4NV3A

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with valine.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with valine.
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
total genus 138
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nv3A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nv3A01
4KZKA 4RU1A 2MSWA 4Z4FA 3C3MA 4MYRA 3MMNA 3JS5A 5GOTA 2A9RA 3RVNA 5FWXA 1ISRA 3IP5A 3D02A 4OATA 3GYBA 3CHYA 5TQ0B 1S8NA 1DC8A 3HJFA 4ETIA 1TLFA 3H5TA 4H3KB 5CNMA 3SM9A 1USIA 1NXPA 4N47A 3HV2A 3RQIA 5FWYB 3KTOA 1EWVA 2PL9A 1ZDMA 5FBKA 3NHZA 4EYGA 2JK1A 3O1IC 1FQWA 3FDFA 1Z2EA 3TX6A 5JS1A 2A9PA 1BVHA 3KS9A 3Q9SA 4RSMA 4Q6BA 1QP4A 4MRMB 1ZGZA 3OQMA 3QELA 3LUCA 4G0MA 3C97A 3LUDA 1Z17A 2CD7A 2IKSA 4Z0NA 4KMRA 2GWRA 3I09A 3IPAA 4RK7A 4Z9BA 5KC9A 5JNSA 4YV7A 1M2EA 4RXTA 3B2NA 3BBLA 3JVDA 4E7PA 3N0WA 3MM4A 4JP1A 3BILA 4G86A 3OQNA 3H1EA 4G0QA 2NT4A 3LTEA 4KK3A 1SD5A 1ZHHA 3H1GA 1K68A 1SXIA 1W25A 1P2FA 4RV5A 3KG2A 4XXHA 5T3YA 5GQSA 3LFTA 2AYZA 2FVYA 3QLUA 3CZ5A 3RVRA 3TO5A 4MGEA 3EQZA 1PUXA 4OBBA 9ABPA 1KRWA 3RVPA 1DJMA 1SXHA 1FFWA 1U8TA 2FEWB 4MS1A 1RXEA 1MVOA 2FEPA 4JB0A 1P8AA 1JWLA 4O1IA 3N0XA 4Z4EA 1JDNA 4WUTA 4OG2A 4F11A 4RDCA 4EVQA 2QV0A 3GL9A 1MB0A 2QXYA 2MYTA 4LE0A 4JB2A 2FEKA 4O5AA 2HPHA 4RK0A 5I4CA 2PUDA 3HM9A 1ZAYA 4LRQA 4RY0A 4D6XA 5CNJA 2PAFA 3HS3A 5TPZD 3C3KA 3C6QA 2V0NA 3SNKA 4G0YA 2MYNA 2QSJA 4Q6WA 4N41A 3T6KA 1DBQA 3NNNA 4DADA 3F6CA 1M5TA 4ZPJA 4HNRA 6CHYA 4G0OA 2R47A 1U0SY 3G85A 4KPYA 1KRXA 4EYQA 2CWDA 1MIHA 1ISSA 1MAVA 3HEBA 3SQNA 1ZVVA 1EWKA 4P1ZA 4XARA 1PEAA 2VK2A 1DP4A 2PUBA 2HJ9A 1JX6A 2ID9A 4MQFB 1B00A 2FN8A 3O2QB 5KQPA 1GLGA 4RKQA 4N76A 1CHNA 1JH9A 4MLDA 3H6GA 5TQ0A 3CZCA 5IUKC 6ABPA 5KQLA 5JNVA 2JVIA 1ZH2A 4ZMSA 2RDMA 2E4XA 3IP7A 3VNAA 4Z4HA 1C0EA 8ABPA 3IPCA 4XASA 4KREA 3OM1A 1KGSA 2XDYA 4JASB 5TQ2B 1DBWA 3EULA 3Q7SA 3N8IA 2QZJA 1JDPA 3Q7TA 1H9CA 3QEMB 1KMIY 3EJWA 4PYRA 1RZRD 4KNYA 1C4WA 2ZAYA 4LDZA 3S99A 4H60A 3G1WA 2WJWA 2MYPA 4WT7A 1USGA 2KYRA 3OLWA 4YWHA 2R48A 3KYIB 3BRSA 4W5RA 3GA5A 3OQOA 3HK2A 1XWWA 2FW0A 2WB4A 1Z18A 1U2PA 3LMKA 3CFYA 2X7XA 4YS6A 5FBHA 2JBAA 1JBEA 2IPLA 3CU5A 3FMVA 3OLVA 4IF4A 4EUKA 4RK6A 2QR3A 1VKRA 2GX6A 1D1QA 3RVMA 3VNBA 1EFAA 3GV0A 5T7BA 4O1HA 3ROFA 5D2CA 3C3WA 4PICA 2LIVA 4LZLA 2PMCA 1A0OA 1YK1A 4MR9A 4RY9A 2R25B 4RY8A 3RVJA 3QEMA 1BDIA 3H5OA 3ILHA 3LKVA 2RGYA 1A04A 3OLXA 3KLOA 3KCNA 1U2QA 4XFKA 2QVGA 1OXBB 1WETA 2H3HA 5KI6A 3GWGA 1E2BA 4Y9TA 2OQRA 1AB5A 5CHYA 5CNIA 3M6MD 1Z16A 3H1FA 1M2FA 1LJUA 2M98A 4N0PA 1JFVA 3CKMA 4B09A 4MR8B 5TPWB 1GUBA 2B4AA 1D1PA 3F7NA 4F06A 4IMIB 3LUHA 1A2OA 5HKOA 2QW1A 1D5WA 3T38A 1NXVA 5BQ3A 3W9SA 1J56A 5EWLA 1YMVA 2DRIA 1Z2DA 3H5VA 3NBMA 1DC7A 1K66A 1CEYA 2HQRA 5B3JA 3LUKA 3H75A 3KYJB 3KJXA 3L49A 1R8JA 1BAPA 4N0QA 4MS4B 3KKEA 3LUGA 3MIZA 4G0PA 1VLZA 4MS3B 4N03A 5C5EA 5JNWA 1NXOA 3LUJA 3QEKA 1RPJA 3KHTA 5DKFA 4KK4A 5IUJC 3MF4A 1BDHA 5F64A 1TVMA 1XHEA 5TE9A 2PUFA 4XLTA 2JVKA 2PL1A 1P6UA 2IYNA 2PKXA 3NNDA 1ZGGA 1YS6A 3EAFA 1E6KA 1YIOA 2WMYA 3O2SB 3QX9A 4JOQA 4RXUA 2RJOA 3K4HA 4M88A 5IBQA 3TMYA 2FLKA 4QYMA 3A0RB 4G0ZA 4IGAA 1PNRA 2FTKE 1OXKB 2FMKA 4QPJC 3SG0A 2HQBA 2L19A 4ZYLA 4ML3A 3KLNA 5IC5A 4EYOA 1YVUA 1SXGA 1ABEA 1LJLA 1MB3A 1YK0A 4ETNA 5JNRA 1DG9A 2GKGA 4IRXA 1USKA 2FQYA 1GCGA 3O74A 4JAVC 1Z15A 5DLEA 3OLZA 5JS2A 4S04A 3HUTA 1ZN2A 4HNSA 3LOPA 4RXMA 1T34A 5JNTA 2IOYA 1URPA 2LPMA 5EWMB 3RH0A 4MQFA 5FWXB 4F8JA 2JBAB 3F6PA 3IDOA 3N0RA 3DZDA 4S05A 1NXSA 1W9HA 3DGFC 3LKBA 2JRLA 4FE7A 4RK5A 4ZJPA 2MYUA 2JB9A 2N9UA 3GRCA 4EY3A 4NICA 2LUOA 4MQEA 5PNTA 1DZ3A 1IIBA 4KQCA 5DGCA 1P6QA 3GBPA 2LBPA 4RK4A 4NCBA 2GBPA 1NXWA 3H5IA 4MAAA 3MA0A 2FN9A 4IILA 1U04A 2P9HA 4RWEA 3O75A 3N75A 4TN5A 3QLTA 2PUAA 1DCFA 1PEYA 2WJAA 2TMYA 2O20A 3QX8A 2IPAB 3A0UA 3H6HA 4ZMRA 5IEJA 3JTEA 3OO0A 3DGEC 1NXTA 3IP6A 4RKRA 5EWMA 4UHJA 7ABPA 1DCKA 3RVLA 4W5OA 5DCLA 1GCAA 3FFTA 1ABFA 2VYCA 4YGXB 4WZZA 3Q7RA 1JHZA 3HDGA 4EVRA 3HO1A 3LUFA 4YR7A 1Z13A 1LBIA 1QO0A 5B3JC 2WY2D 4EVSA 2WRZA 5KC8A 5TQJA 1Y1LA 4YO7A 2J48A 2E4VA 3CS3A 4F3TA 5FWYA 4DQDA 1PNTA 1QKKA 1QQBA 4EYKA 2Q5CA 1TM2A 1SRRA 5ABPA 3QLVC 3A3KA 4MR7B 4Z4GA 3E3MA 4TLLB 5KQMA 1BDJA 5JNUA 2JVJA 2FMFA 3EODA 3N6VA 5BRAA 3ILYA 4MPTA 3O1HB 2PE5A 4D74A 3N53A 1BA2A 1NY5A 4HYEA 5KQGA 4GNRA 3OO1A 1TJYA 2IDMA 3HUUA 4KV7A 4QYWA 3F73A 1Z12A 3UKJA 4TMYA 4FB4A 3GT7A 2F8SA 2E4WA 3Q41A 2PLNA 4LX8A 4H3HB 1ZH4A 1RXIA 2NT3A 4MS3A 4RZSA 1YS7A 3DBIA 3QELB 2FMIA 2W42A 4MQEB 1QPZA 2H0AA 2PUCA 4PZ0A 5EWJB 1EHCA 3O1JC 1ZITA 4NQRA 4W5QA 3T8YA 3M9XA 4YCSA 4W5TA 3FFXA 2FLWA 2WWVD 1FSPA 5EWLB 1L5ZA 4YP9A 3CG4A 2PUGA 2HQOA 2CHEA 3R0JA 4MS1B 1FFGA 3CG0A 4KQ9A 4MS4A 5HQJA 1HEYA 4MR9B 2LP4Y 4IMJB 4UHKA 3NHMA 4ETMA 1LBHA 1EWTA 1PHRA 3CTPA 3HCWA 3UUGA 1E6LA 1JYFA 2HSGA 3JY6A 1YTUA 2CHFA 1AB6A 2OENG 2RJNA 5IEBA 3JPWA 2FKAA 3URMA 5E3JA 4KVFA 4NV3A 1D2AA 4LDAA 1EAYA 1XHFA 1QP0A 2M1ZA 2PUEA 4NCAA 1F4VA 1VPWA 1NXXA 3OMXA 4DN6A 2MSLA 1DBPA 1QNLA 2NZUG 3MYYA 1E6MA 4OTZA 4G97A 2YHBA 4MLCA 2MSKA 5BR1A 1NTRA 3DLHA 4YLEA 2NZVG 3I5AA 4LE1A 2GI4A 2ZWMA 3T95A 5KWSA 4QICA 3IP9A 2ID7A 3A10A 5IULC 4RK1A 4KFCA 3SAJA 3O21A 1QQAA 2E4UA 4P98A 4L85A 1Z26A 4EGSA 3OLYA 4PE5B 5ED4A 1DRJA 3RVSA 3MQ4A 5CNKA 2IPMA 2L17A 3CLKA 4WWHA 4Z4IA 3TB6A 3FFWA 3DLBA 3EGCA 2I6FA 1ZY2A 2IPNA 3TD9A 2A9OA 1GUDA 4WXMA 1JFTA 4GPAA 4PEVA 3KSMA 4Z9AA 2FQWA 3HZHA 5HM6A 2JCGA 4F12A 5TPWA 2A9QA 3CRNA 4CBVA 1RZRA 2FQXA 3HSYA 5EWJA 4YRZA 5TQ2A 2FXIA 3BRQA 3H5LA 3RVOA 2NUBA 1APBA 2AYXA 4WXEA 3HVRA 1NATA 4FE4A 3P9YA 2YHAA 1I3CA 1QO0D 4W5NA 1UDRA 4OLAA 4E7OA 1DRKA 4MR7A 3BREA 2E4ZA 3JVIA 1QMPA 2PJUA 3ROTA 3RVKA 5DTEA 3O2JA 1JYEA 1JLKA 3I42A 3Q15C 4TLMB 3HDVA 4L4UA 3UK0A 1TMYA 1ZESA 2E4YA 1RNLA 1JFSA 3JPYA 3M9WA 1JL3A 4D6YA 3CNBA 3LUAA 3OMWA 3NNSA 1DCMA 3D8UA 4G0XA 2P4UA 1M5UA 1VRVA 4XAQA 1YMUA 4Q7EA 4HNQA 2BGGA 4OLBA 4Z4CA 3EDCA 3EQ2A 3E61A 5HSGA 2QVCA 3QLUC 4LE2A 3GBVA 1QP7A 1F51E 3SY8A 2FSPA 1CYEA 4MR8A 3I45A 2F8TA 5BRJA 4RS3A 2VUHB 1L5YA 3K9CA 3OM0A 2L18A 4KRFA 2VUIB 4JA2A 3QK7A 1Z25A 1JF8A 2L2QA 5C5CA 3L6UA 3HXMA 2FMHA 3QLVA 3FGZA 2B1JA 1FFSA 5IUNC 1LK0A 4Z99A 5IX8A 1D4ZA 2QU7A 2R4QA 3H5WA 4MRMA 3RVQA 5TPZA
chains in the Genus database with same CATH superfamily
4Z4FA 4K0KB 3GDHA 3H5RA 5L7YA 1ODJA 1H2HA 3HH8A 4I1YA 3KYCA 4M37A 5KHAA 1XZNA 4B43A 4C6TA 2JCSA 2AEJA 4PQGA 1LJ8A 4EFMA 2RHDA 1E9SA 1Y8RB 4ZTBA 2OHGA 2H1VA 1VSQA 3EXHB 2N46A 2N1MA 3DPUA 1J70A 1PQ4A 3O47A 3QOFA 1DQRA 5FOUA 5B7PA 1L5HA 1TVCA 2CMGA 2VQ6A 4DMRA 4GL2A 4N47A 1W2WB 2ZAMA 4LGVA 3FAKA 5IMBA 3KD3A 2CJPA 3CSSA 5EESA 2PL9A 4O2AF 3L06A 4RIEA 2ARKA 2VPWA 1N2JA 2QJTA 5CT5A 1AO0A 4IZHA 1L4FA 1N8NA 3ENVA 4HQRA 1TU0A 1FBNA 4PTLA 1BW9A 1FTQA 1ZU5A 3NEPX 3NQ41 2R0QC 2Z5GA 1CUDA 1L2TA 1NNI1 2NSYA 3RCBA 4AMZA 4BNNA 5LU8A 1WY5A 4JXZA 5CM9C 3FMGA 3REGA 1C9NA 3OM8A 3SBXA 1XZHA 4GZMA 1A50B 1O94A 3TNJA 1COWD 1AO3A 3IYLW 1GL9B 4B31A 3HYTA 2PZKA 4JOSA 1F0NA 1XTSA 1CS0A 1I7PA 3IV9A 3T0IA 4V2IA 3ZJ4A 3GFGA 1XQ9A 2HUPA 1KO1A 1ZJWA 2BLNA 2XKAA 2XDWA 2I6XA 1KDRA 1D0SA 2QD4A 3G13A 3L0BA 2I4RA 4G25A 4INOA 5ER9A 3RJ9A 1MOQA 1F4LA 2X9GA 4G0QA 3V4PB 2HNKA 1DAIA 1V4NA 3SQWA 1G5RA 2QQ5A 4QNMA 1GSIA 2IELA 1W75A 4DARA 4I9HA 5BR4A 5LQJA 3QVUA 5GQSA 2IYEA 2EKQA 4GXQA 3WIEA 4E46A 5HGXA 4GH5A 3NBUA 1TJNA 2VDUE 3KEQA 5IHXA 2F55A 4G1MB 2D5BA 4EPWA 4Z1MA 1U0JA 2CVZA 4M87A 4IEIA 4PC7A 2WF6A 3R4VA 2FEWB 1CJUC 2JK0A 2KLHA 3VKUA 4CIYA 2J0SA 4HKTA 3QENA 2UXDB 4PBRA 1T2EA 2WA1A 4BGDA 1ESNA 1KJJA 4HVTA 2Z2KA 1KEZA 3F46A 3HP7A 3U56A 1RLTA 1NSTA 2AZMA 4Q3NA 4CM6A 3AHJA 2WJ3A 2MYTA 4CXMA 5CW1A 5HCUA 2GK3A 1C81A 1YDMA 3GUUA 3K0KA 3ONFA 1O9BA 5L3ZA 2BEWA 4GPIB 3HM9A 2HB6A 2TMDA 1HK7A 4C3OB 2PAFA 3NPAA 5JAUA 2I9KA 5FOTA 3CXUA 5DCUA 3BGSA 3A1EA 4LZZA 4BWFB 4AFNA 3B7PA 3I0NA 3T9EA 4P3KA 1E3QA 4DADA 4EL0A 1GZSA 4X95A 2I2XB 3EFBA 1RYMA 4NENA 3WTBA 4M7WA 4JBLA 3H99A 1MQ8B 1W87A 1AHIA 3D8TA 2ZRKA 4NESA 2ZB8A 2D3TA 3CX6A 1U0SY 1EQUA 2XADA 4L2IA 4CDGA 5C9ZA 1H5QA 4EI2A 4OB8A 1Z6AA 3T06B 3ZXYA 2MSNA 5LMZA 2OA0A 4V0KA 1HFJA 5CA1F 1MUUA 3QP9A 1E1CB 3SSAA 1E1QD 2XKJE 1ZVVA 4XARA 2PZMA 2QGZA 2X2OA 3U5ZB 3N5CA 2CSUA 4R84A 3VZQA 4OB6A 5JJLA 1DKPA 2YXNA 4R8RA 4OH1A 5KQPA 1VZ3A 1CNFA 5JJ5A 5CYGA 3PFIA 5K0LA 1CZHA 2H4XA 1QZ3A 4WCFA 1EXMA 1AY0A 3TECE 2OQIA 1TPYA 3L6DA 3LXXA 3QUQA 3A11A 2HRBA 3BSSA 1YS9A 2IODA 3KT8A 4N7JA 4BQRA 5JDCC 3WOVA 4OQEA 3VZRA 1BZYA 2VCEA 1XTBA 3TSWA 1USWA 5HFAA 4JASB 1NV8A 2PX6A 1UBMS 4XX0B 1OYWA 4IIBA 3IOEA 4YASA 3OPVA 3BD7A 3IAFA 1JEEA 1QHIA 1DNPA 2WSYB 3HACA 3Q3JB 1H9CA 1GOTA 2Y3IA 1MX5A 3Q3VA 1E9FA 1PFGA 1GSHA 2ZAYA 4OVKA 3IGFA 5BUCA 4YCNA 2PT6A 5FPPA 2FZEA 2MYPA 4WT7A 2FPOA 4TKVB 1KIMA 2BFEA 1GQRA 1EX7A 1L1QA 1HETA 3MWJA 4WZBE 1GPLA 4I7EA 3AUYA 3DVRX 3M4ZA 1FFYA 1Z5PA 3F3KA 1IH8A 3LMKA 3MPUA 4KXMA 3STXA 4F9EA 5DM1A 4F93B 4L6CA 4C2TA 5I45A 1JBEA 2VH5R 4DVJA 4Z54A 5IJ9A 4IF4A 1Q0TA 4X54A 2JLXA 4X85A 2UUCB 1Q0HA 4A6EA 5LKAA 6LDHA 5I8WA 3H05A 3ADPA 4CKBB 4A0QA 1DKUA 2ZJ6A 3P0EA 3GLGB 1SVUA 2IP2A 3LZ6A 2QTRA 3O8DA 4ZO7A 3P0IA 5IHPA 2OPBA 4P4SA 1L8XA 5FH9A 4KR7A 4FWTA 2JIQA 3ZWKA 2AFIB 1CZLA 2RHLA 3G2OA 1ZCBA 1V8BA 4LNAA 1P39A 2QLFA 3A6EA 4RY8A 4A03A 4RAOA 4E1BA 1UBRS 3H5OA 1QR6A 2GFHA 4NJMB 2VJAA 3VBCA 2A2ZA 1E2PA 3DPIA 1K63A 1DKQA 2Q6VA 4E33A 3UUEA 3KCNA 3UW3A 3DOOA 2CLSA 3A6PC 1NYLA 1Y81A 4GXTA 4IFBA 5JUWA 4QM7A 1WSWA 3G23A 3LHFA 2D2FA 2BKEA 2WTXA 4YAUA 1ZGBA 3GLTA 2G71A 4U2DA 1P4GA 3IQIX 3IAM1 3PXUA 4RCYA 5JNLA 4UVGA 4F2HA 5CGQB 1N2BA 3GEEA 3EXG2 4MR8B 2DEUA 5EIFA 5BNTA 4UZSA 2I76A 1LRJA 2IP4A 4EG5A 3AHEA 1E0KA 2AI3A 2IZ6A 1ORRA 2C1EA 3DYBA 1V5WA 3QA3E 1KJNA 3B3FA 3MRXA 1WOMA 4E3WA 1PFQA 1ZMOA 1WNFA 3FF4A 2QDKA 1FPMA 2GKSA 4UVHA 1DC7A 1TM4E 2GN1A 1DKMA 4M1WA 4CM8B 2X8BA 2HU7A 4HDMB 4FGWA 4H6VA 3D3WA 1RQXA 3HJTA 1W96A 3GLHA 2BYTA 5K8CA 4D0LB 1GUYA 1UAAA 4WBNB 2P0EA 4L51A 2ZWIA 4O4JB 3TIXB 4MVCA 2AZXA 1FUEA 5A05A 3KHTA 3C4VA 4HQLA 4FEEA 4IFEA 5K3FA 3P27A 1GXSB 3TQTA 3WGLA 1TYDE 4UQLA 1JFFA 1GFSA 1W44A 1IY0A 1XNHA 3MOGA 4HXYA 4N12A 5DZSA 5K3DA 4MWTA 1EFDN 2EJUA 4JODA 1EVEA 2EG5A 4N7RA 2Q9UA 5H1YA 4HWRA 2HJGA 8OHMA 4B2IA 1IHXA 4KJZA 1RTTA 2Q3DA 3ZOKA 1NAIA 1R0ZA 4IGAA 4LKOA 3NM5A 5CFOA 1J8VA 5K7SA 4D41A 1SQ5A 1DUSA 2HN9A 2GPBA 4FS8A 2FE1A 3RHSA 5ALYA 1T8PA 3MWLA 3R44A 4RCZA 3THSA 3CNOA 3ETHA 4RQTA 3RF7A 3A1TA 4I4CA 4ND4A 2QBYA 3WL3A 3CE9A 1I6LA 2J3DA 3HA5A 3O3MB 1Q0SA 2QG4A 5C8YA 1JT2A 1RQ7A 5EXTA 1IG0A 1E32A 3K6JA 4GWLA 4PC3A 1H1LB 2QKYA 2SKDA 3R24A 3SBOA 1ODLA 1YBHA 1ANKA 1LWNA 1ZW6A 1EK5A 1H2RS 1GRVA 3QHAA 4N39A 5CIQA 3CSUA 4YAOA 4GP9A 4S05A 2Q3JA 1C7JA 1OCEA 1HY3A 5GMOA 1E3DA 3GDFA 2IXGA 4TTQA 4QTZA 3M2PA 2FDCA 3IMGA 3U3MA 1W5SA 2Z43A 5GY7A 3IUSA 1L5FA 4V1CA 3ZBTA 4AF7A 3DW3X 3UPDA 4DC1A 1JTVA 2FG5A 3X1KA 2MINB 3R9WA 3ABRB 4LNHA 3P9ZA 1I5EA 3BCHA 2GM9A 1NFQA 2JC3A 3HHEA 1ICEA 3Q85A 2H4YA 4O4HF 1W49A 4OFZA 2O7VA 2PPLA 4PY2A 3UA4A 2QR5A 1GNRA 4FZ3A 4BRSA 4DJEC 1FDIA 3VHLB 1B8NA 4DG5A 3H6HA 4KODA 5AKJA 5BVGA 2ZUSA 1OFIA 2XB6A 1TEXA 4NOLA 2A9FA 4QUAA 4U3JB 1A5SB 2WICA 4Q3CA 4JEMA 5BN4B 2VJNA 5AW2A 3FOBA 5KINB 2NU6B 3R7FA 2NWQA 3IIIA 4HHEA 4ZVKA 5GONA 1JDVA 3BTUA 3MERA 3NHKA 1JHZA 3LUFA 3PQ6A 1LBIA 1W8DA 1WPQA 3W7VA 4TGLA 4ZVRA 1FS6A 5BWLA 1WUJS 3I2FA 3MWDA 3JWEA 3SI7A 3RSZA 3PJGA 4ALLA 2AJDA 1KXZA 3R5HA 1R5JA 2Z95A 4CL8A 2B98A 1UXOA 3L1VA 4JLNA 1TYAE 2CLMB 3GGDA 5ALGA 5DRYA 1W6RA 4FYXA 1GA6A 2VSXA 3O8NA 3RHTA 4AY4A 5DX1A 4E08A 1FIUA 3LPDA 1ADBA 1O2DA 2P8SA 2ZT8A 4XUCA 4JR1A 1L5WA 4RDXA 1P19A 3VPXA 2PE5A 3GJ6A 4RA6A 2X2FA 4Q3OA 3M4YA 4DDUA 2G17A 2RKOA 3LBHA 5ITZA 4Y6LA 3L4JA 3E15A 1KU0A 3KCQA 2C0QA 3C3CA 3PSAA 1N2OA 1QTNA 4WX2B 5JEDA 1DB3A 3EZXA 1JSLA 2VNHA 3DDUA 3G2LA 4IKPA 2BI8A 5HIJA 3A31A 1LZLA 1W5AA 4RA9B 1RAHA 4X7RA 5EWJB 3O1JC 5FUBA 4CTKA 3QVXA 3DHWC 3MGGA 1KZ9A 4Q4HB 1FSPA 4LTDA 4BXOB 1P1HA 3N8KA 4FSXA 1Y3FE 1SXJA 3EGXB 4FOLA 5K3SA 2NPFA 3RVBA 1X80A 3V2HA 4GPZA 5FPTA 1RXWA 1ZJ4A 4ZVNA 4KQ9A 1EM6A 2GYWA 3D8RA 4KIUA 3TG2A 1JU3A 5CLHA 4CCAA 2WILA 2IQ5A 1D7OA 3G0GA 3SJUA 4A2QA 1O89A 3DPSA 2R7AA 1CY2A 5TGDA 4TKVA 2CHFA 4DB2A 3R3VA 4JEHA 3G9UA 3NJRA 4JEUA 4QASA 3L8GA 1JUDA 1B0PA 3H1AA 4HDQB 4RGBA 5IWAB 4KVFA 1L3CA 4PX9A 4DDHA 1JLRA 4MEAA 3HCAA 1QNLA 3DFKA 1C2YA 2W2QA 2YHBA 5EP1A 3WNBA 3P2YA 1ZC3A 3ZK8A 4MLCA 4D8VA 4QRDA 3NT5A 4FFPA 4DTIA 5CB4A 1MOSA 4YP0A 2NZVG 4QDXA 2HF8A 2WF7A 3K09C 4I19A 2AZTA 4L73A 3E5NA 2PNFA 4M54A 5KWSA 3PUIA 2DH6A 2ZROA 3HB7A 4MW9A 2YVKA 3BT7A 3F9IA 3FB4A 3GR6A 3TBHA 1N6NA 2PKQP 5KU1A 1LV7A 2PT7A 2PBRA 3RVSA 2INGX 3A4YA 3WHLA 4ENVA 2WB2A 4AT1A 3DEYX 1DO2A 4MCAA 4ARZA 1P4SA 2PQ2A 3SQDA 1PO7A 1XZFA 4KQFA 4O25A 2AG6A 1GKUB 2WJIA 3W4IA 2HD4A 1NP6A 4UPVA 3PPVA 2RHCA 4TTRA 3FFWA 1AK1A 2PFSA 4Y67A 3RIGA 3MRVA 1GU1A 4M8IA 1DAKA 2IPNA 3E18A 4NSNA 4QD3A 1T2AA 5JR3A 4WXMA 1HL7A 3IT1A 3A32A 3KSMA 4JKYA 5B1IA 1O4VA 3JZFA 4RX1A 3TTTA 4OX9B 4KIWA 4GE0A 3VH2A 5MGNA 4MO2A 2JAHA 3TVTA 3SZMA 2O23A 2VNJA 1YB5A 2SBTA 4YRZA 2K5UA 2ZI4A 5DYNA 4AJ1A 4RIIA 3SFZA 1NATA 1JEYB 3I2IA 3P9YA 3ZLJA 1IY2A 4C0KA 4W5NA 3SVZA 3QPCA 4W63A 4H0NA 4LOHA 3NETA 1XD2B 4A16A 3NJ8A 4JU9A 1JQEA 3HCPA 4HOYA 1U3FA 4PGAA 2F9FA 2R6R1 3BQ9A 4LOKA 2IUUA 4OB7A 1VJ1A 1K8ZB 1AKRA 3KO8A 1K7SN 1Z0SA 3BXGA 4U2CA 1SY7A 4K6KA 4JUFA 2NZ2A 5L4LA 1EFRD 1NHWA 1KXJA 1IVNA 1V16A 4L0QA 4ZGBA 2C5BA 1T1JA 2H31A 4HGRA 3FKSD 2JIPA 1JFSA 1FMFA 2HXSA 1HSOA 2HZ7A 1P7WA 3QPVA 4J0QA 4Y18A 4KR0A 3BXPA 2B8WA 4OYLA 4TS3A 1UPTA 1YZLA 1M5UA 2JI9A 3LCVB 3ZEAA 1IMOA 3GGCA 3WMFA 4HLUA 5JD6A 1UOQA 2YQ5A 1EUDA 2OFOA 2VDOB 3CLVA 3TFWA 2NIPA 5IDXA 5ILOA 1U11A 4KI7A 2QP9X 5D86A 1VCIA 1NRWA 2XRMA 1DV1A 1ZD9A 3EOBI 2EHJA 4R3WA 5KYVA 4HYQA 3RTBA 3U1TA 4MYHA 1BXGA 4YJ3A 3JQPA 2V59A 3C0KA 1HT0A 3CISA 3TL2A 4BC0A 2XVZA 4YV0A 2AW5A 1KQFA 2XD9A 4FMDB 5B4VA 5JPDA 4QVGA 5A4KA 4B6OA 1SO8A 3CURA 3HBFA 5AM0A 1Q0RA 1Y1TA 2B1JA 4L8VA 3QEJA 1K8XB 3I1FA 2XYPA 3KJGA 4JC8A 1JWBB 3EVTA 4X63A 4D0GA 3K9HA 2OG2A 3LY7A 4J76A 3TZ6A 1H4QA 2YUTA 1RWKA 1W19A 3BH7A 5CX1A 3FA2A 3HUFA 3OD5A 1ETUA 4FEAA 3JS5A 4CIBA 5H7XA 1PTKA 4YLYA 4OBXA 1XP5A 3U9SA 1NVGA 4S1TA 1I3LA 2QEQA 5EFOA 3A1FA 1TAQA 2QA5A 1JR3E 4YNBA 4ZRMA 4NXMB 4HBGA 3A27A 3N59A 5JCOA 1R74A 1FX0A 1U6KA 4RZQA 1G5TA 4TXMA 3H9CA 1CD5A 4ZJYA 3LW7A 3UJPA 1NXPA 1CSEE 2P1DA 3C24A 3FUTA 1EFHA 2P9YA 5EKUA 4G4JA 5G40A 1JLMA 3RS9A 4E2WA 4R3UC 1Y6FA 5FBKA 2ZJ2A 3CZRA 2VK4A 1HG1A 2WAOA 1UANA 2DFDA 2ZRCA 2GT1A 3A4NA 4B4KA 5ES4B 1GTRA 3D6UA 4Q6BA 1L4EA 4D98A 3RV4A 5LQNA 2P9QA 2Q6KA 4JLOA 2PJDA 4WKNA 1AHPA 2ZIFA 4NCJA 3TQSA 4G0MA 1Q1ZA 2W2VA 4Q1EA 1D2GA 5F1PA 1E7SA 5BNWA 5JIBA 2P5UA 4RTMA 4ZYZA 2XCLA 3O8CA 3OCYA 5J5VA 2DR3A 2QHXA 1SEVA 2OLEA 4QOHA 1GPUA 5HDQA 4KOAA 4J75A 1Z7BA 2H06A 3N1UA 3AR2A 4QPNA 4WH0A 4UCQA 2ZCVA 4H27A 4PWYA 3QBTA 2YWXA 3SX2A 5ECYA 3L40A 4NHEA 3GJ5A 1OI4A 2NQ2C 1XQWA 5JDCA 3S2EA 1EK6A 5GADl 4Q4AA 2JGEA 4WVLA 1INLA 3CZ5A 2BTOA 3AM4A 3NWBA 1SZJG 4GUAA 1L5OA 3IJEB 4V0SA 2PZEA 3LCJA 3PFKA 1CUJA 3OMLA 4Q5IA 2R8PA 4Y6QA 5ALPA 5DN6D 3RVPA 1RQLA 4UDOA 4XX1A 5K6AA 3P9SA 1OC4A 2BAGA 2GN2A 1YR2A 3FGOA 3I1JA 3BIWA 4GI5A 1JXMA 5E0KB 3TOXA 3DC2A 1OWPA 3KHKA 3JYLA 2AB0A 4O0MA 3C43A 5J4LA 2Y9MB 1MQSA 2B2XA 2AXPA 2WTMA 1XQ6A 3DV0A 2Z2JA 3SVLA 2GN8A 3KXDA 3ZDQA 1Z4KA 4QXQA 4UD2A 4EF4A 2J0VA 1XDUA 1T3ZA 1OLXB 3COZA 3IIJA 2X5NA 3JD0A 2H8GA 4HEA1 4P3PA 4D6XA 4AUNA 1IZ9A 1F0PA 2GHTA 3EXIB 3NP7A 3PGVA 1PLJA 3TKAA 2C4TA 2VQSA 2D13A 4Y2RA 3FCCA 5ESWA 5BOVA 2VWQA 4ENTA 1KK1A 1DVRA 2K4MA 2R5NA 4QUJA 2PRJA 5DXJA 4FW8A 1Z0JA 2VQDA 3A1VA 2GZHA 1LVHA 3PCXA 4JL8A 1S8OA 3RWBA 3V9PA 3ZI4A 4G0OA 4D46A 3VR3D 1ZIOA 2BISA 1CDDA 1Q0ZA 2HU2A 3HP4A 4GI3A 4KPYA 1YIAA 4PLHA 4NPCA 4LHYA 2ZJ0A 1JIIA 2ZVPX 1KYWA 3HDQA 3D3NA 3CPJB 3FSRA 2I80A 1JZTA 3MC1A 3MGAA 3U81A 4AP6A 5KVVA 5M34A 1T1RA 2C7OA 1XZIA 2YY7A 3O8BA 2VK2A 3KPWA 5DM0A 2QY6A 2JCBA 3OCVA 3VYVA 4BNVA 4MQFB 3VKHA 2FPIA 3AB8A 4IOMA 1KOFA 4EJSB 4I55F 4JCCA 3I39X 2ZSKA 2A5YB 2H2GA 3O8OA 2GEJA 2XQFA 3W1WA 2CL5A 2IHBA 3AEQB 1A95A 1Z08A 2D0DA 4JLVA 6ABPA 2H8KA 2TMKA 1EA7A 3N2KB 4LJLA 1AQLA 2FEXA 4MVJG 2APJA 3OM1A 4G1FA 1V6CA 4UZEA 5AW5A 4H1WA 5LP1A 2JLSA 1KE1A 4W1QA 2MR6A 4R6XA 5LQRA 1YVPA 3U4IA 2PEYA 4UXIA 4JC5A 2I29A 1IY8A 4XGNA 3JATB 1YGYA 3IIEA 1N7JA 1PL6A 1SBQA 2RFLA 3L8CA 1GNPA 3VV2A 2XWSA 4OLJA 4TV8F 3ENNA 5HE8A 2VJYA 1UBGA 2JIOA 2VUUA 3DV0B 3OKCA 3Q9NA 1QGAA 3IBFA 4C0HA 3S1AA 4B4UA 4AQDA 1EI9A 4N9WA 1Z18A 3UGKA 4C0WA 4GBED 3B78A 3CFYA 1SU7A 1HFEL 3PNVA 4TXNA 5FLYA 2BKVA 3EFOA 1KTIA 3CRQA 1WQ4A 4JLKA 1DUIA 4IIJA 4B5LA 3IT2A 3AW9A 3VNBA 4TYNA 2G5TA 5I4IA 4AL4A 2GHQA 1LU9A 1SB9A 3AM5A 1O97D 2FMTA 2HLDA 1V2GA 3C3WA 4PICA 4RNCA 4Y2SA 1BS2A 1XT6A 3ST7A 2E87A 4LHXA 1ZSNA 3UJBA 5KVCA 2C0PA 2XX3A 3FCSB 3K0HA 3UG6A 4DZRA 2C1ZA 1NUUA 3CRW1 4R2MA 1WABA 3RE1A 1QB7A 2AX4A 1Z2PX 2NN3C 1E1RA 4MAFA 5CH3A 2DHCA 3GJ8A 4WLOA 4C7MA 4MWDA 1Z0KA 16PKA 2YHIA 4TMKA 1GKIA 1VTKA 3ZY3A 4LRUA 1SHTX 3HCRA 3S5JA 5DM4A 4FNOA 3GLUA 2C4HA 4IO1A 5CB4F 2LD4A 3BTSA 3Q87B 1T3LA 4NK5A 4AJLA 1OXBB 4YYEA 1PWHA 5AICA 2X76A 3JZDA 1ZNQO 2HK8A 3MBOA 4KXFB 3ZIDA 1U7XA 3F6YA 3R8CA 3FNQA 2ZYIA 3EIUA 4ISBA 4TLAA 3CV3A 4LBWA 3AKZA 1KKMA 2X8AA 2PSSA 4W4TA 1YULA 2NUPA 2R5FA 4O4LB 3HJNA 3TCNA 3NUGA 1GUBA 1ORWA 5AUNB 5E7IA 4GOMD 1LSJA 1T0PA 1UKYA 1T2FA 1SIBE 1XRSB 2B5WA 4XPIA 3KLPX 5EZYB 3E7DA 4L16A 2HR1A 1JEDA 4Q21A 2ZXUA 1VL5A 3JWPA 3IUJA 4L0MA 1AJEA 1CEYA 5BP7A 4JNKA 3KYJB 3W4KA 2ISSD 3UUWA 2QYOA 3EXHC 5THXA 1XPRA 3CW8X 3G5LA 4OGKA 1VSBA 1NUSA 4UM5A 1BFKA 1NQ5A 3K96A 3EXEB 5F64A 3RK0A 3MNFA 2XCRB 2WIJA 2F3SA 1ZOPA 2QUJA 5CD9A 2F90A 2V6FA 5EA2A 4YN3A 4NBVA 2FDXA 2VT7A 3N3AC 2DTXA 3EAFA 4HWSA 3QXGA 1KZ4A 3AKDA 3R1IA 3CR3C 2N0SA 1JR3D 3TGPA 1KK2A 4M88A 2R6GA 1ICIA 1X9HA 3DTVB 4CMJA 3A0RB 1Q0UA 2V96A 2W83A 1TECE 1U1EA 3H9BA 2WJHA 4Q19A 1XNGA 2YC2C 2OCYC 2WINI 4GG1A 1SXGA 3A6GA 3WL6A 5B64A 2WSBA 4WNAB 5CVCA 3T9AA 1BJRE 1WCIB 5CT9A 4NVRA 4LF9B 5EQTA 1Z15A 3QJYA 3ANSA 3OLZA 4RZ3A 5DLEA 3VZPA 4ARSA 4C7KA 5A04A 4YT5A 3ZYZA 3W2FA 1ZRNA 1HDIA 1XZDA 3MTQA 3BMCB 2WYHA 5AOVA 3WL5A 2C7QA 1XDDA 5ESXA 3C3AA 1URPA 1CUIA 3K20A 4M0KA 5J3JA 4ARVA 3THWA 3WGZA 4QG3A 1QRAA 2BJWA 2CUTA 2PVCA 5FWXB 3L4EA 1DGQA 2FV8A 3ZHOA 2A7QA 2Z3VA 4I1RA 1NXSA 4KLAA 4C0JA 1J0AA 1KQPA 1S4QA 3E8XA 1MC1A 1AQUA 1WD7A 1GNQA 2IJGX 2VBIA 2R7NA 2P30A 2GPSA 4KFTA 5J2TA 5I9MA 1WDWB 5D5PA 4ESOA 5AVWA 1KMCA 1YR7A 4B4WA 2H92A 3HN7A 4UBLA 1JSRA 3OHPA 3QQPA 1LLUA 3A2MA 5HIIA 1U04A 2FW8A 3LGSA 2XRZA 2P9HA 3CZMA 3Q1LA 3TFOA 3I1IA 1HDYA 2RBKA 1XZPA 5FJJA 2ODBA 1A5BB 1GU7A 1ORVA 1TLTA 2PMDA 2Z6AA 3FH0A 1PNQA 3HDJA 4H35A 4F4UA 3DR3A 1XRMA 3AZPA 4B6JA 5IEJA 4LXIA 1DLIA 1TKCA 2OD2A 2XR1A 3DGEC 3QVVA 4PLWA 3AW8A 3YASA 5DCLA 1GCAA 1M6WA 4J16C 3HEMA 4KG7A 1YS4A 4AVYA 2Z5VA 3HABA 1ZLXA 4FT4A 2ERYA 4MW5A 2RGUA 5BMVB 4IDQA 5FNVB 1U8ZA 3ZIUA 5KC8A 2BM1A 2CFTA 3UMYA 4HI0E 1BVUA 4MUGA 4UVEA 4N54A 2D0OB 2A3RA 3E3OA 3HL4A 2XCUA 2CF6A 1QZUA 2OR3A 4YMGA 5B6PA 4KAXA 1QQBA 3R6DA 5AJXA 2Y1KA 1G4UR 3TE7A 4AO8A 4LXXA 2WQ7A 3RD5A 3ZHZA 1BWQA 4BP9A 5LNK1 2FPLA 2JVJA 4MPRA 2FMFA 3KKQA 1D9XA 4OYRA 4F2PA 3ZWMA 1SA0B 3BJIC 4WESB 1PDOA 3O1HB 3P94A 4GAEA 1YACA 1NY5A 4W7IA 3WRVA 5LMCA 3NONA 3E3AA 2G7MC 3THYA 1P3DA 3ZNNA 1Z12A 3ZV3A 4JXKA 3W2GA 3GT7A 2OVBA 3M82A 4E5SA 1UAGA 4OGFA 1NX6A 2GYYA 4MS3A 3M33A 2XGJA 4MYSA 1PJSA 4CN9A 1QFYA 3JQBA 1EUCB 5IJWA 4BWYA 3QWIA 4EHDA 4L3WA 1QIFA 1U7TA 2V6GA 1MLDA 1AA9A 1SMKA 1ZITA 3D6NB 4WCVA 4YJ3B 5LC1A 3VQTA 4C3ZA 5CA1B 2IW3A 3VKVA 4RDHA 5JV5A 1NIJA 4LHSA 4BNXA 4YP9A 4LDJA 5JAZA 3TZHA 2Q21A 3NEAA 5EINA 5SY9A 4EM6A 1HT2E 3R0VA 4A82A 5IMSA 1KJ8A 3LVFO 1GG8A 2WDZA 3CTPA 4F1KA 1RKVA 1V4BA 4YONB 2BZ0A 3K0CA 2YV1A 3NALA 1LFDB 2JGLA 3TZQA 3C4QA 1VGVA 5E8RA 2DJIA 4R1MA 4CF4A 4QE3A 3U09A 2P9ZA 3ZH2A 5A5VA 1SG0A 1G7TA 1TCVA 5E3JA 2E49A 2GNOA 3RIYA 2WUFA 4FDMA 4FUTA 4ZIRB 2FUG6 1UPFA 2H1CA 4JGGA 2XQVA 2IXBA 4JELA 4M1OA 3P2KA 2OV1A 2FWNA 3D7LA 4IJQA 3LP6A 2OZLA 3LP5A 4MW6A 2GH1A 4PVCA 3QFFA 4LZOA 5SYAA 2AVDA 3TW8A 3U3JA 2AKYA 1RAEA 1M8FA 4A7PA 2HADA 3HZZA 2W8BB 3F7TA 3IR5A 2IYTA 1UFOA 4TS9A 1IE3A 4WD3A 1ECPA 2XNDA 4YRMA 3ED1A 3I4CA 3N2EA 3O6VA 1F3OA 5DLYA 3FYSA 1B8OA 1M2OB 3FYUA 3HLTA 4MV0A 1OTYA 3ZHYA 3I52A 3NHUA 2HRCA 4RELA 1CUHA 3EVZA 3A36A 3FLMA 4M0FA 3TUIC 5C5IA 2PZBA 4V0OA 5EVJA 4D3DA 1ZNXA 4R83A 5K05A 1K0FA 4WWHA 1YU9A 4E14A 3WMGA 2B7CA 3DMFA 4XR4A 1X7HA 4R9RA 3OWXA 4TL8A 3RUCA 2VF8A 3K8OE 4TXJA 5BSFA 2ZTHA 4OLHA 1A71A 5JBIA 1KI7A 2HV9A 1L7PA 1O54A 3JASA 3HBAA 3ZDFA 5B6JA 1OUMA 5BN3A 5LZ5A 2NVBA 3B1YA 1DMSA 4ENSA 3LQ4A 1JGTA 1L7MA 2BELA 3OZBA 3W6PA 3HADA 1MIOA 2VPXA 4EHNA 1MW9X 2VTBB 1KDTA 1QF9A 2VG8A 3GH3A 1UP4A 3HVJA 1JKXA 4WNCA 3MJRA 1NLZA 2J1LA 3AYZB 5DK6A 4D45A 3T0GA 5KJCA 3R7AA 1PHPA 2VDJA 4FE4A 5ICGA 1I3CA 1Z28A 1E5VA 2HJRA 2NTYC 3L7MA 3KSBC 4EW3A 4OLAA 1X94A 1O1YA 2ZSFA 1GZVA 4KMSA 3CR8A 1F6DA 1QQTA 4YTEA 3M81A 1ULTA 1CX9B 3G5AA 4WXHA 2V5UA 3FNBA 1PZFA 3C4JA 3Q15C 1NV9A 4EELA 3ZHTA 3Q12A 2AFHE 1FLAA 4KQGA 3CYFA 1W36C 2PKYX 4I9GA 3LUAA 5AVRA 1OA1A 4CEJB 3VR5H 1T4GA 3T3OA 5IZCC 3ESRA 4PHFA 5CCXA 5LD2C 1B0UA 1SXPA 2ODEA 1FDRA 3DWEX 3AC0A 2Q41A 2GF2A 3IDAA 4U2KA 2QVCA 3VHQA 1EGQA 2I2FA 2YXEA 2ZSUA 4MYCA 1ADYA 1V8DA 3GLSA 4QGBA 5EZYA 5IJ9B 1QP7A 5EJEA 5AESA 1KY3A 3I62A 1QIIA 4WA7A 1Z29A 5AXDA 1C1HA 3OZ7A 5AHWA 1Z5UA 3WA6A 2VUHB 4KRFA 1MR3F 1JHPA 3ANNA 4F9FA 2YR0A 3N3BC 1SULA 1EE9A 2VAPA 1OHHA 2JAPA 3NXSA 3A37A 1O77A 4RTPA 1PQWA 4A2WA 2QU7A 4CQLA 3EFHA 5T8KA 3CUUA 2JJQA 4MRMA 4GP7A 4GR9A 4UNNA 1RJEA 3S0JA 2WUGA 4F2WA 4O2AB 1FZQA 3A6LA 3P2MA 3O9VA 1E98A 1PNVA 3Q40A 2WLTA 4QDUA 4LWOA 4TSKA 3FDJA 1MEJA 5REQB 3GYBA 3QIAA 3QWBA 4GOOD 1SOAA 3GNSA 2G76A 4PC2A 2IU6A 5T4HA 2GXSA 1DC8A 4YAEA 1M2WA 4XGQA 4CMEA 1FL9A 3C3EA 4X7PA 2R7MA 3ZE7A 4BKMA 4D97A 4DQVA 1THMA 4DIKA 5KOJA 3A3NA 3TTSA 3FCXA 1HI9A 1W0JA 5CITA 3TI7A 1XZGA 3FVQA 3HNRA 4KIFA 4DF3A 4EYGA 5A6VA 3THOA 2JK1A 2NXJA 1A8IA 3AFOA 2VDWB 4ZO8A 4G1CA 3WDLA 1OOEA 2NV0A 3TRFA 2IX9A 2W0MA 3CZ4A 2PU7A 2QN2A 4F84A 2HWUA 2OAP1 2ZU6A 4PLPA 2NTEA 3KQSA 1WQ1R 3O4HA 5CGZA 1RRKA 3MT7A 4L4XA 4U00A 4D4LA 5WRFA 5DHSA 1RQGA 3JRXA 2C3YA 4JBXA 4MW7A 4PHCA 1K98A 2WD7A 4Z9BA 2AS0A 4OJTA 2ZSBA 1R4MA 5IDWA 1BCSB 2AHRA 4G0NA 5C8VA 5AVTA 2C2BA 4X1IB 1U0FA 2L82A 5FV7A 5TC4A 4BP8A 5B6IA 4ARBA 1RPNA 4KN8A 1UK6A 2CHQA 3IHLA 1GL3A 1NDUA 3OY7A 3PPYA 4PZUA 2ZYVX 3RQSA 1WXXA 5BWNA 4BNLA 2BT4A 3LGAA 5JU6A 1QHSA 2Q62A 2R6ZA 3UT5A 4PO1A 3HKDB 4U6QA 1FK8A 1DPGA 1HH4A 2QRGA 4JI7B 1XTVA 1KRWA 2FCRA 4TSFA 5GZ1A 2YYYA 2ZJAA 4YMSA 5D3MA 2XCOA 5FBQB 3V1KA 4Y2YA 3GLRA 3QX7A 3KFXA 4PXSA 1JWLA 2VRWA 3UAWA 4YCLA 4B74A 1ZP6A 1JDNA 4F4CA 2JLYA 4OG2A 4X41A 4I3FA 1V35A 1XRJA 3ZVRA 1YO6A 1SH7A 2WDPA 3KUDA 4L74A 3ZEIA 4D9GA 2I1QA 4YH1A 2QM8A 3UKDA 1QC5A 4KXLA 3VYWA 5KSOA 2GNAA 2CJXA 4JI2B 1FUUA 2W90A 4YROA 3A58B 3GG9A 3LWNA 1DS6A 1GL6A 2OBNA 2VDLB 2BN4A 2CY0A 5FEMA 2IKQA 4YHBA 3PRYA 4DJDC 4PIVA 1YRYE 3HJAA 1U0RA 2UYYA 3BL8A 5AH0A 5FKJA 4CGZA 3KAPA 5IBCA 1JA1A 1H2WA 1L8QA 2AJ8A 3PB3A 4N7MA 4AJ2A 2PGAA 3GUZA 3W1EA 3BWCA 5F3RA 2F3RA 4AZ0A 5CB0A 3G2NA 2QT1A 5IJ0B 2FSIA 4BO1A 4EW2A 3OHMA 4C1BA 4DUYB 2YHIB 4PPQA 3NHWA 5FA5A 5CXQA 1Z6PA 4H7PA 3U26A 1OPRA 4EPXA 4S35A 1LUAA 4XM1A 1X87A 4CHGA 4HSEA 4PS0A 2O19A 1GLGA 2JHAA 3V1MA 5K3OA 3DCYA 2ZJZA 4XUEA 5IH3A 3SEFA 2YWFA 1WVGA 2JCYA 4UTXA 2RK4A 4M36A 4BQPA 1AU9A 3W9YA 2E85A 4PYQA 4UXJA 1OH7A 5EIHA 3ROQA 2XUPA 4RIGA 1H4SA 1C0EA 2FSHA 3L7CA 4MP6A 4P2GA 4WZAE 4YJGB 2HPVA 3BE6A 1YA8A 5DNVA 4QX6A 2CNNA 1WOYA 3JQFA 5KTMA 1FTNA 1Q3HA 4AS3A 4EEZA 4UUAA 2M6KA 4AZ3A 4JI1B 1ISFA 2NZXA 2ZUUA 3E4CA 5FNVF 3EJWA 3HG7A 3LPCA 3TI9A 2JJ1A 2LR0A 2XVXA 3M6AA 3WYNA 4UPEA 1EZZA 1YZ3A 3NHSA 4H60A 5TT0A 1FNCA 4YMTA 2ZWAA 5AJZA 2ZOSA 5DNWA 2JG3A 3PUKA 1KETA 4DV2B 2XF2A 1B23P 1E4OA 4YJ2B 5HFJA 1M6VA 3E22A 3ONWA 4UUOA 2RHMA 4XM2A 5SZIA 1NA5A 1L4NA 1F8GA 2J9GA 4WLFA 1J39A 2QRMA 4IP0A 1FSSA 1L3IA 4RC9A 1DX6A 1BEEA 1D1QA 2B1GA 2VPQA 4BFUA 1PR6A 1I0ZA 1S3SA 1PN3A 2NLOA 1G60A 3EGVA 3FLBA 3Q11A 2X9QA 5LQSA 1YAHA 3KOOA 3OAAA 4R41A 4OHUA 1D07A 3WIOA 2OD7A 1P3JA 2QSYA 2RH9B 3KEFA 4JN6B 4KNVA 4ZOCA 3VC2A 1WV1A 4A0SA 1I7SB 1V11B 5KOHB 1CVLA 1NWCA 4RFSA 2FOXA 4XQ0A 5C8XA 4ITRC 2Z1DA 3QYFA 2CCJA 3PQ8A 1I1NA 5LQAA 1PRYA 1N6KA 1EE2A 5ED0A 4OPMA 3KELA 3U61B 1QV6A 3KLOA 1ECCA 1G19A 3AESB 5CDGA 2PLFA 1N6IA 1WF3A 3GFQA 4J07A 1EXWA 4LISA 4OJKA 4AF6A 2ZYTX 5B3LA 4WXRA 1NKSA 4R1NA 1IMJA 5CNIA 3MHPA 5GZ6A 4QU9A 1CQJA 3H1FA 5LUBA 4B35A 1JB9A 1N77A 2NUAB 4E2FA 4PNZA 5IK2A 2XB2A 3C5EA 4O4JF 5EGSA 1K92A 5TPWB 3LDHA 2JL1A 1UPUA 2YIDA 3C41J 3FN4A 1ZRHA 2ZIGA 1D1PA 2GEFA 3WLSA 3QYJA 1A2OA 1UT6A 2P5TB 4XVHA 3I8OA 1YQUA 4FYKA 3PF9A 3IUBA 1IXSB 1YUMA 3PIIA 2O59A 3QVTA 3TJMA 3NBMA 3UY4A 2Q1TA 4EQZA 4FZVA 5IKOA 4AURA 5ITZB 2DY0A 2OUKA 3B82A 4IKEA 3G3EA 1R8YA 1BAPA 4KQ6A 3ZE6A 3TDNA 1OA0A 4P5DA 5AW1A 1U9ZA 2D0IA 2G1AA 2P2ZA 3P1JA 2DWCA 1NXOA 4MKRA 2QD5A 1MNQA 2GSDA 3EGWA 5DSZA 4ZVTA 2H18A 5LXTB 3BHNA 1JR2A 1F48A 3IAM6 3LF1A 4O2AA 1DC6A 3ELUA 3OX3A 1Q2UA 2PL1A 2R6AA 2O2ZA 2XGOA 3GFPA 3ORSA 4GWGA 5CMLA 1PGJA 1E92A 3O1LA 2FN7A 4YQFA 3TE6A 2ZJ4A 4AKEA 3NGMA 4LTNA 4C0SA 3U17A 3G8AA 2JLVA 2VDQB 1PX2A 1QZXA 2RJOA 1G8HA 2R8YA 4QDKA 1EB9A 2QVYX 3AF3A 5DV9A 4B82A 1WMEA 2BW0A 1LLFA 2L19A 3H11A 4ESEA 3UZUA 4EO4A 3LBYA 5L4SA 3L7NA 2R9VA 1V71A 1MB3A 1ZKDA 1UKVY 3DLCA 1N0WA 2CUKA 2PH5A 4GLBA 3RUIA 3T5PA 3ZGLA 2Z6VA 4HGOA 1OIWA 1S02A 3TQHA 4XYGA 4BQOA 1NMXA 4EZIA 1ZNYA 3DDWA 2ZUVA 4S04A 2ZWPA 2OFFA 5DBIA 1R0WA 3PGA1 2M6LA 1FJ2A 3HCDA 3K1AA 4UTOA 1G41A 1JXQA 1B73A 1SEPA 1Y1RA 3JYOA 5TJHA 1NOKA 1N6RA 3LLSA 4N5HX 5TJ9A 2W98A 5LFAA 5EKDA 5BR8B 2WG2A 3MEQA 5LZ8A 3UICA 4CKEB 1GPBA 2WWGA 3N05A 2PMBA 4BLPA 3HVHA 5J58A 1T0HB 2P77A 2HHHB 4WKGA 3QVMA 5DPMA 5FOWA 2NOAA 5FUMA 4CDMA 1PL7A 2JRLA 5DBEX 1EB8A 1ZLYA 2G80A 3ZHSA 2BTQB 3OQIB 1F0KA 4AXXA 1N7HA 2QNBA 3H18A 4H7FA 4KXWA 1PVVA 3JRWA 4OOFA 3G68A 4BIMA 1FVOA 4FHZA 1W6UA 2B0JA 5DH9A 1SOMA 3MTIA 4IQ0A 4JXJA 3RIHA 4BX9A 2YW2A 2ZBRA 4EZEA 1AQNA 1P7CA 4R7TA 4IILA 4X93A 4HDKA 3W77A 1Y7LA 5FAKA 1FLVA 3IEVA 1B16A 4B7ZA 2IDJA 4TRRA 4YCMA 4Y9RA 3AI1A 5LXTA 3ZQKA 3T7SA 2H1FA 4MLZA 4U8HA 3HJCA 4L4ZA 5HQ3A 2Q1XA 3EPKA 1E96A 2A8YA 4NL4H 1E2DA 4OFXA 1WF6A 1KAHA 4CL0A 3UMMA 2XMPA 3I73A 3IQXA 2QL7A 2IZOA 2W58A 1SQGA 5E6UB 3G7SA 3TLZA 2OV8A 4UVDA 2OFWA 4YR7A 2PX4A 3DE0X 4EI8A 3MXOA 3A6DA 1SK9A 4JI4B 4DQUA 4LHEA 5BUSA 1LSOA 2FMXA 2CBGA 1SCQA 2FK7A 1NW7A 5E38A 4F3TA 1NFFA 2DHQA 2Q5OA 3PGJA 5IXJA 1PNTA 3G2HA 3LC1O 4PU0A 3SHVA 2GEUA 1RM5A 4J2TA 3IP8A 4B9AA 1KMNA 5DHQA 1BDJA 3TNFA 4EHBA 2RI6A 3TQIA 4AD8A 3GA0A 2I54A 4EFDA 5FTJA 1N4DA 4Y1EA 1U02A 3N2LA 3KHSA 5SY4A 2WWIA 2QBYB 2CMHA 1M83A 5F2OA 3T3IA 4HRXA 2R4UA 4D9EA 2GAIA 4EKDA 1BE0A 4DBLE 3R3XA 3FYTA 3ZV5A 4EG1A 1G64A 1UODA 1VCNA 2EP7A 3SQOA 1OGJA 1RCUA 1WB6A 1I7NA 2JI4A 3HB9A 5DULA 4CMKA 5K6AC 4K26A 2ZUEA 3AU8A 1YQTA 1GLNA 1XJCA 4G5HA 4R98A 2QMYA 5IVIA 4CKCA 3ZBUA 4H1HA 4C20A 1WB4A 2Q2NA 3USES 4Q1FA 2JIBA 4NKRA 3VC7A 1DIRA 1QC5B 2BKLA 3E8SA 3IDFA 4GMXA 5PGMA 3UT6A 1PCXA 1U4NA 1JQBA 1QGUB 1LX6A 4L7QA 4JJFA 3SSNA 4IJMA 4CL3A 4UPDA 4CDRA 4W5TA 3VGPA 1H0KA 4XJTA 2CCKA 1SC3A 5D8DA 1DSSG 1I6KA 3D64A 4LVCA 5I5EA 1KEUA 5GV8A 3PD0A 3I9KA 3J81k 3H2ZA 4NE9A 1Y4ZA 4JQCA 3HI6A 1ESCA 4MS4A 1T9GS 3ER9A 4JI0B 1CEXA 5G0TA 3B9QA 1MFPA 4HDMA 1AKTA 2ODPA 4M9UA 1BS9A 1QJ4A 1WZCA 2I4NA 3IEPA 5F9HA 1OQAA 5EJMA 4BS9A 2EZ8A 4MUEA 4BDTA 5J63A 2WE8A 1HFKA 3JQRA 4IQ4A 1UBKS 4JGBA 1YTUA 2EF1A 2HAEA 4X1YA 4CTOA 1B1AA 1D2AA 1GU0A 1AZTA 2I2BA 2P62A 2D8MA 1P5RA 3I2YX 1W34A 1Z6YA 2W6MA 2HC9A 1VKZA 3EF3A 4H7EA 2WF5A 1R4MB 1A8HA 3DZBA 3EXIA 3RFUA 4CUJA 4CEIB 3OOSA 4X62B 1Z4JA 2ZB7A 4JJAA 4NU6A 4GMFA 2H4JA 3INTA 2O3JA 4JVSB 2OP0A 5LIRA 1IRXA 5BUZA 3OETA 2FFAA 2JLZA 3DVSX 5HJEA 5JHHB 5JRZA 4KU4A 5DOVA 4D3FA 2R97A 5CDHA 1Y37A 2H52A 3W8NA 4BNJA 2G9QA 4YPOA 1L7RA 4QHSA 3GEIA 5DHFA 5ER6A 4GYWA 3WNVA 4R8MA 1XCLA 2D4HA 3AQ4A 1MV8A 3FPHA 4JJKA 5F2KA 4B3CA 5JVDA 5CR9A 3SX0A 1AKQA 3ZHXA 2DHDA 3B8HA 1PGQA 2QU8A 2A9OA 1S8AA 2XUHA 2FJPA 4RGYA 5IU6A 3B1JA 5A1TA 1KRHA 2YZMA 2JF0A 3MUOA 3U5TA 1VJTA 3TW8B 1NF8A 2W6IA 5JJIA 2DSTA 1YCHA 3D2BA 2A9QA 3JQFC 3LWDA 2ZVQX 4UHDA 4DMGA 3AXSA 4MMXB 4RA9A 4TT8A 5EWJA 3L4BC 2XT9A 5TQ2A 3IL2A 1TK2A 3UJ3X 1DOZA 3EG5A 4DUGA 4GT1A 5GJWC 1HQKA 4ZODA 4WJLA 3QE9Y 1G2QA 1EFCA 1O94D 3ZDEA 3HKEA 3IQZA 3KZXA 3GMDA 1UDRA 4ZQCB 2YV4A 1SHUX 5CK4A 4AKHA 2AC7A 3OUZA 4RVUA 3W5CA 2EC5A 1BIFA 3UTDA 4YR9A 1KYZA 2P40A 1QYDA 1SUIA 2XB8A 1FP4A 1ZSYA 3DLAA 2H4FA 4GQAA 4NPHA 3UMSA 5HP4A 4WBNA 1ZESA 1Q1AA 2PANA 2ZTLA 4BNMA 5D87A 3MJFA 3H3XA 2QZPA 4CV0A 3K2IA 1PD0A 4NFLA 3ADOA 1G18A 2QPAA 4XWGA 2EKZA 3OEWA 3L8HA 3N0VA 1SUCA 2V58A 3DDHA 4G23A 4MAMA 1CE8A 4Q7EA 1XEXA 2ILTA 1BHO1 4NY1A 1GFIA 4S12A 3IPXA 1YE5A 4HX9A 4IIGA 3TR6A 3DZ8A 2DQSA 2HIMA 2YX1A 1P29A 3KB2A 3U7EB 1M2VA 5HRAA 5CDFE 1V2HE 2DPHA 1T2UA 3I45A 4QU8A 4DR1B 2DSNA 4YRTA 2FZKA 1XTKA 2ZWOA 3DP9A 4A10A 4HTFA 1Z25A 4YMIA 2ZR8A 4LTMA 2JGAA 2B4YA 3WL4A 1CUVA 3RSSA 5JARA 5I48A 1IPEA 1HPLA 2DFTA 1ZK2A 3RT7A 3RYCA 1ATZA 2FW7A 3COVA 4KO1S 2MSWA 1GGFA 3RS2A 5L40A 3V8NA 1JHQA 1R27A 1RJDA 1RYBA 1RAFA 4UHFA 2A9RA 3RVNA 4KQ1A 3VPCA 2BMJA 1VLMA 3C3PA 4LHZA 5GGXA 2V3CC 4EG4A 1GD1O 1XLWA 3AIOA 5TQ0B 1NNSA 1XOIA 4WBNF 3HJFA 1P7YA 4X1KA 3H5TA 4WDQA 4RPJA 1PP4A 4EJ0A 1PKXA 2DHEA 3ISTA 4KHZA 4LJ5A 1HSZA 1UMBB 5BQOA 3ROGA 3SM9A 2W22A 4X90A 3RUPA 4UU0A 5CG1A 2BDUA 4IDNA 1T6BY 4D9HA 5LKRA 2V03A 4Y0VA 1AN9A 3DOEA 1QGED 1GARA 3VUFA 1RJ9B 3F8WA 3T7DA 3LHDA 5K2OA 3AWIA 3EBOA 4MKHA 3LT5A 3IQWA 2Q5HA 1H6AA 4AIRA 3AEYA 3L7AA 3TM4A 3QPAA 2QD1A 1HBJA 4KLZA 1CLEA 3N2ZB 4ZXPA 4ITUA 4MWGA 4QDJA 4RAQA 1Q19A 3QHQA 4A91A 2JAOA 5TVKA 3ZXIA 3DKPA 2LXNA 4HX5A 4OYHA 3V7FA 2XNHA 3IQHX 2WJZB 5GTDA 1GL7A 2WG0A 3NIGB 4QPCA 5H82A 3T1NA 4P84A 1M6HA 3WWPA 4I4TF 1WW3A 3M3HA 3FWHA 3SXUA 5KNBD 1T2NA 4EFNA 2NT4A 2BFCA 4KK3A 4TKLA 4HQNA 1DEKA 4WZBB 4BJ6A 4NZZA 1VPTA 4AJHA 5I7OA 2E89A 4ZC8A 2XBMA 4N5DA 1VQ1A 2Y9PB 2XMRA 3QM1A 5DWVA 2AKEA 1P60A 1QOPB 3QLUA 1G5HA 5EMKA 2HA7A 4BFSA 1L5SA 1VCMA 3FUCA 4WIAA 5JVDB 1CT9A 3T1VA 3DFMA 1R12A 4XJSA 3IERA 1TPZA 2IDKA 2C42A 2EBUA 2ZUCA 1NRXA 4QQNA 5DHRA 3MGKA 1RT9A 5EJ8A 1X1DA 1FDSA 2ZRGA 1QH8B 2XEXA 4M38A 2GLUA 3SS7X 2DR0A 1E1CA 1WCYA 2QIPA 2V7BA 5JTUA 4LUCA 2XT0A 5AK6A 1LI7A 5FYDA 1EK1A 3H7IA 3WJ7A 4YRSA 2WYVA 3MCTA 3ZCPA 4A5SA 4BAUA 3IEIA 5AUQA 3CRVA 4LRQA 4AG3A 1HLFA 3LRXA 4KNWA 5AFSA 3QEBZ 3DBHA 1XTQA 2F1HA 2WU4A 3C3KA 4PYNA 3RM3A 1Y5RA 1YR9A 3GJ7A 2I8AA 3NIDB 2H2FA 4PZ9A 4RM2A 1VGQA 3NNNA 3P71T 1AV6A 2PX0A 3UXHA 4ER0A 1WHSA 5BWMA 2GM4A 2HEIA 3UTCA 4NS4A 4IZOA 2GEDA 2HQSA 1Y6GA 1OZ0A 4CCYB 5JJKA 1SVIA 3QLEA 1A9XA 1QRDA 3FTCA 4Q9KA 5L7TA 1ZHOA 1KMHB 2FZVA 2O1WA 1KRXA 2Y27A 4BJ1A 4V02A 1X7DA 1ZM9A 3AR7A 1MIHA 1E7RA 2IVFA 3JQEA 4ZCRA 3UJDA 1GPNA 4XDYA 4DA4A 3F5DA 1O03A 1DP4A 1A4RA 1AKVA 1KYIA 1HE8B 1N7GA 3GAFA 2OO5A 3L0SA 2P4QA 1O7JA 2VEOA 2BKXA 3NV9A 4NARA 4RLSA 1Q83A 1CVIA 1B00A 2MSEB 1FNMA 2IH5A 5BW8A 3HBJA 4HB3A 3LQ1A 4RLQA 1H1LA 3WDSA 4XIJA 2O8BA 4HEA6 1IUPA 4MLDA 2KSQA 3CVWA 1BJTA 3K53A 1ZZGA 5IUKC 5KQLA 3C8UA 1L4HA 2JFPA 3ZE9A 1U8XX 2XRFA 3C85A 3NT2A 3BK2A 4KBFA 1O6BA 1SVNA 2VR1A 1AC5A 3I6MA 2ZRBA 3BB1A 1KNXA 3ZD6A 3Q7SA 2DOKA 1SUPA 1R66A 2C7GA 4JIMA 1KE2A 4Z51A 3AMVA 2GN6A 4WXPA 2IEAA 5EE9A 2YW9A 1FYWA 2G70A 2B25A 4UW9A 3RYHB 2I2CA 2PL5A 5EN4A 1LZKA 1PR0A 1VG1A 4CFYA 2FPSA 2VPPA 2YFQA 4KI0A 2H4WA 3I76A 3JD4A 5AK4A 4KSYA 4W5RA 1Q6ZA 3AL0C 3MBKA 1TTTA 3L0PA 1AE1A 3KWJA 3E8MA 4V0RA 1XWWA 4B3JA 1WXGA 2WYIA 1ODFA 3VZCA 4V3CA 5K3FB 4PLYA 4BV2A 4ECAA 4AU1A 2B34A 1DWUA 4KQIA 4PLFA 3KOXA 2P11A 1G8KA 2JHFA 1IOWA 1NMEA 3FG9A 3HQ4O 2Z6UA 1CXZA 3L8FA 3N7UA 2O50A 1KOGA 4IDGA 2GX6A 2XKKA 1E7QA 1W29A 3JSAA 4DQLA 3QLJA 4JYPA 4OLFA 1XFAA 1HDCA 5T57A 1ST2A 1GNSA 1QCCA 3E9NA 2B36A 1KJZA 4MR9A 4OQPA 4A8JA 3LIIA 4KHPB 5D3QA 5AVVA 4A73A 1RC1A 1KVQA 4G5OA 1C8VB 3TQRA 4F86A 5JYBA 3GEHA 4D9NA 1OH8A 2D7JA 2ACKA 1SZDA 4TV9A 3A2NA 2ODNA 1A04A 1EX9A 1ZM3A 4FBMA 5AI5A 1NQWA 1T9HA 2IE0A 3NTLA 4YDSA 3WBFA 1E59A 2CUNA 4BV8A 1P0MA 2JW5A 3ZWCA 1E2BA 4EOGA 5IM4A 4MOWA 3PLAE 1A69A 4REMA 3IB6A 2FUG1 5CHYA 3SC2B 1Y63A 3Q0EA 5EJIA 4UATA 4D02A 5JPCA 8LDHA 1WAMA 4EY5A 2WFMA 4PIMA 4BUCA 4B09A 2GRAA 3QVOA 2DPYA 2XUAA 2PA0A 3EA5A 4IG9A 5AVZA 1XN1A 2CEKA 4G9BA 4IICA 3HA3A 4NP6A 1XTZA 3ZDYB 2QW1A 3AUFA 4LMAA 1FBTA 3C8MA 1NURA 2ICAA 3GFRA 4LHVA 1R4NB 4YAGA 2ZTSA 1ULHA 4LF5B 1N5MA 1HLDA 1TL7C 2JGDA 1HQDA 3KB8A 4TL7A 4ZVMA 3DOJA 1YBAA 1MABB 2EZTA 4MIKA 4OKIA 3L92A 3H16A 5C51B 2I55A 2GVNA 4DIDA 1ZUNB 2LE0A 4NFSA 5C5EA 5AHOA 1K4YA 4FGJA 3LDAA 2F64A 1OBOA 4PLTA 3GQBA 4YT4A 1QWOA 3SLKA 1QYXA 5CDFA 5TLSA 1VB3A 4JOQA 2A0XA 2VT3A 1IN6A 1C3EA 1P0PA 1EDEA 3M34A 3MWYW 1QIDA 4CN8A 3K4HA 4QATA 2R6DA 4G0ZA 3U3KA 1WPRA 1JQ3A 1Z5NA 2VCHA 5DLPA 4EZBA 4EUEA 5K8UA 3K31A 3U4HA 4PCLA 1IHDA 4F56A 3C8DA 1N2XA 4G4IA 3AP1A 3HC7A 2CJWA 2QL9A 1QFJA 2J07A 4GSLA 3E70C 2BFFB 4NU5A 5TARA 3ZW9A 3GZTB 2GKGA 2JAQA 5H81A 5EHNA 3RNOA 2Z6QA 2RGDA 2DWQA 4B1FA 5CFPA 1Y4DE 3LQQA 2FFQA 2A33A 1K75A 6YASA 2HA3A 4UE6A 1YC5A 4KUGA 4RXMA 4EFKA 1ZGCA 1U4SA 3ADDA 5IW8A 2ZIWB 1M1XB 1KAOA 2LPMA 4Z9YA 3VKGA 1U98A 3MMPA 4P0PB 2R84A 4MVJA 1E3WA 1RWMA 2X5OA 3KJHA 1PDVA 3DE5X 4KO8A 3F6PA 3OZRA 3N0RA 3PK0A 3PLRA 1L7DA 4C88A 3CUTA 4CM1A 3NAMA 1TW2A 3DGFC 3FTNA 1KFBB 4FE7A 4BFWA 3ZZ0A 1SCIA 4TPKA 4NOMA 5BQ5A 4FN5A 5HG0A 3BXXA 4OQMA 3TLBA 3KVOA 1PBNA 4Q4AB 5DNUA 4RVHA 1TMKA 1IIBA 3AV0B 2EFCB 1YDEA 2GBPA 1GM5A 1QORA 2G28A 2FY8A 4RKEA 1OFUX 4OHCA 3M6VA 4G26A 5K20A 3IDQA 4MVJI 1ONPA 2YJTD 1UH5A 1IN5A 3PI7A 5EXSA 2VJPA 3GEMA 2GBLA 1XL1A 4FFSA 4G6ZA 4BVFA 5M7EA 3L6OO 2B1QA 2DB3A 2ATCA 1MRNA 1OFVA 1QHHA 3GFTA 4H7IA 4R01A 4CLOA 2GZ1A 4ID3A 5GGYA 3ED5A 3VJMA 2VYCA 3FOAA 3ECAA 5F7OA 1Q1EA 2X13A 4C2AA 3U6BA 1XMOB 1P2UA 3VH4A 3U7JA 1J2UA 3RW9A 1NJ2A 1Z13A 3LG2A 4FMDF 5TQJA 3A04A 2CUZA 5G4KA 4JCOA 3UHFA 3O5AA 4OM7A 3KYBA 2PQMA 2WSLA 3LAWA 4LMRA 3I4LA 4X1IA 4JI3B 3V1TC 1HLPA 1QHNA 4ZOLA 2W9XA 4LVUA 4HBZA 4C03A 4CG1A 3U3ZA 1YH3A 4EPYA 5KQMA 3VKFA 2GGSA 1MJGM 4KXNA 1PJCA 4R9SA 4YPVA 3BWDD 1HYEA 3N53A 4Q02A 5JSZB 3L79A 2C61A 4ROSA 2ZI6A 3BAZA 3UJHA 1ID8A 1TJYA 2IDMA 2OFXA 3HB0A 5AW9A 5B7QA 3QPUA 1QX4A 2CD9A 2E4WA 2PV0A 1OFHA 2R8OA 3P5SA 5E1DA 4AYWA 4UEJA 1IOZA 3OTHA 4KEAA 2WJYA 4RZSA 1I0IA 3DBIA 3QELB 3S29A 1U2EA 2ONYA 3LZDA 4LQLA 4XSVA 4BZWA 2NU9B 1HNZB 4H3VA 5HEKA 1MJNA 1SKAA 4IV5A 4EMTA 1IWOA 3S8YA 4YAKA 1EHCA 3GCDA 3VRHA 2KBEA 4HQ0A 4EY6A 3WL8A 1DT5A 4EHKA 1X7WB 3L7IA 1GYRA 2FLWA 2CWWA 1UL1X 4DCUA 1TQDA 4MROA 5JHGB 1QIJA 4LGYA 1XV5A 3P4XA 5F2EA 5AOBA 4HPWA 5K8JB 4H7HA 3BGIA 2F8MA 1HQCA 4UHKA 3VAAA 3WQBA 4JXXA 4FMPA 1KSJA 4JX8A 2DMRA 1YFJA 4RSGA 2P35A 5F23A 5K8VA 4JJ4A 2AZ4A 2R1VA 1E6LA 3KD2A 2PR2A 2ORWA 3L1JA 2RE8A 2ZWVA 1ULAA 3IMFA 3V8MA 2JAWA 121PA 2P6MA 2YOFA 5IEBA 4MWBA 4PYLA 1OZHA 1ZA1A 1U1IA 4ZV4A 1S2LA 1X13A 2E3JA 2JFWA 4O4IF 2UYHA 3MJHA 1NXXA 4F5EA 3B5IA 3WIUA 5MN4A 4JLAA 1C1XA 3FDIA 2F7SA 1F6BA 5JMPA 5FBRB 2EGHA 3CF6R 2PIAA 1UZMA 4HFMA 4URHA 4MITA 1NTRA 3WGYA 5BW4A 5FBVB 3KOYA 3RIXA 1JEYA 1JS1X 3QI2A 5KNDD 4WLVA 4OHZA 3GRPA 5IF9A 3E9MA 3V7YA 1SPXA 1A2QA 3QYAA 5IWCA 1Z35A 1UC9A 2P9CA 3PHJA 3NKFA 2H0QA 4YCCA 4MQ6A 5C0OE 1P2GA 4IDFA 2XA1A 1G5IA 4MWCA 4WEQA 5I9SA 2EJWA 4JBHA 4LZWA 1FVFA 3QOWA 4QA9A 2J0QA 5F52A 1AHHA 4MPJA 5LU9A 3UQZA 1O0CA 2ZPTX 4FS3A 3DHNA 3B89A 5FLKA 1NJ8A 2YZ7A 2DBZA 5MFZA 4CQNA 4I66A 1JJFA 1EFRA 5BN4A 1EDDA 3DW1X 4U7TB 5JJBA 4OHMA 1BRTA 3CRMA 1JKJB 3B9PA 3GLIA 1H0SA 1M0TA 4PYJA 3WYFA 2VN8A 4PNHA 1SIUA 1KYQA 2YWCA 1TGVA 2QN7A 2JGMA 3W3AH 1Z0AA 3DMPA 3OCUA 2J0UB 3NTVA 4ILEA 1ZM7A 1JIUA 1RBQA 2NUBA 1APBA 1OROA 3G7UA 4KP7A 5FTLA 4PS1A 1QLHA 2G09A 4AUKA 4CT5A 1AQ6A 1Z0UA 2QSZA 3ES9A 1QWSA 1UOEA 3IPRA 3L02A 3OJCA 3PC8A 1R4AA 1KHHA 1SUFA 2PBLA 3QGMA 1WSAA 1YZFA 3ROTA 2ATVA 2VDWA 1DEAA 5D00A 2CXQA 1IQ0A 3TGLA 1V5IA 1B41A 2EXXA 1LVUA 5E2IA 1EM8B 1OBHA 2GZMA 3EWIA 3UUFA 2H16A 3F5SA 3MWEA 3FTQA 1KS2A 2L69A 2FAXA 2H5EA 1MF7A 3HV0A 4JS0A 3B1KA 3UMVA 3DTVD 2GSWA 2GCNA 3M9WA 3PSHA 4AMVA 4D9JA 4PBSA 1WNTA 2X42A 5K3CA 3ZBQA 1A1SA 1C41A 1P2TA 2JGFA 1YCFA 2XIQA 1Q1GA 2HIAA 2HLHA 2ZVJA 3FRHA 3KQVA 4ZVPA 1IN8A 3ZQ4A 5DXFA 2PLWA 4MICA 1JHRA 2AG1A 3FDZB 4BJHB 3GJ0A 1SCKA 3LC2O 3GVXA 1JIKA 4JBNA 4FHGA 2D62A 1S2OA 5A6SB 3UJAA 3Q8MA 5LXTF 5D3MB 3KETA 3AVQA 3HKDA 1RYYA 4RS3A 3R6TA 1WDMA 1VL6A 2V7QA 2YJZA 3K9CA 3OM0A 3QQ5A 4UFOA 1NQXA 4KUHA 4RV4A 4XLZA 5AXCA 3SXPA 3ZLVA 4AKSA 5K8IA 5IM4F 1KJ9A 3GI1A 1U7WA 2Z56A 1KR2A 3K0BA 4ZQEA 2HBYA 3W7AA 4BASA 1KKUA 3BEOA 4UFPA 3UW1A 5IUNC 4BPBA 1CUYA 4ZAVA 4E4YA 3CZPA 2ATXA 1W52X 2W71A 3M3DA 1E3LA 1O08A 4K6FA 4MPDA 4AN0A 3C3MA 5DYYA 5JT1A 4E4RA 2O0LA 2KWIA 5ANRB 3FZGA 4N3AA 3BTOA 5B57C 3GLFE 1H6DA 2FSVC 3IP5A 5ELMA 3K94A 4UNIA 1C9JA 3FWPA 5LZ7A 4ALKA 3HA7A 1UOOA 1EKXA 2N3ZA 3PNMA 4IUCS 1XP8A 4ND5A 1GTL1 5AT1A 4TZ6A 5JSFA 1MW8X 4TWZA 2C8VA 4L4RA 2H1HA 1CJSA 4Q9DA 4EO9A 3O8QB 4NDAA 1Z47A 3A3PA 4LBVA 4RF5A 4RH3A 5FP0A 1ZO8A 3ORYA 3BM5A 5HUJA 4LJ6A 3N07A 1FQWA 3FDFA 5JCJD 3DZHA 1HE1C 3NANA 1NZDA 5CLIA 2QQEA 3Q9SA 3UENA 3ESCA 2FRVA 4X8MA 4EMUA 4FYPA 4Z1MD 1QIGA 2QE7A 2QR2A 2HDOA 2I33A 3CLTD 4KACA 1CP3A 3SS8A 1M34B 2WQ6A 2KPOA 1XN4A 2IYOA 3WGHA 3ZE1B 3AY6A 1J2JA 3GRRA 1XVIA 4FCWA 5SZHB 2FEAA 4ZOEA 5IBRA 1Y0BA 3IPAA 5LA6B 3P26A 3EGEA 4HR7A 3TSCA 2D5IA 3MCAA 5DIZA 3FHLA 4RJLA 5CDUA 1CZNA 1QS0B 4EA9A 1SVKA 4RJIA 2OLJA 3H2KA 3RFTA 1QRTA 3ZNQA 4N3BA 4ARIA 4X7BA 5AI8A 4MB6A 2C5LA 5ALLA 3QU9A 5MFPA 1SD5A 2AFIA 1W25A 3UAZA 1D3AA 3NHYA 4LOJA 4M22A 2C5AA 1UK7A 4FKZA 4LYGA 2ROQA 4D9BA 1T5OA 1RC0A 3QBVA 3SDBA 4EI7A 5JC8A 1HOTA 1FUYB 1NMZA 2C29D 5FL3A 4QM6A 1L7QA 2GPJA 3K92A 1R7RA 5B7GA 1PJAA 4JDUA 4LMPA 5AK5A 4F4DA 1P8AA 2Z5FA 4UBNA 3WGGA 2Z3WA 4DV4B 1ENPA 4DSNA 1XLTC 4B45A 1Y6ZA 1IK6A 1EAMA 4AECA 1TM3E 1TX4B 2YRWA 1ENOA 3B1ZA 3KZNA 4OGWA 4P34A 3TLXA 2IYLD 2ZSIA 3W79A 3CNHA 1Z33A 4A3SA 2QV0A 2EBFX 3K2EA 3ZJVA 4J1NA 2BFEB 3VNVA 1Z5GA 4IR7A 5TVGA 2W8BA 3PD1A 4U2EA 4E5PA 5AP9A 5J9FA 4QREA 3SNKA 4AO6A 1A88A 4RD2A 3UWDA 5IK2D 1V9LA 2GOYA 3JQ7A 5KX5F 1AZSC 1JIQA 3AL2A 3SPXA 2ODAA 3R23A 9GPBA 3L0OA 5JSQA 2ZQYA 4HNRA 2F6RA 3UXYA 2VHTA 1L5QA 3LCUA 4ID9A 1YHYA 1X3LA 1Z34A 3E82A 1P74A 2R47A 4WMLA 1MGPA 4UASA 4HLUC 1H0RA 1SK8A 3EVFA 4IIXA 1EVIA 1PIWA 4OHXA 4B87A 4FILA 4PFQA 4B7UA 1XU9A 5J4HA 1JFFB 5EZ5A 1NY6A 3UYLA 2QD3A 4LXYA 4OGGA 1CEEA 1QP8A 3RTEA 5DHPA 1M7BA 1U5BA 2PFGA 3DBRA 3N8GA 4QXAA 3WYDA 4OOEA 4KGDA 5CT8A 1X7XB 5JS6A 3O2QB 3PQDA 1T5LA 3L41A 2OORC 3F5MA 1Q2XA 4UTNA 3DTNA 2R1TB 1NJFA 2C92A 3F8SA 3JAWB 5E1OA 3FY4A 5G02A 1H2ZA 5I9TA 1NZJA 4U9HS 4IJWA 3HL0A 5DYIA 8ABPA 4KREA 1HDZA 1KGSA 3ND7A 4MV3A 2Q2OA 1DKRA 1HYBA 5KKCA 1VMIA 3WQRA 2QZJA 1WBJB 1BXGB 3PNSA 4LHWA 3RB8A 1Q7CA 5CIWA 1ZOIA 1TT5A 1VKOA 3ZIAA 2V4UA 4OXNA 4FQ8A 5JAIA 5JDIC 4QFMA 4TWRA 4BB9A 2WM9B 4G8JA 3PG5A 4YWHA 1U2ZA 3V1UA 2OHJA 5CVUA 2R48A 1X3SA 3KYIB 1EGMB 3OCJA 4XIIA 5KWIA 3OQOA 1OH6A 3P9QA 4CQJA 4CUKA 1TYBE 3KUUA 5B37A 2V9PA 3Q8KA 4NIMA 1GGMA 2RHBA 4OIFA 5EHIA 3DL4A 3K9NA 1AD2A 3AEKB 4QXOA 3OLVA 3L9WA 4N5LA 1KPHA 4B3IA 1C9YA 4UBOA 3PJEA 5C35A 5AW0A 3KT6A 3ERCA 1UMBA 1BO6A 4J6EA 5DVZA 4H17A 2NUPB 5FFNA 5BMVA 4DR2B 4KR2A 5LBIA 3UHOA 3I5YA 3KHUA 2FKNA 1RRCA 2FF5A 2LIVA 4DVGA 4LZLA 1YB2A 3E23A 1EDOA 2HU8A 3SZRA 1UWCA 2D5AA 1CIJA 5DHTA 4E07A 3WMRA 4O4IA 3O3OB 2R25B 2FSGA 4HLDA 2QORA 1VE3A 2DJ5A 1SZCA 4RH1A 3INRA 1PFKA 1S3GA 3O2NA 3U2QA 2B1RA 1T13A 4KVAA 1RBZA 1JALA 3CWZA 3IODA 3M1YA 5JQGB 1T0UA 3NGLA 4AP5A 1E1LA 1QH1B 2O5CA 3GW8A 2IX3A 3OEEA 1K3UB 1Q7RA 3LXRA 2QLLA 2BJHA 2M98A 2V1XA 2FFJA 2YQZA 3ZKAA 4HNUA 4HNGA 2CK3D 2PH1A 2XTMA 5U9CA 5EKXA 5FOVA 4F4JA 2A7XA 3ENWA 4I1VA 2OO7A 4JBGA 4C6SA 1P9WA 3LUHA 3PR2B 4HG2A 1EHYA 4IMIB 4V0LA 3E7FA 4WN3A 1RWWA 4CQMB 4GM0A 2QJRA 5EWLA 3B2EA 3PDIA 4D9CA 3KTFA 4BLUA 2W43A 3B6ZA 3VR4H 4A15A 2FMUA 1Q15A 4M4SA 4Z9XA 1I3MA 4WLNA 2GPWA 4JVOA 4DLBA 4ZYTA 1IQRA 2Q2VA 3DMRA 5EQJB 1I7QB 5LDHA 1WZEA 1AZWA 2M9MA 3QBDA 3JATA 2ZBQA 4EQ6A 4MRNA 4FNMA 4BHTA 1UEXC 5F4ZA 4QJ5A 5G0UA 4EKYA 2GERA 1H42A 1ZD1A 3G5UA 4BZZA 1EK2A 5LR6A 3KU4A 3FNGA 2KW5A 1N2IA 2Q0XA 3R0IA 4C9BA 5IVHA 3LX4A 5CFZA 4BVKA 4C30A 3RU7A 4DWVA 1CY7A 4DMCA 2G4LA 3PA6A 4HTAA 3OTGA 4GPTA 4KE6A 5SZJA 1KU6A 3LY8A 4HN4B 3SFVA 2QTVB 4ZVVA 1GHTA 1YVUA 3W6UA 4ZCTA 5AXBA 1WMDA 1NP3A 5TF4A 3GMIA 4YRPA 1IQPA 1YK0A 3EG9B 5A3VA 1USKA 1VA4A 3HCCA 3W3AA 3O74A 3H2GA 5IC6A 2W8ZA 1N1DA 3W5UA 2BP7B 5GPBA 2H5LA 2VSYA 1KP2A 4RVGA 1U7UA 2CLKB 3ZHCA 3ETDA 5B5SA 4PC1A 4BMXA 4C43A 4LJSA 3KPVA 1C8BA 1C30B 2Q1SA 2R68A 3K1YA 1V45E 7ADHA 3RH0A 3J7AC 5AKGA 1AUOA 5DIFA 3H4IA 3DDSA 3ZHRA 4G1VA 2K87A 1P45A 4DT1A 3TVDA 4WAUA 1N9KA 3KT0A 3T0FA 4ESVA 4A6DA 1PG0A 3LKBA 1X9IA 3EHEA 3E3NA 3IUEA 5TR9A 2X3FA 4UHBA