4NV4A

1.8 angstrom crystal structure of signal peptidase i from bacillus anthracis.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
b'HVGDLNRFDVVVFHANKKEDYVKRIIGLPGDHIEYKHDKLYVNGQFVDEPYLETYKKEIDGRQLTGDFKLEELTKEKSVPPGYIFVVGDNRLGSWDSRHFGFVKADTVVGKVDLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Signal peptidase I
molecule tags Hydrolase
source organism Bacillus anthracis
publication title 1.8 Angstrom Crystal Structure of Signal Peptidase I from Bacillus anthracis.
rcsb
total genus 24
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 3.4.21.89: Signal peptidase I.
pdb deposition date 2013-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 4nv4A00
1UMUA 1F39A 1T7DA 2FJRA 1KCAA 4NV4A 3S04A 1JHFA 4ME8A 1KN9A 1JHHA 1I4VA 4K8WA 1JHEA 2HNFA 3IIQA 1AY9A 3BDNA 1JHCA 3JSPA 1B12A 4N31A 3K2ZA 2HO0A 2FKDA 3JSOA
chains in the Genus database with same CATH superfamily
1UMUA 1F39A 1T7DA 2FJRA 1KCAA 4NV4A 3S04A 1JHFA 4ME8A 1KN9A 1JHHA 1I4VA 4K8WA 1JHEA 2HNFA 3IIQA 1AY9A 3BDNA 1JHCA 3JSPA 1B12A 4N31A 3K2ZA 2HO0A 2FKDA 3JSOA
chains in the Genus database with same CATH topology
1UMUA 1F39A 1T7DA 2FJRA 1KCAA 4NV4A 3S04A 1JHFA 4ME8A 1KN9A 1JHHA 1I4VA 4K8WA 1JHEA 2HNFA 3IIQA 1AY9A 3BDNA 1JHCA 3JSPA 1B12A 4N31A 3K2ZA 2HO0A 2FKDA 3JSOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UMU A;  1F39 A;  1T7D A;  2FJR A;  1KCA A;  4NV4 A;  3S04 A;  1JHF A;  4ME8 A;  1KN9 A;  1JHH A;  1I4V A;  4K8W A;  1JHE A;  2HNF A;  3IIQ A;  1AY9 A;  3BDN A;  1JHC A;  3JSP A;  1B12 A;  4N31 A;  3K2Z A;  2HO0 A;  2FKD A;  3JSO A; 
#chains in the Genus database with same CATH topology
 1UMU A;  1F39 A;  1T7D A;  2FJR A;  1KCA A;  4NV4 A;  3S04 A;  1JHF A;  4ME8 A;  1KN9 A;  1JHH A;  1I4V A;  4K8W A;  1JHE A;  2HNF A;  3IIQ A;  1AY9 A;  3BDN A;  1JHC A;  3JSP A;  1B12 A;  4N31 A;  3K2Z A;  2HO0 A;  2FKD A;  3JSO A; 
#chains in the Genus database with same CATH homology
 1UMU A;  1F39 A;  1T7D A;  2FJR A;  1KCA A;  4NV4 A;  3S04 A;  1JHF A;  4ME8 A;  1KN9 A;  1JHH A;  1I4V A;  4K8W A;  1JHE A;  2HNF A;  3IIQ A;  1AY9 A;  3BDN A;  1JHC A;  3JSP A;  1B12 A;  4N31 A;  3K2Z A;  2HO0 A;  2FKD A;  3JSO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...