4NV4A

1.8 angstrom crystal structure of signal peptidase i from bacillus anthracis.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
115
structure length
115
Chain Sequence
HVGDLNRFDVVVFHANKKEDYVKRIIGLPGDHIEYKHDKLYVNGQFVDEPYLETYKKEIDGRQLTGDFKLEELTKEKSVPPGYIFVVGDNRLGSWDSRHFGFVKADTVVGKVDLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.8 Angstrom Crystal Structure of Signal Peptidase I from Bacillus anthracis.
rcsb
source organism Bacillus anthracis
molecule tags Hydrolase
molecule keywords Signal peptidase I
total genus 24
structure length 115
sequence length 115
chains with identical sequence B
ec nomenclature ec 3.4.21.89: Signal peptidase I.
pdb deposition date 2013-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 4nv4A00
1JHEA 3JSPA 1F39A 3S04A 1T7DA 3K2ZA 2FKDA 1UMUA 1KN9A 4K8WA 1JHCA 3JSOA 4NV4A 2FJRA 3BDNA 1JHHA 1B12A 1AY9A 4ME8A 3IIQA 1I4VA 1JHFA 1KCAA 4N31A 2HO0A 2HNFA
chains in the Genus database with same CATH superfamily
1JHEA 3JSPA 1F39A 3S04A 1T7DA 3K2ZA 2FKDA 1UMUA 1KN9A 4K8WA 1JHCA 3JSOA 4NV4A 2FJRA 3BDNA 1JHHA 1B12A 1AY9A 4ME8A 3IIQA 1I4VA 1JHFA 1KCAA 4N31A 2HO0A 2HNFA
chains in the Genus database with same CATH topology
1JHEA 3JSPA 1F39A 3S04A 1T7DA 3K2ZA 2FKDA 1UMUA 1KN9A 4K8WA 1JHCA 3JSOA 4NV4A 2FJRA 3BDNA 1JHHA 1B12A 1AY9A 4ME8A 3IIQA 1I4VA 1JHFA 1KCAA 4N31A 2HO0A 2HNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JHE A;  3JSP A;  1F39 A;  3S04 A;  1T7D A;  3K2Z A;  2FKD A;  1UMU A;  1KN9 A;  4K8W A;  1JHC A;  3JSO A;  4NV4 A;  2FJR A;  3BDN A;  1JHH A;  1B12 A;  1AY9 A;  4ME8 A;  3IIQ A;  1I4V A;  1JHF A;  1KCA A;  4N31 A;  2HO0 A;  2HNF A; 
#chains in the Genus database with same CATH topology
 1JHE A;  3JSP A;  1F39 A;  3S04 A;  1T7D A;  3K2Z A;  2FKD A;  1UMU A;  1KN9 A;  4K8W A;  1JHC A;  3JSO A;  4NV4 A;  2FJR A;  3BDN A;  1JHH A;  1B12 A;  1AY9 A;  4ME8 A;  3IIQ A;  1I4V A;  1JHF A;  1KCA A;  4N31 A;  2HO0 A;  2HNF A; 
#chains in the Genus database with same CATH homology
 1JHE A;  3JSP A;  1F39 A;  3S04 A;  1T7D A;  3K2Z A;  2FKD A;  1UMU A;  1KN9 A;  4K8W A;  1JHC A;  3JSO A;  4NV4 A;  2FJR A;  3BDN A;  1JHH A;  1B12 A;  1AY9 A;  4ME8 A;  3IIQ A;  1I4V A;  1JHF A;  1KCA A;  4N31 A;  2HO0 A;  2HNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...