4NV3A

The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with valine.
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
364
structure length
364
Chain Sequence
NTIPIGIALAQTSNVALLGQEQVAGAKIAEKYFNDKGGVNGTPIKLIFQDTAGDEAGTINAFQTLINKDKVVGIVGPTLSQQAFSANPIAERAKVPVVGPSNTAKGIPEIGDYVARVSAPVSVVAPNSVKAALKQNPNIKKVAVFFAQNDAFSKSETEIFQQTVKDQGLELVTVQKFQTTDTDFQSQATNAINLKPDLVIISGLAADGGNLVRQLRELGYQGAIIGGDGLNTSNVFAVCKALCDGVLIAQAYSPEYTGEINKAFRQAYVDQYKKEPPQFSAQAFAAVQVYVESLKALDTKNKVSKIQLPELRTELNKQLLTGKYNTPLGEISFTPIGEVVQKDFYVAQIKMEKDGSQGKFTFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Amino acid/amide ABC transporter substrate-binding protein,
publication title The crystal structure of a solute-binding protein (N280D mutant) from Anabaena variabilis ATCC 29413 in complex with valine.
rcsb
source organism Anabaena variabilis
molecule tags Transport protein
total genus 138
structure length 364
sequence length 364
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13458 Peripla_BP_6 Periplasmic binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nv3A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4nv3A01
1EWVA 4JP1A 1NXPA 4MS4A 4RXMA 1FFGA 4LX8A 4EGSA 2PJUA 3DLBA 4LE1A 9ABPA 3ROTA 3T6KA 5IUJC 2PUFA 2CHEA 2FKAA 2IOYA 1LK0A 1AB5A 1LBHA 2GBPA 3OLZA 2CHFA 4EVQA 1ZH2A 1URPA 3LUDA 2PUGA 3CHYA 1CHNA 3EQ2A 5HSGA 3LTEA 3LKBA 2MSLA 2JBAA 4KK3A 3I45A 4XLTA 2PUDA 1KRWA 3F6CA 3K4HA 1Z16A 4LDAA 1M5UA 1FQWA 1YS7A 3LUKA 4N0QA 5JNTA 1DCFA 3SG0A 1LJUA 1DBQA 1UDRA 1SXHA 1YK1A 4G0PA 1EWKA 2FEKA 3D8UA 3MYYA 3LUAA 2FN9A 3MF4A 3HEBA 4ZMRA 2W42A 1R8JA 4ZJPA 2HPHA 3FMVA 4G0ZA 1JX6A 4RXTA 4EVRA 2FMHA 3BILA 4UHJA 3EODA 5JNRA 3H5LA 3KYIB 4MGEA 1NXXA 3HK2A 3SY8A 3O2SB 2ZAYA 4B09A 2M1ZA 3QLTA 1Z18A 1A04A 1USIA 5KQLA 3ILYA 2A9QA 2P4UA 4N47A 2J48A 3NNSA 1QP4A 2QSJA 5TQJA 3GT7A 2OENG 1KGSA 2E4VA 4W5OA 3EAFA 1JFTA 3SNKA 4RK4A 2JCGA 1GCGA 1T34A 1S8NA 4PZ0A 3T38A 3IP5A 2HJ9A 4LZLA 4WUTA 3E3MA 4Z9BA 4EY3A 4OATA 4Q6BA 5GQSA 4D6YA 5KQMA 3QLUA 3OO0A 3CU5A 1GLGA 3QELB 1DZ3A 3A10A 3RVNA 2IKSA 4ETMA 3C3WA 1Z25A 2FEPA 3C3KA 1ZN2A 3OM1A 4LE2A 2BGGA 3BRQA 1EFAA 4D74A 1RPJA 4N0PA 3HXMA 1BAPA 2E4XA 3BREA 2FEWB 3KHTA 4HNQA 1U8TA 3IP9A 4IRXA 1DP4A 3CLKA 4MS1B 3RVOA 4Z4HA 1NXVA 3CZ5A 2M98A 2R47A 4M88A 4Z4FA 4YV7A 5TQ0B 1K68A 1P8AA 2IPNA 1PHRA 2X7XA 1BDIA 2GKGA 1EHCA 2NZVG 3H6HA 3QLUC 4RK7A 3HUTA 2GX6A 1ISSA 1RNLA 5DKFA 3LUCA 4RU1A 2GI4A 4XXHA 3MMNA 3OQOA 4WWHA 4RZSA 4YLEA 2QXYA 3N8IA 3K9CA 2FN8A 1SXGA 3EDCA 3QX9A 2FQXA 2FSPA 5IBQA 3I09A 1Z17A 4MQEA 3RVSA 3T95A 2E4UA 2P9HA 3QELA 4JA2A 5CHYA 3N75A 2RJNA 3OMWA 5TPWB 3LFTA 3C6QA 4IF4A 2WWVD 1F4VA 3CG0A 4XASA 4UHKA 4ETNA 3HS3A 4G0MA 4RS3A 4ZPJA 1TLFA 1JYFA 3A0RB 3CS3A 4MS1A 4E7PA 2N9UA 4L85A 5CNIA 1QP7A 2JRLA 3FFTA 1FSPA 3OM0A 3A0UA 4DQDA 5TQ0A 3M9XA 4OLBA 1JDPA 3H6GA 1QKKA 3JVIA 3NBMA 1YMUA 4YRZA 3M6MD 3OLWA 4KK4A 1MVOA 3KSMA 4KMRA 3TD9A 1JYEA 1W25A 1ZDMA 1K66A 2HQOA 1XWWA 4KREA 5KC9A 3IP7A 3UKJA 2MYPA 3RVQA 3RVPA 2V0NA 1ZITA 2PLNA 2LBPA 1A0OA 1D1PA 3HDGA 2YHAA 2FMKA 4Q6WA 1Z12A 1ZH4A 2PL9A 4RY9A 4MR8B 3H75A 2JVKA 2R25B 1DRJA 1JLKA 4TLMB 2FQWA 4XARA 5B3JA 1U04A 2VUHB 1J56A 3FFWA 3GBPA 1LBIA 3D02A 3H5VA 1I3CA 1ABEA 2IPMA 4QYWA 4EYKA 2PMCA 4RWEA 3HJFA 3MM4A 1Z2EA 4RK5A 2FVYA 2WJAA 2FTKE 1JBEA 4EYOA 4QICA 4XFKA 3Q15C 2A9RA 4H3HB 3H1FA 5CNMA 7ABPA 1F51E 2L19A 2RJOA 2L2QA 4PE5B 3CKMA 1QO0D 4RY0A 1U2QA 3H5IA 3KLOA 3Q7RA 5FWYB 3TB6A 5B3JC 4Z4IA 1NATA 5DGCA 4FB4A 3T8YA 8ABPA 4G86A 2WB4A 4G0XA 1PEAA 4RKRA 4LDZA 4MR8A 1C4WA 4N41A 5JNUA 2R48A 1JFVA 4JASB 4W5QA 2RDMA 1TJYA 1XHFA 3TMYA 1HEYA 1YS6A 1U2PA 2L18A 3EQZA 3F6PA 4KV7A 1MB3A 1D5WA 1L5YA 1XHEA 1PNTA 5EWLB 2NT4A 1RZRD 2FW0A 3IDOA 4L4UA 2MSKA 2GWRA 1RXEA 4PICA 3VNAA 3RVRA 3QEKA 3KLNA 2HSGA 4O1IA 3SM9A 1JWLA 1NXTA 4OLAA 3IPAA 5FWXB 1C0EA 4IGAA 4EUKA 3ROFA 1NXWA 1E6MA 2FLWA 1OXBB 5DCLA 5D2CA 4G0QA 4Z9AA 1H9CA 2MYTA 2DRIA 3CFYA 5JNWA 3F7NA 1D1QA 1NXSA 5IX8A 4CBVA 4D6XA 3N0XA 2WJWA 2PL1A 1ZVVA 4DN6A 1NXOA 5C5EA 2E4WA 1SXIA 3CNBA 5EWLA 1QPZA 1ZGZA 1Y1LA 2JK1A 2TMYA 3LUGA 1DBPA 3Q41A 2FMIA 1MIHA 3HCWA 1DJMA 3EULA 1JFSA 2MYNA 1DRKA 3M9WA 3QEMB 3W9SA 4EYGA 4N76A 3HO1A 4MLDA 3OQMA 5IC5A 1P2FA 1ZY2A 3KG2A 2XDYA 4TN5A 5TQ2B 1Z15A 3JPWA 2NUBA 5FWXA 1ABFA 5EWJB 4KQ9A 1BDHA 4OTZA 4EYQA 3I42A 1D4ZA 5BQ3A 3IPCA 3VNBA 1TM2A 1Z26A 1SD5A 1FFWA 5DLEA 4H3KB 3ILHA 2CD7A 5CNJA 2L17A 3S99A 3O1IC 4RK0A 1SRRA 1QQBA 2QVCA 4G97A 5BRJA 4WZZA 5ABPA 3DLHA 3Q7TA 4O5AA 3SAJA 3SQNA 1E6KA 3N0WA 5I4CA 3O1JC 1QO0A 2AYXA 1E6LA 3CRNA 3G85A 3HDVA 3G1WA 4KFCA 1TMYA 4MS3B 1ZHHA 3LOPA 4JB0A 3EJWA 1BA2A 1Z13A 4ML3A 3NNNA 3JY6A 4HYEA 3MQ4A 3LUFA 1P6QA 1QMPA 5DTEA 2JB9A 3A3KA 3OLYA 5EWJA 2HQBA 1PEYA 2WRZA 3GYBA 3R0JA 2NZUG 1LJLA 2QU7A 4W5RA 3Q7SA 3HM9A 3GV0A 4MPTA 4HNRA 2IPAB 4NQRA 5PNTA 4Z99A 1RZRA 5BR1A 2ID7A 2B1JA 2PE5A 5TPWA 1RXIA 4MYRA 2F8TA 2LUOA 2A9OA 1M2EA 2IYNA 2O20A 2VK2A 4Q7EA 4Y9TA 4Z0NA 1VPWA 5TPZD 5EWMB 4E7OA 1IIBA 2PKXA 5HQJA 1WETA 3C97A 2NT3A 2FQYA 1L5ZA 3LMKA 3LUJA 4H60A 4GNRA 3HUUA 1B00A 4NCBA 2ZWMA 4RXUA 2IDMA 3EGCA 1DCKA 1AB6A 1YMVA 5T7BA 3F73A 2H0AA 4MS3A 4XAQA 5T3YA 3RVJA 3UK0A 4Z4CA 5HM6A 2MSWA 3KYJB 1NY5A 2CWDA 5KWSA 4MR9B 1DC7A 1YIOA 3RVMA 4F06A 3O1HB 4NV3A 4LE0A 2PUBA 3BBLA 4NICA 1NTRA 5JS2A 4KQCA 4RV5A 5JNVA 3GA5A 1KRXA 3QK7A 5FBKA 3GWGA 4MQFB 3N0RA 3CG4A 3N6VA 1DG9A 2VUIB 5EWMA 4PEVA 2KYRA 4KZKA 3Q9SA 1VRVA 4MAAA 3QLVA 5ED4A 1GUBA 4Z4GA 2B4AA 4W5TA 4ZYLA 1DC8A 3UUGA 1ZESA 1P6UA 3H1GA 1TVMA 3BRSA 4JAVC 5KC8A 1CYEA 2LPMA 1USKA 2E4YA 4YO7A 2WMYA 5BRAA 4OG2A 4YWHA 4IILA 5C5CA 4MR9A 2AYZA 1BVHA 4HNSA 4RK6A 4EVSA 4Z4EA 5IULC 5TE9A 2F8SA 1OXKB 4WXMA 4RK1A 3B2NA 5FWYA 3GL9A 3H5OA 4MR7B 1YK0A 2FXIA 3H5TA 4WXEA 3O2JA 4G0OA 2QV0A 2RGYA 3URMA 3QLVC 3RQIA 6ABPA 1A2OA 4FE4A 2JVJA 1W9HA 4PYRA 1VLZA 4MQFA 3OQNA 2FLKA 3DZDA 3JS5A 1U0SY 4JOQA 3NHMA 1MAVA 1M2FA 3DGEC 3OLXA 3OLVA 4QYMA 4MLCA 1JH9A 3RVKA 4DADA 5IUNC 5IUKC 2ID9A 4RKQA 4WT7A 4YS6A 5FBHA 1BDJA 1QQAA 2E4ZA 2QVGA 1EWTA 4FE7A 4MQEB 3OMXA 4RDCA 3RH0A 4KVFA 3KTOA 4IMJB 1QNLA 3TO5A 2PUEA 3HZHA 3KJXA 3FDFA 4O1HA 5F64A 1DBWA 1ZGGA 2Q5CA 3H1EA 3P9YA 3KCNA 4MR7A 5TPZA 4KNYA 3I5AA 3FGZA 3JVDA 4S05A 4RSMA 5KI6A 1FFSA 1E2BA 3N53A 1JHZA 3C3MA 4P1ZA 5JNSA 2I6FA 4P98A 3DGFC 4QPJC 2VYCA 4LRQA 1ZAYA 4MRMB 2QR3A 4W5NA 1D2AA 3CTPA 4OBBA 4YP9A 1APBA 3CZCA 2IPLA 2LP4Y 1JL3A 3E61A 3MA0A 4N03A 2PUCA 2WY2D 1CEYA 3QX8A 3QEMA 3RVLA 4YCSA 1JDNA 2QW1A 4S04A 3HV2A 2PUAA 4KPYA 1QP0A 5TQ2A 1DCMA 5HKOA 1Z2DA 3LUHA 3TX6A 2FMFA 1GUDA 3O2QB 4MS4B 5JS1A 4GPAA 2LIVA 3KS9A 5GOTA 4TMYA 2R4QA 5IEJA 3IP6A 2OQRA 1MB0A 1GCAA 3O21A 3OO1A 1ISRA 2A9PA 4NCAA 2H3HA 3MIZA 2PAFA 6CHYA 3GRCA 4YR7A 4ZMSA 4YGXB 4ETIA 1YVUA 3DBIA 4G0YA 3FFXA 3JPYA 4IMIB 4F8JA 5KQPA 4F3TA 4KRFA 3O74A 2JBAB 2HQRA 3NHZA 1JF8A 3L6UA 3O75A 3L49A 4MRMA 1KMIY 1VKRA 5IEBA 5KQGA 4RY8A 3KKEA 3H5WA 1M5TA 1PNRA 1PUXA 1YTUA 2QZJA 5CNKA 4JB2A 3JTEA 3HSYA 2MYUA 4F12A 4TLLB 1USGA 2JVIA 1EAYA 2YHBA 5E3JA 3LKVA 3HVRA 3GBVA 4F11A 3NNDA
chains in the Genus database with same CATH superfamily
4RMGA 3WRYA 2BT4A 4P53A 3VYWA 1HV8A 1KDTA 4R3NA 3C7KA 4LX8A 4YPOA 4AJNA 5AD1A 1YB7A 2WIKA 1F8UA 3OHMA 1RQGA 1QHGA 4GYKA 4U7DA 1YR2A 5AW8A 1X80A 2QKYA 2JAHA 3G5AA 2JJMA 1SKYE 2OV8A 5IM4A 1AB5A 3KYCA 2XUQA 4GDMA 3G5MA 1G60A 4EBBA 5KNBD 4ETWA 4YPFA 4AROA 1R50A 5FR2A 4AICA 3QKUA 4O4JB 1OCEA 1XZLA 3FTQA 4KL8S 1JEJA 2EV9A 3EVAA 4RIGA 4WY8A 5I9SA 1JLHA 1FP4A 4UTNA 3KJIA 3EEIA 5JQWA 1KO1A 1U11A 3VNRA 5LNK6 2G67A 3MUNA 2FSHA 3I8XA 2O7VA 2X1MA 2BKAA 1CRQA 2PX0A 3VI4B 3A3YA 2JAPA 4Q3AA 1X77A 1HTTA 1ECFA 1NVDA 4C5BA 3BH6A 1C9YA 5F2NA 3QA3E 4TWRA 2J6BA 2NLOA 4YEDA 5L4LA 2GASA 4W7HA 1FL9A 2RH8A 4HLUA 2C07A 2HWWA 3WHPA 2GCNA 2XDQA 5LZ2A 3TIXB 4B33A 2WF8A 3MUFA 2BTOA 1CRZA 4OF4A 3H5LA 2WAXA 1GVNB 4WXYB 1A97A 1I2AA 3EVBA 3K94A 5ALOA 5AI4A 1WY7A 2WMNB 1NVAA 2F3RA 1WVMA 1SOAA 1U7PA 3U7GA 4IV8A 2CCGA 3UUFA 3GF4A 2GYUA 3HLKA 4CM1A 4D0NA 3DLPX 1OI7A 4B1FA 3LXMA 3K9FC 2D3WA 2DMRA 4NFSA 1N57A 1SCJA 1YCFA 1J9GA 1Y6ZA 2FB9A 2YC4C 2C9OA 4X6XA 1VECA 3H6KA 3V7YA 2V4UA 4CDRA 1LPBB 1MFPA 1VLHA 1YDFA 2QS9A 3CNLA 3RWBA 1XA4A 4WOPA 4DJ5X 4YIHA 4I1PA 2AFHA 1REQB 1C3LA 1F8XA 1XXLA 1MPTA 2V4MA 2VTVA 3QLUA 2IS6A 3DVRX 2UZIR 2FG7C 2VSOA 3JW8A 1E2MA 3GMTA 2R6FA 4UNSA 4Y8VA 2NVUB 1NMEA 1AUQA 4L0MA 1JHVA 2G80A 2GAAA 4QBHA 3TLBA 4FX5A 2JIOA 1YJ5A 1U0RA 3BEDA 3GRAA 1Z8FA 3DULA 5EQTA 3FYCA 3WK7A 3DPIA 3PX3A 2A9FA 2PFKA 3N2IA 4U6NA 3KSBC 2H18A 2NU6B 2QMEA 3KB1A 4QVKA 3MUOA 5KVVA 1FNBA 2A33A 4WOJA 5EJ9A 3RRMA 3OTQA 4PIMA 1SKUA 1HUQA 2J8ZA 5AKLA 1H8HA 1NVFA 4XLLA 4X66B 1BZYA 3KOOA 4RK7A 1NUHA 4HT3B 4JCCA 3C74A 2GX6A 1T3TA 2RGNA 3I32A 2X5XA 3EZ9A 4W9NC 5TGTA 4JU8A 4OXYA 3TRKA 5AJXA 4C0AC 3PJFA 2A1IA 4OXXA 3L7AA 2HMUA 2QXYA 1EGVB 1WZIA 3S1SA 1QUEA 4JL5A 2UKDA 4DLZA 4V2IA 2FSPA 4XVUA 3DCNA 5CLQA 2ZUBA 1A9ZA 4Y2QA 5I6DA 4FFPA 1KMMA 2HHCA 3LCRA 4F4IA 1V3TA 3ENKA 4TTPA 3M6FA 1Q16A 3L02A 1MRSA 2NO0A 1G8KA 1IZ0A 1BE8A 3FPEA 3GARA 5FJJA 4FM9A 1P3DA 2YFQA 4JEMA 3WL3A 4ESVA 3ZHRA 3UV6A 1WS6A 1TLFA 1N6HA 1NXQA 2D5BA 1OIXA 4Q9IA 5J40A 3DH0A 4MHSA 2QTCA 2QENA 2B99A 3BBPA 3QJGA 2A4KA 1G6Q1 4RVUA 1ZO8A 4FHZA 3TM4A 2B5VA 3Q2KA 3GRPA 1YMUA 1QC5A 3NTRA 2P5TB 4KMRA 5T4BA 3TGLA 1ZDMA 2CXRA 4CFYA 4D0RA 3JQBA 1J8VA 1O77A 3FRIA 2IEDA 4B6PA 1V71A 2OV4A 2RBEA 2YZMA 2ZS8A 4EKGA 3OHPA 3DJYA 4S1NA 4L4YA 4TXLA 2IU3A 4NLLA 3A1EA 3FTCA 1EBUA 2VUTA 5GZ3A 1OXUA 1PWXA 4GBJA 4B6SA 3BMNB 4HI0E 5FTKA 5TIIA 3AVWA 1LDYA 2OEPA 4M0MA 4CR7A 4QUDA 1I80A 2X1LA 4ES6A 1W2WB 3I01M 2W4IA 4OIMA 1LBIA 2X3YA 4IIJA 1XCOA 1WVGA 1X7GA 3F8TA 2R9VA 3JZAA 3KVRA 3VZDA 4WK4B 4NABA 1LSSA 1OU0A 3H11A 5BWMA 3EW9A 2ECPA 4DLLA 2R66A 4EMBA 4YCNA 1GRQA 3OIGA 1CUZA 3QXSA 5I51A 4A5OA 5G0VA 2PJRA 4WLFA 621PA 2OZEA 4WFQA 1O5OA 1OC2A 1VC2A 1W93A 2ZUUA 1I1QB 3N8NA 3TNFA 4ILEA 2Z8YA 3I9JA 2ERCA 3IUJA 3AG6A 4O4HA 4NNJA 5E95A 4P32A 5T6BA 1N25A 2B4QA 5B3JC 3E9ZA 5EJIA 1T0JB 2AG0A 2OGUA 4CMGA 2OA0A 5CXQA 1OAOA 2PT6A 4F92B 2A59A 4CCSA 3VR3A 1NKSA 1PEAA 3I5MA 4PG6A 3L1IA 3JU3A 5EMLA 3O3OB 4F4CA 1U7ZA 1FLAA 2OCIA 1SXJC 4FDAA 2CE2X 5KKNB 3JVUA 3BG5A 3PXDA 4FHCA 4DUGA 3F6SA 1RWQA 1GG8A 3PA6A 4M76B 2VZ8A 2VQ3A 5C8XA 1H4VB 2DT5A 2PL3A 3FNBA 3QOFA 5JC8A 1V1MB 3UAGA 2BFDA 1JSCA 5DTMA 3T3MB 4FMDF 3F78A 1YBMA 3H8VA 1II8A 1XVTA 1WPGA 5EXXA 1ORTA 1C1XA 1E79A 3M5CA 2UYHA 3K8ZA 4MTCA 4RD2A 1RRKA 2O6HA 4RH3A 1ZUWA 2YZKA 5D3MB 3ZKWA 1YL5A 4IOLA 4CMAA 4EW3A 3PRHA 1KZ1A 1W46A 1NZFA 1YR8A 2DU8A 3E7DA 3ROZA 2IF2A 3FX2A 3V48A 4A0GA 3E70C 1V5GA 5A3RA 3FAZA 1U80A 3TOZA 3OQIA 3HFRA 5AJHA 4MYDA 2VTKA 2R6ZA 3FNHA 3HJRA 5TVGA 3VYUB 5M29A 1E9RA 2KI5A 4P81A 4TL9A 4WL0A 3CINA 3AFGA 4Q4JB 2NG1A 3BB3A 1U0JA 1W47A 1GD1O 4N5DA 2OOKA 4WK6A 3UGKA 4EHDA 2JFHA 4U7PB 4CM3A 5A7FA 4CQMB 4AS1A 1LEHA 3CNBA 3IAAA 4HSEA 2BFCB 1R27A 1ZGZA 3NI2A 4HUQA 1IOVA 3OA2A 2H1FA 1EK0A 3L6BA 4FLMA 4URUR 5F5XA 1LTKA 2XNKA 2ZJ1A 4CKBA 3ND9A 4TXHA 2MYNA 4UQOA 1BTOA 1PWZA 2XZLA 3HBMA 3I5UA 2G09A 3WJ7A 2IYWA 3R8CA 1AY0A 1T5TA 5EJ4A 4BWYA 2BC9A 5TT1A 3FWHA 4ZYZA 2R6HA 4ABYA 1IU9A 3ABQB 5AXCA 2OXRA 3M6AA 4JDPA 3ZY2A 2IUTA 3WIVA 1FW8A 3CZPA 5ALVA 1PT7A 2XUDA 4TV8F 5HFJA 5CTJA 1P4HA 4RL6A 2W6QA 1J2JA 3TDMA 3S27A 4OH7A 2L0XA 1I4WA 2HY7A 3TF5A 4Q4AB 1TF2A 3OEYA 5TDHA 5DLEA 4Q1AA 1QIJA 3ILHA 4W1PA 4KLNA 5AHWA 4E1VA 3LSTA 3O1IC 1STOA 1UK6A 1CQXA 2CLCX 1I2ZA 2ZTMA 5CJPA 5BPFA 5BRJA 1XTKA 2FZCA 1A9RA 4HQ6A 4WZZA 3V7WA 4KDRA 3VR4D 3AUKA 3RUCA 2Q5JA 3ORHA 1HQDA 3R8FA 1FC0A 4JJIA 4WZAA 5TMEA 2ZIAA 1OXMA 4P4SA 2WF9A 3K15A 1ZCAA 4OYHA 1QH8B 3R0XA 2X8BA 4NZYA 1O54A 4TVBA 1CRPA 3G1WA 4Z9FA 5LUBA 1JQLB 3ZDAA 2EJCA 4D4KA 3EJWA 4BEJA 5C4IA 5HUHA 3LPCA 5CUQA 4YQFA 5K5EA 3NNNA 1LH0A 3VZBA 1IBRA 1ONOA 4HYTA 2PTGA 4Z3OA 3O8QB 3G49A 5JSFA 1K2WA 2B6NA 1QCZA 4D8VA 4JJEA 4BN5A 1PV4A 2UXBB 2ZUTA 1DIBA 1SBQA 4AP6A 3UF0A 3WJ1A 1LJLA 3W0LB 4CJXA 4W5RA 1VMDA 1DKUA 4AQYB 1M34E 2C7GA 4WDRA 1R0KA 4KACA 4W63A 5PNTA 3Q3HA 2LZ0A 1Z0UA 2EQ5A 2VATA 1P31A 4FSDA 4E3WA 5KSOA 1J23A 1T6BY 3Q11A 4DSNA 4D0LB 5FUBA 2JGMA 3PNBA 3TL2A 1NVVR 1UWKA 1X3SA 5JW6A 2ZAIA 4L95C 4JP3A 4Z4QA 1YZHA 5TLSA 1XTSA 2W2KA 1G5FA 4G6ZA 4BNVA 2X6RA 1L5ZA 4WQMA 2B9VA 1SUIA 3ZCPA 5DW3A 3H0EA 4B7XA 4DGSA 1QGOA 4C0KA 2OD2A 4RXUA 1KZ7B 1TCVA 5KYWA 1KE2A 4CEHB 5T3YA 3I9FA 3FCCA 3YASA 4O6VA 1D4AA 3LBFA 5EQDA 5C46F 3DAHA 3IYLW 3P5SA 3H04A 4P31A 3V4OA 1JE0A 1EWRA 3WIBA 3AB7A 5FO1A 4E2YA 3ACCA 2X77A 1N5LA 2B34A 1K2VN 3C70A 1IY0A 3GMDA 3T7SA 3W5VA 1KQFA 2XWPA 1BC5A 2WIBA 5AVKA 3E84A 1BDMA 3AM4A 1GAJA 1U2TA 2CLLB 2O3QA 3QQ5A 4TVKA 2Z4RA 3BL6A 2IIQA 4IJMA 1PLJA 4LNAA 5H16A 4IV0A 3JAKA 4ND5A 3AUAA 5TQVA 4NJOA 3F74A 1SAYA 2PVCA 3BCRA 4AY5A 4H0FA 3UWKA 4P4GA 2NUTA 4G1MB 4DNOA 3EGVA 2DFTA 4E5KA 1OBCA 2EZ9A 4D3ZA 2V9ZA 3T5DA 1MOQA 2VCYA 4TKUB 4ECAA 4UHBA 4M1WA 2B4AA 1Q22A 4UU0A 4KGZA 2SNIE 3ZV4A 1PFUA 1C7IA 4KIJA 1BD4A 1OFGA 3FGNA 3L84A 5EKSA 2C5GA 3ZGYA 3T5GA 1GYPA 2WYWA 5KNDH 5IYZB 5J4YA 5C5CA 3QFSA 3QY9A 4N8SA 5FNZA 3WK5A 3JSXA 2FAXA 1OX4B 3DEJA 5EEHA 2F8SA 3FOCA 2VBGA 3HKEA 5EQJB 4EZBA 4Z3KA 1CY1A 4QG7A 7AT1A 1TEZA 5AQ1A 4RETA 1I4EB 3C0KA 5DM60 3B1VA 1O8CA 4AZ0B 3LCJA 4PZLA 1J2TA 2M6SA 2C94A 4EI8A 3S3TA 2E48A 2JVJA 2JLBA 3AM5A 2BFWA 1Y9DA 4UMFA 5A4AA 1CERA 4JOQA 4ARUA 1K7SN 3NMUF 1T9BA 2SBTA 1JEQA 3DBOB 3IQIX 2B7LA 2IY8A 4LZOA 3AONB 4NESA 4R1UA 3ORRA 5BSMA 3IT3A 4D9JA 4TRRA 1OIWA 1ZUNB 4G9EA 4L4RA 1RBZA 4P82A 2PGOA 1VJGA 3T3GA 3WGGA 4Z54A 4EUFA 2ZJZA 3A6JA 2GMWA 3R3HA 2WQZA 2NGRA 4N0DA 1HMPA 2CL7X 2AZ4A 1DEKA 4CLRA 1MB4A 2I9PA 1N9GA 2QE7A 4RDCA 1GAWA 4KVFA 3VU9B 3O4GA 1YR9A 4K1LA 2BBTA 5F3RA 1NRJB 3P9SA 3TO5A 4DREA 2C2XA 4GGPA 4LJYA 3RNOA 1NWHA 4M98A 4WKGA 4D56A 5CGZA 4QJ3A 3EIUA 3S8YA 1L7PA 4IIUA 1FBTA 1Z6PA 2AFIB 3SYMA 3FY4A 3X1YA 4FYHA 4WY5A 5TEWA 3FRHA 3ZCSA 4CM9A 1H2YA 3A1NA 3MB8A 3RSZA 3VU3A 2QR3A 3HDYA 4I50B 4KPFC 4IRUB 2CCKA 4PR3A 5COQA 1JTVA 2WKWA 1I3NA 3CWCA 3OJFA 4D9IA 3ZHZA 1FK8A 3KLMX 3KQUA 1J0DA 1WO8A 2Q1XA 3PNLA 5FPHA 2WG0A 3PV0A 2VRWA 4ZZ1A 1DIGA 4AX8A 4WCFB 3DTYA 1H2BA 1CQJA 1T6YA 3MZ0A 1BN6A 3G79A 4L3OA 4O2LA 5EL0A 1E2FA 1AKYA 1XVVA 2NO7A 2V7PA 1G20E 3U3DA 2PMEA 2E87A 4M8KA 4QFBA 2RHLA 4RW0A 4TL8A 5HE9A 5IEJA 2GAIA 1JI3A 2C7VA 2ZSFA 3KE9A 5DV9A 4HNUA 3VKHA 2WF5A 2AEJA 2AJLI 4NCAA 3IMEA 6CHYA 1ANKA 4MUHA 3HVIA 1W2GA 4Y9RA 5FTJA 1NPTO 5AP9A 5KQPA 1OILA 3GGGA 1YGYA 3KC2A 5IAJA 5B5SA 4QTYA 4BJ1A 7YASA 1U0NA 5AHRA 4JYMA 5M34A 1XNQB 1R4AA 4JQSA 2R6AA 1C3OA 4MGYR 2RGEA 4ZDIA 4X1YA 3CBQA 5GTDA 4YJGB 1XTQA 2JHAA 5LZ5A 3TN7A 4YP7A 1YJXA 1RCTE 1RPAA 5E7IA 5L7TA 4R9RA 2DUMA 2YN0A 3LLCA 1E3SA 5EIOA 4DIEA 2I5PO 3UOWA 3PEEA 5AK5A 1THMA 3FB4A 3GBVA 5EI5A 3CJQA 3K2BA 2IXTA 2OCKA 3ROQA 4EHNA 1NDQA 5FL3A 3UGQA 3VTFA 1EWVA 1SVUA 1TKBA 1IXZA 2P1DA 2ZYHA 1G98A 1F9EA 4JP1A 2NU8B 5B6PA 1QVVA 3K05A 4FYWA 4HGNA 4R69A 3ESCA 4MWZA 4PWYA 4TMFA 3ECSA 5DIFA 1HQKA 3I01A 3KT3A 5AT1A 3HCDA 3OH8A 3DZJA 5IJZA 2YWBA 4EKDA 3CA8A 1N1EA 3REFA 3BOSA 4HADA 1RMTA 5D5HA 5KOJB 1WDMA 1QORA 2QZ9A 3GLIB 4X92A 2QQ0A 2Q62A 3GN2A 2HH9A 3K0AA 4DMRA 1H3FA 4OMFG 1ADFA 1N6RA 4LHYA 4NCKA 5K8JB 3EWAA 4GP6A 4IHJB 1NVKA 3VZSA 2DPMA 3U56A 3L46A 2C20A 1OLUB 4BGEA 1WQ4A 2ZIEA 3MWJA 1JJVA 4WSOA 1E9BA 2OM2A 4MVJD 3GJ7A 3X44A 3H2BA 4MMZB 5DWVA 3ILXA 3OZFA 3ZGLA 3X2EA 3HSSA 2BONA 4RTOA 4KPGA 4B35A 1BVYF 1YE8A 4D1YA 4KE8A 2NPFA 5F2OA 3UGJA 3NJ4A 2I33A 1O3YA 1EESA 4BWVA 3CC8A 2YICA 4RPGA 4JQOA 4XSVA 1H1LB 1C9MA 1KI6A 2PZEA 4PG5A 2E85A 1DEAA 1C8LA 1L7QA 2ZAYA 3QLTA 3S2ZA 2FPKA 1U8ZA 3SQMA 1TVKA 4JCOA 3WB0A 5LOVB 1MO6A 4MV9A 5EIBD 3CLVA 4JV5B 3DL2A 3H1AA 3G9UA 2QSJA 3I9V1 1U7WA 2RH9B 1E3LA 2G1JA 7REQA 1U5CA 2EW2A 4IVQA 1UWCA 5BW4A 4OYYA 2VEOA 3VH2A 3M4ZA 1VL0A 1T2EA 2QD1A 4CETA 5GVSA 4DW8A 1P2VA 2AMFA 2XKAA 1FFDA 4MA4A 3E3MA 2X0DA 5G02A 5IF9A 4A82A 1E7WA 1SBIA 2GXUA 2P62A 2H9YA 1HLDA 1E5QA 5GZ1A 3OO0A 3G0HA 1L1EA 1VGRA 3SF0A 4JLWA 2Z5LA 4HUTA 4H18A 4GHWA 3TTUA 2G0NA 4ZI5A 1DIOB 1T8YA 3JD3A 1X2EA 1L5VA 2F3QA 5K8VA 3AJ9A 4FSHA 4AJOA 2QRGA 5K0EA 1X15A 1GPMA 5CFOA 4LDQA 3HADA 1PG2A 4KJZA 1K75A 1UL1X 4GNKA 4Q24A 1O4WA 3WMFA 5EJ5A 5J5AA 1AA9A 5AXAA 5I9LA 4ZOCA 3I28A 5H83A 4YV7A 2WU0A 4QDKA 4W5HA 5EFZA 3W2FA 1BDIA 4FNOA 4J1QA 4NWIA 2OP1A 1AQUA 1ETHA 4JH0A 4UUAA 1O2DA 1WULS 4YBZA 1Q7TA 1R5NA 4IXDA 4LRYA 2XT0A 3MMNA 3OQOA 4LZNA 2H0RA 4YDQA 2NOAA 4RIHA 4RZSA 2ZGVA 3TZEA 3WB2A 2FN8A 1M2VA 2V7GA 4EY4A 1PJQA 4BP3A 4D8YA 1SIUA 5CDTA 4OKNA 1NUTA 2FWIA 3AETA 5DBFA 1XQXA 1U8UA 2CF5A 2JGDB 3COZA 3MXOA 5HIJA 3TW8B 2OO3A 2J3QA 2ZRPA 3LDAA 1SIOA 5JI3E 3IVAA 3L07A 1NFFA 5KNBA 4BKQA 3R5SA 4D5EA 2YVUA 4K40A 1IHYA 1ZJ5A 4EUNA 4I81A 1T6NA 1Y6FA 5F1OA 3V8BA 4E7PA 4IMRA 4L85A 2OSVA 4MYUA 1SD1A 2V6FA 1IUNA 3O9MA 5JJLA 3MLEA 1PZHA 2F3PA 3A6DA 4PCUA 4J4TA 3RO7A 2AX3A 3FDZB 3WQQA 1TMOA 4OLBA 4TZKA 5LNK1 1RHJA 2MINB 4G89A 1JV2B 2I62A 2WWRA 3BWBA 4CM8A 4EJMA 4G0VA 3TD9A 1JYEA 1FPMA 1C4OA 1WX1A 4AMVA 3LY8A 4HAYA 1VXRA 2MYPA 2YXPX 5DNUA 1JPVA 4LV5B 3KYDB 1UFOA 4GRAA 3R7NA 2Y4OA 2X42A 3AGQA 2PCJA 2DKFA 3ZGVA 1GQRA 1TIPA 4M8NE 3REQA 1O9GA 3TTYA 5KREA 1XEWX 3AY6A 1QLHA 1RHMA 1C5KA 1FRQA 1KVTA 2FP4B 1JLKA 2QG6A 2ZT6A 3N8KA 4MPJA 3SYNA 1WZUA 2P3QA 4ND8B 1LPAB 3GZJA 3L7MA 1Y1KE 2X41A 4A7PA 1IYZA 1KEZA 2IZ6A 4FYJA 4YQEA 3X1MA 1SKMA 2M6LA 2PGJA 3H2KA 2BGTA 1V41E 3IH5A 4RWEA 3GAAA 2ZUWA 4HAIA 2FRXA 4O0MA 1HE5A 2YY7A 3SF8B 4BAZA 4DYHA 2E89A 5GGYA 4N82A 1L5OA 1P62B 3K6KA 1R6VA 8LDHA 1K5PA 5BR7A 4QWMA 1VA4A 3TG2A 3P9IA 4LY0A 4QBGB 1Q3HA 4KC0A 4GBED 4H3HB 4N7MA 1UP4A 5LBTA 1F51E 1SUBA 5EPEA 4E22A 2GARA 4HEHA 4CVNA 4QU9A 5BV8A 4PFJA 3ICEA 4W82A 3PXXA 2AFVA 1IEWA 3VFDA 4EB6B 5KPJA 5FWYB 4LCJA 3TB6A 1C9JA 3IE1A 3OY2A 1J8QA 4B6RA 4FR5A 3ENWA 2JASA 3TGPA 1B7GO 2QRPA 3DMPA 1LSUA 2OB2A 1VLMA 3MT8A 4FR0A 2KS6A 3FZEA 5EZYA 3WOHA 4G0XA 1P18A 4M1YA 4ZAVA 3U7EB 1X8LA 4N41A 3DVQX 2HIGA 3Q5GA 3DE3X 4Q18A 5DJ5A 1BH2A 3BIFA 1HEYA 1FRNA 1R0BA 4K9NA 4UBIA 3NANA 5BORA 2WM3A 2XTJA 2GAJA 1D5WA 4L6IA 4C0QC 1CHDA 3Q0TA 2WSBA 1EHYA 3EXEA 3FYTA 1RZRD 5JCOC 1E2DA 3HWRA 4UVHA 2VHTA 2D1RA 5J4VA 4S1WA 5HUQA 4ER7A 3DKRA 1CUAA 4OQZA 2X4LA 3U37A 2PZGA 3TQFA 1XT6A 4JHXA 1RACA 2HSGA 2HSZA 3ZE0B 1EU1A 1P3JA 4Q82A 4CL2A 5FUQA 4YQZA 2R8RA 1P4SA 4Y67A 2BEWB 3VR2D 2XCSB 2R1VB 2WOOA 5EPOA 4V24A 4QQNA 4UREA 2PZ8A 3N5CA 4MITA 4CLOA 5D51S 3R7BA 4OBWA 1TUBB 4PBRA 3V33A 4JEIA 3QUAA 2GKOA 1DAHA 5KMGA 3DUFB 2FPWA 1L7NA 3AJ8A 2DQ4A 3ANTA 3PYMA 3UWSA 4DCMA 1M1YA 1SH7A 5BSGA 1W0JD 3BFKA 1XYYA 2OK7A 3F7OA 3MRXA 4FW8A 4Z86A 2VJMA 4GE3A 1A9OA 5FQOA 3S44A 3ZR4B 5HWSA 3NHYA 3A04A 3M6LA 5GMOA 1PZGA 3M83A 3R5TA 1P0IA 4DRXA 1KJ9A 4ZHSA 1T9KA 3LUGA 4ALIA 4U6SA 1Z82A 5IBPA 2LXNA 3EFHA 3TMKA 1ESMA 1F5SA 5I4IA 1DDOA 3KXLA 4PRKA 3UMCA 4HEQA 2P2CA 3GZTB 3KQLA 4RKEA 4BO5A 2R00A 1OH7A 4BY9E 4TN5A 5IDYA 3EXAA 2HA2A 2ZWOA 3P9CA 3JPWA 3NBUA 4JT9A 3FUVA 1N7JA 2XYPA 2ZWPA 3FI9A 3LHKA 3MTDA 4X1KA 5TARA 4FJ0A 4URXR 4X94A 1W1WA 1CJSA 2CLIB 5L3SA 3IDZA 1IBKB 1OFUX 2A35A 2HLNA 1O0CA 1TM2A 3ZKAA 1OH8A 4D26A 2O8CA 3KSUA 2G36A 2J3MA 1MLDA 2ZSKA 1NW6A 4FOPA 2C77A 4KDFA 3M33A 3ZUGA 3AR7A 1KH1A 3VTKA 1P9LA 2IYVA 5K6RA 3SICE 4EUEA 1CQIB 1KZYC 4W8OA 2H8KA 2QMHA 1J09A 4DUZB 2N42A 1DJPA 4PAWA 3T1HB 1BWSA 4MVJM 3A6FA 3L7NA 4OQLA 3ME5A 4KAAA 2SKDA 4TMWA 1A4UA 4PV7A 2RCYA 4OJYA 2IK8A 4L8GA 4ML3A 2H1VA 4OSEA 2QLBA 1YDHA 3QBDA 2Q5FA 4YT4A 2RBGA 2NZJA 4DPMA 2YJZA 2ZI4A 5I9MA 4ZVLA 1PQUA 3EGEA 3K0CC 5D86A 1N78A 2NZUG 1MJ5A 1BH6A 1SUDA 1ECBA 4GW3A 3NBAA 4IIXA 4C7BA 2M9MA 3GV0A 1RXVA 1OVGA 1US8B 4HAVA 4F2WA 4ZODA 3UHOA 2HN9A 4R1PA 2ZJOA 1S4QA 4R41A 1MQSA 2RHDA 1KK3A 5HZGA 4N3AA 4KQKA 2F4NA 2O20A 4EARA 1OD6A 1TLLA 1IEQA 3EF3A 1VPWA 2AK3A 3U80A 2IBTA 2OWDA 1NIPA 2YXNA 4OMUA 1FXWF 4A2WA 4HDOB 1HKUA 1T9GR 1UMCB 121PA 1S2NA 3IRUA 1COZA 2Q5QA 3LA8A 4FS8A 3LD9A 4KRYA 2J07A 1LS6A 4PRLA 5IJ9B 2H92A 4LWQA 1DWQA 1ZMXA 4MO2A 4AY6A 1FUKA 4BP9A 2XQIA 1V35A 1SUEA 3IB3A 1GFWA 2FW8A 2ISQA 1N0HA 1K7EB 3WYNA 1JPNA 2Q49A 3RVBA 4CQMD 4P7FA 4ROSA 3W6ZA 1QKIA 1ZISA 2QSZA 3LT2A 3ADPA 3OX3A 2MU1A 4CCAA 3DAOA 3VZQA 1XTPA 5I8PA 3MJCA 1QANA 3IJ5A 3TLGB 3COSA 3ZE2B 2VFAA 4UPEA 1O87A 4FIDA 3G82C 1NTRA 3CRQA 4B4VA 4I55A 2WD8A 4DWWA 4EL5A 1P75A 3E7WA 3F3KA 2QV7A 3LDGA 1I0ZA 4OVKA 1DG9A 4LOJA 4R4JA 5AI5A 1MEEA 3AYXB 4DWJA 1E2EA 1U1DA 4TVSA 1I94B 3RODA 2XECA 5BOSA 4D9HA 1HRDA 2W90A 2XZTA 3AEUB 1ZESA 3E9YA 1GM5A 1K06A 3V4SA 2ZSBA 2Q3LA 1G63A 3GRRA 2E4YA 4M46A 4R8LA 3TLMA 3OCZA 3T99A 1YSCA 1CEXA 1NE2A 1SC3A 3N76A 3H65A 3NLLA 1DEHA 3Q3VA 1JA1A 1YHNA 4MWDA 4PFQA 2Z08A 2HSDA 1VSUA 2D13A 4JJ8A 1NQ5A 3I2GA 5CT9A 3KQHA 4RMJA 2JS7A 3LWNA 3I1FA 1AA6A 2J6IA 4MJ3A 1Q77A 4K6CA 3VR4A 1A8QA 4BLSA 3MCVA 4DV1B 4X44A 5EESA 5EINA 1HYBA 2FPIB 1P91A 5KNCD 3VGJA 3F96A 4QOHA 3V2IA 4O8CA 4BFLA 2XPCA 1ZLXA 3COJA 4OQMA 1GUFA 1U0SY 4AKHA 1UPXA 3REOA 2WFMA 4UUPA 1U9JA 3RDPA 3QSYA 1V6CA 4XWGA 1Z7BA 1UM8A 5T4HA 3V1TC 4V2UA 2SKCA 1L4KA 4BNUA 4L73A 1D2MA 1V0JA 1W1IA 3IDQA 4OFBA 3MWEB 5IUKC 2ODWA 1GQOA 1SEVA 3WZMA 1ZHFA 5GJBA 2DWOA 4ZEVA 3VH4A 4KOAA 2I4LA 3LBHA 3R40A 3I39X 4GC9A 1CR1A 2FZKA 4C2AA 4CEJB 2ZYRA 3UJNA 4HPXB 2NPIA 3NHAA 4Z8XA 3QVTA 2GSWA 4R81A 4UMDA 2V9PA 3UCFA 3JVDA 1QTIA 1B74A 4Y9DA 3R9IA 4CLXA 5AVYA 2R96A 4ZOLF 4O4LA 5BYAA 4O4HF 1I13A 2EKQA 3UNXA 1YUNA 3WAGA 2CYCA 3UWOA 2J4FA 4A8JC 2KBFA 3JQCA 3KHSA 5HKBA 1JQDA 4CE6A 4OBBA 1ZR4A 4H6WA 2W2NA 2V3CC 1KEVA 3LSYA 4IH1A 4WUVA 1JSXA 2ICAA 3LZCA 5EXDA 4BECA 1TA9A 2D3TA 3RVLA 4B3CA 3DWFA 4YCSA 5JYCA 3L0DA 5E6RB 3C5CA 3PJGA 1JTEA 1T3LA 2Z56A 1WEHA 2ZB3A 3HV2A 3UJHA 4CTNA 5KBYA 2JAWA 2J3LA 4KW7A 5AW7A 1SC4A 5JH7A 1ZEJA 4ZAXA 5HG0A 1GUDA 1K92A 3ILSA 4RJKA 4C3ZA 3PQ5A 4MS4B 2LIVA 1VB5A 3D4NA 5JXWA 4MWTA 1N2CA 3QOWA 4IBOA 1H5QA 4GICA 2IHNA 4QQ8A 1E2KA 3ZWAA 4C08A 2E7ZA 4UKDA 3L3BA 4H7IA 2GCIA 1A50B 3JATA 2W2OA 1C4XA 1F2TB 3OWXA 4D9BA 4YYEA 1VLVA 3TR5A 4YR7A 5ALGA 4H08A 3LL4A 2AI1A 3JWPA 3S7TA 3NTQA 4MV6A 4XVQA 2FP3A 3DBIA 1KVSA 4GR4A 4BX9A 2NXEA 2EWVA 5KSYA 3RM3A 1CC1S 1EDOA 1JF8A 3D7KA 5IMBA 4X3CA 3SZRA 3T9FA 1RLMA 1Z0JA 1ZW6A 4YMSA 1X8KA 4CEIA 2AWNA 1WHTB 3S81A 4EFLA 3MJTA 3SOPA 1OROA 4BN4A 3A32A 1Q74A 5CNKA 3HP7A 4JB2A 4BLOA 1PWEA 1UXIA 3PNOA 1E0JA 1E1CA 2OBNA 1JJ7A 1SG9A 5IAGA 1Z45A 3SKYA 4M0UA 3LKVA 4R1NA 5CW2A 3HXOA 3K32A 5DM70 5AVRA 1U0TA 2FOLA 4PYJA 4B2PA 4Q16A 3FR8A 3ZLBA 2POCA 1JVSA 4JBLA 1NDUA 4FJ1A 3TLCA 1A9QA 1IQRA 2H7XA 3U48A 2XA9A 5AOCA 2JI4A 4IEFB 1IZ8A 1RQ2A 2PRJA 4Q1BA 1BE6A 1KR2A 3E2IA 3OEHD 5FI3A 5KYXB 4PQEA 3WGTA 3EIEA 2A0FA 3KR0A 1WTAA 2BELA 2DR0A 2MSLA 2VUSA 4LXGA 4MIEA 5ALWA 1PE0A 1NGSA 2CZGA 5A5FA 5CCBA 3X1ZA 3R3UA 1A8PA 1BGXT 4W6QA 2AVNA 4LDAA 4LZWA 4XCVA 2QD4A 4O2BA 3RRBA 2Z2YA 3O0TA 3G7UA 2UUCB 3DS8A 3FDIA 2QRMA 3ICPA 3RPEA 4YFYA 3R4CA 1AQIA 5BNFA 3ZH9B 4JXZA 2I2CA 3DVSX 4GI3A 3RK4A 1OI2A 5LJLA 3ZW9A 1VSTA 3O94A 4PZDA 3QI7A 4M2LA 1XVLA 1C9KA 3D64A 4IGKA 4X62B 2Y1EA 4WXPA 1TU3A 2GK4A 3Q1KA 2IGTA 3P9RA 4LYHA 4PC7A 4UHJA 5GJWC 3BX1A 1WNFA 2FX2A 2NUTB 4F2HA 4DG9A 3O2SB 4AP9A 1IG3A 1USWA 2GK6A 2VNAA 4MEAA 4XWYA 1DI0A 2X2FA 5AUPB 1USIA 5EXSA 3VHQA 4YDSA 5DFAA 3TECE 1JSZA 5FTMA 3QKRB 5K4AA 4R05A 1VYUA 4QGAA 5AK6A 4F46A 2G88A 5T57A 2PU7A 4EHIA 2D2FA 4EO7A 4P08A 5ALMA 5G0WA 4YUXA 3WLEA 4POOA 2DSTA 4Y1EA 5KEIA 3GNSA 4JDUA 4RHCA 1W88A 1QTQA 3FCOA 4AZ3A 3O4HA 5LMNB 3K35A 1LI5A 2PZMA 4LJSA 1RBQA 4QJIA 4D45A 1GSIA 1SU6A 4HQOA 4I50F 4JBIA 3QELB 1K4MA 4F3KA 4YCLA 1L7VC 2ODNA 4K3UA 4MW2A 2FZ5A 5M5BA 1EIZA 5JDCA 1H4QA 4KO3S 3L4BC 1T2AA 1IATA 2YJ6A 1U02A 1WMEA 5E6SB 3SP1A 2XDWA 1YR1A 1IK4A 2JFNA 3D9QX 1DP4A 3DOUA 3TFWA 2YJTD 3NWEA 2B8JA 2VH5R 3C6MA 4V3BA 1IM2A 5FKJA 5AW3A 5G1NA 3H8JA 4YCDA 3DMRA 5EIFA 1ZXBA 4BCBA 1EHCA 1HR0B 3EF1A 2B30A 2EFCB 4YI3A 3KT6A 4AECA 4DF3A 3GXOA 1R5JA 5LQSA 3OCYA 3PDCA 1GPUA 4DC9A 1NQXA 4QDZA 1I51A 4QPCA 2R65A 1P1HA 2IYXA 2WMOB 3ZDFA 4EA8A 4CKWA 3T0IA 2GCOA 3K9CA 1XD2B 3FFBA 3BTVA 2QPAA 1KYXA 3LFHA 3RVSA 3ABZA 2CVHA 2J59A 4ALLA 4DANA 4DMLA 2P9HA 3BH7A 5CGQB 4ZDKA 5CB0A 4JA2A 1AQLA 2GEJA 2J5BA 4M9QA 4QUGA 4RVFA 4ZREA 2IIVA 5JJIA 3AI1A 3SVLA 3F90A 2C31A 1PW5A 3OKAA 4F86A 1O95D 4LVUA 5EP3A 4XASA 4ETNA 3FLAA 1FRFS 3N7UA 3NYRA 1OLXB 2VJKA 2QTZA 3MLAA 1NNI1 4IHQA 3R75A 2XE4A 3D3NA 3DLIA 3G0OA 4DBLE 5DX8A 5SY9A 3U4QB 4HWKA 5A71A 2X3FA 4F21A 1AH2A 4G8DA 2Q45A 1SXJB 3L0SA 4MVJA 4RFLA 1JS1X 4N65A 1E5TA 4O02B 4FQ7A 3HVJA 1NN1A 5IG2A 3TQRA 2HDOA 5CA1A 1KU0A 4H16A 1VL1A 2VWGA 1XWWA 1VBKA 2FXVA 4XR4A 3UKJA 5KC9A 4RHEA 1R88A 1MMFB 1QAMA 4G5QA 4MUJA 5A06A 3ELYA 2X8WA 2XVZA 4QOEA 1LLFA 4U3JA 2YHAA 5GGXA 4ZEOA 1XLVA 4DCPA 1V95A 2R11A 1I6WA 4MR8B 3GT3A 3OF3A 1NMSA 3RW9A 2PKEA 2PV0A 1X9GA 2CHGA 3HKDA 3IT2A 4OJTA 4XR9A 2F4VB 2BCGY 2ZKLA 2ODEA 2P5YA 1M6NA 3H9BA 1KWGA 1DXYA 1NSFA 2HHLA 2J0VA 4YUWA 5I4BA 1R0CA 1N32B 3HB9A 1Z2EA 1Z5ZA 5ECWA 3RT7A 4B6GA 5FORA 3ZWQA 1UMDA 1ZL2A 4HB3A 4LYFA 1Z47A 3KKNA 2ILTA 1XQWA 4ZARA 4QLAA 1UT6A 2ZE5A 4QICA 2I7VA 5JBIA 2XKJE 1DAMA 4MCIA 5JI2E 2DBQA 3ESBA 3VUEA 1ZJWA 4ATNA 1UM9A 3HRKA 3PYLA 3E3OA 3T3NA 1TCBA 3A7EA 3MQFA 3L9WA 5JLAA 4DIFA 3FHTA 4MUBA 1FEZA 1V1RA 3LECA 1BNCA 3DAGA 1YDWA 1PT6A 1UKCA 3LQYA 1YDGA 1J0BA 2G4CA 4PONA 4DE5A 2CW5A 1WCXA 1C0KA 1PGOA 1TUEA 3IGFA 1DJNA 2NO6A 2Y93A 3CR8A 4UFNA 1VZ2A 5IASA 5JNUA 4DZTA 3HYLA 3ZVKA 1EFPA 1B0AA 1JPUA 2PZBA 4P3OA 2AMYA 1GRVA 5AKJA 1S3SA 2CVOA 1E3IA 3TLXA 1X1RA 2HRQA 4EGFA 1TA4A 3WTBA 3QE3A 4DLUA 5AM0A 3NAZA 1IHOA 2MSKA 4F85A 3L01A 4DQKA 1CJBA 3C98A 3FPHA 2BHRA 4IG9A 4B4WA 1KHTA 3CW9A 3O03A 1SVLA 2LKDA 3KO8A 5TV2A 2D06A 2I3GA 2J41A 3FRJA 4Q4DA 2BFBB 1VP9A 2EFHB 1ENOA 4UNPA 2XQKA 3PPYA 4H59A 4IGAA 1HLFA 2QLNA 4IJ5A 4C6SA 1GTRA 1NPDA 1YO6A 2BMVA 1RYEA 2I2XB 2Z04A 1EDEA 3BGWA 5C3MA 5D2CA 3U4CA 5JH7B 1CY7A 1T5OA 3MSCA 1RKUA 4Z9AA 4HPJB 4TRJA 3MELA 4NR0A 1F2UB 5AKEA 3ZVLA 5A4DA 1RQNA 1E3EA 2EHDA 1NXSA 1HFWA 1E7MA 2YYYA 2C3OA 3FF4A 1FDRA 1HL7A 3BA1A 2NV0A 3NJ8A 5LXTF 4DN6A 2PG3A 4TXMA 2ALJA 5LYJA 2NNWB 4M4SA 1RXUA 2IE8A 1L4LA 5FHQA 3UTCA 5K0TA 1RTKA 1K4KA 1WZNA 1XTZA 1Y1LA 1NBIA 2GF0A 5LQJA 1GKUB 4FOOA 1U8XX 1QIGA 3EULA 4WZBB 3V6MA 1EXVA 4BGVA 1NN5A 4N76A 2ZRDA 4WN9B 4J4BA 2BF7A 5A03A 3LW8A 4UBKA 4ZCRA 2BMFA 4HNTA 1MV8A 2GN1A 1M0EA 4ZJYA 4BKRA 4G01B 5DT2A 4ERNA 4ODIA 4FNAA 1HYEA 4N40A 3GJTA 2YJGA 4RSHA 1ZD8A 1DCTA 1REQA 2JCBA 2QD5A 3PR1A 2I71A 2WABA 3AZOA 1LV8A 1M6WA 4K9PA 1RE0A 1DAGA 2CD7A 4IEEA 1OE0A 2BUBA 4K6FA 4ZVVA 4BLPA 3TRHA 3IBYA 4RK0A 3NO4A 3UA4A 1N9ZA 2VWHA 2Z1NA 1NVEA 1QZZA 3ICCA 3Q7TA 1C4KA 2O2GA 1E77A 5SV2A 1XF1A 1XCPA 2J9XB 2I9KA 5HCNA 3ZXUB 1IOLA 2EL9A 2NU6A 1I2BA 2JIMA 2PQ2A 3GFFA 3O1JC 4LNUA 4R84A 1VIVA 4N3GA 2D74A 1X94A 2GBCA 3BB1A 3DCYA 3KEFA 4AG5A 1SHKA 3T1VA 3DHNA 2ZZNA 2D7CA 1MQAA 1DKOA 3V2UA 5BYKA 5HBRA 1TT5B 2WJVA 1AX9A 4DSUA 4QE3A 2ZRLA 3A3KA 4BC0A 3F5QA 1UUFA 4IWYA 4NTZA 5FA8A 3Q3CA 2WUFA 3T61A 3WLNA 4G4SO 4IP0A 4R2LA 4ZQGA 1Z4OA 3DB2A 4X6YA 3ZE9A 3X0DA 5JAIA 3QJYA 1WPXA 1Z6GA 1K9VF 3BZWA 2V7TA 2Y0DA 4Z99A 1RZRA 1YVEI 1A96A 2QJWA 2K2WA 1SUWA 2X15A 3KJNA 2IUYA 3MCTA 4MYRA 5PGMA 3RE1A 3UPDA 1YRYE 2P6RA 2GFQA 4YRLA 3MJSA 4I2VA 1CZOA 3TFQA 5EWMB 1E4VA 3TSOA 1E8MA 3FYUC 3NOQA 3K09A 3CRVA 1NP7A 1Q7GA 3VR2A 1WCV1 2NXCA 1YCHA 3FPAA 3DL4A 3LI2A 4Q15A 3RREA 2IDMA 5K01A 3DZGA 4QRIA 4EG6A 1P0CA 1VDZA 2HEIA 3M81A 1R4MB 3RVJA 2Q0XA 2DBZA 4X90A 4ZYVA 1N5KA 1QHYA 3I05A 1FJGB 1Y7IA 4QUBA 1AF4A 2ZJ8A 3PWSA 3AG5A 1UJ2A 5BSKA 1W0JA 2D0IA 4RA6B 3G23A 3RU7A 4YDRA 1PF7E 1QIKA 4OQFA 5KO2A 2AJCA 2FQQA 2YIVX 4G67A 4RACA 5BR4A 1BJTA 1FX0A 1SUFA 2EZTA 1F4LA 1PR3A 2E49A 2ZI7A 3WIEA 4RULA 2AR7A 2AQ8A 2QLMA 1OYOA 1CT9A 1H2WA 4CFZA 1KRXA 5KTMA 2FRDA 2PYDA 3ED5A 3E1GA 3GLQA 4M38A 4NEHB 1KOGA 1LQUA 2P9QA 1XEXA 5FUMA 1KWKA 5AHXA 1LI4A 3GLRA 5CP8A 3IUYA 4HWGA 4HDMA 2RAFA 1T4BA 4LQLA 1I2MA 1M0SA 2H51A 3F4KA 3IV9A 5IDXA 2XKKA 4CCYA 1Y8AA 1TM7E 2V8OA 3OJ0A 1P2BA 2YJ3A 4MVXA 4ZKEA 4RTRA 1O9BA 1D9ZA 3KOWA 4MUMA 4DL9A 1FFXB 1XU9A 2BGLA 1U8CB 1KSHA 3NKLA 4I99A 5CXXA 5JSUA 4RK6A 5FV4A 3SJUA 1KZ6A 3QXHA 4Z4EA 1OXKB 5JHHB 2YS6A 4IFBA 3LPLA 2O8EB 3T5BA 3I4LA 4MR7B 1H9BA 3DOFA 1A2KC 2I03A 4MA0A 3I2YX 1KKLA 3ND7A 1QQ6A 5HEKA 1XZIA 3WQBA 4DIOA 4NE2A 3WL8A 3DVLA 3E8MA 3WLTA 5BSFA 2BVNA 1J21A 1Q2UA 4H7KA 3CCFA 4YUYA 1A2OA 4FK8A 3L1VA 1MZPA 1NTOA 5FX2A 1EEXB 4F0JA 1GZ3A 1SIBE 1EX9A 1S2MA 2JFOA 2RGCA 3AW9A 3EB9A 4YGYA 2YBEA 1PTJC 3H16A 2X0IA 2X6QA 3PXGA 2VJOA 1XRRA 5K05A 5DMXA 2XTMA 2B20A 4IVNA 2WEKA 4OI2A 1UH5A 3WYAA 3AU9A 5FBHA 5JZMA 5IVDA 3O8CA 2HSJA 4UTOA 2IQIA 3PF8A 1VFNA 1S1MA 3C8DA 2DCMA 4RZHA 3HVHA 1M34A 1KZHA 1MX9A 2HA6A 4XIIA 2CLEB 1E59A 2QTVB 3BTOA 3Q7PA 2PUEA 5D3MA 1XRNA 1FSZA 1NWCA 2XMRA 1A71A 4JUDX 4AJIA 4IHKA 2RI1A 4ARCA 3THWB 1A8UA 1QFXA 5THQA 4BNXA 4EVIA 4OP2A 2AHOA 5FBZA 4PIPA 2IE0A 3GGOA 2GJKA 2YQZA 4EGJA 3HBLA 3R0IA 1WBJB 4BP8A 1KEUA 1ZSNA 2IT1A 1HURA 4PINA 2OXIA 1F6BA 2AEMA 3I2JA 2W9XA 4DEXA 5BNZA 4FQ5A 4URHA 4RZUA 1G3UA 3N8DA 3PHIA 2P65A 2ZI3A 1Z0SA 2NO4A 4LRQA 4QPJC 3TD6A 1ZOLA 4B47A 4X7RA 4BC1A 1D2AA 2QMUA 3EA0A 3OZIA 2QVBA 4C0BA 3CZCA 2IPLA 3QXGA 3HA5A 4IJ6A 1ICIA 3TAUA 3EVZA 4CQMA 2R7AA 1SOUA 4UZFA 1NN3A 5ALLA 4A0RA 5IAOA 2QM7A 3JSAA 4LSWA 5FOWA 5JXJA 1TECE 1TRKA 2PUCA 1WXWA 3GAMA 3I30X 1RYBA 2BM8A 1DKMA 3GPIA 4K6OA 3W4KA 1S5PA 2GD0A 2A58A 1LPSA 3COVA 4D0GA 5HKOA 4XZ3A 5CDFA 2ZR8A 4XJXA 4BLTA 3ICWA 1VCMA 2FWAA 3WJ2A 5F77A 3DPSA 4MDHA 2QNIA 2QD2A 1G17A 2PZJA 4UBOA 4D3YA 1ZQ1A 4ZRDA 1Y81A 3P45A 4DLVA 2CY0A 2YCLA 2OQRA 4UM5A 3EXG2 2CMFA 3GFBA 2AS0A 2O2ZA 1U81A 1K6XA 4LMPA 1OW3B 4HB0A 3OUUA 4TYQA 3VYRB 3VPDA 5E1BA 4FYMA 3M2PA 2C5BA 3OTGA 2QUJA 3FWKA 1JR2A 1XZ8A 4XM0A 3T3HA 2WWFA 2IEBA 4YRKA 4OFZA 2R6GA 2PRSA 4PG7A 2XCRB 5GIPE 2ZIGA 5DTJA 1QH8A 4YO8A 1H4TA 2WHRA 2B78A 1CPYA 1UBCA 3F2VA 2ZTSA 2O6LA 1EFLA 2XAAA 3M6UA 5FA6A 1W36D 5FV7A 3JTEA 1IVSA 1DLJA 1HMYA 1T3SA 4I9NA 1JB9A 1U7XA 1EFDN 2PXXA 1M2HA 5KNCA 3O8QA 1SY7A 1B0UA 1UKBA 5DPMA 4P54A 5FLXA 1NXPA 1OGYA 3OU2A 3CRRA 5HKAA 2Y4NA 1VSBA 4N49A 2GD2A 3HCOA 1GRNA 2I1LA 4J16A 1UMKA 4XE5A 3W3ZB 4D9GA 1S2LA 3HR4A 1R0XA 5DBGA 5D7NA 1LVUA 4CN8A 3P96A 3ONNA 4LJKA 3HFJA 4IM7A 3VPAA 3S0JA 1GEGA 4KR3A 4LBYA 1GPWB 1Z6YA 2G5PA 3QHPA 4U2FA 4U8GA 1HGXA 2W83A 1V8BA 3KXDA 4OAOA 2IODA 3IPXA 1JR3D 4BO2A 5I45A 1LKZA 1NJ1A 4ZPXA 4CKEB 3BMOA 1PQ4A 4CW7A 1CUEA 2X86A 4FLEA 4PY2A 5AHKA 4OI4A 4W4TA 3KTAA 3GLSA 1EWKA 4CHTA 5HW0A 1FIUA 1ID8A 3WLLA 2XA1A 2IXFA 4JQYA 2CNWD 3MF4A 2N1BA 1H1TA 1YRAA 4R1SA 2G63A 2D5AA 1DB3A 3EQ8A 4KR6A 3QBEA 2W93A 1JX6A 2NU7A 2A9JA 2C82A 3N6XA 3GNTA 3PEVA 3DM9B 4X8HA 4KXVA 3G2OA 2EFDB 2FUKA 3WC4A 1UAYA 2MDTA 4HJXA 3DR3A 4QO8A 1R6XA 1Z18A 2XTZA 4BLWA 5JCXA 4RPJA 3HGTA 5ERXA 4H1UA 4N9QA 1AG9A 3F47A 2J48A 3SKVA 5I7HA 1J90A 3MQ2A 3NBQA 4IOMA 4RYLA 5JJKA 1WUJS 2B0JA 4CIYA 1SCDA 1JFTA 1HK7A 3FG9A 4FYVA 1DDIA 3U62A 4FZVA 5B7GA 4ID9A 4J3NA 1ULHA 3WGZA 1PJ2A 3T38A 4AN4A 4KFSA 4XGRA 5CG2A 2J3IA 1G20A 2WG2A 4JUCA 4FD2A 4QULA 1P0MA 1TEXA 2H4FA 2ZIXA 5DM1A 2PA3A 4Q3DA 2PJZA 4BMYA 1TE2A 4NQZA 4FB5A 4RD1A 3WZLA 3A10A 2HO5A 5G4LA 3NW9A 4GOMD 1NRWA 2C3UA 3C3KA 3B6JA 1HWYA 4EG0A 2D00A 4YHHB 4WVFA 3DF7A 1EFAA 1NL3A 1QGDA 4WTOA 4R2KA 4ZYXA 1Q6YA 5FOSA 4UM9D 3TZLA 3GFVA 3UOAB 2D7JA 1QG6A 3S2EA 3KSDO 4F5DA 1OH6A 2ZDQA 4TRNA 2IUFA 5FPPA 1DQSA 5CT5A 1ZSVA 3DQQA 5JTUA 3KAPA 2ZE7A 2ZJBA 2ZBDA 4DQVA 2J5KA 4BNHA 2JEOA 2NZVG 3DTTA 1EP1B 2XNJA 3GQBB 4QXOA 5E8JA 3KFLA 1ISSA 3IUBA 3KQKA 3BK1A 1ZUNA 3ZD7A 3GEIA 4TWIA 5A2GA 3A31A 3K73O 5CYGA 4FEGA 1G8HA 4Y6OA 2EFJA 4UTRA 2CVZA 3O95A 1SVNA 2ID8A 2VSXA 4LZJA 2ORED 2GKSA 3JWEA 2NU9A 4I8IA 5EHNA 4FT2A 3VU9A 5U1PA 3PKZA 4IX9A 1QKJA 5CFRA 3IKVA 1Z4PX 4BVLA 2MHCA 5JJCA 3OEHA 3DUWA 1YKSA 3SQLA 3JQ6A 2R85A 3A8TA 4AG3A 2PRIA 4JLOA 1LDEA 1QH1A 3AH8A 1AS3A 2SCUA 4JQCA 3RS0A 3QQPA 2P2SA 3A0RB 1PJRA 3CS3A 421PA 3OIYA 2Z1DA 1CX9B 1SQGA 3F6YA 3MTIA 3BE4A 4AM8A 3WKAA 2FI1A 3OOEA 4H0NA 4QYSA 3GR6A 5I7EA 4MWBA 1W7AA 3BN3A 1HLGA 2K5UA 2MTBA 2P78A 1RBMA 3GEGA 3M9XA 5IT0A 2BGRA 2JGKA 3QSGA 4UDNA 1EUCA 1CR0A 1KPIA 2AT1A 4TOIA 3M6MD 4YECA 1QTRA 3C5EA 4YRZA 2RH4A 2E2WA 4Z9XA 3SX2A 4OHYA 1K98A 4EJSA 5DF1A 3T4XA 821PA 1IN7A 3LK6A 3ZV6A 5I7WA 2FRVA 3IKLA 1Z4JA 2J0EA 1D7OA 1GA4A 2V5VA 4FGUA 3HXQA 3CLRC 4WCFA 1A0OA 3HDGA 4LIPD 4J76A 3ZK8A 4Q6WA 1E60A 3CVOA 5EAIA 1FFYA 5DXFA 4L27A 1RC1A 4ZWNA 1I4DD 3VHRA 3GX1A 1KSFX 1QUFA 3Q3EA 1ZMOA 4O33A 3JQ8A 5TS3A 2NP6A 4YONB 1JQBA 4O2RA 3QUTA 1Y4SA 2D54A 1WNTA 3P2OA 1WXFA 2Q6VA 3D02A 2J3KA 4OYRA 4LHEA 1I3CA 3QOYA 5DYYA 3ZQ6A 2ZJ5A 2PMCA 3JR7A 1DT5A 1G8PA 3EISA 1WRBA 1KZ4A 2O3TA 1IWBB 1RS0A 3R0QA 5ULLA 2QJTA 3PDWA 1CUDA 3ZCTA 1JBEA 4YRMA 1S96A 4ENQA 8AT1A 3UPTA 4KE9A 1AKNA 3MRTA 1E1NA 3GLGE 3HPRA 2FZLA 2L2QA 3QU4A 3T54A 2B83A 3KR2A 1ESCA 5CT6A 3H5IA 3PUHA 5DGIA 2X8AA 3KK0A 3ECAA 3Q9UA 3ULKA 2D2EA 4NG5A 5ECYA 2AVDA 4UD6A 1SCIA 5E9WA 2ZREA 1JFVA 4X60A 2OO5C 3RYCA 4PLCA 4H7FA 5K6AC 2CMDA 2QX7A 1RQRA 2O7RA 4PSKA 2PT7A 2AH5A 2ISCA 2BYTA 4QDJA 4E6EA 5EWLB 3FROA 4R31A 3HWX1 3R5KA 4MEJA 5T41A 4BYGA 1BHO1 2QL6A 5AW4A 3ZNPA 2DY0A 5LIRA 3RTCA 3BERA 3AFMA 5F7ZA 4F96A 1QPGA 4KQJA 1T4CB 4LF9B 3EIHA 1YTLA 1CF9A 1CJTC 1MX5A 2AWOA 2XVYA 3FUTA 3PGJA 3ZJ5A 3IPAA 4P5DA 2YCBA 2GZDA 2WHXA 1J70A 4BMSA 1O95A 1C7ZA 2VPXA 3FYDA 4LXHA 3B51X 4K1XA 3QP9A 5FWDA 5IAAA 3NHKA 5A5EA 1A82A 4UCWA 1R15A 4WVLA 3DFUA 1ZYUA 3FPCA 1QGAA 3L6RA 4V0NA 2A5JA 1PNOA 3ITEA 2EATA 4BHTA 4QLOA 5FULA 4KAJA 3VPGA 4L16A 1UBGA 3I6QA 1E4OA 3VTAA 2X23A 3ZWYA 2BIFA 2VDVE 2PDAA 1A27A 1ZVVA 1HFJA 1X9IA 4K8OA 5C5EA 5DT9A 6AT1A 3AUSA 2NIPA 5E6UA 4ZVTA 1D1TA 3VSDA 1DJOA 2WJ4A 4BNNA 2W6NA 2JW5A 4PR0A 2WI8A 1FY2A 3TL6A 2JK1A 2GPWA 2LWIA 3RSSA 3HYRA 5KTNA 5KNBH 1KTVA 3AF4A 2D4HA 2PZFA 5CDGA 1WZCA 1DRKA 1Q7CA 4QT0A 2INGX 2QNBA 3FPBA 5B6IA 4EG8A 1UAAA 1XA0A 2ZRIA 3JYPA 4KDEA 4FYXA 1DADA 4Y6PA 2IYEA 2ZBFA 1GO2A 2EGUA 3TR0A 2M32A 4PRZA 1QWSA 4CT0A 1L4YA 4FZ3A 4ENSA 3GGDA 1G21B 4F9GA 1D4ZA 5BQ3A 1T0UA 5EUCA 3G59A 5B58T 2H1CA 4XIYA 4CF5A 1VG1A 3OETA 1QIDA 3RQSA 3UWMA 3WLPA 3PU6A 1V43A 3MMPA 5H80A 1V3UA 3VAAA 1N6KA 1K86A 2YXEA 3ETJA 3KAQA 2G28A 5EJGA 5TXGA 1W4RA 1JHUA 3BFPA 1K89A 3VNSA 3GPLA 1ORRA 2CXSA 1YJ8A 1DGQA 5CLIA 5CCXA 2PMKA 3ZI7A 2R79A 5REQA 2C7RA 5J23A 1VPEA 1MTZA 1P1KA 1EVJA 5F9MA 3LCVB 2C59A 3HACA 3LOPA 4EAQA 5LIPA 1GQQA 4R8SA 2ZUVA 1NX6A 4QRDA 2R8OA 5C7IO 5KJ1A 5D1HA 1O96B 3UVEA 5AXBA 3OZ7A 3PTZA 2W37A 1G7SA 4KBFA 4EKIA 4YTEA 5FBLB 4C06A 4B8ZA 3QU7A 4KU4A 2PT9A 4CKXA 3L4SO 3ZIDA 3EVDA 3KDSE 4X63A 1NI5A 521PA 5K8IA 1O7JA 1YHYA 1F3LA 4C4XA 3HM9A 5DH9A 1J00A 2PX4A 3DEKA 1PR0A 5BR1A 3C6XA 4J91A 4D43A 1XZBA 4DV7B 2WU1A 1JDBC 3A4VA 5TC4A 1YOBA 2O59A 4GAEA 1ACJA 2YASA 5ALTA 1OYWA 1NMYA 1ZGCA 2O2XA 2NMVA 3L4JA 1JN0A 2C2YA 1KMQA 1I7QB 2E55A 2FK8A 2CLOB 1KKMA 5TPZD 1B43A 3B5IA 4EA9A 3GA0A 2Q99A 3F2IA 5C34B 1B73A 2DG2A 2JG3A 4KXUA 2BPOA 2Y3IA 4JR2A 1E7QA 2JHFA 1WUIS 2J9YB 1WQ3A 2IXBA 3FDZA 4YP6A 3PYXA 1NKTA 2BTQA 2H52A 4WFIA 3UK0A 3T4EA 7MHTA 4X8LA 1E94E 2VDPB 3E7FA 3O84A 1YFZA 2WT9A 3HCFA 1JU9A 2OZKA 2BUAA 3D8TA 2IGBA 2GPYA 1D4FA 2PUBA 3ESQA 3OOWA 3L8ZA 2JLUA 1JXQA 3AHEA 3RYFB 2I7TA 4DLWA 3L7KA 7MDHA 3ZDCA 1VG9B 1GV0A 3PFWO 2ZZMA 2PS1A 1FNNA 4QYIB 4AG6A 4XA8A 4MUNA 2PKCA 1XPOA 3T52A 1BOFA 1V1JA 3V46A 1D2CA 4K87A 4ND8A 2NAFA 3MCWA 4ENPA 1D6NA 4MUGA 1R0WA 1T0HB 1JHPA 2CXOA 4KZKA 4GEKA 3DKKA 2EP5A 2J0QA 1HE4A 1RQXA 4MJ7A 2J3EA 3WWDA 1ECGA 4I9FA 4L5BA 5BN1A 3DZBA 2FJUA 1EVQA 4D4MA 1USKA 4WNCA 4YO7A 1WKBA 2P9BA 3NR2A 4PS1A 4QGHA 3WMXA 2HCFA 4MZDA 1ODJA 1C0IA 2C0CA 2WOJA 3E2PA 2WWXA 3EC2A 4DCSA 4YT5A 3B2NA 4FEYA 4QL3A 4AJKA 5FWYA 4DTCA 2GM4A 4E03A 4HN9A 3U7QB 1JG7A 3SQXA 1WABA 3KWJA 4LPKA 1EXMA 5CA1F 5B7PA 1DQRA 1WW2A 3QLVC 5ENDA 2HNAA 4UPVA 1T6ZA 4W7SA 3P0EA 4JKOA 3SFVA 4F4FA 4NHOA 1PR5A 4PYRA 4AJHA 5LMZA 2IL1A 1VE9A 4MH0R 3KDPA 3NHMA 4OB8A 2OGSA 2BZ1A 4IX1A 4D41A 2EP7A 1U2DC 2QTLA 2ZTVA 2VXBA 4M8SA 3KNZA 1JDZA 4RTQA 2VLIA 2Y1GA 1SQSA 1GPDG 1MENA 1NAIA 2PGAA 4JZYA 1G2IA 3EVFA 3SZLA 1U3WA 2Y0PA 3JQRA 2GYWA 3PHLA 4NRDA 4ZQHA 4CQLA 2CV2A 3F97A 1Z5WA 3AF2A 4BBAA 1G9SA 3IUMA 2NTEA 3CNNA 4LGVA 1JWAB 1VHLA 2BEWA 3RJZA 4EFKA 4NZMA 4MRPA 3AVOA 1BMFD 4QEKA 4F6LA 3P9YA 3CH4B 1GZHB 1R64A 2NXJA 1ZH0A 1XMPA 1XYGA 4OLJA 4QHYA 3VPXA 1ID1A 1RM3A 1W75A 4GT1A 1KO5A 4RJTA 3KBOA 4WBNB 2HT1A 3N53A 2Q3HA 1ZI6A 3TZ6A 1V26A 2BI7A 1AV6A 5JZOA 1H66A 2UXDB 2HL6A 1JXAA 2DUWA 2W2TA 2A5GA 4C2UA 2I6FA 3LP8A 4P98A 3RR2A 2Z3VA 5DHPA 3GPCA 3GJ8A 1XFAA 3LWZA 5BURA 3N05A 3EZLA 4C1BA 1UMBB 4P2GA 4BFTA 2NXNA 2ZYAA 1JLSA 3DE2X 3N2KB 1P4JA 4K03A 4DCOA 4MVYA 2C61A 5GM2A 1Y8QA 3PLAE 1N5DA 1SWVA 3GLKA 1OUMA 3K16A 4OREX 1I24A 4AMGA 4JVSB 2ZRFA 4QSHA 3KVNA 4QM6A 3LNTA 5K3SA 3TNYA 1Z35A 4FOSA 2O8BB 2HTEA 2DP4E 1CYEA 3HWSA 1Z5NA 3RS7A 4ZN6A 1R10A 5FDFA 5LLTA 5LU9A 2P0YA 4C05A 2B4RO 3FPFA 1AMOA 3HCBA 3QE9Y 4CF4A 2H11A 4Y1RB 1K7CA 4EJ0A 3MGCA 3R5JA 3GROA 2CBZA 2F43B 4XDHA 1FBNA 3ER8A 1N0UA 2KJQA 2LNDA 1U8YA 3U7JA 2PAFA 3HNOA 2C2KA 1FFCA 3UGTA 4ESEA 4I46A 2HC9A 2NN3C 3IDSA 4Z7QB 5A02A 3DTNA 4KTTE 3GUVA 4QU8A 3SPXA 3T94A 1THTA 4GXRA 5CH5A 2BJWA 1CZHA 1DRWA 4I8DA 3VNAA 2P68A 3RS2A 4PTZA 3SZGA 4Q9JA 3TDKA 1EUDA 2HD4A 2QTFA 2WJHA 3BHMA 3EARA 5F4ZA 4EAAA 4X8MA 5CIQA 3JWIA 3B78A 3OJEA 3VR5D 1KHHA 3C3PA 3MTAA 2ZT7A 4IKPA 1VHWA 1D2GA 2I87A 4JC5A 1EVIA 4NS1A 3T34A 1DXOA 2J0UB 3HSYA 4KSBA 3UANA 4F12A 5JT1A 2KM1A 4FN4A 3CEJA 2J08A 3U1TA 1USGA 5LYJF 4R5HA 4JA0A 1Z29A 2GS9A 1DIAA 4YJ3A 5L45A 4LA4A 1GU1A 1JJFA 3B5EA 5C1DA 2A0UA 4C87A 1U2GA 2Q8NA 2YVKA 5A7GA 4F7DA 1MG5A 1US8A 2EL7A 2ZSAA 4RZXA 1QBGA 3ZGXA 3LA6A 3QEOA 2ZYVX 4EPWA 3G2KA 3T3PB 3EGXB 5AKXA 4CNBA 2IZ1A 4ENWA 4X91A 4HVTA 2I4TA 1P19A 4CRWB 4YY3B 2JIRA 4MYHA 4BE9A 1E8DA 3KOUA 3VR4H 4RTNA 3C87A 4MUIA 1QDLB 3BF7A 3I45A 3QEBZ 1NR1A 2XUOA 3WLRA 2GYYA 3RUIA 1GT91 2ZYUX 4NCHA 3C5WP 3K4HA 3I37X 4LRTB 3AP1A 1C30A 1PK7A 3LVRE 4PX5A 3O3MB 1VM6A 5GV7A 3C3YA 4J7UA 3BCSA 4X41A 4CG0A 2P8SA 4E5DA 4RH1A 3CUKA 1GFSA 3N2GB 5TS2A 1RC8A 1V4BA 1PUIA 1TYDE 3PUKA 2C3YA 4GX5A 4RVSA 5FBRB 4ZI7A 4UQLA 4BQQA 2J3DA 5E3IA 1WUYA 3UMRA 2YQ5A 4KR9A 1HSZA 1ILWA 3CEAA 4H31A 4X3PA 3EODA 1P9RA 1Q19A 4MWCA 5DHSA 2CJFA 1RRCA 2V7EA 1PJAA 5F7OA 1U5AA 5C9ZA 5JS8A 2J7KA 3LY5A 4KO1S 5FUVA 2JLWA 1HDGO 2HU5A 3A28A 4RHFA 5F51A 3U3MA 1T2NA 2G08A 2YFYA 3AF0A 2XOXA 3PDUA 4N47A 5YASA 2IXEA 1QP4A 4OXKA 3M3DA 2G0AA 1SA0B 2Z2KA 2C00A 1ZD4A 3C85A 1SQFA 3ETCA 4BVGA 1RAHA 1YJBA 3JZIA 4ZKDA 2QAJA 1KK1A 4EFDA 2FPOA 4MRAA 2HJ9A 3A6EA 3ETEA 4A8TA 3AEUA 2O50A 5LD2B 3W8DA 3HDTA 3FOEC 3DDHA 3GEEA 4KH0A 1VBNA 2Q9CA 4JOCA 3N9IA 2FX3A 4J0KA 1HDZA 5ICCA 1RIFA 2AK2A 3CU5A 2YX1A 4D4GA 2FWNA 4RFSB 2IKSA 2CBGA 3K9BA 2PX6A 4D8UA 2VN8A 1T13A 4Q7QA 2AJDA 2R6JA 5KQSA 3OIVA 3UXMA 1ZCZA 3K71B 3WRWA 3TOVA 1B76A 2CDCA 1RXYA 1S1CA 1VYVA 2I1WA 4IJUA 4L8YA 3PA8A 5B1SA 4DNFA 4LCEA 5IVPA 2JLYA 2AN5A 5CFPA 5LMUB 3I6ZA 1Q0PA 3VU8A 4Z4HA 2VDNB 1FSGA 3NGLA 4KR0A 4MS1B 4D9NA 2FPIA 4K9RA 3GMSA 4NZNA 2ZUFA 1ZWKA 2M98A 2R5WA 4W5WA 1TFUA 1Z4KA 4I0WB 2H2GA 1EXDA 1C7QA 2R7MA 5TQ0B 3RLIA 1TYAE 5HKLA 3AOEA 5GONF 2D62A 4UBLA 4ZCSA 1WE2A 2RHGB 1YQGA 3BE8A 3EC1A 2TYSB 1YQ9A 1E2NA 1M6VB 4N0MA 1GHTA 4GOKA 4QTUB 1RRFA 4NOMA 2QYOA 1RRMA 3O0DA 3SU8A 5MN6A 1KETA 2JPDA 3QX9A 1NVUQ 3GDWA 4REMA 1SXPA 3TPFA 5KYUB 4ZO8A 2C92A 1E2GA 4QECA 4Q19A 1AU9A 3KD3A 3QVUA 4EUSA 5BUSA 5EE1A 5LZ8A 4HAZA 5CHYA 3OMWA 3LFTA 1FYWA 2QL5A 4MQBA 2DHEA 4KGVA 4U0JA 4Y18A 4YRGA 2HRBA 2W48A 4A0HA 4RS3A 4ZPJA 4WESA 3L1JA 3NIDB 1XU4A 4NBUA 3RUDA 3EGIA 1I6LA 2UZ3A 4XX0A 2FN3A 4P36A 1XKTA 2BEKA 2RB5A 1JR3A 3KZXA 4GPBA 1PSDA 4RTPA 2I54A 1N6LA 1LBSA 4N6NA 4TLBA 3RYHA 5E2AA 1V3VA 3K3PA 3TMAA 4X61A 5H02A 3HJGA 2D59A 5KVAA 4L7QA 4IDAA 4Y0AA 1G55A 1DQYA 1MVOA 1GPNA 2CNWA 3QLJA 4EI9A 1A7AA 1JECA 1WY5A 1VKHA 2VS1A 2CDRA 3RJTA 1SRQA 3G3EA 1RLJA 1XTIA 3AO0B 2C9ZA 3ZJYA 4FWTA 2LBPA 1ZVJA 5ALJA 2V65A 1BGWA 2QRHA 1YI0A 3QF4B 4OA8A 3TLAA 3MRVA 2PL9A 3ANXA 3G17A 3NQ41 4COOA 2FA9A 3OD1A 3V9AA 1MP0A 1P1IA 1VCOA 2P67A 2FQWA 4CODB 3P4UA 4ND3A 4JT8A 3THYA 4EHJA 1TUIA 4D57A 4TYNA 4F4UA 3ONDA 4BX2A 5G4KB 5FIUA 1B6SA 4UHFA 1ABEA 1I36A 1IBSA 1XRLA 3RC3A 2DQKA 2HXGA 3BWDD 1VMEA 2ET6A 2I4NA 4FMCF 1ABBA 3W7BA 1ZVMA 1S4MA 3H18A 1U3GA 2HDWA 3UK6A 4LOLA 4A6EA 1E64A 2ERYA 3FOWA 3U19A 3NPMA 4TV9F 3BXGA 4BNFA 1PT9A 3X1WA 4LWOA 5IJAA 1UDAA 4TPKA 1DWUA 2HGZA 1PJ4A 4QYXA 1EI9A 3G0BA 4L74A 2RJOA 3M82A 1L3IA 1P7CA 1QV9A 1DFIA 1B16A 2XJ4A 5SZJA 3SIPA 4DA9A 3MJDA 2P6NA 1G5PA 1M2JA 5DGCA 3NH9A 8ABPA 5K4HA 1N75A 3A25A 1Q0ZA 1ZJYA 2HAEA 4DDMA 4BAGA 3LF2A 2Z9DA 2P2DA 3FD8A 3UHPA 4BYMA 1B3RA 4YRRA 4HZIA 2Z6AA 3VHXA 3RVDA 5GJCA 1UOOA 1B26A 3L5KA 1QHSA 4IUBS 4JR0A 4L51A 2DQZA 4TRMA 1A9SA 4KV7A 5F76A 4ZCIA 2BAGA 2Q07A 1RQPA 4V1CB 2P9GA 4LBZA 2BZGA 4EABA 2B2CA 1I7SB 1HG1A 1UXHA 4EQ6B 2FMXA 3Q85A 3L7YA 3K0KA 3TJMA 4D9CA 3LKZA 3NALA 3WBFA 1M10A 1RXEA 1KYYA 3RYTC 1E3QA 3R09A 4M49A 3V4PB 3OHSX 1O94C 4BB9A 4C0LA 1INLA 1V37A 2OXTA 1KSGA 1VHDA 3RVRA 1UZLA 2BJHA 4IUCS 1JWLA 3DZKA 3N8HA 3WMEA 2Q1UA 1ZK0A 4O3FA 1F2DA 5KTYA 1HDRA 4EUKA 1J24A 4GUDA 4RA9B 4RZQA 1K6JA 3QVOA 3RG2A 4LDRA 4NULA 1VB3A 1JZTA 5C5IA 3HKCA 3HLTA 3F7TA 1DARA 2DRIA 4GBGA 1ULUA 1M54A 5BRNA 2O8FB 4ILKA 3UW1A 2WT8A 4R1QA 1NY6A 3IR7A 2I3ZA 1ADCA 4AYTA 2QTTA 1Y4AE 2XNCA 4R6XA 4X20B 3LV8A 3FMIA 4LYDA 2EGHA 2AUMA 2P1ZA 3I1IA 3PHGA 1Y5LA 4D9MA 4Y2HA 3M5PA 4F71A 1TQ4A 4BX8A 2Y1LA 4Y1FA 2E4WA 4E1AA 1GPBA 1AUOA 4OHWA 4C0SA 3L77A 5KNLA 3TRFA 4PYQA 1HT2E 1DUIA 1CQZA 2D2XA 3V4LA 2VJLA 1I32A 4BPBA 4LHSA 2Z57A 3E9CA 3UJ7A 4MLDA 1J2YA 3FYUB 3RWMB 1RYDA 3P5BA 4Q9NA 2Y66A 3LX4A 2ZBPA 2OLJA 3FHJA 4M1MA 1Y34E 3BWXA 1QDUA 4O4IB 1ABFA 1EZ1A 4PZPA 4YDHB 3V8RA 2VG8A 3LP5A 5JCJD 4MVJH 4EB0A 1UBNA 1R74A 1C81A 2GZHA 2VOEA 2W00A 2YMMA 3AUYA 4W9RA