4NUQA

Crystal structure of mouse n-cadherin ec1-2 w2f
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
b'DFVIPPINLPENSRGPFPQELVRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDRELIARFHLRAHAVDINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cadherin-2
molecule tags Cell adhesion
source organism Mus musculus
publication title Structural and energetic determinants of adhesive binding specificity in type I cadherins.
pubmed doi rcsb
total genus 46
structure length 215
sequence length 215
ec nomenclature
pdb deposition date 2013-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4nuqA01
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 4nuqA02
4AQAA 1ZVNA 1WYJA 1NCGA 3UBGA 4AQ8A 4APXA 4ZMVA 4AK1A 2O72A 2OMZB 3UBFA 4AQEB 2WHVA 2QVIA 2YQGA 3PPEA 5CZRA 3Q2WA 1WUZA 2V37A 2OMTB 4NUQA 2OMUB 3K6FA 2OMWB 2WCPA 4ZMLA 1NCJA 4NUMA 4AQ8C 4ZTEA 4ZMOA 4ZMQA 1FF5A 1O6SB 3K6DA 4QD2E 4ZMTA 1Q1PA 3K5SA 2YSTA 4ZT1A 5JYLA 1NCIA 4ZMWA 3K6IA 4OY9A 3LNDA 3LNEA 1NCHA 4NQQA 2A4CA 4ZMZA 4ZMPA 3K5RA 2OMVB 4ZMXA 1OP4A 3LNIA 3Q2VA 4ZI8A 3Q2LA 4XXWA 1ZXKA 5DZVA 2OMYB 3LNGA 3MVSA 5JYMA 2A4EA 3LNFA 4NUPA 3Q2NA 5KJ4A 3LNHA 4AXWA 1SUHA 2QVFB 2OMXB 2WBXA 4APXB 4AXWB 3QRBA 4XXWC 4AQAB 3FF8A 1L3WA 4AQEA 2EE0A 2X2UA 2WD0A 3UBHA 4ZMNA 4ZMYA 1EDHA 3FF7A 5CO1A
chains in the Genus database with same CATH superfamily
4AV5A 4PJ5A 3BT2L 2CIKA 2COQA 3MUZ1 5HI4C 1XTMA 4LIQL 4JCWA 4BH7A 4M7ZC 4RMBA 5C9JA 4M00A 4BKSC 4OJFH 1WWBX 2NDFA 4XBPB 2CRIA 2R2HA 5E8OA 3QUZB 3G5WA 1F58L 1X9QA 1XF4B 4TRPL 2VE6B 4NOFA 4LCUA 2AEQL 3RWEB 1C5CL 2HFGH 3CDCA 2V0AA 3P0YH 3TN0D 2FR4A 1MCFA 3BO8A 4Y16B 2EXYD 4FLRA 5AAMC 1Q0YH 1U92A 1RP8A 3M17A 5EO0A 1MUJA 5H35B 1TF4A 5JNYA 5IM7A 5I5IA 4CDGC 3TP4A 2UVEA 4X6FB 4BFGA 3DIFB 2UWEA 2HLAA 4IW4C 4JM2B 4LCCB 1CICC 4GS7B 1FLRL 4X5XA 3V9EA 1KB3A 1R47A 4HS3A 5E94B 3GINA 3RX8A 2XKUA 3QO1A 3PWLB 2CJUL 4N6RA 4R4ND 2X9YA 4YSTA 2AJZB 3NIDF 1KBBA 4L1HA 1RZGB 2G2NA 5B38B 2WQXA 1FZJA 2W94A 4AENA 4K7PY 4P5TB 4AL8L 2MQCA 3HJ0A 3MRHB 3RUGB 1JV2A 4Z7UF 4MB4A 2V5YA 5ADPL 1ZV9A 1CT8A 3UX9B 3MLXL 3QCVH 1GS8A 4L4TE 5KZCD 3X13B 3TGXA 1LO5B 4NQCE 4EKXA 5C7ZA 3LXCA 1QWHA 2PYED 5HHVL 4KZEH 4GI9A 3HHRB 1THAA 2QDVA 3K5RA 4WJ5A 3KWWB 3REVA 4HULB 5BJTA 3V95A 2D3LA 3BCFA 1KF9B 1S9YA 1J9SA 2ZCKL 3K8MA 4PJ5E 2NZ9D 3I75B 4RSVA 4WDIB 1TFHA 4S0HA 5C0CB 3CN4A 3OKOA 3SKMB 2BOCA 1GAFL 4RMTA 5CKGA 5KJRL 5CBEB 3BJ91 1QNZL 3PIQA 5FA4B 2IFGA 3MOBH 3U79A 2OAAA 4NBYB 3QZOA 4H8WH 4AYMC 4C56A 4D7BA 1KFGA 3APDA 3OSKA 3LNHA 4OD3H 4U3HA 4YE4L 1J9TA 5FM8A 2OMTA 5EFIB 3UYPB 3L6FA 5DS1A 3OX8A 1SUHA 2ICES 4RQQA 3ZE0F 4XTRC 1VZHA 1ETB1 4K8RD 5AQ0A 3QNYB 2NYYC 3ZYJA 1Y0LB 4O4YL 2E3VA 1AG6A 4KKNA 3KJ6L 3GSNL 4P3DB 2V2TA 2D31B 4JPVH 4M7LL 4JGUA 1S9XA 3ARQA 3VB8A 4YBQD 2C9XA 1U2YA 3I9GL 2A9MH 4X0KA 3ARWA 1U3HB 2OSWA 1WS7A 5LNDA 5EZIH 3G6JA 5DTFB 3ENEA 2IH3A 3DUUB 1QO3B 2XQYA 2IQ9H 2YEZA 2W9LA 2WKLA 3MRDA 5K59E 5ITBL 3WBDA 1G5GA 2WBJD 4YO0B 2BY3A 2LAAA 3JWOC 2HLFD 2YOAA 2CRYA 3N55A 4R97C 2H0EA 3SE3C 3TZVC 4LOVA 3SGJC 4Z0BH 1OAYH 1LEIB 2I9TA 2HJFB 5T5FA 1J1XL 4QO1B 1AKPA 1DFBH 1WA1X 2H9GA 3MJWA 3NCBB 4OTXL 4YZFE 5DJZA 2IAMB 3QIWB 5D4QA 2ZUVA 4PJEB 4HG4J 4BQCA 1NCBL 1A7BA 5IHWA 1OCZB 2P5ED 2CUIA 3CSTA 2ETWA 1ASOA 4NNYA 2JXMB 4DHLA 5D7LB 4ZMOA 1B4RA 2GTWB 1OD7A 3NJXA 1MCOH 2L7EA 1F13A 1I31A 2N1KA 4OZ4B 5C0EA 1YAZA 4WWID 5IP4A 3FQRB 4NSKA 4G1EB 4AIXA 5F7WC 1E5BA 3MA7B 1D3CA 2R29A 3KYMA 3R4DA 4O58L 4X83A 4DVRH 1UUSA 1W6WA 5E1HB 5IY5B 3S5LA 2HKFH 5I0DA 1ZLUK 3NIGE 3W9EB 3MX0B 2YPVA 2QKIB 1T2JA 1TZIA 5E95B 1RZ8B 3II3A 2D7QA 4LLQA 4POUB 2IQ9L 3ZQXA 5C92A 1T1XA 3ZSSA 2FWSA 3NCJL 3REWA 3LRSA 3NGBB 4LVNB 1BQHB 4N2LA 2IANB 3RG1C 3SDCC 3RKPA 1FNSL 5BZZA 4DEPB 3VVWA 2HVKA 4JPIA 3CHRA 3VG9C 2OYLA 1REIA 4FXGA 1Z66A 1T03L 3ISRA 1D5XB 4V33A 4K3HA 2NR6D 2CR0A 4LEOA 5CCGE 4K5MA 4GUPA 2FB4L 4P46B 5BW7C 3CD4A 1FG2B 2ZG1A 1WT5A 5BS0E 4ZW7A 4TLUA 2QHRH 1KTJA 1KG0A 2CCVA 5CSZB 2WLZA 1D5MA 5GRVK 4PRIE 3V52L 3T3ME 1AE6H 4ODHL 2DJSA 1XMEB 3ZBMA 2R0LL 4XCEA 4D8PA 2H32A 1FYTA 1UB5A 3HA0A 1AHKA 4G7QB 3MLZH 3P9MB 15C8L 1DBAH 5ESAA 5EBMB 2VZTA 3EGXB 5BOJA 2LW3A 5A43C 5C0JB 4IRZH 1BD2E 4ODXA 4GKNA 4LRIC 2VLRD 1GSKA 1HDMA 1Z3GL 4J39A 2XG5B 3OLEA 4XBEL 3VAEA 4AIZA 1FCCA 5DEFB 4KROC 2J5LB 1WUNT 1KJVA 5K9JH 2IANE 2FX9L 5L4MA 4J6RL 3NIDB 4GKSB 5CAYB 4FNUA 2XN9B 4DP6X 2DLFH 4YXHH 5DFTA 4J3OH 2ZP8A 3DVNB 2X9ZA 4I3SH 4U1JA 3OGCB 4URKA 1VACB 1PCSA 1ZMYA 4L5FH 3WFEL 1ET5A 1JK8A 3GSUA 2SEBA 3PWUA 3NTCL 1EAQA 3GMNB 4NKIL 2D4FA 3KDMB 1JPSL 4W6WB 3LPOA 2Q8BL 3ZGHA 4XO4A 3W0WA 2AGJH 4FLOA 4PJ8B 1KGIA 5IR1B 1VFAB 2Y5QA 3V6FA 4GW4B 3QUKB 4TSAL 4J8RB 2YMTA 2X1OA 3IJHB 1KIRA 4L9LA 4HLEA 5TDPA 3H0TB 2JQMA 5TH2B 3GSXB 3VU2A 1TT6A 4JQIL 4M7JL 2ZOWA 1KLGA 5J1AB 1JZ3A 1QQDA 1JGEB 1KIUB 4UT9A 3X11B 4GAAA 2BDNL 4P9MH 1MHHA 2LFEA 4LLDA 4JDTH 4HWEH 3ARBD 4PRAB 5AB1A 1HH6B 5I6OA 1KDIA 5DJYA 5KJRH 2WIMA 2BP8B 3IDMA 4IRZL 1N5YL 2Y69B 2BSEA 4PHXA 2BOBB 2D0HA 1J88A 1AGFA 3RI5K 4HKJB 3RZCC 5HHOD 4MXWL 3IDXH 3M8OH 4N0FA 3V2AR 3BVVA 1OANA 2FATH 3DSNB 3QNFA 1BMGA 3FUHA 1YUHA 2Z6FA 3FDWA 3GI8H 4OLXH 3P1VA 5F7YC 4JJ5A 4WSJA 4XXCC 2XPGB 5IBTL 2F8VA 4IGBC 5EB9A 2H4EA 4BK4A 1QHQA 1J0JA 4NQSA 1YQ2A 3V7MA 4GSRA 4Y19D 4JY6B 1DQTA 3D0LA 4Z7WF 3BD3A 1K9TA 3P4NA 4F9PA 5ETUA 1KENL 1GZQB 2VDQL 4KX7A 1EANA 4G5ZH 5I6NA 3WNJA 2VXUL 3EYOB 3DPBA 3ZDXE 5I1EH 1T22A 4PRIB 4MCMA 4OB5L 3IEAA 1JPGA 4ODUA 1ODAA 2A5UA 4XVJL 2D0FA 2ESVA 3EZJB 1FDLL 4GRWE 3DK2A 2BHYA 3V7AE 3W9DA 4W9HC 3D7PA 4JN1L 5FGCB 4RAVB 5JLZA 3I2CL 3QUYC 1V55B 4A7GA 3NJGA 3FRPA 1LMIA 2XWXA 4PJIE 4Q97A 5ICYA 3HG4A 1I82A 1V54B 2W92A 4G6ML 4CUCA 2BVOA 1FBIL 1YN7A 4JY5L 3LS5L 5J3HD 1D9KA 3GMPA 4KFMA 3BVNB 1LXMA 5L4FA 1JZIA 3R06A 2HPTA 1A3ZA 5EU4B 4APQD 1BVLA 1C8PA 3F00A 3LXUX 3CFJB 4PJCF 2EDFA 4UV4H 4EAEA 4QXUL 3S7GA 1PDKB 3FL7A 4UQ3A 3L13A 4XNQA 3VI3B 3LMJL 3HR5A 3F58L 1UM4H 3RKDD 1QEWA 2C9QA 1IBZA 4JO3H 1YPZA 1JK9B 5EEVA 4R97B 2ADGB 2WLIB 4W6XB 3BUTA 3KYOB 1A3LH 3V4VH 5D1QA 3FQ2A 1WAAE 3PL6D 2IVFC 2FH8A 1U36A 3DV6A 4JPSA 3JTSB 4LHUD 3Q8CA 1UXSB 1E4XI 2IAND 3LV3B 4ONOA 5IHUL 3RWDB 3S5LG 3GRWL 4KHTH 3UYOD 4XN4A 4PCTA 2GFBA 5AOLA 5L88L 1KB5B 5JHAA 1XH0A 4KMQA 1PJ9A 1SOKA 5FUOL 3QUMH 5D70H 1QBMH 2VQ1A 1OTSD 3MRKA 2XZCL 4AEEA 2QSVA 1BQ5A 5MHSD 4PGCB 4GO9A 1CIUA 4NP4H 4K3JL 4LXFA 1WS8A 1TTBA 2KPNA 2XV2A 3ZT7A 4XCNB 1XXFC 4OLZL 5FW6A 5IVXA 3QNZA 4DP0X 3IJSA 3VWKA 4J2QA 4P3CL 5GGUB 2ZXEB 1GPOL 2VR3A 3HMXA 3LPGA 2DWSA 4JDZB 3ZTNH 1LO4H 1MNNA 1KCBA 2NXYD 2A4CA 1MAJA 2EUZA 2FO4B 3KGUA 3US1A 1QYGH 3D2TA 5B7MA 3ZDZF 1MCWM 2BK8A 1MFDH 1UD3A 5C6TH 1M2OA 1G6RL 3D52A 2L04A 1Q1JL 2XPZA 2QPUA 3B2UD 1SLVA 2FX9H 3O8XA 3S5ZA 5FO8A 4IIZA 1A3LL 4WWKC 3BKCH 4FZEL 5BXFA 1A4JB 1QFUL 3GTVA 3D69B 4FA8A 1EBPA 2ZONA 4KNUA 3DRQA 1DCEA 3MOAL 2EIKB 4NUPA 4R2GD 4RA0C 3EO0A 4FXKA 4EJ1C 1AFVH 4LO9A 5I28A 3HCVB 4E9WA 3V6BR 1JZ5A 4BE6A 1EXGA 2VR6A 4GRWH 1G7PB 3NQKA 4ABUA 4I0PA 2AAVA 1HWWA 1XB8A 2YMXH 2N7AA 4M3JA 5D1QE 3UTPE 5LHDA 1VCBC 2E27H 2Y36H 4PGJA 1NC2A 4JQIH 4M7JH 4L1DA 4RMUA 4JUSA 4Y9EA 1HHIA 5AVWB 4HEPA 1FL6A 1AR1B 1OAQL 1QSEB 3QQ3B 5TTRA 4ACTA 1N0XL 1U8JB 4DKAA 1FZKB 1HOCB 2J5LC 4QHMB 4NPJA 4WI9A 1UCTA 1E6JH 4FZ8H 4LLYB 2HT2D 4HJ1A 5AVVB 5CLWA 3ES6A 3FAWA 5DD3L 2FJFB 3AADB 4M3HA 4N1HB 1XH1A 3F7KA 3MV9A 1OAZL 3CDFA 1ECZA 2DYPD 4Z18A 4CADB 4YWGL 3Q2WA 2UUDK 3QXUA 5GS2H 2DLIA 4HS6B 5EORL 4MNGE 3GSQB 4G6JH 4I13B 5FGRA 2VXSH 5IQMA 1VGEH 2CDGB 3MJ9A 4FZEH 2ZJSL 2VDMH 2MOVA 2O5XL 4QAMB 2X9WA 3WV0A 3DX8A 3MO1B 1OSPH 5L8JB 5L9DL 1J7VR 4LSTL 4F57H 2NY3C 1F1AA 2EYTB 5DSCB 1WWAX 4KKPA 2AXJA 2QSCL 2PABA 2FX8H 2LU4A 4M1GL 4QRBA 3C75A 3SDAD 4P23C 1CYXA 5DZPA 1N12A 1NDTA 4FFYL 5FV2A 1OLZA 1OSZB 5DHVB 2BPBA 1K4CA 1NEZA 4XMLL 5ICXA 1ESOA 5DJ2B 1OAKL 3P9LA 4PG2A 4WW2A 1V05A 5CN2A 4TSCL 3CFBB 4N22A 1F90H 4RX4D 5B3JE 3GS0A 5A2JH 3WL9B 1MAML 3K0YA 2JKLA 4Q6IA 4L4TA 1LILA 2FYVA 5E6IB 3BO8B 1SEBB 4OY9A 1TEYA 4GKOA 3E9TA 2GSGB 4JY5H 1YMMB 3N04A 5IFAL 3DURA 4JRXA 2F8XC 1J1PL 3LQZB 4Y5YC 2X6AA 5DJ6A 3FSZA 3BZ4A 3QHFL 5I1IL 3L5XH 2EO1A 2EEFA 1N18A 4JM2A 4AMXA 1J48A 1BWMA 4E9RA 5HI5D 5DS8B 4TOYH 2FECI 2OXHA 3QO1B 4NNXB 5KVGL 1JD7A 1I7TA 3JWDH 2WP3T 3QHZH 4RGND 5JPMB 3V6OA 3BAXA 2YBGA 1CLZL 5J56B 1IE5A 1MY7A 1Q9OB 3MGTB 2HMID 3NIGF 2G2PA 3SGEH 1KUMA 1MCQA 3FT2A 3VXRD 3GTTA 1NM9A 1J5OL 1WWCA 2UY6B 4HOMA 3HMWH 3L4ZA 4H0IA 5MERB 5I24A 1JWSB 5BRZA 3DUSB 3VFSB 1UEYA 3C5ZA 2FBJL 2VABB 4WWNA 5GGVH 4UTAL 4RNRA 3UOAB 3BWUC 5G4OA 2JKXA 3H6AA 4DETA 1RZJL 4R0LA 2JK5B 5DHDA 3H7BA 1IC4L 3H42H 1S7XA 5HGHA 4AV0A 5E9DB 1NCGA 4H7VA 4HCRA 4AVJA 3D3VD 4BFBD 3QUMA 3MA9L 3K71B 1HX0A 1S7WB 3ETTA 2EILB 4FG6D 3WNPA 3MCLL 2EDLA 2YEVB 2HXAA 5KUMA 4ALAC 1SYSA 1RULL 4RAUB 2ICEC 1Z9NA 3Q6FB 3KPNA 2V37A 3PREA 4NQDE 2BHZA 4ZQKA 5LJYH 3UMNA 3ZT5A 2NT1A 5HVGB 3LN5B 5DA4A 4OZIA 3IWUA 4U1IB 3VFMB 5FYLL 1EJFA 5IMMB 5EOTA 4CVZA 1QTPA 4RIRB 1A5FH 5JIQA 4PRHB 4ZW6A 4N8UA 5D1ZC 1X4XA 1F6FB 2VQTA 5KSAC 2IH3B 4FL4B 2XQYK 3ROLA 4PJIF 1BWWA 1JHLL 1OF2A 1MCLA 1TVDA 6CGTA 4CW1B 2IBGA 1DQLL 3T6XA 4M7ZB 1IM9D 3CJJA 3INUH 1AP2A 2XKNB 5LQBL 3K74B 1OVZA 3O11B 5EUKB 4DGVL 2QEJA 4PJ7F 2JV6A 2NCMA 3V7AG 5FCUH 4D0BB 1B2YA 2NNXA 4WHTA 1AO7B 2VDPB 3ME0B 3X14A 4HAFA 5MP6H 4E41A 5JYLA 5GGSB 4OD2B 5EZOH 2XNAA 3WJMB 4P2RD 3KXFB 2PPDA 3AFLA 1CWVA 5FB8B 3OD3A 1AHWB 4PJEA 3BP7A 1XF4A 3O6LL 5JZ7D 1ES0B 2DRUA 1CO1A 4J8QA 5DR5H 2Q2EB 3A5VA 4UOW0 4D9LL 4HLJA 4OT1L 3O9WA 4I4WA 1A6WL 1BQSA 4JM2C 4LCVA 2FR4B 5JIIA 1GYCA 4OZ4A 3BHBB 4MJ4A 1YEJL 4X6BB 4LL9A 4PJGA 2QL1A 2XT1B 4RLDA 1A5FL 1ZS8B 1E28A 2ZF9A 5CUSL 1IAIM 3GXPA 5DO2D 4OM0H 2L7UA 3BP4B 1R3LA 5CJ8A 5MEQA 3UTTB 4EPSA 1JZ6A 4W9JC 1SUJA 2G9KA 2VO5A 3KBEA 1RZFH 4Z7VB 5F7DB 1UKSA 1IAOB 5F0PB 1GGBL 4OQTL 2NQ3A 1AQDB 3CBKB 1KFAH 2APTA 1DUYA 3FQWA 4U6XB 1G7MB 1VRSA 5TE6H 4NUJB 3JWNH 4UIMA 4ZMVA 4DO4A 5GIRA 5CSZA 4N2MA 3F6IA 1MJ8L 1GH7A 1OP9A 4FHKA 3SEPA 3E80A 2DOCA 3UJIL 4B9IA 2H32B 1CDHA 4ZSOB 1EZUA 2OXGA 1MAMH 1I4FA 3BKYL 4HX1B 4FQXD 5C0JA 1A7QH 3GS7A 4M02A 2F53D 5HJBA 1WZKA 5C0CD 1CE6A 4JRYD 3QA3B 2WLLB 4JG1H 1X5HA 1AZVA 3MLSH 1MCPH 2VDPH 2XG5A 1CGSL 3J2PA 3ULSB 4G6FB 5FM4A 4KJQC 4R96B 5D1XB 3F04A 2TRHA 2XN9A 4GBXA 4N0UA 1R3JB 1S78D 1TQBC 5DD1L 1O7DE 2QV2A 4CNIA 1ZDQA 1S9XB 4P4KC 2XDHA 4Z7OB 1U8LB 4KNSA 3VW3L 2NX5E 3UZEA 1BFOB 4JGJA 4NJAH 4S1DD 5IMKA 1PPIA 4IRJC 2IGFH 3N0PB 3WS6A 2MFNA 2CO1A 4A7UA 1Q9LA 2I69A 2YD1A 1JFHA 2J12B 3FU8A 4Y19A 2X38A 4QRSB 3KS0H 3QDGB 2HKHL 1OP3H 4PRBB 5HVHC 1T83C 1WWWX 3ROOA 2C3WA 2QKSA 4LLDB 1SVCP 3OWRA 3OZKA 4JZJB 2CDEB 3U0WH 4TULL 5BUPA 4I18A 3QIWA 4FQHB 2V2XA 3VGAC 4X6DA 1T66C 5CGYC 2CXGA 3RU8H 5I1DB 1BZQK 1LEKA 1YSOA 3EBGA 4NNYB 4R8WL 2XZQL 3TNMA 3Q8AA 5EOQH 4G43A 2Q8AH 4OAWB 5F1OB 5IGXH 3ZKMD 3DSNA 2ZUWA 4TLTA 1MPAL 3W81A 5KSVB 3GO1L 1D9KC 4MQSB 1D6EB 2K45A 1RVFH 3RFZB 3FQNA 1N0LA 4MS8D 35C8L 4B5ZA 3MA7A 2VLKD 3OJDA 1JZ2A 3ATBA 1NFIB 2EQDA 2C5DC 2P5EE 5CWSA 1KBKA 4LOUC 3O6KH 3NIGB 4MNQB 4XP4H 2A83B 4W9DC 3FFCE 2B0SL 3OHXB 3OMNB 3REWB 3INUL 1AGCA 4HSAC 3F01A 3PQYA 5EZPA 3C08H 1SJEB 4FQ2H 4R26H 3RTQC 4AQEB 4XZUA 2HVKB 3SE6A 4M5ZL 4BZ2L 3MXVL 3ZDYE 1NCDL 3OWEA 2D7MA 3QARA 2FH6A 1TNNA 1ODUA 4G6AC 1AD0A 4TQHA 2C3VB 3P3SA 4HIXL 1NIBA 3HS0C 3IU3B 3HZMA 4M1CC 1KG0B 3H9YA 5GGQL 1TXKA 4PGEA 3T2PA 3KPOB 5EU4A 3V0AC 1BVLB 5D93B 1ZHKA 4GG8B 4ZFOB 2VERN 3Q05A 1P9MA 3LEYL 1HEHC 1F8TL 2CNYA 4WWKB 4H26B 2X1XR 3MV01 4XCEB 5H4ZA 1J8KA 4PLKD 5IGXL 1ZT7A 1BJ1H 5EUOB 3HJEA 4HUUB 1IC0A 3SBPA 2V9QA 3P3RA 4OGAC 3CZUB 1INEL 3FN3A 3NP3A 4G82A 5FUZL 4PB0L 1CFSA 3DHPA 2Z1PA 1X5LA 3I85A 1SHSA 5ECJE 4BA0A 2A6IA 5LB1A 4UQDA 2JB5L 3WTVA 1A14H 1BAFL 4PJAB 3T0EB 1JPFB 3C6SB 3VFOA 5L4JA 3BKMH 1NSNH 1ZKAA 2G4GA 1F11B 3EHBB 3C60D 3KPSB 3TIDB 2W9EH 3D87B 4N24A 3BAIA 5IWLA 2WUCL 4XPAH 4UV7L 4GO8A 3PWUB 4IRSC 2DWYA 3WEXA 2V5SA 1M2VB 4XMKL 1J1OH 3T71A 1PEWA 2J8OA 1HIML 2VDLL 4NFBA 1SRDA 3L9BA 2J4WH 4WIQA 3FRUB 3TCLA 3F85A 4GG6E 3LNGA 3SJVB 2OCJA 2IPTH 3C9NA 4MGXA 4KK5C 2X7LA 4F7TB 4FP8H 4RFEA 3HG1B 4YMPA 2W80C 3FU7A 4EI5D 2F2HA 2E8ZA 5HDLA 5FFGA 4JPKL 4BWWA 1F5WA 4JK0D 3EGDB 4OCLC 5L2JB 3ULUC 3K2MC 3SD2A 1JZDC 2NRDA 4ZXBC 3U7YL 2OLDA 2X3BA 4LCWE 1NCCL 1XX9C 4OCWL 4FFYA 4TUKH 5B1BB 1S9WA 1RZIB 1UZ8B 4KRPC 2R0KH 5E5RB 3OKKB 4MMZC 3QJVB 2BC4A 4AL8C 3HC0A 4D0BA 2P24A 2K3HA 1GZPA 4A6YH 5F7AA 1R17A 4NWTL 3VSVA 4AW4A 2HRHA 5IG7B 4PGDB 4ALAL 4AMKH 2FSDA 2F61A 3NBNA 2AV1A 1LWHA 2X6UA 1AXSA 1MCSA 4I9WE 2GEEA 1U8KB 2WUCH 3QORD 3A3YB 2EIDA 3MLWH 4O2FA 3QXWA 3VNYA 1IC5H 2WLHA 1A21A 1Y6NR 2OI9C 1BFVH 2VZSA 5GSRB 4ZO7A 4XVSH 4ZFGH 3AS2A 3B7YA 3EKCA 1CD1B 3GIZH 4ZUVA 4YK4C 4I0PB 1FYTD 5FYJE 4D0DB 2Y7LA 2IPTL 2XV0A 1MJJA 4LVNC 4DESA 5G5DA 3FO1A 3PWNA 1VEPA 1JF5A 1ICTA 4XXDA 1OV8A 4LHJB 3MLUH 3CDGB 4BK5A 4M4RA 4J3BA 3RPIB 4HMEA 4TLKA 4OKVA 4Q52A 4W9FC 4Y2DA 5FK9B 4QGTA 4XI5D 3CX2A 2UZXB 3ES6B 4NT6B 2FJFA 3EADA 4B9ZA 4AEIH 4Q9QH 5H94B 1NAMB 1G87A 3WJLA 2BMKA 4KJWC 1KYAA 4R8WH 1JAEA 2EDBA 5IVNA 3EO1B 4HG4K 3MRPB 2DS4A 5BMFH 4MLIA 3CZEA 4HT1H 5LGHL 1OT4A 4JJHA 2DQHH 5IQ7L 4JR9L 3HS0A 5LDSA 2DQDH 3VI3E 4L05A 5BUGA 1T0PB 2AJVL 2XXGA 3F12B 5PCYA 5IESL 4AE1A 1XGYL 2E6JA 4YHIB 4P04A 3PHOB 4PWIA 4JQIA 2B4CC 1EHLL 4XWGH 3C5ZC 2NY6D 3F84A 3OAWA 3TO4D 2AXHA 4OGZA 1MWAB 4HKZB 1O7VA 4PD4K 3OV6A 3E6FB 4GBXD 5IMOA 5F6IB 4JZJC 1JMXA 3RIAK 3QDJB 3JTSA 2V33A 4OCRL 1NC2D 2IDTA 4HIJA 5KVEE 2Y22A 3Q2NA 1CI3M 4F20A 2WXNA 5IVXE 2CK0H 1IGCH 3IXTB 2JI2A 2BP0A 2WO3B 2OJZL 3STZB 4AXWB 2XWJA 1UD2A 2ICEA 4JCMA 4FHBD 3S3SA 4PJEF 1YN6B 1EHAA 4QHKJ 4AGQA 3HC3H 3LEXB 2VL4A 4CKQA 4RWYH 1RK7A 1BOGB 2NUPA 1K8IA 4FNTA 3HAEA 4QTIH 1E67A 4UQ2B 2EJ1A 1UUNA 2ZSVB 3QH3B 4J23A 1JDCA 2XVLA 4R90L 3IJSB 3VWKB 4FABH 2QVKA 1TJIH 2VJ8A 3O4LD 3BN9D 2XHNA 3OF6A 1NIDA 4QT5B 2J6WA 4JG0H 2N0MA 1KCVH 3DGGB 4BFFA 1J5HA 2J5WA 4K94L 1T7WA 4MCYA 4N86A 2F19L 1A47A 4PWHA 4YVNA 5E2UL 5F96L 3NJHA 7PAZA 5FO9A 4CSSA 1URZA 4Y9CA 3GB7A 1NOLA 2VB5A 2WZ6A 3CIQA 3F8UB 2EXWC 3PNWB 4OIBA 4HW6A 2F53B 2GBTA 4BFKA 3BD4A 3UPRA 2ATKA 3QIBB 2DQTH 3SKJH 1CVRA 3CVBA 1J0ZA 3SDDD 5ESQA 2DV6A 5I66A 1GGCL 2BZ7A 2QV4A 2Y7NA 4NN7B 5EC1B 5L2KE 2N56A 4PGZA 5F97E 3UJTL 1G84A 3UERA 1HNGA 4GRLA 1DO6A 5FKAA 5T1LB 3SE4A 2YO3A 4GQQA 1R3KB 1JZJA 1E3ZA 4QRTA 5LGKA 1HC1A 3BUQA 2AMGA 4JLRA 5HBBA 5E5MA 2XX0A 5J7CC 2F5AL 2R0ZH 3OXSA 2MCAA 3RJQB 4FQQA 2G2RA 3FUJA 1XT5A 4AZ8B 5GS0L 3IAPA 2QJDA 1F4WL 4JFPA 4MAZA 5D2LE 4HPOH 4QRUB 3O41A 1NCWL 4I3GA 2H1LM 3NJKA 4PJFE 4LCCC 1J8HE 5GGVY 3N44B 3RILA 2QSQA 2VLKE 5T1DH 5HY9B 2VDMB 4IRSB 1FAIH 2G3ZA 3AT9A 3NCEB 2VZOA 3DV4B 2FSEA 4ZUSA 2F19H 4RIRA 1YZZA 1IIKA 1XCWA 4UT6L 4ETYA 3OQRA 4NZJA 3TBWA 1F4YL 1KXQA 2NY5C 3KYAA 4MS6A 4TQEL 1ZK9A 4LSVH 4Y1AA 5DVKA 4PJ9D 4TNEA 4F2EA 4YEFA 5K9KB 2CLVB 2VSDA 4LU5L 4ZOEA 3SDXF 2ORBL 1XIWC 1EZVY 5E2VL 3MSPA 3RHWF 3WN5C 2X0WA 3U36B 2B1HH 4MZ2A 5DSCA 3FMGL 4BDVA 5ADPH 1DSFH 1YYLH 4OZGB 1TYJA 1CTOA 2IOOA 2OL3A 3EJQA 3QRBA 3MUY1 4OD2A 3G5ZB 4XP1L 5FUCC 3V0JA 4ATTA 4ELMA 4F9LA 1NGQH 1AHWA 5LWYH 4P2QA 1BFSA 4G9DB 5DHEA 3IGAB 4KVNL 1Z32X 3QXVA 2NW2A 2FX7H 4NX0A 1SEQL 1BZ8A 2P43B 3P2DA 4M5TA 4L4TB 3BZFA 5KSAD 1U8HA 4EUPB 1P1ZA 5LG6A 1JPST 2AABH 3GJFK 4F7EB 4WGWB 1GHFL 1ZLVK 3NP4A 1OAXH 2JKSA 1TQCC 2B39A 5AWNH 2CJ3A 5K93A 4F37F 1E65A 4I0PC 4W1TA 2YRLA 3MU3A 1F4YH 5F3FA 2GK0A 1GSMA 1JI1A 2YZ8A 2JWYA 1Q0XL 4DTGL 2Z91A 2UZPA 4PTUB 5CBAA 2HT4C 1O9VA 4P23A 4L5FL 3WFEH 5FAAA 4N85A 2DQHL 2GT9B 3BAEL 3L9EA 1MFVA 5IQ7H 3PFQA 2CHNA 5J12C 1I1RA 1T5XB 3STBA 1GGIH 3PHAA 4G2AA 4P2OB 5GZNA 3QUZD 4XPFH 4LPCA 1WAAF 3GLEA 2VN7A 1T1YB 1SHXA 4LIQH 5GGRA 4JFOB 1J5IA 1ZT4B 1FNLA 1YMMD 2B16A 4YHLL 1IM9A 2YUWA 1JTTA 1TETH 4NO3A 2XACC 2DQJH 2DH2A 4RBPH 1FYTE 4IKIA 4XBGB 5FYJD 2WSPA 4YS4A 2FHCA 1NGXB 3HE7D 1II4E 2GITA 1IM3B 5C3TA 3RYMA 4BIKA 2JELH 4UBDD 5T33H 2QGEA 1MG2C 4Y9FA 4R0LB 2A74B 3ZE1F 3LVTA 1IGTB 3CFCH 5I1LA 5E6YA 5D1XE 1KGXA 3K71A 3HZYA 1FORL 1X6LA 4QRQB 2B5IB 3I50H 3MBEA 5D7IB 4ZDHB 4DP8X 4RGNC 2CH8A 3B43A 4H8VA 3VXRB 4OVVA 1P5UA 4N4YB 3D3VB 1FE8L 3KPRA 4RMSA 3ZN6A 3FBKA 3GEFA 4I89A 4G7RB 5KSAB 3KPNB 1N59A 1A0QH 5FWRA 1Q9KA 1JXKA 3QDME 2R7EA 3MGOA 3HG1D 1S7QA 4OZIB 3ZYOA 2LT9A 1HJBC 1MELA 4OCNC 2XWBB 3LN4B 1KBWA 2OK0L 4ZYKB 3WO4C 1J8HD 1QHPA 3FT1A 3IS1X 1E6OL 2YD6A 1RZQA 3KVDD 3V0EA 1BLNB 3FT3A 4CVUA 5L7XL 1AMXA 1H6FA 3C8KB 1N19A 1AIZA 5D7IE 1J87A 4I9XA 4XNZB 1OF2B 1ML0A 2WNKA 3KD4A 3TONA 3DHUA 1NCUA 4LCIL 4P48A 2CRZA 1UKTA 5CNHA 5EOCH 3WAKA 4ZO9A 1QFOA 3IMWA 3QAQA 1CFQA 3B9DA 5EBLA 2JFCA 3AQYA 2OMWA 4XE0A 5G4MA 4F7PA 1XF5B 4ZW5A 1AO7A 4L2LA 5AB9A 1DVZA 1DN0A 4LP5A 3PCYA 4QYOB 1NBYA 4P46C 4CBZA 4DEUA 1WZLA 3I6LE 4LCWD 4TQIA 1EQWA 1PZ5A 5H2BB 2Q76A 3HUJA 4R5XA 3G5YB 1BIIB 3FB5A 2VZUA 4UNUA 4FQJH 5AB0A 1FZMA 1T04B 2OR8A 3TTYA 3Q8EA 5GRJH 1EEYB 5GS0H 5D5ME 4UAHA 3J07A 4OF6A 2ZXGA 1CFTA 4OAWA 1TTFA 4LSPL 5D8JH 1IO4C 3HPLA 3QUYA 4PJCB 3T0AA 5B1CA 3VYPA 2HX8A 4RMQA 3HFML 4XNUL 5GS0D 1HINH 3DOIA 4IJ3B 2Q9OA 3VI3F 2X1WL 2D3NA 1HTYA 2VXQL 3DTXB 3HBQA 3PWPA 4NBXB 4V11A 4AJVA 4FMKA 2GJJA 2YRPA 3EFFA 4YHML 4MSWB 3F62A 1OIOA 4KPHH 2EXWD 3H3PH 5I6LA 3PQYB 2DLHA 2ARJQ 4PJHE 2KLRA 1G4MA 4Z7VA 2MHAA 2YLHA 1VDGA 4NAJA 3WMSA 1VFBB 1FNHA 3L1GA 4PD4J 4HWZB 4HVBA 4GSXA 4NC2B 3ZKMC 1DE4A 4ZW3A 1MXDA 3FQ4A 4U1MB 4L4VA 4ORGA 1RZKH 2C3VA 2DY2A 1CLOL 4XP1H 1AY1H 1FZOA 5A16B 4XNBA 5T5NG 4HJJH 5T5NF 2ENQA 4X8GA 3MRQA 3ILPB 5ALCH 1ZXQA 2VC2B 1AC6A 2OYMA 5HYEA 2WVUA 1M57B 2AEQH 3T6VA 5T3ZE 4HJEA 5FM5O 4WY7L 1B0GA 3SD5A 3HUJE 4V1DE 2V2WA 1NUGA 1WVZA 2XWDA 3H54A 4AVHA 5C97A 2BSCA 4P2RE 3MLRH 5BVPL 5JHLL 2O6CA 5DJDB 4G8EA 4E5XA 1CE6B 1URIA 1BVNP 2QSTA 3A21A 1OAXL 1R3IL 2BZDA 4OLYH 3IB4A 4WW1B 3PWVB 1EGJL 5D1XA 5IK3B 3WXWH 2QVFB 3X1EA 4A2FA 7FABL 3LTVA 4F58L 1JF1A 1FLRH 4PN6A 1E4KC 4DTGH 3R0NA 4K7FB 2IH9A 3THML 4UT6A 4G6FD 5IBTH 5SWSB 2VC2L 4YSSA 5HHOB 1T20A 3D4CA 3NAAL 4UT9H 2R23B 4F15C 4XPHL 3VXTA 4V1DB 5AVQB 4C56D 1U8LA 3N9GL 4A7VA 3IVKB 1NFDA 3ARBA 3WEXB 4ERSL 3HG1E 4R6UA 3CVIL 3N1PC 3PLYA 5C09E 4WK4B 1VKXB 3EYQD 4I48B 5TE7H 2UXFA 4G83A 1DLFH 1RZKL 2BVQA 1INQB 1Q4NX 3DJZA 3VO0A 4H13C 3X1FA 3CCHB 1HCZA 4JFHD 2YGPA 3JWOH 2XWEA 4Q7DA 1G7QA 1YEDA 3NQIA 2IXQA 4FTVB 3MN8A 3PPEA 5KBDA 3L9RB 2N59A 1RIHH 4OLVL 4EI6A 5IMLB 1DBAL 4HUKB 3KWTA 3T1FA 2ED7A 2XTJE 4JRLA 4BELD 2F54E 2ICCA 5KSBF 2V2XB 4HPHA 2VL5A 4TTDD 3VGFA 1CL7H 2P24B 4L9DA 4IBVA 3QG6B 4XPGH 4QXUH 1MCKA 3B2UC 4U6YA 5DJ8B 1N8OE 1E5CA 4NI3A 2FUQA 3LQAH 1BAGA 1YPZE 3S35X 1ZGLM 2F8IA 3Q1EA 5MENA 2BVUA 2NOYA 4I77L 3AM8C 3MV7E 4KOBA 1G7LA 3TL5A 3O2DA 4TNFA 1NAML 3TH3T 2Y7OA 3KPMA 3OAYH 5IHLB 1T4KA 2DKUA 3VMOA 2BIIA 5ANHA 2XTJB 4M1CD 3HKZA 2OJEA 2E7LA 4IRJA 3ZGIA 1FG9C 1SF3A 4NLHA 3UZEC 1A22B 2DQMA 1G9NL 2OQJA 3FRPG 3HNSL 4ZAKA 1Y18A 4P4KA 1SM3H 2NZIA 1T3FA 3JWOL 4UQIM 2OYKA 2V5TA 1NBQA 2DWEB 2WAQA 4X50A 1CICD 5C09A 2YWZA 5D1ZD 4CVXA 5GZND 3MV9D 3EFOA 2P5WB 3W1ZA 1J8SA 4UBDC 4ZI8A 3O6FA 4HUMB 3CSPA 3V5KA 4UM9B 4UYPA 2YAFA 1M6OB 4WV1A 4D9QE 5KYXB 1C1EL 2PPAA 2AZUA 4HXAH 2EKJA 4XAKE 2NUTB 3QEQE 2HRPL 1KWKA 2YGNA 4WO4A 4YHOL 1U4EA 3ULVD 3BZEB 5I76A 3U0PB 2BMKB 2FQEA 1A1OA 1AJ7L 2GTZA 3G08A 3I02B 1LEGB 4W9LC 3PGCB 4NKMB 3M8OL 4C83A 3MBED 2HCZX 3ORJA 4WEEA 4F2FA 3RIFK 3WNNA 1QFHA 3GZQA 1I3UA 5KVGH 1FIGH 3M6DA 5LN4A 1O9WA 2P8MA 1HS6A 3L3OC 5LCVL 1HHKB 1I8MA 1I8KA 4YC2C 5J9PA 2NW3B 4FXGC 4K9EL 1LWRA 3VXNA 4B60A 5IREA 2H2PD 2WD0A 4GSQA 4MB3A 1NCAL 1OGSA 3MJ8A 4A7TA 3IMSA 4ZMNA 1R0AL 1P6FA 4LKCB 2YQ3A 3DO7A 1KENH 4P2RA 1MDTA 1QWNA 3N42F 2YEQA 3LRGA 3O2VL 2YD2A 4K8RL 4JQXA 4P5MB 3ZVVA 3KLAA 4ILDA 3UDWC 2Z4QB 1MFCH 1SVZA 4PFEA 4LCUB 4ZXBD 3IDGA 1JRHL 1G9EA 3KPSD 1NQBA 5L6YH 1YYML 4PREB 4ANWA 2P9RA 2ED6A 1BECA 1TIUA 2I07A 5FPIA 5IVOA 4ENEC 5T1KB 3VH8B 5AD0B 3GMRB 1AY1L 2VM9A 5MEPB 4NERA 1K2DB 2M26A 4QXGH 1BLIA 1TZHB 5KYUA 3ARPA 3KBPA 4LLUB 3PAYA 4Q6IC 5HGGS 4LCCA 1ROWA 5LGJB 2ADIA 3UG4A 5J13C 1X9RA 3EGDA 5L2JA 1YJDL 3BWAB 4BKLA 4AUYA 3MNWB 2J1YA 1B6DA 4ZMQA 1R1CA 5HYQA 1MQ8A 2FGZA 4N0CC 4M7LT 2PTUA 4JRWA 5AL0A 1IAKB 4LNRB 1QACA 4P5TA 1ZHNA 2OM5A 4HJ0C 1HL4A 4IGBB 3HC0B 2G3NA 2WY3B 5CMAB 2IC2A 1NMBH 1CT8B 5DZJA 1CYGA 2OZNA 3STLA 4OUUA 4HUWB 4HMDA 4Y9GA 1PTZA 3GQFA 4Y4KA 1PFOA 4JREC 3FH7A 5ESVA 4LFHG 3TFKD 3GHEL 5D9SB 3E2HB 3PP3H 2V7HB 4WGVB 4WGKA 4NAQA 3N9GH 4YHPB 1H8OA 1YYMH 4A7QA 3MBWA 1USZA 5AVXB 5CBEA 5KTEL 3PJSB 2DKSA 2X4NA 1EMTL 1BW8A 2BNQB 5C08A 4AEHL 3WY4A 4F24A 1UWGH 3APNA 1FIEA 3BH8A 4P59H 3WSQL 1FVEA 4HV8B 4ODSH 2Z8SA 2O61B 2X4UB 4JLRB 1MJJB 3WTYA 2XJLA 4PJDF 1A4BA 2NTFA 4PG9A 4Z95L 1U91A 4JFPB 4RQQB 1MAKA 4HD9A 5JXAH 4RMVA 3ZTCC 2CCWA 5JIHA 4FG2A 1XBRA 1A7PH 2DF3A 4HK3N 1I8AA 1Y0LA 1JERA 2BZCA 3OB0H 5ITFA 4JVWA 3O6MH 2FSEB 3VXMB 3K1DA 1PD1A 3F83A 3L5XL 1CXHA 2HA1A 5C6TL 3V6OE 1BBJB 3F05A 3TBWB 5EIVA 4HOXA 5F71A 4PY7B 1W72B 4AYSA 2BNRE 5SWQA 3Q9QA 1KPUB 4MVBD 1E40A 2QVMA 4FA7B 1JDDA 5H37H 3SCMA 3MAWA 4DKEH 5C0DB 3FSOA 4Y2LA 4X4YA 1KFAL 2YQGA 4BSJA 2APFA 3WEOA 4XX1E 43CAA 5TPWL 3SDAC 2X2HA 2F7PA 2FEDD 5CCHE 4AWJC 4X4ZA 4XI5C 1DVFA 5FO7B 3TO2B 4FFZL 3OZLA 4QDGA 1ONQB 1WTGT 4IMLB 3CFUA 4NN6C 4QI3A 4WK2B 5JORB 1G9NH 4WO0A 2HTKC 2WXMA 2ILLA 4S1RH 4Z7UB 5D7LA 5JXAL 3QUGA 4ZX3A 5HPOA 3EG9B 4L8SC 5DJXB 2R1XB 1GYVA 2BP0B 4OLUL 4XCCH 1ACZA 2X6MA 1BCIA 3HZKB 4GRLD 1A7QL 1YN6A 1HESA 3NJVA 5C0AE 3WXVL 3P77A 5BZDB 1P84J 4XN8A 3WNMA 1L6ZA 1L9PA 4XN1A 2YD9A 4Y5XB 5DEJA 4HPYL 3QJXA 4AMWA 3ISYA 2VDOH 3NYKA 4FCHA 1O9ZA 2W38A 2X1QA 2KBGA 2JQAA 1J12A 1IQDB 1M1SA 3DGGA 2VDML 2HN7A 1P5VB 2B1AH 3CHSA 3D5OF 4JPIB 3MYZA 1NJ9A 4RZCB 4HF5H 1UFUA 1KJ2H 3QGVA 2J7LA 4KKLC 4DO6A 2F1AA 5FO9B 5I8EA 1FO0A 2CAKA 3EJRA 4R7DB 3VFGH 2MCG1 4XX5A 4NKDB 1T1YA 4OZGE 3UPRB 3QS3A 5LXGH 1AIFB 4QF1A 3KG5A 3R8QA 2ESVE 5IQ9A 4L8BB 5E6RB 4QKTA 4TYUA 5I66B 1OM9A 5F7BA 2PP9A 4DCQB 4PWFA 3L3JB 3VB9A 1IM3A 8FABB 3KPLB 5J12B 5AW1B 4EDXA 5I1KL 4M62H 3U6RB 1ZRUA 4I5BA 4DOHB 4IOSD 4POYA 4UAOC 1NH6A 4FERA 1DQQB 1P4BH 2VMCA 1ZVHA 3O45B 3RY4A 4KGJA 5E2WL 1WG3A 1ID5I 1ZY9A 4AI7A 3KLHC 1AZCA 2G2RB 5DR5L 3HLAB 1FGVH 3K2UL 4NRYA 4A2HA 1F6LL 5DHYB 5FHBH 4PJGE 3NOIA 4HLZG 1BYNA 5HYSB 3UC0H 2PTVA 1KELL 5IVZB 4WO4D 2P4AB 5CP7B 2MNUA 2FD6L 3LZFH 1XCQA 2P3YA 3JUZA 3H9SA 2YQBA 5HHPA 2ZCKH 3JWDL 1WV7T 2D31A 3DWTA 4QRRA 5IOKA 5EEZA 1RUMH 5C0AA 2B1AL 3M86A 2ZCLL 2V8LA 1MEXH 4ZX4A 2EE3A 1MFUA 4DOHE 4LQFL 2GJ6A 3QUYD 4KK6D 3RVWC 1J0YA 2LR4A 5LAXB 3FTWA 3V4PL 5DC4B 2WN3A 2APSA 4W4OC 3QUKA 3LB6C 3QCUL 5F72S 3AY4A 3LX9A 2XWTA 3DX9A 4UMSA 4YHZL 1RMFL 2QGDA 1BXAA 2XETA 1UM6L 1NGWB 4NO2A 1M3JA 4DZ8A 1LK3L 2AS5M 4KFZC 5HHQA 2OMWB 3IFNL 1NCDH 4YFEA 4BDVB 2AAAA 1XZ0A 2E74C 2WQVA 4LHUA 3QO0B 3O8XC 4O02H 2BSBA 5FWQA 3V79C 3OM3B 2BP8A 3IDMB 4XP5L 5CF3A 1CD9B 3WE1A 3IDIA 4AGPA 3ML8A 2PETA 1PY4A 2GQHA 3KDPB 5AOKA 3FOLB 5I30L 4K7PX 3NG5A 2XY2A 2BIMA 2VLLB 1SXCA 3MLYL 3CSYA 1BZEA 1E4HA 4AVIA 3QJQB 4AQ1B 4M8QB 4KTYA 4NRXA 2YAOA 5DMKA 1P9MC 5M95B 3VJ6A 2CSPA 2AJ3A 4GPVA 1AYRA 3B7RL 2R1YB 2YKLL 2XPGA 1OAJA 2CA3A 1BP3B 1E27A 2IMMA 4NSKB 4KXDA 4GQZA 3C5JA 1T21B 5J6HB 3JTTA 5JXEC 3ZR6A 1SXNA 4OI8A 4N5ED 1KXVA 1ZA3A 2Y7QA 3D6GA 3MX0A 2E59A 4K23L 5HJDA 5I1AA 2CBMA 1KN4L 5CKAA 1F2XK 3DPBB 1BBDH 3NFNA 4PRIA 1MZZA 5E5UB 3BZDA 3RTQA 3IETA 2YHGA 1P7QB 2DQFB 1FGNH 5CFAA 5CEZD 3UAJD 2G75B 43C9A 2VMFA 4HJIA 5I0WA 4BUQA 5CCJA 3C2SA 1VLXA 1SDDB 4LPXA 4NYLB 4Y7MA 2O6PA 4ZX6A 1CXEA 4RAVA 5JLZB 3VFWA 1J1OL 3VG0H 3S4SB 4NP9A 4ZFZA 1DBJH 5CD5D 3AWEA 5AOIA 4QXTA 4MCZB 3DIVA 1U8NB 2FLRT 2R1WA 5I30H 1T5WB 3OKNB 5C0IB 5AAWC 3AWFA 3TIEB 1NUNB 4NQCB 2DN7A 2W95A 1ZV2A 5A2BA 5EEYA 4NQEB 3NCJH 3AVEA 3QDMA 5DFWH 1VGKA 1CR9L 2Y9RT 5FO2A 5IQLA 4L8DB 2EDDA 1EHXA 1LK2A 3HZYB 1E4JA 2BIOA 3L4UA 2K78A 1DJSA 3FAXA 1EVTC 2ZOKB 1P5UB 2Y07H 3SO3C 4YR6A 2CQVA 4YDIH 2P48B 1Q9KB 1HILA 5DD6A 2Q7YB 4XT1C 3BSZA 2VDQB 4KY2A 5HHOA 4QJ4B 2E75C 4LLWA 2SEBB 1YQVL 5A2AA 4JFTA 1NFDB 4U6VL 1KJ2L 1OLLA 4KJYB 2K7PA 3FQUA 4L23A 4AUJA 2UX7A 4NFCA 4CJ1A 2KDYA 1KXTB 3L2NA 2CM6A 2ZYHA 2JB6A 3ZLQC 3GUFA 1O7DC 4XP4L 1D5RA 3JWNE 4MJ2A 5TDPB 1QG3A 3HB3B 5F7NC 3GSXA 3PXJA 3E6HB 1NFKA 2FYYA 3TNNB 4GAYA 4KH2A 3CE1A 3OVUB 3RY6A 3DX3A 1AHWC 4M5ZH 2F54B 2P80D 4OZFA 1QLFB 4GIOA 2JKRM 3EBHA 3IGKA 1IJNA 2YSTA 3QJHA 1DJHA 3IMVA 4W81A 3EH1A 4MXQD 1K8DB 4K15A 4LLVB 2FO4A 4L29B 4RZKA 4LSSL 1LNUB 3NTCH 2XTLA 3OR6B 4G42B 4HJGA 3L7FB 4H25A 2ITCA 1CGSH 1CFBA 1EEYA 2VKXA 2P5EB 2XXCB 2Z7WA 4LVEA 3N91A 5TGBB 3SO5A 1E90A 3FUMA 5BMFL 2HUEA 1D9KD 2W65A 3RWCB 4FS0A 3HPLB 4NQED 5A2CA 1B9KA 3L3OA 5ID0B 4KO9A 1JV5B 1XWVA 2AJVH 4Z78A 2G3XA 3KAAA 2FE0A 1P4IL 4E9SA 5LXVA 1FPTL 1AI1L 3QFDA 1FFPA 3U2SB 3RWHA 1NOAA 4JZOA 3GM0A 4JY6A 4CN6A 2ZOUA 4HKXB 4DWHA 3GZKA 3ZDYB 4KITB 1MKFA 3S5YA 3NZHL 4LK4A 1QVOB 4LCWB 2E9WA 1A6ZB 4LVHB 4L0PB 3QEUA 4ODUB 1JYWA 3T4YB 3G6AB 1KSRA 1S7UB 3BMWA 5E00A 4O5LL 4GW5A 4CU6A 4OZHF 2QTEA 2FO1A 1IL1B 3P11L 5KSUA 2VDLH 3GLAA 3MFFB 1BF5A 2LQRA 4QXVA 3HI5H 2OSLA 1CD8A 4QHLB 1ZSDA 4UM9A 5KYXA 4Y4KC 1KGCE 5IJVA 3T8MA 5F6HJ 2RQEA 4GXFA 1UXWA 2FZ3A 2MJWA 3PY9A 4M29A 4YBHA 3U0PA 3KLHD 4G5ZL 5BOZG 2WTPA 4OZFG 4TQ8A 4QHUA 2D4DA 3CX5J 4MD4A 4OCSL 1GC1L 1BIHA 2Q8AL 4AKOA 1CK0L 2EICA 3ZK0A 1KBVA 2IDUA 3D85D 4C8XA 3TF7C 4FQXA 1K85A 3UTQA 4QHNA 4OGXL 5E1GA 3DGCR 3DETC 4HETA 3WEAA 3CSGA 1U93B 1RPUA 3B3IA 1UGKA 4GSUA 3WS6C 2HZHA 4HYTB 1U8MB 1FBIH 3PWVA 3UAEA 5HHXL 5I2IB 5DVOA 1JHTB 4JFOA 4B97A 2D9QB 1IBHA 2OTUA 2XG4A 4X0NA 2XN9D 2XXMB 3GIVB 3IMRA 3F7LA 3SKJL 4KXZI 3WYRA 3UTSD 2YUXA 3DARA 3RY6C 2Z93B 5DRXB 1FGNL 3RGHA 5CEZE 2WXKA 1QKZH 5B39A 5E99L 2ZWKA 2MKLC 1E43A 2CU9A 4MNQD 2QHLA 4TNWK 1AGDA 3PV6B 1DQKA 2K6YA 2WIIB 2VQ1B 1UM4L 4R4BB 5G4NA 2AXGB 4EF3A 2ID5A 4XB8A 3ZMRA 5C0RL 3QORB 4KKQA 4HZLB 1SBBA 3BE1H 5DQJB 3PGDA 4A6YA 1H0DA 1TZHA 1F4WH 4PV9B 3HRZA 1T0MB 3SY6A 2X4RB 1GC1H 1N6UA 5DQ9B 1DJGA 1KB5H 2OXHB 2ZNWA 4N8CH 4ZX5A 1TJMA 2QVTA 4KRPD 3RWIA 1TU2B 5C8JA 4X5WB 3WUWB 1XF2B 1FHGA 4H8UA 1E4KA 4LNRA 5DCCA 4HC1L 5KVMC 4NM4L 2TSBA 3O9WD 3RA7L 4LEBA 1IBGL 1OCCB 4MB5A 1SFHA 1MCPL 2VDPL 3P4OA 5DEZA 4Z1PA 5L2KD 5A6IA 4BFJA 4JHBA 4U0RC 3UABA 4WKZA 4APXB 1Z7JA 1S3KL 2DMCA 2FT7A 3QRGH 3RAJL 4KTDH 2OTWA 4IKLA 1H9DA 2NZ9C 4N90D 4CRPA 2WQ8A 4NNPL 3ZKQD 3LD8B 4PUBH 1PLBA 1WK0A 4JM2F 5HYJA 1JPEA 1T4KB 4S1QH 4HDIB 5L0QB 2D0GA 3FFDA 4TUUA 4Y2DD 1WJ3A 2EDTA 2JK5A 1OCRB 4M7KH 5CO1A 4FA6A 1AZNA 4OIIL 1KMGA 2VUKA 4G11A 1QSED 2YK1L 4XNAA 2MPAL 1FVEB 4HV8A 3T4AB 2R59A 3VFRB 1QZ1A 3SCMD 3UAJA 4QPEA 3TBVA 3QXAA 3CFEA 4JO1H 2YPLD 4EMZA 5JOPE 4PSRA 5ISZA 3AT8A 2DDQH 1AZRA 1U8JA 1SFDA 1EAPA 2GI0A 2QVIA 2J55A 3BEVA 5DWUH 1XGRB 5IB1B 4MA8H 2JE8A 3PV7A 1ITBB 5D96B 3WLBA 4BH8B 2YFNA 4Y1AE 1JF6A 1NZRA 3MRCA 3ZKND 3MV9B 5ABZA 3FB6A 2H8PB 4IU3A 3RU8L 4FX5A 1IGMH 1UFGA 2XBDA 3IJEA 4N2BA 2H41A 4JM2D 5FYKU 2CNZA 2FWUA 3MTXA 3RLSA 2V7NB 1U2HA 4XGZB 4ZS7H 1KCSH 1QSFA 2OP4L 1E4XH 2HTLD 1RVFL 1DDTA 3KYKL 3QJUB 1MCWW 5SWQB 4P2YA 2WCGA 4NQVA 1MH5A 4PJFB 3BD5A 4YHKH 5IQOA 4X4YB 1RSYA 4YNYB 1XCTA 1CDYA 3AUVA 2BRRH 3DO7B 4NOBA 4ZFGL 5GZNC 3D9AL 5HHVH 4KJPD 4KZEL 4OZIF 5D7KE 5FO7A 1A4KB 2B7DT 3Q8BA 5AEAA 3VTAA 4PH8A 5GS1B 1Q0EA 4F7MB 1QA9A 4ZOCA 1YEGL 1QRNA 1EJOL 32C2B 1IEBA 5EDSA 1S5IL 2CBQA 2J2ZA 2P5PA 3TA3B 1RU9H 1CU4L 4DK5A 1CMOA 5CJXC 4Q6IB 2HG5B 2BW5A 2ZAIA 5J13B 1YECL 1KPRA 4HS8L 1V7MH 3NPSC 1A7RL 4BSVB 5JHBA 1U2CA 3SYPA 2CLRA 2OMYB 1OKEA 3SE8L 3TASA 5F9AC 5C1MB 3BZ4B 3D4YA 1MLBB 3CVHL 4V2CB 2GW5A 2WXJA 4HIHA 3PGFL 2D9CA 3OJVC 4J4PC 4TSBL 4U4BA 4NZUH 4CSPA 4L8SB 1AACA 1OAKH 2ZX5A 1YPZF 3HUJF 2BFGA 3FTXA 1FNFA 2YAPA 2L0DA 1KTKE 3KPTA 4IU2A 3SHSA 1X5GA 1JFQH 5DRWB 4FG4A 1EHNA 2W91A 5F7DA 4JEGB 4AQOA 3RL2B 4F7CA 3EXLA 2A2QT 3ZE2E 4XRCB 4ZD3L 4DQOL 1HH9B 3VD1A 3L3HA 1DJWA 3CXHJ 1X9LA 3MBEC 3STLB 4OFDA 1GW0A 5ICUA 5HHXH 4OV5B 3ASOB 1QD0A 3BKML 4QF1B 1BZ9B 1LO3L 2OMBA 3QHFH 5GIRB 1P6AB 3I6LD 4RNRB 1FNAA 3TJHD 1EJOH 1PIFA 5JA8B 2LGNA 3AY2A 3Q01A 4P2QE 4S1DC 1MIEH 1CTNA 1J1XH 2IALA 4KXAA 1YO4A 4NEHB 3CGTA 3KXFE 1HKLL 5HJ3A 1C12A 4L5FE 4LVOC 3RIKA 1JXFA 3VU1A 4U4IA 1BM3H 3QUMB 3RVUC 2IIJA 2YPVH 4HKBB 4WTXA 2Q6WA 3AXHA 2EVHA 4ADJA 4MDJB 1AS7A 3OKLB 1Z5LB 3T5WA 1U0QA 4LSPH 3SYCA 4RAUA 5A2LH 2CLZB 4TMPA 2GY5A 5HPMB 2TRYA 4HCRH 4K7PL 5ITFB 1A7OH 4JFZL 5BOPA 4N2FA 1YG9A 4PRHE 2W0KA 3SYOA 3WFBL 2PYFA 1PX8A 2GABA 3HE6D 3K81A 3MYJA 3QVAA 4O9HL 3TBTB 5C9KA 4LESA 4IBTA 1B0RB 4KI5F 1ILUA 1YNLL 3B2MA 4POZC 3W39A 2KDGA 3VXQA 1TFPA 4DQOH 2H3NB 3X17A 1W72A 3MV8A 2B1OA 1MCDA 1D7DA 2F58H 3ZZLA 2P1YA 1MRFH 2G5BB 5EZLB 1HQRA 4QOKA 2PW2B 3KBHE 1NMAH 3EOTH 4YXLH 2PMZA 2YGQA 4KKAD 5CJOH 1C7TA 4Y2NA 4M61B 2DMBA 3VCLB 5KEZA 5F9DC 5DZAA 4GAGL 4KHXH 1RJZA 1GRWA 4N68A 4AYFA 1HL8A 4WI0B 4OIIH 4YHLH 1DBMH 4R7NB 1UWEL 2FLBT 4G71B 1N70A 4WFGE 4IEFB 3FOLA 2PYEE 1OGAB 3W3BA 1UXMA 3FTVA 3NRFA 5CLZA 4GRWF 3G04A 1SJVA 3VXOA 1AYOA 3BPOC 3T6ZA 1MJUL 4HU2A 3QXDB 3OG4B 4MJ6A 1DFXA 3QQNA 1R33A 3MOBL 2EUWA 3GNMH 4FXTA 5BVPH 2CKBA 4IS6A 2YD8A 4B9JA 2WQAA 3UGXA 3WJLC 2APVA 4BYHA 4OD3L 3ZTEA 4B6ZA 3QQDA 3SGKC 1JHKL 5JMRA 3PFUA 5I73C 1VA9A 3K6OA 1E28B 3SDDB 2C1OB 4G8FA 3WE6A 4J6RH 5I1HL 3CNKA 1TMQA 2RD0A 3GTNA 3P02A 2WC7A 4ONHB 5BO1L 4I3SL 4G1MB 3CMGA 1N4XH 2G9HB 2E9IA 2ZXWB 3BVTA 4NRZB 5EBWA 5C0CE 43C9B 2NX5B 1GR7A 1N5AA 1P4UA 2OR9L 5I8OH 3KYKH 3WJJA 4JHUA 5F1NA 3BGAA 3VXRE 3GMLA 3T8VA 3MNMA 2ZUQC 2MNJB 2R9HC 1DVFC 2BLFA 3D25A 3Q3GB 1HCVA 1SNRA 3D08A 3MCYA 4BFRA 4E9YA 1OT2A 1QI4A 3HZVA 3BT0A 2W60B 4IYKA 4UQAA 2ZPKH 2XI9A 3O0RL 3EIFA 4OJFL 3KPOA 3ARVA 5E2TL 5HI3D 5DDHA 4Z7WB 1KN2L 4L1LA 4KVNH 3S48A 5SX5K 1MLCA 4Z0BL 3UZQA 4AITA 1VB9A 5D55A 1KCWA 4N2NA 1I1YA 2JCCE 1C5CH 2HFGL 2OXGB 4GOSA 3UTSB 3L3IB 3JZ7A 1AD9A 1TJGH 3TF4A 4KH9A 5D1XD 3SKNA 1FHNA 2A6JB 3ESVF 5KW9L 2A6IB 4EI5C 2JIXA 1T7VA 1K6QL 4Y5YA 3VD5A 3VGBA 1WZ1L 3MCKB 4FKHA 4QTIL 3RDTC 3OJ2C 3IKCB 4G7YH 5GJSH 4HQQH 1BJ1J 4HA1A 2X4PA 1MI5A 3QUHA 4DGYL 5CEXB 3FULA 3WNKA 4A04A 2DJ4A 4KZ0A 4B3VA 4Z3EA 1A4CA 1I7ZB 3I9AA 1MCRA 3R7RA 4PS4L 4XVOA 2CK2A 3EHBD 1SHWA 3H56A 2QQKL 4UTBH 3NPSB 5DZOA 5E8NA 4YN3A 4X9YA 4YDJB 5IMKB 1T2XA 3LKQA 1PZAA 1TJXA 2GCYA 4HGWB 4NPYB 3WIFA 5E4AA 2PXYD 5T3ZD 5KVEL 1BXUA 2H6PA 3AAZA 4G7VH 4OB5H 1KTCA 2H2SD 4JG1L 3G5VA 1NUDA 3JV4B 3N1MC 4F7TA 1QI3A 3DX6A 1OM3L 1TZAA 3NZUA 4M48H 4OFYA 2WANA 2KC0A 3FH5A 1BD2B 4U3CA 5T3XL 4J3VA 2Q0ZX 2JKIS 1XZ0B 3ABLB 3M7FB 3MCG1 2DTML 4LEEA 2CDEA 4X7SH 3BLBA 4XH2B 4B0MM 3A24A 1PD0A 1CF1A 2VCOA 1K8DA 3P9WB 1X5YA 1BM3L 2AVFA 1MFBH 5B4MC 3I50L 3OKYA 1OQOA 5E9AA 1D5ZA 1FFOB 1IGIH 4LSUH 5HI5C 3QFJE 5IFJA 2Q7NA 1S9VB 1T2QH 4ANVA 3LZPA 4OFYD 1ZTXE 4BZ1L 1YRKA 3IN0A 5ANME 5IG7A 2FQDA 3FN9A 4GKZB 4ZFQA 4HQQL 4OSUH 3QIBC 4F5CA 1MW1A 4NZRH 5E08L 2WLMA 2WWOA 3KLSA 4K7PH 3VXSD 5AG8A 4D0CB 2AQ3A 1H15B 2IV9A 3GI9H 3PJLA 1E2VA 3O3BB 4OR1A 4YSUA 1EFXD 4DN4L 1HN1A 2OMZB 3QRLA 5AYUH 4PW3A 4R3SA 2MRYA 2O5NA 3BWZA 3EW3B 1NFDE 5CWSB 1QVOA 4IBSA 2DLFL 1A6ZA 1CD1A 3LPFA 4ZUVB 2XVBA 3IWVA 5F1KC 2CUHA 2R0WH 5IWLC 3VX0A 1MFCL 5G5DB 3IGFA 1KGCD 4NFDA 4FTDA 1NMAL 2B9AA 1SDDA 3ERXA 3QWRD 5C0BA 1N3NB 3VXSA 3HG5A 3VDAA 1KIQA 1GOGA 1Y07A 2R15A 2JJSC 4J1UA 4WI4A 3HS9A 1IAIL 3WFHA 1RV6X 2LE9A 3S4SA 4APQA 4R0LC 1U8PB 4QHLA 1ZSDB 1BX2A 1DBML 3Q1SL 2AEPL 3HZMB 5CP3H 3S3DB 1EH9A 1NGQL 2HWZH 4HBQA 4XOCA 3WKNA 3KWVA 2X89D 2Y1AA 4BZ1H 4MDIB 4PJBF 3GKWH 1CGTA 5EC2A 1YNTA 3NN8B 3V4VB 5IW6A 1TZOA 2B0SH 4NQDB 1ORSA 1PKQB 3L95B 4UDUB 3VGEA 3LD8C 2OS7A 3X1BA 2X53A 4FQXB 3FFOA 3K0WA 3UAAA 2YZ1A 4QHNB 3F12A 4Z6AT 3K8KA 5DGRA 1QUPA 4ZFFB 1PG7W 2CKBH 1GHFH 1X5FA 5IB2B 4UZGA 4DN4H 3PHOA 5E8PA 4L3EE 2DD8H 4PP2A 2OMVB 3BJLA 1G9NC 2OULB 3LJ3A 4KK9C 4GXVH 1KLFB 1AOHA 3KPSA 3DX4A 1FL5A 1EIBA 1ZD6A 2J1WA 3HN3A 1CDCA 4MAYC 3SE3A 2ARJB 3ILQC 3TIDA 3VWJC 3FHEA 4U7MA 1TPXB 3UZVB 4EN3D 4HWNA 2FHFA 3IDJB 1IC7L 1IAIH 2XWJB 3VACA 4X4ME 1NM4A 3U30C 2K6WA 3QORA 4C4BA 1CIDA 4B95C 1FVCB 4L8CA 1SJHB 3WHXA 3FYEB 2V4LA 1CL7I 3D2UD 3HAEB 2EDOA 2JB5H 4LGPB 2UWEB 4FNQA 4J3OF 2XYCA 4RRPG 2DL9A 1K5WA 1A6TB 3I2CH 4PCYA 1A7PL 1SJXA 3NACL 3AUWB 3D0VA 4Q0XL 5JXEA 4K9EC 4L3EB 4CSTA 1VPOH 1SOSA 3N0AA 4Y5VC 5HVWA 3B1UA 1WYJA 2BNRD 3I84A 3QDGE 4LFHD 1N8ZB 3IDUA 4MCYB 1WEJH 4MQ7A 4XNXL 1SYVB 2BJML 5BW7A 3T9WA 4U1KA 3LHPH 3GB7B 4K8RC 2P5EA 1T1WA 3CTTA 1IGYA 2WZAA 1UM5H 1FE8H 1PQZB 4YJZL 1E8XA 2VDRH 3BVXA 2XUWA 1FH2A 2JJTA 3L3OB 4UNTA 1JV5A 3DIDA 1IEAA 2IPKB 1WIPA 4XC1L 5IEKA 5J11C 1S9YB 3RWHB 2F54D 3CFIC 3I75A 3VM7A 4ZZKA 5BCAA 1A65A 2WBKA 4OV6F 2AQRA 3FFDB 1QSFE 3CFDB 2CR6A 4GQRA 4J3OD 5EU7E 3GC3A 3CWGA 5KVDL 1CDUA 3GXUB 3H3BC 4FFZH 4QRTB 1DLFL 1IBFA 2BFVL 1JWMB 1YJDC 4M9OA 4W9GC 3QIUA 1KYUA 4JKKA 3SPIA 4LDOB 1QMUA 3NA9H 4X9IA 1A6VL 3AREB 4L37B 4AMKL 3DX7B 5KWYC 2AJUH 4B5EA 3V5HB 1M1XA 4Q74A 5AKTA 3MRCB 2Y6SC 4RA3A 3DV4A 4D9QD 1BEXA 4S1SH 2EINB 4ODWA 1TKWA 1AGBA 4NQXB 4JO8A 2JJVA 3IJEB 3MV9E 3Q13A 5E6IC 3UACA 2X4SA 4AJWA 5KYNA 1BG9A 1SY6L 5AYTA 3QUXD 3RURA 2CLVA 3X3GL 2GG1A 4NZFA 4L3ED 1QSEE 3HS0B 3ECUA 3CV5A 5D4JA 2NYYD 4FNRA 2Y06H 1JXGA 2E8YA 2VLKA 3HE7C 1RK0A 1E9QA 2C7UA 2Y25A 5BZXA 3CK0L 4BH7B 4YQXL 1HAWA 1BGXH 5GISL 4OJAA 1DJXA 1FSKC 1GMEA 1UASA 2BWQA 2WCSA 2UY7A 5AVYB 2X6BA 2R2HB 3G5XA 4PHZA 4HIJB 2ZSWB 3NCYP 4OJDH 2WYHA 1IEBB 2DQCH 3QCTH 2A9CA 4JRYB 4X8CA 1I53A 3TVMA 2VDRB 1UZ6E 1UG9A 3KPSE 1AC0A 2VLRE 1U8HB 2VSMB 4W9KC 1WA2X 2N7BA 1P1ZB 2WIIA 4OLWL 3TBCA 3B6SA 2DQDL 5IESH 5EO0B 1P4BL 3OXRB 3SSGA 3VI4E 1RUKL 2OMYA 4G1EA 1ZLSH 4QXWA 5D2LB 4XN7A 4HXAL 2NUPB 1QLRB 1VZIA 2P8LA 3DNKA 5LGYA 3SY0A 2OJ1A 5ALCL 4LRIA 2EDEA 1TLMA 5JUEH 4EI5B 4ELME 3HRZB 3P30L 2DYSB 5FYJH 3TV3H 4NJ9L 3V0IA 1RQ5A 2FD6H 5CZRA 1Q9WB 5SV4A 5F93C 2DLGA 2DLEA 3UP6A 3QPXH 5DRWA 2Y06L 3HAEH 4NKOA 4JO3L 2VT0A 4EQ2A 3FOMB 4ONGH 3RFZC 5F9WB 1LO5A 2AP2A 4Y5VA 3DUHA 3FQXB 5MEND 3V8CA 3X1GA 4KO7A 3RVXC 5LO7A 1VEOA 3C6LB 3PDOA 3RIFF 1ACCA 3PWPD 3WY3A 5L2KB 5BJTB 3NZSA 5C0FA 4EN3B 3T08A 2J8HA 3VDBA 4HAGA 4D8PB 4HDIA 3OKOB 1XGQB 2ENSA 4XHQA 2X42A 4XO8A 4BINA 2FJGB 4Z7AA 5EBMA 1EEZA 5JO5A 4KRPB 4FI6A 2AQ1A 4MD0A 1OSEA 3MBEB 4L4JA 5D96C 1VF5C 4EVNA 3SE9H 1HDMB 1MQKH 1CB4A 5IF0B 2RCSL 1U6AH 4FQQB 3LZLA 4IHOA 5EFIA 5LBSL 3UYPA 3AU1A 3F65A 1F90L 5JPNB 3ARBC 3S8WA 3BI9X 3VD2A 3TC9A 2OBGA 5HGDB 5EV7A 3QNYA 5GGRY 4OFIA 2WB7A 4WFHE 5GSVA 3SQBB 2GJ6D 3MLVH 1BZ7B 2IG2H 3JWNG 1OE3A 2BNRB 1VFUA 3LKNB 3DYPA 3WY1A 1CXKA 3H85A 2E9BA 3VWJB 3S97C 1U3HA 2H6UA 4N1CA 3C60A 4YSPA 5DZNA 3WG7B 5C7XL 5I1JL 1JWUA 3ARGD 5CD3B 4BSWB 4XPGL 5IR1A 4PWJA 3V6FB 4RISL 2EIBA 4GB9A 4EXKA 5DO8A 1PJWA 2R2EA 5EZLA 4Q89A 2X4OB 5DVLA 4AIEA 1W6LA 4F9LC 2VOTA 3O9WC 5D7LD 3KEHA 3ZDWA 1CFVH 2FAUA 5AKVA 3MRLA 5CGMA 4QO1A 5BQ7A 3APMA 4DKTA 2CIKB 5IBLD 3U25A 4GMTL 4OF8A 3B2DC 2WVVB 1ZIAA 1Z5HA 2E6QA 3B9KD 3KW8A 4XMPL 1WD8A 3TO4B 3FT4B 5CILL 1E8YA 2CIIB 1FO0H 1A8JH 4IEFA 2BOBA 4Q58C 4UT7H 4Z7OF 1FZMB 1AGFB 1MJ8H 4EZJA 3GD1C 3TM6A 1ZANL 3FZUC 3LQMA 4PV8B 3RWEA 1UWXK 4N0FB 3Q5YA 3TA3A 4C4KT 4KTEH 1EXHA 3BZFB 3D39A 3LRMA 4IK6A 1ILSA 1M7XA 3KPPB 4HH8A 3ZL2A 4BSVA 1NUFA 4CMMB 2YAMA 4PY8J 1H3UA 1IC1A 3BIKB 3D3VE 4PJ8C 1M7IA 4U7KA 4DAGL 4NZDA 4YSRA 3ZRFC 1P53A 3EOYG 2AQPA 4MA1C 1W2KT 3WE6B 1TCRA 4UQBA 2HLAB 4OM1L 3NRPA 2WVSA 4X5XB 4HALA 5KVFE 3EYOA 4PVLA 5HYIA 1WBYA 2WKGA 4MKTA 4ESKA 5D5MF 5TDOA 4XMXA 1WO2A 2BS8A 4N6RB 1QFWH 4QOKD 3ZL1A 2XX1A 4X9BA 2LVEA 5D71L 4A37A 5DC2A 3FTZA 3TBYB 4WUUD 3E3QE 4WFHD 4ELDA 1OT1A 1PSKH 5I6MA 1DE4B 1XQ4A 4LPWA 1YN7B 3CK0H 1M7DB 5E0FA 1MI5E 2WBJA 3LKPB 3FUNA 5EIIG 4WJ5B 3N6YA 5ICZA 2BCKB 5I16B 1FFRA 1MCJA 4FXKC 3VTTA 1G94A 1W8OA 2C26A 4WDIA 1KTDB 2C9PA 5FCUL 1I75A 1H6TA 1Q0XH 4PJIA 3C8HA 3ARFC 5FA4A 3L3DB 3HPJA 4YZWA 5JDSA 1XH2A 2VUYA 1G6RB 1RUPL 2F18A 3HW7A 4N2CA 4UQCA 5C0AD 1GGIL 3S88H 3QDHA 4BZ2A 3QWOA 1GTFA 1JK9A 1YNTF 4F80A 1NAKH 2XZQH 3ESNA 3FKUS 5ELIA 5EOQL 3LIUA 3AG4B 1MREL 1A6WH 5F3HB 1JF1B 5D1QB 3BWUF 1WIUA 3TV3L 1K72A 1Q94B 2E4TA 3JUYA 2D7TL 4FYSA 2Z34A 3WDIA 1E7VA 1ITCA 3LV3A 3P73A 3QJFA 2N01B 5CINH 2XWBA 5F89B 4HU8A 5I75B 3KGSA 4X0KB 1QRKA 3II2A 5J11B 4HUXB 5CJXA 4MHHG 2VDNB 3GZOA 2O26U 4QY8B 2FECL 3WIIL 4M6MH 3VD9A 1KGWA 2H6PB 2H3NA 4Q9BA 4XCYB 3RDTB 3WEMA 4F2ME 5I1CH 1F1DA 1SY6A 4P9HL 2IF7A 3G5VB 3AGWA 2WQUA 2FBJH 4XCNA 1AANA 4NIYE 1YNKH 3X11A 4P5KB 3GBML 3DTUB 2O72A 2GAZB 1G7QB 2UUDH 4QLWA 5GGUA 1DVUA 2WSKA 4M61A 5F6IC 4PRAA 3VCLA 3ZDXF 5FW7A 4M62L 1TOXA 3P4MA 3AMLA 1DL7H 3C2AH 2J6EA 5DJZB 1KEMH 1MHPL 3T0ED 2Q76B 3T1FB 4CA4A 3CZNA 1L7TH 2WWMD 3G5YA 2ROXA 3B5HA 5IZ7A 1J9CT 2B59B 4FTVD 5JHDE 4G70B 3QZPA 4NC1C 2X3CA 3W5NA 3CIAA 3UJIH 4CC1A 2NY0D 1G0YR 2W07A 2WQSA 3FO0H 2CGRH 4PRID 3O8XB 4Y5XC 5TQ2L 5MENB 2JCCB 1NL0L 5DLML 2HYMA 1YUHB 3T8XA 3ZU8A 4EIZC 4YGVB 3OKEA 3VGDA 4OGXH 1P6WA 3DXAE 3QYCA 5KVFH 5T1MA 3ECBA 4JFFA 4OJCA 3ULAB 3TPUB 1P0SE 1DQJA 1ZV5A 1OOAA 5C7XH 1ZTXL 2HX7A 3SDDA 4O2EB 3R4RA 2OJEB 3ABGA 2HG0A 4XVUC 5JHDB 3SDXE 5TQ0L 1RK1A 3D34A 1JPGB 1DQLH 3FB7A 3OZ9L 4PY8I 1NCBH 4S2SB 4U1HA 4WF7A 3S8GB 2WGXA 2ZJSH 1DJYA 1N5AB 5MENE 2VRQA 4JFED 4J1UB 3CHOA 5C09B 5IUSA 3PL6A 3WFHB 2RB8A 2Z7UA 3R0MA 4YDKH 1OP4A 1UH4A 4KUCD 1ZLVH 2A7BA 1X9UA 2ODIA 1L0YA 1U8PA 3QQ4B 4PP1D 3RGBA 5AVTB 3QISA 4J3OC 4NHCH 5FOBA 1AH1A 3H4HA 4FP8L 2MOQA 3N5AA 3UG3A 1OSYA 5EU6D 2VDNH 5FX3A 4PJXE 4JY4B 4HOWA 1UB5B 5TK2A 4OGQC 4HS6A 2BIHA 2CGRL 1I3RA 5TQ2H 3VRLF 1OO2A 1QBLH 2D03L 4NZTL 1QSFD 3GSOA 2A9NH 1UJ3A 2Y2WA 5LDUA 3DX8B 3MO1A 1I8MB 4E5XB 4AQAB 3D12B 2F7QA 6FABH 3C8DA 1J0HA 3ESOA 3MJ8B 3MCKA 4UOQA 1TO5A 1Z1WA 4K2UL 4Z23A 4EUPG 4FI7A 1B0WA 5GGTL 3HE6B 4X99A 3VXPB 3US0A 1GS6X 4ZMAT 1CG9B 2AK1H 3MNDA 3S9DB 4N9GB 1NINA 4JZNB 1L9SA 4WW2B 5DI8A 1FWXA 4IBZA 3UBGA 3BGFB 1S7TA 2WXRA 3TYGH 3WOVA 1IT9L 5CLTA 2DIEA 2QBWA 3KDMA 1FJ1B 1A02N 3IDJA 4N20A 4TVSa 4M7KL 4PREA 4BUGA 4HGWA 1OTTD 1PSKL 3ARGA 4TF4A 2YK1H 2I07B 4LMQI 4W6YB 4FCAA 2WXOA 1YMMA 4KDTC 4HXBH 1INQA 5LXGL 1INDH 4K5LA 4ZAKD 3MODL 3LZQA 1KLGB 5J1AA 5CCKL 2H3XC 1OW0C 1SXSA 5GHWH 4P0DA 1EGJH 3MGAA 7FABH 1RIUH 1OZUA 2P46B 3QNZB 4IRJD 1X7QA 5C09D 4LF3B 4JKLA 3QZWB 3BWAA 4BKLB 3MC0A 2X40A 1OARL 2JMRA 5DS8A 4GAFB 4LLMA 3THMH 3C6LD 4XH2A 1J5CA 1RZJC 4JO5A 5DC0A 5I5JA 3QEGL 4C54A 1U8IA 1IAKA 5JPMA 2VL5B 4IOIA 3VFVB 6FABL 3E8VA 4U1KB 2G0KA 3FT2B 3O3UN 4U6YB 2KH2B 4QRPB 2Y07L 3B2XA 3ESPA 3BRGC 4OUUB 1I3GL 1HEZB 1G5AA 4YUEH 5FYKH 4KDWA 4JR9H 4GT7A 4IBUA 1WFUA 3CDZA 4L18A 2IPKA 4L3CB 1GYUA 5D7KD 2IPUK 1IKOP 3D0LB 2CJTA 2GSIA 4YXKL 3FU9A 4ZK8A 1EWHA 2WXFA 3TH2T 3HN5A 3WFCL 3Q06A 3P0YL 3K6NA 2EYRA 1A3RL 3RGVC 4OCMC 4PJ7A 2ZF8A 3NIDE 2XJKA 2O61A 1NMCB 2LLNA 2EEDA 2WINA 5ERWA 1NC2B 3HRZC 3V55A 3ARTA 2NTFB 4MVBC 1KT2B 2BM3A 4P8QA 1SYSB 1N3NA 2DWEA 4JQXC 5IV2B 3QQ3A 4XO9A 4U1LA 4OJYA 2J21A 3FS9A 3FRPB 3W56A 1KJ2B 1UD6A 4YC2B 2ZKHH 1X7SA 1YUKB 1WIOA 4UUJA 3ZYIA 1EXUA 3HTLX 5HD8D 3KLKA 2RMNA 2P44B 3ELQA 4UTAA 4FG6C 3G08B 3I02A 1IFHL 4XNYL 4PJ9C 1T89A 1NEPA 3WCYA 4UQ3B 2LU3A 4DNLA 4NZUL 1ZHLA 2BSED 5C86A 5KAQG 1NL0H 5DLMH 1PKQA 4EN3C 3B2PA 2NSMA 3IU4L 4G8IA 3T2NL 5AG9A 1ZA6B 4S10A 4OZIE 1AXIB 1QEWB 2ADJB 3V4UL 4X5RA 1FPTH 2CHZA 2EDQA 2N0KA 1JTPA 3F6JA 4RETB 3VWKC 3RZCD 1YPZB 1C16B 5H4YA 5TFSH 3CXFA 2PUQT 4G6MH 4BQ8A 4AG4L 3U46A 5K33A 3ULUE 3HVDA 4P2RB 1YDPA 3BIBX 2NNAB 4Y4FA 3KLAB 4FJ6A 3ZDZB 5KYWA 1TEFA 1QP1A 2HJKA 4X6EB 1RZFL 4APQC 1L4IA 3GXMA 5INCA 3VFUA 5EIIA 2Q87A 3IJ9A 3UJTH 4DIXA 4OD1L 2AJSL 1KB5A 4WI5A 5T8IA 5DLLA 3QUXC 5LBSA 3AZUA 2ZKHL 1A9EA 4HIXH 4X6BA 3ET9F 1NDMA 4X2UA 4RFNC 5LGJA 1UA3A 2YA2A 4LIQE 2ADIB 4ZO6A 5JHDD 4FFZA 4X8JB 2XV6B 2N7SA 4PJCE 3JV0A 3DECA 3WN6A 3KCPA 4PJGF 4L3EA 1I7TB 1K5NA 2BCMA 2XZZA 4PB0H 1FQ9C 1Q9OA 3MGTA 5FYKE 3N2JA 1N64L 3QULA 4DF9A 3FN0L 2QADC 2ROYA 2WO4A 3ZE0B 1T1WB 3I6SA 4JNXA 4N26A 3L8QA 5TF0A 1PD6A 3QJTB 1JRHI 4HT1L 5LGHH 3VTMA 1V3MA 4LCYB 1XGZA 1MRFL 5FR3A 1E4XL 2CO6B 3T77A 2R8SH 3ULVE 2HFEA 4HHAB 4OLZH 5H8DA 5E1QA 1E42A 4HIIB 5IJKC 4F8TA 3I74A 5JIKA 1YJDH 2W9DL 5FF6B 1ASPA 2HFFB 5F7MC 2AFNA 2Y6SD 2X4NB 4WI2A 2MQ3A 1OGTA 3MRIB 4GMSH 5I0ZA 3UL4A 1JWMA 2XWRA 1INDL 4X5QA 2OYPA 2Q1EA 2BY2A 3VD0A 3D8MA 5DHYA 3NSXA 1FL6B 1PL3A 1W9XA 4XC3H 3U7AA 3SPHA 3DO3A 3FT9A 2HKHH 1R24B 3RVTD 2NCEA 2IFFH 3N1FC 4YDZA 3O4LB 5F8RC 4L4TD 4X6DE 2DQUH 3B83A 3EF7A 3B8YA 3SQBA 1UGNA 3FF7A 3G9AB 3VSQA 1RZ7L 4FGMA 1KYDA 1T4WA 4OCWH 4TUKL 4EBQH 3LKNA 1A9BA 3S3CB 2H2SC 3A6OA 1TQVA 4KV5E 3MV8D 3VXMA 2XIDA 1TKWB 3ZKXC 1I9RL 4PJ5D 4CILA 4I0CC 4UILH 5CD3A 1ED3A 1PZDA 4YVUA 1IU1A 3NJLA 3ROLB 1QNIA 2UYLA 2PP8A 3ARFA 2MKWA 4MJHA 4XHJC 3NK4A 3BSHA 3QYMA 4ECNA 1UD4A 4U0QB 3DX2A 3J8F7 2AW2A 5HDBE 1RFDH 2HTLC 3NZ8B 3QI9B 3MZTA 4LEXH 2VLKB 1RK0B 2C7UB 4PUBL 3RY5A 3X14B 2VXTL 2BSRA 3L2MA 2WLNA 4YFDB 2BVYA 4NUMA 3WFCH 2JJUA 1F0LA 43CAB 2EH8H 4Z7QB 3WJMA 2IH1A 3UIZA 3KXFA 4G3YH 1UWFA 2V17L 2Y2YA 2MWCA 4TUJA 1LO3H 4QKXB 4UOZA 2PO6D 1LP9E 3D1MC 4U2YA 5DVMA 5CFHA 3BXNA 1OZTG 3LKSA 5DK0B 2X6VA 3TNMB 5DC9B 3LN9A 3O9WB 4I4WB 5DJXA 3P69A 2CPUA 2X05A 2CUMA 2VXSL 4YX2L 1SEBA 1X4YA 4NWUL 5FA3A 1D6EA 2NY2B 2VAAB 3MXWH 1QLEH 4B96A 5CHNB 3BPNB 1AQ8A 2NYKA 4JRXB 4YH6A 5DHXB 3BIKA 3L2LA 4LBAA 4BQ6A 1JL8A 1F97A 3OJDB 2ZTBA 4DKEL 2QSCH 3GBDA 4HPOL 2Y7QB 1D5BB 5JOPD 1Z5YD 2GTQA 4G7YL 5CGYD 4EI5A 4YHYB 4QGYA 1RY7B 3KS0J 4F33A 1R3LB 3NSCA 4KROB 4OCSH 4R2GC 4HWBA 5TDOB