4IMCA 4ERGA 4EACA 3GM8A 1GOMA 4FEZA 1UA7A 1XLIA 2OYKA 1DJNA 3H2OA 4L9YA 4AHPA 3O6YX 5A2AA 3DG3A 4JTRA 5CCZA 4JY9A 4R33A 1TMHA 1DQWA 3O7UA 1OM0A 1WDRA 4E8GA 8XIMA 1OFQA 1JG9A 1Q4WA 4GUIA 2YB4A 4AWEA 2OWXA 1UPPA 3GNDA 3D47A 3TWBA 3GFXA 4Q4SA 4I9MA 5D03A 2OLSA 1T40A 4DJEC 1KWGA 1XFCA 3B0VC 2O55A 4HZ6A 1ICSA 3OVRA 4U2ZA 1PYFA 4LUSB 4RZ6A 3OVPA 2GJRA 4XIAA 4GYPA 1CBGA 4FLSA 4Y6GA 4INFA 4UNLA 7CGTA 1EDQA 4B3ZA 3CPUA 2Z2AA 3NQ6A 3W84A 1KBLA 3QYSA 2J77A 3AXXA 5REQA 4ZOAA 3WK0A 3RK8A 1RALA 3G1DA 1M04A 3W1PA 3KP0A 1Q6FA 3AJ7A 2UY3A 3Q37A 1S38A 2FIQA 4JNZA 4X9SA 4R53A 4QG6A 3GG0A 1JZ7A 1LRTA 4NJKA 1EBHA 4TVDA 1VEMA 4JS3A 4GRSA 1AJ2A 3T07A 3EA2A 2FPVA 3WNMA 1PDYA 1AQFA 5C55A 2WB5A 1TCDA 3JU2A 2PCQA 2Y5EA 3CL7A 4L4LA 2X1TA 2VEPA 3W82A 4GNJA 1W8GA 5AZ0A 2PDXA 5I0DA 2XWEA 1XHGA 4PSPA 2X05A 2HCVA 1EWEA 1S2TA 3H7VA 3PZ9A 4I6VA 2INFA 1JAKA 1VYRA 3LM3A 3T78A 3HG4A 1GVRA 2QJMA 3CL6A 3FOKA 3I65A 1U33A 4FOUA 1W56A 1YE6A 4RJEA 2OO0A 3PUOA 1EPVA 3OZPA 3RR1A 3M6DA 5D37A 4WY0B 5DBTA 3OOQA 2IS7A 1V02E 3WLOA 5AHLA 5I23A 3JZUA 1LQ0A 1NEYA 6XIMA 5AOUA 1PE1A 3GG7A 3FAWA 1XP3A 2HPIA 3R11A 4HNNA 3TV8A 4E5TA 3MMDA 3PB2A 1CXHA 5JVLA 5HUPA 2X1UA 3P80A 4EVZA 4PFMA 4CNSA 1F3WA 1UD3A 2CLOA 4M56A 1J0ZA 2I7GA 2YL6A 2C8NA 4HU8A 2V2CA 3E0WA 1TQXA 3M7SA 3P67A 1OZMA 4TX6A 1PIIA 3CAQA 3MBDA 4DJDD 3ZLHA 4WQ6A 5A2BA 3QQ0A 3PZIA 4BFAA 1RCOB 1HF6A 2NSOA 7A3HA 5KSWA 2QCDB 3OA3A 1W6TA 4FOJA 2NVAA 3PBVA 3A22A 4DVOA 1S46A 3RX3A 2VX4A 2DU2A 3GC4A 1GTHA 4G7EA 4IXHA 4N02A 5HNNA 2NLIA 2WMFA 3THAA 3N4FA 3NVTA 1Z3NA 3G1AA 3T0DA 1NFPA 3WF2A 1KGXA 4A35A 3WUEA 1GJPA 4AZCB 5IBXC 4P7LA 5K9XA 4O16A 3BTNA 1XCWA 2J7DA 4IP4A 5D8ZA 3TTSA 4JTEA 5FJPA 3HU7A 4H2CA 4US5A 4Q4KA 2BS9A 3GFYA 2JKEA 3M47A 2PWUA 4MFDA 4F2BA 2QPXA 1GYNA 4LBUA 1OFOA 3J7HA 3KX6A 1HO4A 5D2TA 4S2CA 1S5MA 1ZAJA 4WGXA 1R87A 4KPLA 1JPIA 2J6VA 5SWUA 4LJ3A 3AIRA 3L67A 3DFTA 3AQUA 3MY9A 2R1LA 3NTYA 4NNCA 1AMYA 2E9BA 2V5LA 4FNSA 4C91A 1TJ2A 4RZ5A 1FWDC 3PC0A 5A6BA 5A8NA 4V33A 4QQUA 4LF1A 1HKKA 2FJKA 1UR8A 3KRUA 4BQ4A 2GGGA 3GVQA 4ZXOA 4XWUA 4XO6A 2HBXA 2V81A 4I90A 1GHSA 4XZMX 3MSDA 4IGHA 2YPIA 1QR7A 2XH0A 2X1SA 3KBMA 1BF2A 3IJLA 4YU1A 3T08A 3LY0A 4UTFA 4IPNB 3G1SA 1UJPA 3LDVA 3SB0A 2YA0A 1JUEA 3BMVA 3L12A 2OGJA 3HQ1A 3EAUA 3PBGA 3Q94A 3EEZA 4UUIA 5CZKA 3AFBA 1GZ1A 1W54A 4CU8A 1G6CA 4L61A 4M6VA 4LTSA 4ZQCA 3LCFA 3UZXA 4ZB0A 2P1FA 3E3HA 4JAWA 1E4LA 1TPDA 3B0UX 1WX0A 1BYCA 5JU6A 2V38A 4DI8A 4UIOA 3U7VA 1LORA 1BPLB 5I07A 4O8RA 1ITUA 1K8YA 2RDUA 1TV5A 1VC4A 2J9ZA 2AL2A 3DOPA 5I3IA 1S1PA 2DORA 2WC3A 1TZZA 3R0KA 4H01A 1EIBA 3L4XA 3G3MA 5EBAA 1Q8JA 3II1A 1QFEA 3WH9A 4AG0A 3KW3A 3I3EA 3GLCA 4H00A 4DIAA 3WFAA 1XLLA 2L5HA 1K7FA 4AZ6A 3W01A 4ZO7A 3MI2A 4H7ZA 5LGXA 2QJGA 1PWMA 5A6MA 2VEKA 2PGEA 2YR1A 4IJRA 4J35A 4DO7A 3S5OA 3BGGA 3UY8A 3NQ2A 2DW7A 1QOXA 1SPQA 4NASA 3ORWA 2OSWA 5E9AA 1VBHA 3WSUA 3KWSA 1J0YA 4PMVA 1JDCA 3WNNA 2E67A 3TXZA 5FF2A 2BNJA 1KFJA 2WANA 2CZ5A 5TNVA 4DXXA 2DGAA 3EOEA 2WPGA 1CLKA 3E2RA 3N6QA 3WQOA 2P53A 3P5YA 3CAVA 4F3HA 4AD2A 1OX6A 5B80A 1E3XA 4WKFA 5CZ0A 3R94A 4Z0SA 5C71A 4IP7A 4LC6A 4CLMA 4LX4A 2QCEA 4MAZA 3QZAA 1CWYA 2W62A 4GISA 3VD9A 5A8GA 4ZE5A 4JQAA 4ASTA 1VPYA 1W5QA 4V1XA 3EX1A 1EP1A 3AWNA 5HUOA 3WYZA 5A1AA 4Q4RA 3LSCA 3LOTA 1PEZA 3EWDA 4M7SA 2A79A 5AKQA 4AFYA 2LLEA 3HPXA 4N0RA 1LT8A 3M4HA 5HNUA 5RUBA 1LROA 1B5TA 1SGJA 1UD4A 3K5XA 4GH3A 1G4TA 2D2OA 4MKVA 4RKAA 1YTKA 3PAJA 2H3DA 1OX4A 5H8UA 3W1RA 4KCVA 4AU0A 1PS9A 3DFSA 3HPAA 2FDMA 1KRCC 4MAVA 1UIOA 1XH0A 3CIVA 3S3GA 1LLOA 1WXYA 3NQ8A 3RU6A 1LOQA 1QU4A 2WYSA 3SJNA 4GJIA 4JD4A 1KXTA 3VD3A 1HW6A 1MMFA 2EPLX 4C7FA 1JCJA 2HDJA 2X0HA 2Y7EA 3O15A 2DUXA 1OT1A 4CU7A 4HSOA 4I8YA 3W7PA 5CSRA 4ICCX 4WD0A 3NL3A 4MYXA 3IEBA 5A6AA 3V7PA 5BRPA 4K3ZA 1ML1A 5HNTA 2W92A 3TCEA 3RU8X 1A4LA 5CZJA 1J11A 2ZE3A 3AMLA 1NDYA 1QNPA 1ZJIA 1BSIA 1RQHA 3CH9A 5ECVA 1RY0A 4QE4A 1SW3A 4O1CA 1IEXA 3TWAA 1MI3A 1S39A 3ABRA 3GHTA 2OPJA 4D8ZA 1G9HA 3VAVA 2J7FA 2QCFA 4ZO6A 1L8PA 3DI0A 3ANVA 1NFBA 5BXTA 2ISDA 3T0CA 1UOKA 5M2FX 4YWIA 5E5CA 4ICMA 1XLDA 4PULA 2YA2A 4PCFA 4N9DA 2NQJA 4QXIA 4UFHA 2NUWA 2OT0A 2MNRA 3NM3A 4HKPA 1ENUA 1FWFC 2JQXA 3FVMA 1UWIA 2XFFA 4ONVA 4YYFA 1B9BA 3RLGA 3S2LA 3DYOA 3VX1A 4W88A 5BROA 3F7JA 2J9XA 1XCFA 2PD9A 3NO5A 1OCQA 1UOZA 3TJ4A 4D71A 4UR7A 3ZXWA 1Q66A 3U3HA 3BSGA 3N3MA 2CHRA 2Z2BA 3GFZA 4DJDA 3ICJA 4W4QA 4GIRA 5T8GA 2EPHA 1MRQA 3OG2A 4MM1A 3S47A 2NXIA 5TD4A 3WBWA 3P84A 2ZDSA 1FDYA 3GDLA 2JE8A 3T1GA 1B9ZA 4OOUA 1PB0A 3DEQA 2NSXA 1VQTA 1A3HA 3QJAA 2HSAA 5IHSA 3T0BA 1YBQB 2PI6A 2Y7GA 2EF9A 2B81A 1E6QM 3TCSA 2YCLA 4IIBA 3FV9A 2R24A 4HZ7A 1K7EA 4EPKA 3WD3A 1W9DM 2HTMA 4P61A 1PXGA 1XL9A 4J3SA 1C8XA 3B9EA 4OT7A 1ZGDA 1BTCA 4H9VA 1KA9F 1SZGA 2IPJA 1YDVA 1HKMA 1EDTA 1B57A 1IHIA 4WKHA 1VEOA 4GQRA 4EIVA 1JCNA 1YNQA 4G6CA 1CNVA 1EXPA 2Y70A 1PZ3A 4V27A 1K9TA 3FJ4A 1ZCCA 2VI0A 1D3GA 2J7BA 4BI7A 3QZ6A 3UGVA 4Q4OA 4N6FA 5HWJA 2CU0A 4RL3A 4H04A 2VFEA 2E28A 4Z42C 4NAFA 3TQ0A 3HV9A 4XSLA 3HGJA 3P8IA 3BVJA 1OADA 5D9NA 4GBDA 4K8HA 1GOWA 2ANUA 5TF0A 3KDOA 1NP2A 3YPIA 4N9BA 5A8OA 3WD2A 1EZWA 1WE5A 1RK6A 4GVHA 4KEVA 5GVJA 3NWRA 2YCEA 5K2ZA 3I68A 2FJUB 1O5RA 1GVFA 3L4WA 5C9UA 3LN3A 1S5NA 1R3TA 2BXZA 1J5SA 4AHOA 3LZ5A 1QW9A 5CPOA 1P7TB 3LUTA 3GNOA 4DBEA 2C6QA 3AROA 1S3TC 5EBUA 4ZTYA 9XIAA 3ENLA 1ONXA 1O12A 2FGLA 2DZBA 4JTCA 1YE4A 3UU0A 3M0IA 4YTQA 5CC7A 3B03A 3LENA 1JYXA 3MB9A 1OIFA 4MKSA 1DORA 2PFHA 1NQ6A 1R3QA 4MB5A 1BWVA 4DBWA 3TA6A 1VD6A 2DZTA 4H4IA 2YBUA 2YBTA 4GPNA 4XVDA 3WCZA 2WZHA 4C6IA 3SY1A 1LRNA 1A0DA 3VNJA 3WNKA 2IQDA 4B5TA 5FOOA 4FNTA 2WKGA 4MYAA 4AD4A 1A0CA 1FDZA 2Q3RA 5CC3A 1L6WA 2VVNA 3ITGA 1CZ1A 4R27A 4C6JA 4UMAA 1ZHAA 1VAHA 4FLOA 3U4AA 3DYPA 5D32A 3ABQA 3PHAA 4PMJA 3EYPA 4UQBA 3G18A 1WNOA 3N25A 1SVDA 2Y2WA 4UTLA 1PIFA 2W66A 1LWHA 5AC7A 1E71M 3C86A 1VBUA 1I2NA 4JXCA 2WHLA 1RP8A 1FWGC 3N34A 2QF8A 5DMLA 1TREA 4F0MA 2JEPA 1DHKA 3H7RA 3NZPA 3PUGA 2CBJA 2FHFA 3R1ZA 3NGJA 4WIWA 4ZQRA 4Q6JA 2CPUA 4D2JA 4Q8VA 2VFDA 3M16A 4E6MA 4JIQA 5CBIA 1XWYA 5LIUX 3W29A 1OF8A 3ABXA 3GTFA 1LUCA 2ZZ7A 2X2GA 3WLQA 1TE1A 2NX1A 4TMCA 1CXFA 1HP5A 2RHGA 1ZJAA 4PUJA 4Z1AA 4K36A 3H2FA 4Z2KA 4JBRA 4A8NA 4AWUA 3OVGA 1B3WA 2AAAA 3E6EA 2INEA 4RLIA 3S5NA 2CZFA 3LBMA 3DG6A 3ME3A 2C71A 4EKJA 1XIIA 3CO4A 1DTNA 2VX5A 3ZZ1A 4M6QA 2X16A 1I2PA 4D9PA 1GQLA 2SFPA 4EAYA 1WKFA 3ARYA 4B90A 4MWAC 4XTDA 3I7SA 4GYKA 3W7CA 2VDHA 1KCLA 5EB8A 1PX8A 1R2RA 4H6QA 3W7DA 3WJZA 1QCWA 1CECA 4FO4A 3TN4A 1F61A 3WH7A 1A47A 4UFIA 1Q7QA 3VU2A 4F2TA 4S3EA 1J0HA 4L6OA 1GQJA 3IACA 1MNZA 1QPOA 4MUZA 1TR1A 1YDOA 1O60A 3UJSA 1B3VA 2QUNA 4DWSB 5J5DA 3W1LA 4CQAA 3G1XA 5IFPA 1ITCA 2KX9A 1HJSA 3LLDA 2QDGA 3ANUA 3RCMA 2DIKA 2RUSA 1R2TA 3IIPA 4QFUA 2HEJA 1E5NA 1YKWA 2X41A 4HMNA 5T9BG 3TKFA 3N6JA 3KTCA 2OKTA 1X1NA 4JFWA 1C7SA 2ZICA 4FB7A 2FVMA 4LBSA 3CHFA 4O0QA 3ALFA 2ACQA 1SU5A 3ZIZA 2QDEA 2J88A 4KWWA 2QULA 5AC6A 1RSCA 1TPUA 1ONRA 4KCWA 3K4WA 4GQGA 4J2PA 3MBFA 4AIBA 4REQB 3UWWA 1SR0A 1YQ2A 3EMCA 1LL7A 1M01A 1EC9A 1LL6A 1FDJA 2J7CA 1TVNA 1P1XA 2Y0FA 1V6TA 4B91A 2POZA 1QVBA 3SSZA 2VCAA 3MYOA 1SZFA 1A5BA 3M7WA 3FNDA 2AL1A 3VD4A 1D7KA 4DXKA 3WFZA 4GX8A 3K46A 1JUKA 3TVAA 2B7QA 4JHMA 4POCA 3W83A 2ZX8A 4E8CA 3WH8A 4DYKA 2BOEX 3B0XA 3BV7A 1TV7A 1TJ0A 3TXVA 4KWUA 2Y24A 1YPFA 4QQ3A 4KFPA 3W7MA 4F4RA 4RX0A 4W7WA 3L21A 3TIMA 1TWSA 3EWCA 5AYBA 1DJYA 4QNWA 3WKZA 3IS4A 1AW1A 1FY6A 5F4XA 1A5AA 1Q4NX 3S2NA 1ZBWA 3W7IA 3D3FA 1ZENA 1GONA 4UTHA 5LNSA 2OXNA 3CB8A 3HG5A 3PANA 1CGTA 2X40A 2J9YA 4XO7A 3M0LA 3UWQA 1VHCA 2D2JA 5AHMA 3MCNA 3CV2A 4JDYA 3S2JA 3DERA 3VKAA 1VHNA 1J2BA 3PJWA 3O3RA 2G3IA 4CCZA 1TMQA 2Z27A 4H8UA 5HINA 1TV8A 1T8QA 2WVUA 5DN1A 3S6DA 4S3BA 2YDSA 1VPXA 2WZMA 3A4WA 1XC6A 3QXBA 1PZ0A 4DJFA 2FZBA 4WVXA 3TOYA 4CEUC 3BAKA 3KOXA 3PTQA 4UTKA 1EZ2A 1DXFA 2HVNA 3LGGA 2ZXQA 3QC3A 4UTTC 1O7AA 4HBKA 1DHPA 1WO2A 3V5CA 3AZSA 1G7VA 1EGVA 1XSKA 3AYVA 4CGTA 1Z44A 1FXPA 3GS6A 1XPGA 3MO4A 2ISFA 3UR2A 2YLLA 3SQSA 2YSWA 5KTLA 3LK6A 4UCFA 1V5XA 3IV8A 3FHQA 2OOFA 4DHGA 5BWAA 2V3DA 3WL0A 1KO0A 2QV4A 2WCAA 1M7PA 1SMAA 3MDUA 3E5PA 3HURA 1W2VA 3MWAA 2H9AA 1SQ7A 1I2RA 2A5HA 3EWBX 2PUZA 3THQA 3TR2A 2V5CA 1A0EA 1TWDA 2DSZA 5C6MA 1GCYA 3NDOA 3JVAA 3PPHA 4DZHA 1AJ0A 4TVCA 2FFCA 4JTGA 3FK4A 5B7YA 4FK9A 2W61A 4A6GA 3SUVA 3LM7A 5LA1A 2ZTJA 1BGGA 2CKSA 1S2AA 1XLKA 1PX4A 1J12A 3H2CA 1R3RA 4UZSA 4TV5A 5G2WA 2WMIA 1JEZA 4B9ZA 3QRHA 5HULA 4NJIA 2VUYA 1Q85A 3LMYA 3IVTA 3S5SA 3NURA 1S2VA 4OBSA 2BY0A 3CZLA 1KB3A 5ABGA 4GI8A 5DMMA 1KBBA 1EC7A 4I7WA 2XUCA 4FPSA 5KZEA 4YYCA 2QEZA 3IGSA 3R25A 1IIGA 3PWAA 5REQB 3HF3A 4AVOA 5FA5A 1KM6A 4PE8A 1Z8AA 1JR1A 5CPSA 4WXYA 1G0CA 1RLCL 1E4MM 4GABA 3WEOA 1TTIA 4HA4A 4AY8A 1A80A 3KL3A 3D5HA 1M1BA 2QCGA 1W9UA 1JPMA 3B0YA 2H90A 3LG3A 4JX6A 4AIEA 2XFRA 1B3ZA 1BXNA 3AHYA 2QAPA 2E09A 1ZALA 1UASA 1R7AA 2F7FA 3QC0A 3EA3A 4J3XA 2GUUA 1JQXA 4Q22A 3K8KA 2VURA 1V6WA 4W5UA 3DYMA 1K7XA 3A24A 3QV9A 1WZLA 2PS2A 2XN2A 1TPH1 4RE4A 3C2YA 2ZRVA 3H2NA 3H2EA 1OCNA 4KT2A 2ATSA 3VINA 3W53A 2E6YA 1V3HA 3GO2A 4H7VA 2I57A 5HATA 1E40A 2HNEA 4OVXA 4X0VA 3WQCA 2QLYA 4AMCA 5DX7A 4QJ5B 1GEHA 1XIEA 1HKJA 1XF0A 1H1YA 3GVWA 2VZOA 4YTRA 5BXPA 2PGRA 3ZVIA 1R3VA 4YLWA 2HWGA 3W76A 3HM7A 3RPMA 4JCMA 1OC5A 3UWEA 3ZWTA 1R38A 3LPOA 5LZLA 5I06A 3SCSA 1MZHA 3AXKA 2GZXA 1P0DA 3QW4B 1W5MA 2OSYA 4UTWC 4QX4A 1WQ5A 5AC4A 1EO5A 3QOKA 1SO5A 1QNRA 2C1IA 4XKMA 1HJXA 6TAAA 1FWWA 2PDKA 5DELA 4WEVX 1LWJA 1UH3A 4QRNA 1U1JA 1XPYA 3MW7A 4R9XA 1RCXB 2WBGA 3UD6A 3TMQA 4GXWA 3RO8A 4LYPA 4K8EA 1BYBA 3C52A 1ICQA 3MKCA 1XRTA 2ZRUA 3G24A 4A2SA 2YOCA 2O92A 3S9ZA 1VFFA 4UFJA 3QM3A 2QYGA 5D2VA 1V0KA 4LY8A 2ESCA 2UY4A 3A3XA 3A12A 1H62A 3B9NA 2Y6ZA 2OG9A 3D0CA 3AJXA 4F0LA 2PGWA 5LIXX 3V0UA 3TYAA 4M0XA 1XC4A 3OPSA 3DBPA 3L23A 1N7KA 5A3HA 2Y61A 4HK7A 4G9PA 1IZCA 1OCJA 2XSBA 2YXXA 1V3JA 3PPCA 2Z6JA 4M81A 1IQ8A 3VUSA 4EXQA 1TUFA 8TIMA 4LT9A 1OWQA 1S1RA 2J78A 3B4UA 4MJMA 3GW0A 2YDRA 1E5JA 5A95A 2VXNA 4B15A 3HTWA 3R8GA 3TZNA 1VIWA 3TK7A 4AY1A 1YEYA 2X0YA 3OIXA 1ZCOA 3GDKA 3W02A 4GGHA 1XLEA 4IT1A 3NQVA 2ZZ2A 3EMQA 3O0KA 1KR1A 1JNDA 3FA5A 1H09A 1PTDA 3V5FA 3GAKA 4FAMA 1GVOA 1HL8A 4F9JA 1SJDA 1WBJA 4Y9AA 4IFRA 2Q02A 4RDZA 2OR2A 2QKFA 3RJXA 2AMGA 1CGYA 2GJPA 1MWOA 3U8GA 5D05A 4IIDA 3MCMA 4CN1A 2A7RA 3FYPA 2PB1A 5HANA 1TZ9A 3CZJA 1HUVA 1ODZA 3MMWA 2BDQA 2VZVA 3EA1A 3BG5A 3GXMA 3STCA 3QMTA 4DZ5A 3S4TA 1BWLA 4NG3A 2BB0A 3IARA 4URIA 5D38A 3NCOA 4XAZA 5E0KA 1JJKA 3MP3A 4H6RA 2X2YA 2W3ZA 3EGJA 4C6EA 3SN4A 1GOKA 1EEXA 1JRBA 2INZA 2F61A 2YZ5A 1I0DA 5HOSA 3GYCA 3NQ7A 2C1GA 4ROPA 3QKZA 1RR2A 2WVVB 3F1QA 1GOXA 1NM9A 1F5ZA 3MS8A 1F05A 1VJSA 3NL2A 4FALA 3EKZA 1EEPA 5FJIA 4QJ4B 2FB2A 1CYGA 4EXAA 1Y7VA 3CHDA 4H3DA 4S1FA 5I3GA 4IIHA 2GSJA 4LVDA 4B5WA 3CZKA 3BAWA 1XISA 5AYZA 3PBWA 1XICA 3WDIA 1BQCA 1FP8A 3CAKA 4V15A 3QYQA 4PL1A 4FMVA 4JEQA 1JDDA 2YLAA 2R14A 1GWJA 2A3CA 4DRSA 1DWFM 3U57A 4RR4A 3WLHA 1GYLA 3B06A 1W1TA 4M7TA 3O0FA 2ISVA 4JDBA 4IP5A 3O6DA 2AGKA 3ZLFA 3W70A 3DGRA 1W3KA 4W85A 2NXGA 1KR0A 4MJZA 1CPUA 4GY7A 2AQOA 2G96A 5H6HA 1W3HA 3P62A 1V3KA 2EKGA 2VC9A 2WOQA 1PUDA 3DHDA 4IIEA 3PUDA 4A4AA 3FS2A 2V30A 4C6QA 3BLOA 3EWYA 1BQGA 4B2DD 5BOOA 1DJWA 5CLWA 1RJPA 1A3XA 3VCNA 5AYYA 3RN6A 3DFNA 4BS0A 2VZTA 3MU7A 3P74A 4HK6A 4IMEA 1R85A 3V0SA 4HK5A 2G41A 1OX4B 2PP0A 1OK4A 1CLXA 4S2BA 1NSJA 3L4TA 3EX6A 2DVXA 4BJHA 2IPWA 4MLRA 2DZWA 3T2QA 3A13A 1SFSA 2PTXA 1UC4A 2EKCA 1V3MA 2A3BA 1W3TA 3CUZA 4WX2A 1UIPA 4DI9A 1WPCA 1HKWA 1VLIA 1C90A 1XIGA 2F6XA 4JFUA 1XBVA 1XJBA 4DLMA 1FOBA 4HHLA 3BWWA 1YHTA 3PULA 3L65A 4GUFA 1NY1A 3LCWA 3CYJA 3H24A 2GPTA 2VR2A 1ECEA 5I79A 2FB3A 3SECA 1JXJA 2ABBA 1ADOA 3L2MA 4EOUA 3BH4A 1EYEA 3MO7A 1TG7A 5FEWA 1FH9A 1H1ZA 2BVYA 4Q8UA 3VOJA 5BOEA 1WAUA 3TONA 1U5HA 2HE8A 1R3SA 4I5RA 2ZFAA 2G3NA 1JZ8A 4EPBC 1XLHA 4Y9OA 2EG8A 4R3UA 3OHIA 2X1RA 3R0DA 1KTCA 4ZQOA 3W6YA 3LQLA 1KM0A 4G5DA 4CNNA 3ZR6A 4D72A 1ZFJA 3C4UA 1M68A 1FHLA 1P0KA 1SUXA 1PKNA 1E4IA 3AMDA 1N8FA 4ZMGA 1SYTA 6PTDA 3EBVA 1JDFA 3H6OA 2YIHA 3TEVA 4LVAA 2XVLA 4ENLA 3LCXA 3L2IA 1JZ3A 4P7RA 1OB0A 3R10A 1L8NA 1Q6QA 4UTJA 5CSSA 1RVKA 4EK7A 4FX8A 2PTDA 4DUOA 3MUAA 4L4OA 1QPKA 3DHFA 4DY1A 5HPOA 1X97A 2AGTA 4PTDA 5G1MA 5DFAA 1VENA 3C0JA 1QXLA 1E3ZA 1G01A 3QQ1A 2F9RA 3DUGA 2NUYA 1TV2A 3TLQA 3QV6A 4HPXA 5KITA 4RXFA 4R85A 1KFLA 4UNKA 4V1YA 4W8BA 3LLFA 4LY4A 2O4MA 2V2HA 1NWRA 3WELA 4OE7A 2PTWA 3G1FA 2YCLB 1GJUA 3C2OA 2R6OA 3NQAA 3WLJA 4CD5A 1QMLA 1W1YA 3L68A 1DQXA 3DFOA 3W2KA 2A7NA 4WR3A 3GDBA 4YVXA 1PKYA 3GUWA 1XFBA 3RLHA 3RM4A 1IEVA 5AHIA 3BDKA 2WNZA 1V02A 3B8TA 4UTUA 1XYBA 1RAKA 4EWJA 5K4XA 2ZUMA 3RAOA 1O1ZA 1HT6A 1FHVA 1U5VA 2J8FA 4JTHA 1IT8A 1VF8A 3MUCA 3GU9A 1IIHA 4C5ZA 1W9VA 4NI3A 3TTQA 3JS3A 3PM6A 4RXGA 3QQWA 3DFYA 1M9HA 2EQDA 3GDRA 1YLVA 5DY3A 3P93A 3DKJA 4OWGA 5C9ZA 4QAIA 4Y9NA 4PMXA 2BGSA 4NAFB 2ZBTA 1XGZA 3EWZA 2J74A 4HHMA 3W23A 4YMZA 3VNIA 4S39A 2DVUA 3G1HA 4M29A 1JI1A 1QW8A 5DXXA 4GI6A 4MNMA 4QBXA 2NX9A 3U48A 3UZWA 1VCGA 3UCCA 4NNBA 3V1PA 3VUPA 2GVLA 1TWWA 2NQLA 3UXKA 3OTRA 5FSDC 1JD9A 3OYZA 4O8AA 5BNKA 4B16A 1UZHA 4Y8EA 1XS2A 4IXXA 2VX6A 4JNYA 1TKKA 4NX5A 3PUEA 2QUUA 4Z0JA 2J8GA 2OQYA 4LAKA 2W27A 3W1QA 5AC8A 3CIWA 1TVLA 1UR0A 4HOXA 4ZGYA 3SCNA 4H9XA 3EX2A 4C6BA 4PUMA 3S6OA 2KAUC 4IJBA 3ABSA 5M03A 4ZR8A 4XUYA 3R12A 5IM51 4LVGA 5T9CE 1F6PA 4KQNA 1KM4A 3G8EA 4AIOA 3IK4A 3GXTA 3QH2A 3VIHA 4KMQA 4ECLA 1Y5WA 2J25A 4PUDA 1Q6EA 1OX5A 3UJEA 1DV7A 4JEJA 2PLMA 4IQDA 4WSHA 1DJGA 1M6JA 1TYGA 5DANA 4O0KA 3O07A 3ONBA 1XRVA 1JZ5A 2E7FA 5I03A 3UNTA 4KW2A 3QVQA 3PZQA 3FYYA 2IQ0A 5HWMA 3WK2A 3L7RA 1EJWC 3GR8A 1CB7B 3LQGA 1WYIA 4MB1A 1OGGA 3KRSA 4Y9PA 4GZEA 3HMCA 2GVJA 1P5BA 2BVDA 2ASHA 3GXFA 1R9YA 1B3XA 2VWTA 2VL4A 2WM0A 4TTUA 1R0MA 4Z2IA 3GNXA 1XLMA 1ZP4A 2ICSA 3M0XA 4HNCA 4WDUA 1EYWA 3HZ3A 2W0UA 4NRRA 1AJZA 4YIWA 3F2BA 3IGUA 1HL2A 3EXTA 3INPA 3M0VA 3URQA 1TJRA 3LEPA 1W31A 2WPBA 3SO7A 1EKOA 5IRPA 5I6SA 3UY7A 2EAWA 4IM4A 2X8RA 4IMGA 4CKQA 1QPQA 4GXPA 1UMLA 2X1IA 1X38A 1W1B1 2CXGA 1Q2SA 2W9MA 4HPGA 1UKPA 1GPWA 2D24A 4UR9A 3OQEA 5K3VA 1V0NA 3W0KA 5I3JA 3FVDA 4CCCA 4ZENA 3WNOA 1XRSA 3RIKA 1QUMA 4LUTA 4GUHA 3BPWA 3H2MA 5LIYX 3B8IA 3A4AA 2WSYA 1FWEC 4JTLA 1BG4A 4ZQPA 4DBUA 4RW5A 3TUUA 3WJWA 4XD4A 3W27A 3BC9A 1AH4A 4QEEA 2XFWA 4LEFA 5TQLA 2X7WA 4PTNA 3FIGA 3UG4A 4LF2A 1Z42A 5CH9A 4RZBA 1P0EA 1QNQA 3EWXA 3W7GA 3C0QA 1LRQA 4AY7A 1RXOB 4I8DA 3QBUA 4F48A 3G3DA 3N18A 3BLIA 3LTSA 3IUIA 3VXGA 1JYVA 4DLFA 2VELA 3BW4A 2PWEA 3WQPA 1RBAA 1AZ2A 7TIMA 3UCQA 2VZUA 2Y8KA 2J7GA 2NXHA 1ZNNA 3G0SA 1N8IA 3UXLA 2Z4GA 3W74A 4DXVA 1C92A 3C61A 3AXMA 2VEFA 3NUKA 2PSNA 1V7YA 1XIBA 3EB2A 4Z1DA 1AUSL 2DT0A 2I9EA 2JALA 2WSRA 1E9ZB 5F1VA 3V75A 1UUOA 4J5NA 1ADDA 2XZ9A 3DX5A 4ZFMA 2QQ6A 3VABA 5L6UA 3LRMA 3UESA 3HJEA 3FJ6A 3KCJA 7REQA 1JNEA 4L6DA 2J7EA 2W91A 4J28A 4HPHA 1QATA 3KOYA 3E02A 1UP3A 3WO8A 4NZCA 4PBEA 4MF4A 5ABHA 3NL6A 1IT0A 1CGVA 1CXIA 3A4JA 3MUY1 3RPDA 3QEZA 2PC8A 4F0SA 3FSUA 2X09A 3PNZA 3E96A 4S3CA 2HVMA 2WNWA 3KHJA 3GTXA 1ISYA 3WBAA 4A21A 3ITXA 3CPGA 1UWSA 1QAPA 3EB4A 3IJ8A 2DV0A 2D1ZA 2FZ9A 1HGWA 4NI8A 1MQQA 3GXIA 3FAXA 3FY1A 3V16A 1GQIA 2ACRA 3LERA 5DLCA 2DVTA 1MW2A 3QGVA 3A9BA 5HJLA 2PZ0A 4QJ1A 3VILA 3WDRA 3WQ6A 5I24A 2A3AA 4NJGA 1JZ4A 4NYYA 1DTUA 1OG6A 4Q4MA 3R6IA 3CT2A 5DRIA 1RBLA 3HOJA 2B0MA 5GNZA 4Q8MA 5AHFA 3T8LA 1OF6A 1E1CA 5LHEA 2VRJA 2CEQA 4NQ1A 4Y7EA 4JKMA 1MEHA 1G7UA 2ZUWA 4E4PA 2HNHA 4A29A 2O9TA 3CLMA 1K9DA 3UERA 5FAJA 1W37A 4LGXA 4PR4A 3OBKA 4ZBCA 5H8MA 1PBGA 2ZUUA 1FHUA 1SM9A 2VRKA 1QHOA 3PJTA 3ZR5A 2HPMA 3XIMA 5HJYA 1UG6A 5EMMA 1H3GA 2IXUA 4JFSA 3RX4A 3L5MA 2PWVA 3B8VA 1EUNA 2Q8LA 3WJXA 4FNUA 3N04A 1FCBA 2E3ZA 4HA3A 3MI6A 3BAJA 4MWAE 1BYDA 4M51A 1DXEA 5H1WA 2BP1A 4R7WA 3SQMA 1UPMB 2ZXAA 4LAUA 2CLKA 1EIXA 4QE5A 5A6SA 3E2QA 4W87A 4UQ9A 1XGDA 1LCOA 3WG6A 2H9AB 1PZ1A 1YW1A 1B31A 3ARXA 3PY2A 4BA0A 4C6OA 4WSKA 4IF2A 1R6WA 3CV7A 2ZXBA 2J66A 3NXLA 1QO2A 1EA9C 1XCXA 4EAMA 4B5UA 4PGLA 4O14A 4BF9A 5FJTA 4PTXA 5HQLA 3WX7A 3A23A 4GGBA 3CZGA 3QSTA 4GH1A 5K9CA 2GGHA 1ZY9A 5D9OA 1H60A 3W22A 1V77A 3W85A 3UYCA 1O5XA 2Q8ZA 1AD4A 1EB3A 1RH9A 3LS9A 2NQ9A 2H8XA 4FXSA 5AY7A 4D1IA 1AA1B 1TIMA 1LBMA 4KGLA 4CUCA 4IGSA 3BW2A 3K30A 3VIMA 3M64A 1KBKA 3QR3A 4JTKA 3VIJA 2YDQA 4ZFCA 4HD5A 4PBFA 5FJJA 5DO8A 3SGUA 3TNOA 4GYJA 3E9AA 4EWND 2CLHA 3SIZA 3AO0A 2V5JA 3MANA 1P6CA 1HO1A 3ONCA 4QITA 4Z1CA 1M5WA 3MQTA 4IWWA 4ML9A 1A5OC 3G6MA 2F6KA 4NZJA 2Y5SA 3APYA 4NUWA 3PSWA 3GWQA 1JF5A 1HG3A 3QY6A 1WDQA 2QJJA 4W7UA 5G2IA 5D33A 4V28A 5BU9A 5EPDA 4DM2A 1TZ7A 1BVZA 2MUCA 3WENA 2ADAA 4GKLA 1A5CA 3OLEA 1D8CA 4AZIA 5HR6A 5G4WA 1H41A 4N7QA 2ZADA 5HJXA 3U7BA 5I3DA 3AC0A 4JIEA 2P76A 2RJGA 2XZ7A 1BG9A 3KM8A 4NU7A 3GR7A 4G7FA 4PCPA 1TJPA 3QR1A 1MEIA 2PDCA 3SBFA 2GDUA 1XUUA 3FEQA 3KBWA 1KM1A 3V1HA 4Q8OA 4J2MA 2E8ZA 1UKQA 1KXHA 2IUZA 3I10A 3U2CA 2PDUA 4P7QA 3THCA 3D3AA 1LZOA 1SJBA 3U5UA 1TR9A 4LU0A 2NV9A 3ZJKA 3IIOA 3IUDA 3WL1A 2VD9A 2CETA 1ONWA 2JKAA 1H5VA 1HKIA 3CIXA 4ATWA 2YL5A 4XKYA 2PWFA 3M44A 2NWSA 1QI0A 3MDWA 4AW7A 1XYLA 2NVDA 1SFTA 1R2SA 2XH2A 3SFWA 1IXPA 5CZSA 3CHVA 2FVKA 3LBOA 1W9XA 3HV8A 3AZTA 2Z26A 3B9OA 4US5D 4ZCWA 1XLBA 4PRTA 4LV4A 5G1YA 2V3FA 3TYZA 1XSIA 2PDLA 4FP1A 3SFKA 2WXDM 4JKLA 2WHMA 2WQPA 3ITOA 3CNYA 1XH1A 3LD5A 3TFXA 1WXJA 3OZOA 1J8VA 3QZEA 3GNRA 1EF3A 1AD1A 4K6AA 3TC3A 3PR2A 3VIFA 2A0NA 3DXIA 3NJ3A 1MRAA 4O4VA 2OOGA 3FJLA 5A6BD 3CQ0A 2Q71A 4LV9A 4O1AA 4US6A 5GPRA 3DN5A 4JTUA 2PLCA 2NQHA 1KRMA 1UUMA 4IL0A 3O2LA 5KZ6A 1AVAA 3UPMA 4W8LA 4BCEA 3VDHA 1D8WA 4XZBA 1H5YA 3GIYA 3S1VA 2DT1A 4O1DA 3RUBL 3GZAA 2O7QA 1E0XA 3IANA 4DNHA 4AYSA 1UKOA 4Q33A 3W07A 2G37A 3NQBA 1I1WA 4Z08A 1ODUA 4GMEA 2WLZA 2DSWA 1NWUA 3VOHA 4LNCA 5G4EA 1E51A 3URBA 3NEVA 5BZAA 1NOUA 4HNLA 1KTNA 1O5KA 5C2XA 1YPXA 2Y7FA 4HNOA 1NQKA 1MSSA 1M41A 3RLVA 3WH6A 4F0KA 4FIRA 3LGDA 5LA2A 5FEZA 1J96A 3WMCA 3LMZA 1LL4A 3VDCA 1R47A 2BHUA 2VVSA 1K1DA 1GEQA 3O6AA 3VDGA 2XVNA 1OVDA 3LRKA 1HP4A 3BZJA 3SN1A 2QHAA 4UR8A 2DH3A 3I6TA 4JYDA 4AISA 4MJ4A 1KCZA 1TCMA 4DELA 4HMEA 4H6KA 1ZBCA 1XH2A 1J10A 3ZS4A 4PRWA 3LI1A 3TYEA 4CQ8A 3UFYA 5A94A 2ZWYA 3RILA 1TB3A 4G2DA 2ZUVA 3FLUA 4MJ2A 1DQUA 2QXWA 4S3KA 3QHOA 4O18A 3NA8A 5FAGA 3VOCA 3BAIA 3GIPA 2FKPA 1ZJHA 1L6GA 5E1QA 3G1YA 4S38A 3P7YA 1U1HA 4AX6A 2NWRA 2DQXA 4NY2A 3FXYA 2D2HA 3B4YA 3QF0A 2CZVA 2Y88A 4UTIA 1CGXA 1GPFA 1T8XA 1XSJA 4XSMA 2WJFA 1V8EA 5ABTA 3ZT6A 2CKRA 4HU0A 3WZ0E 4X61A 3SY5A 4L4MA 3AIUA 2P8BA 1FCQA 2OT1A 4LYKA 3WBEA 3W6LA 5I3KA 3L0KA 5HDRA 4ZXLA 4JTJA 2ACUA 1P4CA 3P5ZA 3PJUA 1W1A1 5AFDA 3LHUA 4M5PA 2DIEA 4XZHA 1KW1A 3GXPA 1MDLA 4CCDA 3VD5A 2YX0A 4XK2A 3RMJA 2TYSA 3PZVA 4P8UA 1VFTA 2VDGA 3BARA 2OYLA 2G3FA 2ISWA 2AQWA 1FWHC 4UQDA 1KV8A 1MW0A 3I6EA 1CXKA 2O0TA 2XISA 1Z48A 1EOKA 1JD7A 3VIKA 4C6FA 3DCPA 4MZ1A 2ZXDA 3E0VA 3ARSA 3W28A 3W2LA 4BZYA 1GQKA 4OQVA 5F7UA 2I16A 5E0FA 1XW8A 3GYEA 5KEZA 4X9YA 4CD6A 1VS1A 3F5LA 4HGXA 4XVEA 4WUIA 2QF7A 3VGHA 4H19A 2YJQA 1HXJA 1RVGA 2Z25A 4XZNX 3AS0A 1MFUA 4DQWA 3FHAA 2QCDA 2VNCA 1HJUA 5ABFA 5GJMA 2FGBA 1UD5A 3SW6A 4AVNA 3TMLA 4YN5A 5GQBA 1XIMA 2YBVA 3F4VA 4W7VA 2YL9A 1J0KA 1P43A 5T26A 2W67A 5CG0A 3CXOA 3EWWA 3RM9A 3NO3A 3WIJA 5C70A 2OZ0A 1SZNA 5C54A 2Y8UA 1UB3A 2D0FA 4BK9A 4Y90A 3LV6A 4Q8TA 1XD0A 1VFSA 1FWNA 1QPRA 4GIYA 3L0GA 4G1NA 2XVKA 4GQQA 5FJOA 4PEEA 1PTGA 4LBRA 4LAMA 1LBFA 4QSHA 3VC5A 4E2VA 4A3HA 1US3A 3ARUA 4GCXA 1OT2A 4PUKA 3LTYA 3UR7A 4O28A 3GXNA 3SCPA 1OFEA 3E2SA 5EFFA 4UNIA 1POKA 3NQCA 3OLDA 2PWHA 3TU9A 4BI6A 1XBZA 5EMYA 3LCGA 2VGGA 1ITXA 4ADSA 3S46A 4ACYA 1KFBA 5C2CA 4JN7A 1RQBA 2E8YA 4MVAA 4GUGA 4QP0A 1YX1A 2PP3A 1XYMA 2E6AA 5J5RA 6A3HA 3NZRA 2E5DA 1Q3NA 3N3TA 1JFXA 4GKTA 1Y5XA 2YCJA 3V35A 5BXRA 3E2VA 3TLLA 1TSIA 3TTOA 1FWIC 3URAA 3BCJA 3TTEA 4WDTA 4XAGA 2E5CA 2I5IA 2BOGX 3ZYZA 1X6NA 3C56A 1WZAA 3DECA 1J9YA 4O11A 1HJWA 5KINA 2B7NA 3TSDA 3NPWA 1TTJA 2QV5A 4MGGA 4MMWA 4ACZA 2ZRXA 4NZ1A 3C2FA 3SRDA 4UC5A 1YMYA 5HQEA 3WBYA 1A49A 5DMNA 4H9ZA 3CEUA 1E9IA 3CHCA 4JTFA 4ERAA 2YZRA 3MSRA 2PTYA 1IF2A 3F5KA 3W24A 1TPVA 3LCHA 4IISA 2PWGA 4WZHA 3NAVA 3DFHA 2NV2A 1NIUA 4HZMA 4WJXA 3CZEA 4XAPA 1TVPA 4Z1BA 5EY5A 1JULA 3WQEA 4FOKA 1OINA 1EJTC 2NQZA 3T0AA 4Y9MA 5FL1A 3KVLA 1Q65A 1DWGM 1TPB1 2CIPA 2XIIA 3TYUA 4IX0A 3VOIA 4U31A 3USZA 2OU4A 4DBSA 4Q4QA 4AZBA 3K13A 4ADUA 3FW6A 1ZUAX 1IXOA 3F4NA 4H1ZA 1UH4A 3VKKA 1VJZA 2HS6A 4CCEA 4YS1A 3M0YA 2XM2A 1EL3A 1UC5A 2ATMA 2CBVA 1V51A 3GUGA 1SJCA 4YWSA 3V5OA 2POTA 2VQTA 3LZ3A 1POJA 4LYRA 2NT0A 4HMDA 3RITA 4JIIX 1GK8A 3PS7A 4I9AA 4PCNA 4O53A 4XAYA 2JBMA 3W7LA 5E6YA 2ZVRA 4JQ1A 4B9YA 2WNNA 1F76A 3UWUA 3OODA 3WDQA 2VX7A 3BLDA 1EXBA 3WLSA 3PVFA 4D8AA 2R8WA 5EFDA 3MJMA 3TZFA 5BW6A 1JRCA 2OX4A 1MW3A 1MVYA 3AIEA 3QW3A 3AHVA 3QTGA 2VEMA 2BZNA 3QTPA 2G0WA 5I78A 2OEMA 3RG6A 4MPKA 4BQ5A 4Q3MA 2VDIA 5AN7A 3U2ZA 2WV8A 3ECQA 2FPTA 2A6LA 3BGAA 1OSEA 1ADSA 4LH8A 4IMDA 4GHRA 1RHCA 3SI9A 3ITVA 4NZ3A 1TJ1A 3PSVA 1LYXA 3GXDA 1W3LA 4BF5A 3KFTA 3D6NA 1TX0A 4QSFA 3V3WA 1MUCA 3SM0A 4ZQMA 5HXMA 1J2WA 1GHRA 4I5XA 5DEZA 1IXQA 4Q8WA 4DJEA 4E8DA 2EG7A 4RV8A 5JIWA 2DSKA 1HKVA 4E0CA 5C7HA 4MLJA 3ZLGA 1RUSA 2C14A 1E72M 1TIWA 4CD4A 3V0TA 2O7SA 1ME9A 3RHGA 4K38A 1JPDX 1DWJM 2DY3A 4C6KA 3VZXA 1IWBA 1QWGA 1IV8A 3AZRA 3N29A 4AD0A 1I6NA 4AWTA 3SY8A 3RRAA 3PZGA 1VIZA 1MXDA 3GZ3A 3W2UA 2O4QA 1H2JA 1JXKA 3VO0A 3CTLA 3P0WA 3BZGA 1QBBA 3EPMA 1WUFA 2VFIA 4UMCA 4H9YA 1VH7A 3T9PA 3IGHX 4MUPA 4GYFA 4BWLC 1AMKA 4KH2A 4HOWA 5EGRA 1JPKA 3H4WA 4UOQA 3BSHA 1DWHM 2J4GA 3HN3A 4ROQA 4DWDA 1E1EA 2TMDA 4RW3A 2F8QA 1UR9A 4QS6A 4L9XA 2VEGA 4KS0A 3U2OA 3URNA 2QPUA 3AYTA 2FH6A 1HVQA 2W4XA 3ITCA 3LNPA 3V4BA 4JFVA 4CNTA 1J93A 4JNMA 4NAEA 4AF0A 1RY8A 1LLWA 3E0LA 1W5OA 3GVRA 3LHVA 3I4KA 5M17A 4C6LA 3FA3A 4UWMA 4DYEA 3OP2A 1G69A 2WMKA 3ALGA 5CPTA 3CUXA 2GYIA 3DFQA 1AW2A 1B0IA 1HL9A 1NVMA 1UYQA 2ZZ4A 2PDJA 4H6EA 2VENA 2R1PA 3ARQA 4DWSC 1E73M 1I2OA 4H2HA 3SUUA 4FNPA 1JFHA 2BY1A 4GC3A 4CN6A 4IHCA 1M7XA 1AL8A 5JH2A 2C3ZA 2WWCA 4ZB2A 3ITYA 3R8HA 3K1DA 3S0CA 1S5TA 3L5AA 3ARTA 3UVIA 4AVFA 1QK2A 4DUXA 2HROA 2DZAA 4DZAA 4KRUA 3AHXA 1OYAA 2XGBA 4LS2A 3Q58A 4B5NA 3O9NA 4ZTXA 4PCTA 1E43A 5HWNA 3HMJG 1B1YA 2ZX7A 1EGZA 4B5VA 4BQ2A 4AXNA 4RCXA 1AODA 3CB3A 1M03A 1EX5A 3NYZA 4GLEA 4WOQA 5IBXA 2JF7A